F484475

General Info

Members Datasets Scaffolds Average Seq Length
880 552 1760 164

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10007862|JGI24740J21852_100078622
Length 176
Sequence MRIIFPGARADMISRDDFVGRFGGVFEHSPFVAERAYDAGAIVAPLTSGGVHAALVRAFRAASEAERLGVLRAHPDLAGRLAIAGQLTEDSRKEQAGAGLDRLSPEEHARFTELNAAYVTKFGFPFIIAVKGLGKDDILAAFETRVDNSRDAEFATAAAQVEKIALLRLQSLLPDA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
61 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
62 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
71 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
72 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
73 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
114 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
120 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
134 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
135 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
136 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
137 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
138 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
139 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
140 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
141 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
142 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
146 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
147 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
148 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
255 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
256 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
259 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
260 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
261 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
262 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
263 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
268 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
269 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
272 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
273 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
274 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
275 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 2509276019 Ensifer aridi TW10 Isolate Nodule
279 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
280 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
281 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
282 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
283 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
284 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
285 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
286 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
287 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
288 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
289 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
290 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
291 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
292 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
293 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
294 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
295 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
296 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
297 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
298 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
299 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
300 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
301 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
302 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
303 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
304 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
305 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
306 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
307 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
308 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
309 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
310 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
311 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
312 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
313 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
314 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
315 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
316 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
317 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
318 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
319 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
320 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
321 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
322 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
323 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
324 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
325 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
326 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
327 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
328 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
329 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
330 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
331 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
332 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
333 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
334 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
335 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
336 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
337 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
338 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
339 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
340 2643221558 Rhizobium sp. Root149 Isolate Unclassified
341 2643221568 Rhizobium sp. Root564 Isolate Unclassified
342 2643221582 Rhizobium sp. Root651 Isolate Unclassified
343 2643221599 Rhizobium sp. Root708 Isolate Unclassified
344 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
345 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
346 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
347 2643221693 Rhizobium sp. Root491 Isolate Unclassified
348 2643221719 Rhizobium sp. Root274 Isolate Unclassified
349 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
350 2718217882 Rhizobium sp. N741 Isolate Nodule
351 2718217927 Rhizobium sp. N324 Isolate Nodule
352 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
353 2718218009 Rhizobium sp. N561 Isolate Nodule
354 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
355 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
356 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
357 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
358 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
359 2718218363 Rhizobium sp. N113 Isolate Nodule
360 2718218365 Rhizobium sp. N731 Isolate Nodule
361 2718218366 Rhizobium sp. N621 Isolate Nodule
362 2718218423 Rhizobium sp. N941 Isolate Nodule
363 2721755514 Rhizobium sp. N6212 Isolate Nodule
364 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
365 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
366 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
367 2721755809 Rhizobium sp. N541 Isolate Nodule
368 2721755810 Rhizobium sp. N871 Isolate Nodule
369 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
370 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
371 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
372 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
373 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
374 2728369365 Rhizobium sp. N1341 Isolate Nodule
375 2728369397 Rhizobium sp. N1314 Isolate Nodule
376 2738541293 Rhizobium sp. GV031 Isolate Unclassified
377 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
378 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
379 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
380 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
381 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
382 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
383 2791355260 Rhizobium sp. L9 Isolate Nodule
384 2791355261 Rhizobium sp. J15 Isolate Nodule
385 2791355263 Rhizobium chutanense C5 Isolate Nodule
386 2791355266 Rhizobium sp. L43 Isolate Nodule
387 2791355267 Rhizobium sp. L18 Isolate Nodule
388 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
389 2802429633 Rhizobium anhuiense J3 Isolate Nodule
390 2802429634 Rhizobium anhuiense S10 Isolate Nodule
391 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
392 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
393 2802429637 Rhizobium anhuiense C15 Isolate Nodule
394 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
395 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
396 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
397 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
398 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
399 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
400 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
401 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
402 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
403 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
404 2838048938 Rhizobium pisi 27/80 Isolate Nodule
405 2838061910 Rhizobium phaseoli L15 Isolate Nodule
406 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
407 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
408 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
409 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
410 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
411 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
412 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
413 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
414 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
415 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
416 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
417 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
418 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
419 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
420 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
421 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
422 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
423 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
424 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
425 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
426 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
427 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
428 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
429 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
430 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
431 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
432 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
433 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
434 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
435 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
436 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
437 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
438 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
439 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
440 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
441 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
442 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
443 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
444 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
445 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
446 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
447 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
448 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
449 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
450 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
451 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
452 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
453 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
454 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
455 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
456 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
457 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
458 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
459 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
460 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
461 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
462 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
463 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
464 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
465 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
466 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
467 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
468 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
469 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
470 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
471 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
472 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
473 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
474 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
475 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
476 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
477 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
478 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
479 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
480 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
481 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
482 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
483 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
484 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
485 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
486 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
487 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
488 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
489 2933599457 Rhizobium phaseoli M3 Isolate Nodule
490 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
491 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
492 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
493 2936381700 Rhizobium chutanense C16 Isolate Unclassified
494 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
495 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
496 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
497 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
498 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
499 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
500 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
501 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
502 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
503 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
504 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
505 2996887358 Rhizobium sp. R711 Isolate Nodule
506 2996893221 Rhizobium sp. R635 Isolate Nodule
507 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
508 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
509 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
510 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
511 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
512 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
513 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
514 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
515 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
516 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
517 8005258706 Rhizobium sp. R693 Isolate Nodule
518 8005275841 Rhizobium sp. N4311 Isolate Nodule
519 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
520 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
521 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
522 8005321885 Rhizobium sp. R72 Isolate Nodule
523 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
524 8005382845 Rhizobium sp. R634 Isolate Nodule
525 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
526 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
527 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
528 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
529 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
530 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
531 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
532 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
533 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
534 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
535 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
536 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
537 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
538 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
539 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
540 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
541 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
542 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
543 8018176218 Rhizobium sp. N122 Isolate Nodule
544 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
545 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
546 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
547 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
548 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
549 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
550 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
551 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
552 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.75
Metatranscriptomes 0
Isolates 31.25

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 24.77
Nodule 20.68
Rhizoplane 3.18
Rhizosphere 27.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007862 3300001979 Bacteria 4302
2 JGI25155J39150_1000014 3300002704 Bacteria 196159
3 JGI25156J39149_1000083 3300002705 Bacteria 70138
4 JGI25162J39368_1000217 3300002737 Bacteria 59945
5 JGI25162J39368_1000272 3300002737 Bacteria 49890
6 JGI25162J39368_1000416 3300002737 Bacteria 34791
7 JGI25154J39366_1000052 3300002738 Bacteria 120209
8 JGI25157J39369_1000110 3300002741 Bacteria 69643
9 JGI25152J39213_1001348 3300002773 Bacteria 10778
10 JGI25152J39213_1002158 3300002773 Bacteria 7716
11 JGI25152J39213_1002644 3300002773 Bacteria 6642
12 JGI25152J39213_1004295 3300002773 Bacteria 4541
13 JGI25152J39213_1004334 3300002773 Bacteria 4506
14 JGI25152J39213_1021598 3300002773 Bacteria 1126
15 JGI25150J39212_1000100 3300002774 Bacteria 49138
16 JGI25150J39212_1002765 3300002774 Bacteria 4262
17 JGI25150J39212_1003426 3300002774 Bacteria 3708
18 JGI25159J45721_1000832 3300002987 Bacteria 13465
19 JGI25159J45721_1002615 3300002987 Bacteria 6738
20 JGI25151J46595_10000146 3300003187 Bacteria 93373
21 JGI25151J46595_10002021 3300003187 Bacteria 12689
22 JGI25151J46595_10003013 3300003187 Bacteria 9572
23 JGI25151J46595_10007505 3300003187 Bacteria 5334
24 JGI25151J46595_10043085 3300003187 Bacteria 1619
25 JGI25151J46595_10066878 3300003187 Bacteria 1110
26 JGI25165J46597_1000363 3300003214 Bacteria 50542
27 JGI25165J46597_1000767 3300003214 Bacteria 24591
28 JGI25165J46597_1005503 3300003214 Bacteria 2428
29 JGI25153J46596_10000764 3300003215 Bacteria 19680
30 JGI25153J46596_10002359 3300003215 Bacteria 10937
31 JGI25153J46596_10009056 3300003215 Bacteria 4677
32 JGI25153J46596_10009420 3300003215 Bacteria 4541
33 JGI25153J46596_10009505 3300003215 Bacteria 4506
34 JGI25153J46596_10052409 3300003215 Bacteria 1161
35 rootH1_10095586 3300003316 Bacteria 1605
36 rootL2_10044385 3300003322 Bacteria 6042
37 rootH1_10047163 3300003323 Bacteria 1504
38 JGI25160J50197_1000001 3300003354 Bacteria 782301
39 JGI25160J50197_1000351 3300003354 Bacteria 30617
40 JGI25160J50197_1013610 3300003354 Bacteria 2764
41 JGI25161J50226_1000001 3300003374 Bacteria 655036
42 JGI25161J50226_1000167 3300003374 Bacteria 45203
43 JGI25161J50226_1014399 3300003374 Bacteria 887
44 Ga0055526_1000842 3300003771 Bacteria 22899
45 Ga0055526_1003643 3300003771 Bacteria 9648
46 Ga0055526_1004423 3300003771 Bacteria 8446
47 Ga0055526_1018827 3300003771 Bacteria 2552
48 Ga0055524_1002425 3300003775 Bacteria 9616
49 Ga0055524_1003892 3300003775 Bacteria 7079
50 Ga0055524_1007700 3300003775 Bacteria 4549
51 Ga0055524_1012307 3300003775 Bacteria 3289
52 Ga0055524_1013955 3300003775 Bacteria 3002
53 Ga0055536_1006441 3300003781 Bacteria 5483
54 Ga0055528_1000158 3300003790 Bacteria 56769
55 Ga0055528_1000707 3300003790 Bacteria 23679
56 Ga0055528_1000749 3300003790 Bacteria 22632
57 Ga0055528_1003189 3300003790 Bacteria 8389
58 Ga0055528_1006485 3300003790 Bacteria 5304
59 Ga0055528_1009987 3300003790 Bacteria 3910
60 Ga0055530_10021732 3300003791 Bacteria 1883
61 Ga0055540_1000518 3300003792 Bacteria 29203
62 Ga0055540_1005724 3300003792 Bacteria 5129
63 Ga0055540_1006013 3300003792 Bacteria 4916
64 Ga0055540_1034552 3300003792 Bacteria 1137
65 Ga0055531_10010704 3300003794 Bacteria 4521
66 Ga0058692_1001431 3300003856 Bacteria 8783
67 Ga0055543_1000060 3300004625 Bacteria 98330
68 Ga0055543_1000216 3300004625 Bacteria 46311
69 Ga0055543_1000699 3300004625 Bacteria 17145
70 Ga0065165_1000008 3300005262 Bacteria 334429
71 Ga0065165_1004363 3300005262 Bacteria 8852
72 Ga0065165_1064875 3300005262 Bacteria 988
73 Ga0065165_1067950 3300005262 Bacteria 955
74 Ga0065704_10475575 3300005289 Bacteria 673
75 Ga0070666_10099735 3300005335 Bacteria 2000
76 Ga0070668_100017103 3300005347 Bacteria 5428
77 Ga0070668_101579046 3300005347 Bacteria 601
78 Ga0070669_100135042 3300005353 Bacteria 1897
79 Ga0070671_100033648 3300005355 Bacteria 4241
80 Ga0070663_100013668 3300005455 Bacteria 5186
81 Ga0070665_100007074 3300005548 Bacteria 11401
82 Ga0068855_100081851 3300005563 Bacteria 3742
83 Ga0068854_100040374 3300005578 Bacteria 3292
84 Ga0068854_100410685 3300005578 Bacteria 1122
85 Ga0068856_100190581 3300005614 Bacteria 2064
86 Ga0068861_100942699 3300005719 Bacteria 820
87 Ga0068851_10166693 3300005834 Bacteria 1213
88 Ga0068863_101719947 3300005841 Bacteria 637
89 Ga0075365_10007766 3300006038 Bacteria 6041
90 Ga0075365_10010140 3300006038 Bacteria 5469
91 Ga0075365_10095352 3300006038 Bacteria 2032
92 Ga0075368_10005974 3300006042 Bacteria 4220
93 Ga0075368_10317028 3300006042 Bacteria 675
94 Ga0075363_100015703 3300006048 Bacteria 3727
95 Ga0075363_100019422 3300006048 Bacteria 3398
96 Ga0075363_100055338 3300006048 Bacteria 2125
97 Ga0075364_10015660 3300006051 Bacteria 4706
98 Ga0075364_10349320 3300006051 Bacteria 1008
99 Ga0075364_11049827 3300006051 Bacteria 554
100 Ga0075362_10075178 3300006177 Bacteria 1549
101 Ga0075367_10000779 3300006178 Bacteria 12517
102 Ga0075367_10011013 3300006178 Bacteria 4769
103 Ga0075367_10102795 3300006178 Bacteria 1748
104 Ga0075369_10003894 3300006186 Bacteria 5473
105 Ga0075369_10013982 3300006186 Bacteria 3198
106 Ga0075369_10021466 3300006186 Bacteria 2655
107 Ga0075366_10003058 3300006195 Bacteria 8734
108 Ga0075370_10002851 3300006353 Bacteria 8118
109 Ga0075370_10003951 3300006353 Bacteria 7122
110 Ga0075370_10042620 3300006353 Bacteria 2564
111 Ga0075370_10479373 3300006353 Bacteria 750
112 Ga0079104_1000015 3300006946 Bacteria 321803
113 Ga0099826_10000102 3300006948 Bacteria 40381
114 Ga0099826_10018575 3300006948 Bacteria 5245
115 Ga0105251_10010023 3300009011 Bacteria 5538
116 Ga0105244_10097209 3300009036 Bacteria 1443
117 Ga0105244_10280460 3300009036 Bacteria 773
118 Ga0105250_10067011 3300009092 Bacteria 1448
119 Ga0105240_10000014 3300009093 Bacteria 482033
120 Ga0105243_10006869 3300009148 Bacteria 8774
121 Ga0105243_10111991 3300009148 Bacteria 2285
122 Ga0105248_10153015 3300009177 Bacteria 2602
123 Ga0105237_10002158 3300009545 Bacteria 24754
124 Ga0105249_10082826 3300009553 Bacteria 2985
125 Ga0123340_1049595 3300009763 Bacteria 1572
126 Ga0123341_1000035 3300009765 Bacteria 62072
127 Ga0123341_1061365 3300009765 Bacteria 1838
128 Ga0123341_1061371 3300009765 Bacteria 1838
129 Ga0123342_1009440 3300009766 Bacteria 11684
130 Ga0123342_1011443 3300009766 Bacteria 9682
131 Ga0157373_10055636 3300013100 Bacteria 2810
132 Ga0157373_10227511 3300013100 Bacteria 1316
133 Ga0157371_10000017 3300013102 Bacteria 320830
134 Ga0157370_10000329 3300013104 Bacteria 59662
135 Ga0157370_10001031 3300013104 Bacteria 35059
136 Ga0157369_10024034 3300013105 Bacteria 6781
137 Ga0157369_10522116 3300013105 Bacteria 1228
138 Ga0157369_10661880 3300013105 Bacteria 1076
139 Ga0182008_10047466 3300014497 Bacteria 2133
140 Ga0182008_10303399 3300014497 Bacteria 836
141 Ga0182007_10003468 3300015262 Bacteria 7427
142 Ga0182005_1000982 3300015265 Bacteria 12354
143 Ga0214542_1000268 3300021321 Bacteria 87082
144 Ga0214543_1000022 3300021327 Bacteria 241930
145 Ga0214543_1000219 3300021327 Bacteria 87102
146 Ga0209435_100027 3300025206 Bacteria 196217
147 Ga0209760_107985 3300025207 Bacteria 786
148 Ga0209436_100081 3300025208 Bacteria 48215
149 Ga0209437_100051 3300025233 Bacteria 392523
150 Ga0209437_100060 3300025233 Bacteria 355034
151 Ga0207425_1000046 3300025245 Bacteria 189433
152 Ga0207425_1002771 3300025245 Bacteria 5954
153 Ga0207425_1004453 3300025245 Bacteria 4198
154 Ga0207425_1005031 3300025245 Bacteria 3841
155 Ga0207425_1020267 3300025245 Bacteria 1423
156 Ga0209646_1000086 3300025246 Bacteria 196217
157 Ga0209026_1000082 3300025250 Bacteria 196315
158 Ga0209677_100540 3300025253 Bacteria 21044
159 Ga0209148_1022470 3300025254 Bacteria 1013
160 Ga0209759_1000063 3300025256 Bacteria 196315
161 Ga0209129_1000171 3300025258 Bacteria 95724
162 Ga0209129_1000283 3300025258 Bacteria 48305
163 Ga0209129_1000450 3300025258 Bacteria 30620
164 Ga0209129_1001443 3300025258 Bacteria 13284
165 Ga0209129_1001916 3300025258 Bacteria 10956
166 Ga0209129_1004411 3300025258 Bacteria 5500
167 Ga0209129_1005600 3300025258 Bacteria 4373
168 Ga0209233_1000095 3300025261 Bacteria 303783
169 Ga0209233_1000190 3300025261 Bacteria 130713
170 Ga0209233_1000228 3300025261 Bacteria 100100
171 Ga0209673_1000010 3300025273 Bacteria 596656
172 Ga0209673_1000025 3300025273 Bacteria 404572
173 Ga0209673_1000112 3300025273 Bacteria 179676
174 Ga0209673_1000637 3300025273 Bacteria 53013
175 Ga0209673_1004043 3300025273 Bacteria 8113
176 Ga0209130_1000003 3300025284 Bacteria 677988
177 Ga0209130_1000023 3300025284 Bacteria 359355
178 Ga0209130_1010464 3300025284 Bacteria 2552
179 Ga0209675_1034800 3300025291 Bacteria 1155
180 Ga0209676_1002751 3300025292 Bacteria 11779
181 Ga0209025_1000091 3300025294 Bacteria 250401
182 Ga0209025_1000137 3300025294 Bacteria 190136
183 Ga0209025_1000152 3300025294 Bacteria 171558
184 Ga0209025_1000154 3300025294 Bacteria 170288
185 Ga0209025_1000545 3300025294 Bacteria 70608
186 Ga0209025_1001424 3300025294 Bacteria 31618
187 Ga0209025_1005945 3300025294 Bacteria 9717
188 Ga0209025_1006114 3300025294 Bacteria 9496
189 Ga0209025_1011337 3300025294 Bacteria 5889
190 Ga0209025_1022784 3300025294 Bacteria 3305
191 Ga0209025_1047100 3300025294 Bacteria 1765
192 Ga0209564_1000564 3300025295 Bacteria 58801
193 Ga0209564_1000672 3300025295 Bacteria 50497
194 Ga0209564_1001566 3300025295 Bacteria 22444
195 Ga0209564_1003798 3300025295 Bacteria 9803
196 Ga0209564_1012665 3300025295 Bacteria 3654
197 Ga0209758_1000058 3300025297 Bacteria 331603
198 Ga0209758_1000123 3300025297 Bacteria 190136
199 Ga0209758_1000725 3300025297 Bacteria 48331
200 Ga0209758_1000863 3300025297 Bacteria 41967
201 Ga0209758_1001901 3300025297 Bacteria 22797
202 Ga0209758_1001960 3300025297 Bacteria 22253
203 Ga0209758_1006925 3300025297 Bacteria 7909
204 Ga0209758_1008712 3300025297 Bacteria 6487
205 Ga0209050_1002725 3300025298 Bacteria 14282
206 Ga0209050_1016627 3300025298 Bacteria 2994
207 Ga0209256_1000914 3300025299 Bacteria 36121
208 Ga0209256_1001132 3300025299 Bacteria 30392
209 Ga0209256_1001499 3300025299 Bacteria 23682
210 Ga0209256_1003097 3300025299 Bacteria 12188
211 Ga0209256_1007950 3300025299 Bacteria 5056
212 Ga0207426_1000008 3300025302 Bacteria 848730
213 Ga0207426_1000011 3300025302 Bacteria 791203
214 Ga0207426_1000228 3300025302 Bacteria 129261
215 Ga0207426_1006647 3300025302 Bacteria 4975
216 Ga0209051_1000462 3300025303 Bacteria 53349
217 Ga0209051_1000785 3300025303 Bacteria 33541
218 Ga0209051_1001635 3300025303 Bacteria 18178
219 Ga0209051_1007538 3300025303 Bacteria 5929
220 Ga0209051_1015498 3300025303 Bacteria 3502
221 Ga0209257_1003221 3300025304 Bacteria 14390
222 Ga0209257_1005494 3300025304 Bacteria 8860
223 Ga0209257_1036976 3300025304 Bacteria 1493
224 Ga0209257_1037140 3300025304 Bacteria 1488
225 Ga0207713_1041996 3300025735 Bacteria 1902
226 Ga0207680_10183137 3300025903 Bacteria 1418
227 Ga0207695_10000037 3300025913 Bacteria 476303
228 Ga0207671_10001228 3300025914 Bacteria 30331
229 Ga0207681_10127084 3300025923 Bacteria 1879
230 Ga0207650_10001248 3300025925 Bacteria 18474
231 Ga0207644_10058528 3300025931 Bacteria 2785
232 Ga0207706_10295850 3300025933 Bacteria 1411
233 Ga0207709_10199828 3300025935 Bacteria 1427
234 Ga0207711_10061404 3300025941 Bacteria 3240
235 Ga0207712_10070189 3300025961 Bacteria 2516
236 Ga0207658_10318477 3300025986 Bacteria 1346
237 Ga0207639_10735315 3300026041 Bacteria 917
238 Ga0207678_10025462 3300026067 Bacteria 5164
239 Ga0207702_10034211 3300026078 Bacteria 4248
240 Ga0207702_10184423 3300026078 Bacteria 1924
241 Ga0207641_11160395 3300026088 Bacteria 772
242 Ga0207675_101047242 3300026118 Bacteria 835
243 Ga0209281_1000034 3300027111 Bacteria 382562
244 Ga0209371_1000022 3300027312 Bacteria 536342
245 Ga0209371_1000341 3300027312 Bacteria 50975
246 Ga0209371_1003792 3300027312 Bacteria 7034
247 Ga0209282_1002798 3300027666 Bacteria 10209
248 Ga0209282_1017894 3300027666 Bacteria 4503
249 Ga0209813_10004580 3300027866 Bacteria 3310
250 Ga0209813_10184410 3300027866 Bacteria 765
251 Ga0268266_10005469 3300028379 Bacteria 11831
252 Ga0268266_10113508 3300028379 Bacteria 2403
253 Ga0307515_10000017 3300028794 Bacteria 550465
254 Ga0307515_10029550 3300028794 Bacteria 9255
255 Ga0268256_1000019 3300030500 Bacteria 587949
256 Ga0268256_1001403 3300030500 Bacteria 14620
257 Ga0268256_1004051 3300030500 Bacteria 6289
258 Ga0268256_1043464 3300030500 Bacteria 991
259 Ga0316181_1107412 3300030744 Bacteria 2647
260 Ga0316182_1174290 3300030745 Bacteria 741
261 Ga0307513_10001095 3300031456 Bacteria 39184
262 Ga0307513_10009210 3300031456 Bacteria 12501
263 Ga0307408_100836973 3300031548 Bacteria 838
264 Ga0307405_10017156 3300031731 Bacteria 3966
265 Ga0307412_10004052 3300031911 Bacteria 8165
266 Ga0307412_10703297 3300031911 Bacteria 868
267 Ga0307510_10526875 3300033180 Bacteria 626
268 Ga0373927_0000419 3300035695 Bacteria 32608
269 Ga0439436_0010510 3300041404 Bacteria 2821
270 Ga0439466_0025917 3300041411 Bacteria 2043
271 Ga0439465_0050912 3300041413 Bacteria 1356
272 Ga0439465_0076364 3300041413 Bacteria 1129
273 Ga0451795_0647420 3300041456 Bacteria 1159
274 Ga0451807_1773350 3300041486 Bacteria 1113
275 Ga0451833_0575078 3300041491 Bacteria 1063
276 Ga0451835_0487282 3300041492 Bacteria 892
277 Ga0451837_0448786 3300041494 Bacteria 920
278 Ga0451839_0351025 3300041496 Bacteria 1236
279 Ga0451841_0429116 3300041498 Bacteria 2017
280 Ga0451845_0704804 3300041501 Bacteria 1275
281 Ga0451847_0545907 3300041503 Bacteria 1063
282 Ga0451847_0607285 3300041503 Bacteria 2584
283 Ga0451849_0971194 3300041505 Bacteria 1109
284 Ga0451851_0559086 3300041507 Bacteria 1338
285 Ga0451855_0815820 3300041511 Bacteria 4040
286 Ga0451855_1183387 3300041511 Bacteria 743
287 Ga0439432_026777 3300042006 Bacteria 1887
288 Ga0439449_0080579 3300042007 Bacteria 1200
289 Ga0439462_0021294 3300042015 Bacteria 1693
290 Ga0450909_006211 3300042185 Bacteria 1724
291 Ga0450918_012682 3300042531 Bacteria 1468
292 Ga0466982_0343227 3300044672 Bacteria 832
293 Ga0466966_0074592 3300044684 Bacteria 2120
294 Ga0466963_0018270 3300044694 Bacteria 4380
295 Ga0466964_0101026 3300044706 Bacteria 1272
296 Ga0466970_0000872 3300044765 Bacteria 14575
297 Ga0466957_0176279 3300044842 Bacteria 1394
298 Ga0466967_0060709 3300045976 Bacteria 3352
299 Ga0466967_0099658 3300045976 Bacteria 2654
300 Ga0495617_117724 3300046452 Bacteria 857
301 Ga0495617_145929 3300046452 Bacteria 754
302 Ga0495627_101476 3300046453 Bacteria 821
303 Ga0495592_0042081 3300046454 Bacteria 3422
304 Ga0495590_0321806 3300046457 Bacteria 584
305 Ga0495638_0000953 3300046460 Bacteria 29358
306 Ga0495651_0022780 3300046462 Bacteria 4870
307 Ga0495650_0086473 3300046471 Bacteria 1200
308 Ga0495605_0001474 3300046474 Bacteria 15363
309 Ga0495605_0097803 3300046474 Bacteria 1352
310 Ga0495662_0003309 3300046476 Bacteria 8162
311 Ga0495585_0011346 3300046492 Bacteria 5275
312 Ga0495585_0025457 3300046492 Bacteria 3388
313 Ga0495585_0071440 3300046492 Bacteria 1892
314 Ga0495585_0106941 3300046492 Bacteria 1491
315 Ga0495596_0122860 3300046500 Bacteria 1008
316 Ga0495607_0025745 3300046501 Bacteria 3657
317 Ga0495583_0003748 3300046506 Bacteria 11302
318 Ga0495583_0012759 3300046506 Bacteria 4732
319 Ga0495583_0103731 3300046506 Bacteria 1211
320 Ga0495606_0002168 3300046507 Bacteria 23621
321 Ga0495606_0110593 3300046507 Bacteria 1658
322 Ga0495610_0012771 3300046512 Bacteria 5027
323 Ga0495610_0063587 3300046512 Bacteria 1747
324 Ga0495610_0297126 3300046512 Bacteria 624
325 Ga0495616_0112151 3300046513 Bacteria 1266
326 Ga0495618_0214161 3300046514 Bacteria 1217
327 Ga0495620_0013879 3300046515 Bacteria 4112
328 Ga0495620_0049847 3300046515 Bacteria 1789
329 Ga0495620_0064131 3300046515 Bacteria 1520
330 Ga0495631_0012885 3300046518 Bacteria 4071
331 Ga0495631_0081293 3300046518 Bacteria 1398
332 Ga0495632_0013526 3300046519 Bacteria 4654
333 Ga0495632_0044287 3300046519 Bacteria 2221
334 Ga0495632_0148593 3300046519 Bacteria 1084
335 Ga0495643_0088887 3300046522 Bacteria 1596
336 Ga0495643_0219943 3300046522 Bacteria 901
337 Ga0495648_0024217 3300046524 Bacteria 4140
338 Ga0495648_0297118 3300046524 Bacteria 758
339 Ga0495652_0344343 3300046529 Bacteria 1070
340 Ga0495654_0000758 3300046530 Bacteria 24982
341 Ga0495654_0053584 3300046530 Bacteria 1960
342 Ga0495640_0122447 3300046533 Bacteria 1689
343 Ga0495609_0008203 3300046538 Bacteria 5126
344 Ga0495622_0030020 3300046557 Bacteria 2540
345 Ga0495633_0021557 3300046558 Bacteria 3221
346 Ga0495633_0049675 3300046558 Bacteria 1979
347 Ga0495633_0120220 3300046558 Bacteria 1217
348 Ga0495633_0204623 3300046558 Bacteria 905
349 Ga0495656_0066770 3300046615 Bacteria 1586
350 Ga0495668_0003159 3300046616 Bacteria 12699
351 Ga0495668_0080778 3300046616 Bacteria 1784
352 Ga0495611_0111483 3300046648 Bacteria 1274
353 Ga0495625_0005331 3300046660 Bacteria 11778
354 Ga0495625_0062307 3300046660 Bacteria 2636
355 Ga0495625_0491495 3300046660 Bacteria 752
356 Ga0495635_0088343 3300046663 Bacteria 2121
357 Ga0495661_0167154 3300046665 Bacteria 1176
358 Ga0495588_0001565 3300046674 Bacteria 9801
359 Ga0495588_0149404 3300046674 Bacteria 1235
360 Ga0495657_0015576 3300046675 Bacteria 5558
361 Ga0495658_0040425 3300046683 Bacteria 2593
362 Ga0495624_0053180 3300046690 Bacteria 2557
363 Ga0495670_0003394 3300046691 Bacteria 7829
364 Ga0495670_0148823 3300046691 Bacteria 1227
365 Ga0495671_0052719 3300046692 Bacteria 2021
366 Ga0495671_0103852 3300046692 Bacteria 1388
367 Ga0495671_0306891 3300046692 Bacteria 763
368 Ga0495649_0049124 3300046694 Bacteria 2292
369 Ga0495600_0141875 3300046809 Bacteria 1558
370 Ga0495660_0032206 3300046810 Bacteria 2944
371 Ga0495660_0045004 3300046810 Bacteria 2425
372 Ga0495604_0031909 3300047317 Bacteria 4176
373 Ga0495672_0003408 3300047320 Bacteria 13639
374 Ga0495683_0129898 3300047323 Bacteria 1189
375 Ga0495681_0010603 3300047470 Bacteria 5569
376 Ga0495681_0335685 3300047470 Bacteria 578
377 Ga0495686_0007900 3300047472 Bacteria 7901
378 Ga0495686_0016439 3300047472 Bacteria 5017
379 Ga0495686_0018844 3300047472 Bacteria 4622
380 Ga0495615_0016963 3300048090 Bacteria 1579
381 Ga0495615_0029692 3300048090 Bacteria 1299
382 Ga0496101_0152268 3300048904 Bacteria 1769
383 Ga0496101_0205390 3300048904 Bacteria 1524
384 Ga0496101_0284143 3300048904 Bacteria 1294
385 Ga0496101_0734581 3300048904 Bacteria 779
386 Ga0496102_0004330 3300048905 Bacteria 12011
387 Ga0496102_0060372 3300048905 Bacteria 3467
388 Ga0496103_0036078 3300048906 Bacteria 3027
389 Ga0496103_0067827 3300048906 Bacteria 2228
390 Ga0496104_0049484 3300048907 Bacteria 3963
391 Ga0496104_0554104 3300048907 Bacteria 1060
392 Ga0496105_0029943 3300048908 Bacteria 4457
393 Ga0496106_0001496 3300048909 Bacteria 17571
394 Ga0496110_0135447 3300048913 Bacteria 2225
395 Ga0496112_0487960 3300048915 Bacteria 1168
396 Ga0496113_0029675 3300048916 Bacteria 3953
397 Ga0496113_0130856 3300048916 Bacteria 1969
398 Ga0496113_0252125 3300048916 Bacteria 1409
399 Ga0496113_0754236 3300048916 Bacteria 775
400 Ga0496114_0296181 3300048917 Bacteria 1428
401 Ga0496114_0995822 3300048917 Bacteria 721
402 Ga0496116_0010698 3300048919 Bacteria 7660
403 Ga0496116_0016794 3300048919 Bacteria 5712
404 Ga0496116_0022826 3300048919 Bacteria 4676
405 Ga0496116_0033222 3300048919 Bacteria 3663
406 Ga0496116_0081123 3300048919 Bacteria 2012
407 Ga0496116_0088663 3300048919 Bacteria 1889
408 Ga0496116_0125237 3300048919 Bacteria 1477
409 Ga0496116_0150895 3300048919 Bacteria 1291
410 Ga0496116_0162805 3300048919 Bacteria 1221
411 Ga0496116_0168676 3300048919 Bacteria 1189
412 Ga0496116_0459327 3300048919 Bacteria 542
413 Ga0496117_0000002 3300048920 Bacteria 2483758
414 Ga0496117_0002241 3300048920 Bacteria 24957
415 Ga0496117_0003292 3300048920 Bacteria 18915
416 Ga0496117_0020448 3300048920 Bacteria 5395
417 Ga0496117_0025317 3300048920 Bacteria 4668
418 Ga0496117_0026153 3300048920 Bacteria 4571
419 Ga0496117_0026472 3300048920 Bacteria 4538
420 Ga0496117_0077801 3300048920 Bacteria 2193
421 Ga0496117_0219603 3300048920 Bacteria 1059
422 Ga0496118_0000566 3300048921 Bacteria 61208
423 Ga0496118_0001388 3300048921 Bacteria 36504
424 Ga0496118_0004636 3300048921 Bacteria 16127
425 Ga0496118_0023728 3300048921 Bacteria 5316
426 Ga0496118_0027341 3300048921 Bacteria 4830
427 Ga0496118_0078264 3300048921 Bacteria 2341
428 Ga0496119_0012920 3300048922 Bacteria 6720
429 Ga0496119_0024130 3300048922 Bacteria 4288
430 Ga0496119_0041712 3300048922 Bacteria 2918
431 Ga0496119_0046892 3300048922 Bacteria 2693
432 Ga0496119_0066220 3300048922 Bacteria 2136
433 Ga0496119_0069863 3300048922 Bacteria 2062
434 Ga0496119_0090750 3300048922 Bacteria 1736
435 Ga0496119_0241108 3300048922 Bacteria 916
436 Ga0496120_0000309 3300048923 Bacteria 81375
437 Ga0496120_0024822 3300048923 Bacteria 3731
438 Ga0496120_0061705 3300048923 Bacteria 2091
439 Ga0496120_0126591 3300048923 Bacteria 1314
440 Ga0496120_0156937 3300048923 Bacteria 1138
441 Ga0496120_0163707 3300048923 Bacteria 1106
442 Ga0496120_0197631 3300048923 Bacteria 975
443 Ga0496121_0001287 3300048924 Bacteria 43216
444 Ga0496121_0002836 3300048924 Bacteria 25580
445 Ga0496121_0009257 3300048924 Bacteria 11372
446 Ga0496121_0014795 3300048924 Bacteria 8242
447 Ga0496121_0019082 3300048924 Bacteria 6878
448 Ga0496121_0020642 3300048924 Bacteria 6505
449 Ga0496121_0023780 3300048924 Bacteria 5884
450 Ga0496121_0025505 3300048924 Bacteria 5606
451 Ga0496121_0034993 3300048924 Bacteria 4508
452 Ga0496121_0044494 3300048924 Bacteria 3828
453 Ga0496121_0075202 3300048924 Bacteria 2699
454 Ga0496121_0128385 3300048924 Bacteria 1902
455 Ga0496121_0129721 3300048924 Bacteria 1889
456 Ga0496121_0223713 3300048924 Bacteria 1323
457 Ga0496122_0000004 3300048925 Bacteria 645283
458 Ga0496122_0000414 3300048925 Bacteria 90664
459 Ga0496122_0004472 3300048925 Bacteria 17302
460 Ga0496122_0016318 3300048925 Bacteria 7039
461 Ga0496122_0027013 3300048925 Bacteria 4925
462 Ga0496122_0027041 3300048925 Bacteria 4920
463 Ga0496122_0038145 3300048925 Bacteria 3855
464 Ga0496122_0078425 3300048925 Bacteria 2313
465 Ga0496122_0083743 3300048925 Bacteria 2209
466 Ga0496122_0090029 3300048925 Bacteria 2095
467 Ga0496122_0093356 3300048925 Bacteria 2041
468 Ga0496122_0103890 3300048925 Bacteria 1889
469 Ga0496122_0133124 3300048925 Bacteria 1574
470 Ga0496122_0148042 3300048925 Bacteria 1455
471 Ga0496122_0218112 3300048925 Bacteria 1097
472 Ga0496123_0000007 3300048926 Bacteria 645283
473 Ga0496123_0000147 3300048926 Bacteria 143834
474 Ga0496123_0004704 3300048926 Bacteria 14130
475 Ga0496123_0009287 3300048926 Bacteria 8877
476 Ga0496123_0035340 3300048926 Bacteria 3562
477 Ga0496123_0037920 3300048926 Bacteria 3396
478 Ga0496123_0072249 3300048926 Bacteria 2147
479 Ga0496123_0076381 3300048926 Bacteria 2062
480 Ga0496123_0176583 3300048926 Bacteria 1120
481 Ga0496123_0185765 3300048926 Bacteria 1080
482 Ga0496123_0214230 3300048926 Bacteria 976
483 Ga0496123_0237938 3300048926 Bacteria 906
484 Ga0496123_0286424 3300048926 Bacteria 793
485 Ga0496124_0000348 3300048927 Bacteria 84728
486 Ga0496124_0006920 3300048927 Bacteria 12188
487 Ga0496124_0014287 3300048927 Bacteria 7685
488 Ga0496124_0016689 3300048927 Bacteria 6966
489 Ga0496124_0016988 3300048927 Bacteria 6887
490 Ga0496124_0024351 3300048927 Bacteria 5506
491 Ga0496124_0033989 3300048927 Bacteria 4480
492 Ga0496124_0060381 3300048927 Bacteria 3180
493 Ga0496124_0065366 3300048927 Bacteria 3033
494 Ga0496124_0086611 3300048927 Bacteria 2563
495 Ga0496124_0087575 3300048927 Bacteria 2547
496 Ga0496124_0090792 3300048927 Bacteria 2490
497 Ga0496124_0121346 3300048927 Bacteria 2088
498 Ga0496124_0189057 3300048927 Bacteria 1578
499 Ga0496124_0256330 3300048927 Bacteria 1290
500 Ga0496124_0333557 3300048927 Bacteria 1080
501 Ga0496124_0539301 3300048927 Bacteria 773
502 Ga0496125_0001144 3300048928 Bacteria 40287
503 Ga0496125_0001465 3300048928 Bacteria 34178
504 Ga0496125_0022507 3300048928 Bacteria 5849
505 Ga0496125_0029569 3300048928 Bacteria 4921
506 Ga0496125_0035651 3300048928 Bacteria 4358
507 Ga0496125_0051306 3300048928 Bacteria 3403
508 Ga0496125_0088459 3300048928 Bacteria 2334
509 Ga0496125_0390359 3300048928 Bacteria 817
510 Ga0496125_0438870 3300048928 Bacteria 751
511 Ga0496126_0000188 3300048929 Bacteria 139625
512 Ga0496126_0000879 3300048929 Bacteria 52860
513 Ga0496126_0012445 3300048929 Bacteria 8714
514 Ga0496126_0026789 3300048929 Bacteria 5520
515 Ga0496126_0063420 3300048929 Bacteria 3312
516 Ga0496126_0105356 3300048929 Bacteria 2462
517 Ga0496126_0176748 3300048929 Bacteria 1815
518 Ga0496126_0205108 3300048929 Bacteria 1662
519 Ga0496126_0286753 3300048929 Bacteria 1362
520 Ga0496126_0479075 3300048929 Bacteria 997
521 Ga0496126_0909609 3300048929 Bacteria 666
522 Ga0496126_0992794 3300048929 Bacteria 630
523 Ga0495678_008240 3300049459 Bacteria 5284
524 Ga0495678_030026 3300049459 Bacteria 2278
525 Ga0495678_124410 3300049459 Bacteria 862
526 Ga0495682_0131299 3300049460 Bacteria 896
527 Ga0501032_0055328 3300049569 Bacteria 2669
528 Ga0501032_0083701 3300049569 Bacteria 2121
529 Ga0501033_0002870 3300049570 Bacteria 14437
530 Ga0501033_0088013 3300049570 Bacteria 2272
531 Ga0501034_0056607 3300049571 Bacteria 3944
532 Ga0501034_0233824 3300049571 Bacteria 1786
533 Ga0501036_0050174 3300049572 Bacteria 3534
534 Ga0501036_0144141 3300049572 Bacteria 2009
535 Ga0501037_0068354 3300049573 Bacteria 2586
536 Ga0501038_0106209 3300049574 Bacteria 2331
537 Ga0501039_0040985 3300049575 Bacteria 3575
538 Ga0501043_0042912 3300049579 Bacteria 3555
539 Ga0501043_0219572 3300049579 Bacteria 1471
540 Ga0501047_0213966 3300049581 Bacteria 1785
541 Ga0501048_0124339 3300049582 Bacteria 1824
542 Ga0501073_0371548 3300049589 Bacteria 988
543 Ga0501080_0110220 3300049742 Bacteria 2551
544 Ga0501083_0347377 3300049744 Bacteria 964
545 Ga0501280_006841 3300049776 Bacteria 1602
546 Ga0501280_018903 3300049776 Bacteria 1011
547 Ga0501035_0006588 3300049822 Bacteria 10874
548 Ga0501035_0046668 3300049822 Bacteria 3896
549 Ga0501044_0051657 3300049823 Bacteria 4238
550 Ga0501045_0247987 3300049824 Bacteria 1326
551 nmdc:mga03683_5823_c1 3300050489 Bacteria 4185
552 nmdc:mga03n38_167739_c1 3300050490 Bacteria 1116
553 nmdc:mga03n38_62536_c1 3300050490 Bacteria 1699
554 nmdc:mga03n38_670868_c1 3300050490 Bacteria 595
555 nmdc:mga00v17_144_c1 3300050491 Bacteria 41064
556 nmdc:mga00v17_19824_c1 3300050491 Bacteria 3846
557 nmdc:mga00v17_7_c1 3300050491 Bacteria 167228
558 nmdc:mga0yw44_19943_c1 3300050492 Bacteria 3709
559 nmdc:mga0yw44_40104_c1 3300050492 Bacteria 2780
560 nmdc:mga0yw44_61836_c1 3300050492 Bacteria 2299
561 nmdc:mga0k408_14201_c1 3300050493 Bacteria 4384
562 nmdc:mga0k408_44480_c1 3300050493 Bacteria 2561
563 nmdc:mga06z11_20051_c1 3300050494 Bacteria 3085
564 nmdc:mga06z11_253717_c1 3300050494 Bacteria 1036
565 nmdc:mga04h51_147569_c1 3300050495 Bacteria 897
566 nmdc:mga07m45_296705_c1 3300050496 Bacteria 940
567 nmdc:mga07m45_435_c1 3300050496 Bacteria 17361
568 nmdc:mga0sz30_12651_c1 3300050516 Bacteria 3286
569 nmdc:mga0sz30_1942_c1 3300050516 Bacteria 7387
570 nmdc:mga0sz30_20686_c1 3300050516 Bacteria 2656
571 nmdc:mga0sz30_4853_c1 3300050516 Bacteria 2849
572 nmdc:mga0sz30_55891_c1 3300050516 Bacteria 1680
573 Ga0495601_0072051 3300053077 Bacteria 2207
574 Ga0500610_0086482 3300053079 Bacteria 1631
575 Ga0500578_0060936 3300053086 Bacteria 2410
576 Ga0500583_0476743 3300053092 Bacteria 589
577 Ga0500651_0094771 3300053093 Bacteria 1835
578 Ga0500557_003467 3300053105 Bacteria 3135
579 Ga0500560_096910 3300053107 Bacteria 987
580 Ga0500569_007398 3300053109 Bacteria 2462
581 Ga0500594_0001767 3300053118 Bacteria 4704
582 Ga0500607_248561 3300053121 Bacteria 710
583 Ga0500618_000056 3300053125 Bacteria 98509
584 Ga0500618_008675 3300053125 Bacteria 2821
585 Ga0500618_040706 3300053125 Bacteria 1067
586 Ga0500658_0113569 3300053134 Bacteria 1194
587 Ga0500658_0123087 3300053134 Bacteria 1151
588 Ga0500561_0000236 3300053137 Bacteria 9886
589 Ga0500568_0001459 3300053139 Bacteria 15147
590 Ga0500568_0007906 3300053139 Bacteria 5176
591 Ga0500573_0032288 3300053140 Bacteria 3021
592 Ga0500588_0013233 3300053146 Bacteria 2066
593 Ga0500604_0048553 3300053151 Bacteria 1303
594 Ga0500616_0000363 3300053153 Bacteria 64277
595 Ga0500616_0005056 3300053153 Bacteria 9116
596 Ga0500620_040580 3300053155 Bacteria 1525
597 Ga0500622_0001665 3300053156 Bacteria 17370
598 Ga0500624_049336 3300053157 Bacteria 779
599 Ga0500633_0001402 3300053160 Bacteria 4517
600 Ga0500634_0019481 3300053161 Bacteria 3656
601 Ga0500634_0100106 3300053161 Bacteria 1452
602 Ga0500636_0000003 3300053177 Bacteria 240189
603 Ga0500636_0001041 3300053177 Bacteria 14876
604 Ga0500636_0231095 3300053177 Bacteria 957
605 Ga0500645_025193 3300053730 Bacteria 1816
606 2509376714 2509276019 Bacteria 6802256
607 2509391734 2509276021 Bacteria 7634384
608 2509447405 2509276033 Bacteria 7180565
609 2510134242 2510065019 Bacteria 6903379
610 2510840614 2510461069 Bacteria 5505000
611 2510895678 2510461076 Bacteria 8618824
612 2511134085 2510917022 Bacteria 6504556
613 2511169894 2510917026 Bacteria 7046020
614 2511182416 2510917028 Bacteria 6185411
615 2511199321 2510917030 Bacteria 7460662
616 2513567681 2513237084 Bacteria 7231967
617 2513597609 2513237088 Bacteria 6927906
618 2513631884 2513237093 Bacteria 7545552
619 2513707912 2513237103 Bacteria 7647401
620 2513870172 2513237138 Bacteria 7368160
621 2513997630 2513237159 Bacteria 6810126
622 2514018011 2513237162 Bacteria 7468464
623 2515113404 2515075009 Bacteria 7288508
624 2515635126 2515154113 Bacteria 7807172
625 2515645568 2515154114 Bacteria 7848616
626 2515655051 2515154116 Bacteria 7552979
627 2517037007 2516653077 Bacteria 7555578
628 2517096130 2517093000 Bacteria 7412387
629 2517407751 2517287029 Bacteria 6905599
630 2524458915 2524023209 Bacteria 6679728
631 2530646507 2529292951 Bacteria 6916614
632 2535517162 2534681796 Bacteria 7146037
633 2537877202 2537561587 Bacteria 5425293
634 2554248446 2554235003 Bacteria 5877155
635 2558863921 2558860100 Bacteria 8458965
636 2559295562 2558860242 Bacteria 5568029
637 2561469241 2558860983 Bacteria 4133860
638 2585201943 2582581294 Bacteria 6626667
639 2585225342 2582581298 Bacteria 7315509
640 2585228580 2582581299 Bacteria 6518058
641 2585258206 2582581304 Bacteria 5831370
642 2585271404 2582581307 Bacteria 6597605
643 2585279342 2582581308 Bacteria 7413247
644 2585323053 2582581315 Bacteria 7318924
645 2585331165 2582581316 Bacteria 7774528
646 2585401019 2582581867 Bacteria 7184437
647 2585531173 2585427527 Bacteria 7273426
648 2585538480 2585427528 Bacteria 6842387
649 2585547898 2585427529 Bacteria 7395659
650 2585552903 2585427530 Bacteria 7383882
651 2585559147 2585427531 Bacteria 6992870
652 2585822080 2585427590 Bacteria 6824633
653 2585836433 2585427593 Bacteria 7141551
654 2585843541 2585427594 Bacteria 6180594
655 2585898530 2585427608 Bacteria 6544331
656 2585903907 2585427609 Bacteria 6667127
657 2585996762 2585427633 Bacteria 6413184
658 2586001347 2585427634 Bacteria 6455027
659 2587980975 2585428125 Bacteria 6662905
660 2599332042 2599185156 Bacteria 5403036
661 2599601885 2599185210 Bacteria 5624189
662 2601609861 2600255279 Bacteria 5605316
663 2601746636 2600255308 Bacteria 5611129
664 2616293075 2615840624 Bacteria 6557588
665 2616311085 2615840626 Bacteria 7921970
666 2616554522 2615840698 Bacteria 7319877
667 2617385411 2617270742 Bacteria 6808054
668 2643811265 2643221558 Bacteria 5460675
669 2643856530 2643221568 Bacteria 5187270
670 2643920120 2643221582 Bacteria 5804683
671 2644006979 2643221599 Bacteria 6292121
672 2644191760 2643221634 Bacteria 6705461
673 2644242613 2643221643 Bacteria 5749658
674 2644298964 2643221653 Bacteria 4569637
675 2644521743 2643221693 Bacteria 5513853
676 2644657192 2643221719 Bacteria 4568197
677 2671111160 2667528174 Bacteria 6435400
678 2719182077 2718217882 Bacteria 6556348
679 2719386694 2718217927 Bacteria 6972593
680 2719666447 2718217997 Bacteria 6740740
681 2719732793 2718218009 Bacteria 6478651
682 2720492867 2718218199 Bacteria 6740745
683 2720614328 2718218232 Bacteria 6720332
684 2720621100 2718218233 Bacteria 6662049
685 2720632426 2718218235 Bacteria 6630699
686 2720776151 2718218269 Bacteria 6906114
687 2721148168 2718218363 Bacteria 6524337
688 2721159621 2718218365 Bacteria 6274507
689 2721165004 2718218366 Bacteria 6425255
690 2721400400 2718218423 Bacteria 6438183
691 2722841174 2721755514 Bacteria 6424414
692 2723027748 2721755556 Bacteria 6745503
693 2723561378 2721755684 Bacteria 6859907
694 2723568001 2721755685 Bacteria 6704835
695 2724039213 2721755809 Bacteria 6438790
696 2724045549 2721755810 Bacteria 6479005
697 2724090758 2721755819 Bacteria 6906405
698 2724105266 2721755822 Bacteria 6726041
699 2724111093 2721755823 Bacteria 6752556
700 2725950359 2724679232 Bacteria 7646494
701 2730108684 2728369352 Bacteria 6745171
702 2730165312 2728369365 Bacteria 6555560
703 2730299253 2728369397 Bacteria 6274511
704 2738804972 2738541293 Bacteria 7065685
705 2739033122 2738541333 Bacteria 7106503
706 2757571573 2757320392 Bacteria 3737298
707 2766066166 2765235942 Bacteria 7445910
708 2778175704 2775507266 Bacteria 7392367
709 2793280072 2791355253 Bacteria 5171699
710 2793318146 2791355259 Bacteria 7254731
711 2793319461 2791355260 Bacteria 6598818
712 2793328912 2791355261 Bacteria 6661293
713 2793339559 2791355263 Bacteria 6872478
714 2793362485 2791355266 Bacteria 7116587
715 2793367608 2791355267 Bacteria 7222458
716 2805926786 2802429605 Bacteria 6875453
717 2806045261 2802429633 Bacteria 7341974
718 2806049944 2802429634 Bacteria 7083200
719 2806056782 2802429635 Bacteria 7650140
720 2806064164 2802429636 Bacteria 7597525
721 2806071432 2802429637 Bacteria 7067217
722 2808987705 2808606387 Bacteria 5697198
723 2819241025 2818991272 Bacteria 4622173
724 2819559278 2818991439 Bacteria 6907412
725 2819609410 2818991448 Bacteria 6772224
726 2819641278 2818991453 Bacteria 7181617
727 2821125829 2821123053 Bacteria 7836056
728 2838020065 2838016132 Bacteria 6577831
729 2838023567 2838022645 Bacteria 6494267
730 2838033327 2838029111 Bacteria 6603031
731 2838045257 2838042994 Bacteria 6046894
732 2838053267 2838048938 Bacteria 6044578
733 2838065383 2838061910 Bacteria 6794874
734 2838069860 2838068647 Bacteria 6208656
735 2838675551 2838675328 Bacteria 4909118
736 2838683158 2838680041 Bacteria 6545511
737 2838697898 2838694306 Bacteria 6853137
738 2838711013 2838707686 Bacteria 6619912
739 2838714432 2838714209 Bacteria 5525906
740 2838721766 2838719591 Bacteria 5523910
741 2838725193 2838724970 Bacteria 4908691
742 2838737721 2838736955 Bacteria 5760694
743 2841841910 2841840854 Bacteria 5761912
744 2841848750 2841846520 Bacteria 5345850
745 2841862352 2841859092 Bacteria 5436171
746 2841867251 2841864319 Bacteria 6742987
747 2842079188 2842077413 Bacteria 6508645
748 2842112974 2842110456 Bacteria 7656360
749 2842118301 2842118031 Bacteria 7033875
750 2842125219 2842124991 Bacteria 5346824
751 2842130446 2842130223 Bacteria 4909145
752 2842141689 2842140634 Bacteria 5759631
753 2842154384 2842152218 Bacteria 4908957
754 2842170675 2842170452 Bacteria 5525737
755 2842178004 2842175837 Bacteria 4908771
756 2842187541 2842187318 Bacteria 5524014
757 2842199081 2842198810 Bacteria 6608673
758 2842211852 2842211629 Bacteria 5523832
759 2842218238 2842217011 Bacteria 7497767
760 2842226528 2842224351 Bacteria 5524473
761 2842240215 2842237096 Bacteria 6620661
762 2842267783 2842264693 Bacteria 6472963
763 2842285321 2842285085 Bacteria 6011953
764 2842292850 2842291075 Bacteria 7076806
765 2842298267 2842298080 Bacteria 6123127
766 2842313933 2842311132 Bacteria 6616990
767 2842319830 2842317721 Bacteria 6793725
768 2842348139 2842341865 Bacteria 7003929
769 2842360133 2842357229 Bacteria 6485165
770 2842368385 2842363717 Bacteria 6844742
771 2842373788 2842370503 Bacteria 7038661
772 2842379247 2842377471 Bacteria 7140707
773 2842384812 2842384541 Bacteria 7057858
774 2842400051 2842395702 Bacteria 6780583
775 2842402681 2842402390 Bacteria 6681310
776 2842409948 2842409023 Bacteria 6687331
777 2842416596 2842415677 Bacteria 6596907
778 2842423474 2842422224 Bacteria 6239196
779 2842430427 2842428310 Bacteria 6767288
780 2842436761 2842434925 Bacteria 6502746
781 2842443397 2842441272 Bacteria 6769273
782 2842449268 2842447887 Bacteria 6754142
783 2842466681 2842462802 Bacteria 6588055
784 2842471369 2842469257 Bacteria 6752936
785 2842480008 2842475841 Bacteria 6603183
786 2842483797 2842482326 Bacteria 7212537
787 2842493629 2842489311 Bacteria 6620893
788 2842497780 2842495871 Bacteria 6820686
789 2842505207 2842502639 Bacteria 6604161
790 2842514216 2842509118 Bacteria 6850950
791 2842519136 2842515876 Bacteria 5436280
792 2842522127 2842521101 Bacteria 6569494
793 2842924377 2842922631 Bacteria 5824079
794 2850081716 2850079185 Bacteria 6848280
795 2852390549 2852387548 Bacteria 8025568
796 2854901427 2854896431 Bacteria 5869725
797 2854918960 2854916844 Bacteria 5725939
798 2857517129 2857516855 Bacteria 7787325
799 2857532390 2857531043 Bacteria 6754041
800 2891051202 2891048133 Bacteria 4447501
801 2891373629 2891373044 Bacteria 5202277
802 2899794048 2899792073 Bacteria 4926588
803 2899806749 2899803654 Bacteria 5577784
804 2899848822 2899845264 Bacteria 5672268
805 2919106161 2919100787 Bacteria 7710546
806 2919114469 2919114240 Bacteria 5700270
807 2919173056 2919171160 Bacteria 6499771
808 2919410273 2919408235 Bacteria 6149349
809 2923561151 2923556063 Bacteria 6793593
810 2926755483 2926754445 Bacteria 5964435
811 2926762614 2926760298 Bacteria 5505990
812 2929141076 2929138655 Bacteria 5810547
813 2933009029 2933006813 Bacteria 4912075
814 2933014690 2933011516 Bacteria 5439334
815 2933588969 2933586486 Bacteria 7667493
816 2933596372 2933594066 Bacteria 5594265
817 2933600666 2933599457 Bacteria 5858799
818 2935896717 2935894831 Bacteria 6620579
819 2936371752 2936367885 Bacteria 7324495
820 2936379587 2936375103 Bacteria 6652732
821 2936388144 2936381700 Bacteria 7006523
822 2979092074 2979089926 Bacteria 5670289
823 2979100537 2979095461 Bacteria 5669583
824 2979104133 2979100975 Bacteria 5423623
825 2984511297 2984509177 Bacteria 5274802
826 2984522342 2984518228 Bacteria 5277463
827 2984541644 2984537506 Bacteria 5277481
828 2984603917 2984601300 Bacteria 5455244
829 2989350109 2989349275 Bacteria 6349068
830 2989773254 2989771324 Bacteria 5605128
831 2989779530 2989776772 Bacteria 4843317
832 2995396539 2995392953 Bacteria 4539380
833 2996892756 2996887358 Bacteria 5795980
834 2996897932 2996893221 Bacteria 5823108
835 3003934516 3003930520 Bacteria 5667563
836 3005414268 3005409236 Bacteria 7188837
837 3005418906 3005416602 Bacteria 7064308
838 3005448743 3005445848 Bacteria 6906074
839 3005454978 3005452660 Bacteria 5889319
840 639649462 639633055 Bacteria 7751309
841 643826592 643692032 Bacteria 6891900
842 650740771 650716007 Bacteria 5573770
843 8003571847 8003570095 Bacteria 5747666
844 8005249861 8005246636 Bacteria 4933972
845 8005259477 8005258706 Bacteria 6184835
846 8005281504 8005275841 Bacteria 6929066
847 8005284527 8005282627 Bacteria 6675747
848 8005303411 8005301065 Bacteria 6614431
849 8005318202 8005314921 Bacteria 7072929
850 8005327283 8005321885 Bacteria 5795980
851 8005381215 8005376324 Bacteria 6590079
852 8005388824 8005382845 Bacteria 6732062
853 8005437570 8005430974 Bacteria 6689030
854 8005464088 8005460587 Bacteria 7157962
855 8005488921 8005484373 Bacteria 6297373
856 8005501184 8005497431 Bacteria 6477605
857 8005545977 8005542996 Bacteria 7077758
858 8005561509 8005556819 Bacteria 6908598
859 8005568287 8005563573 Bacteria 7153261
860 8005573173 8005570704 Bacteria 6957481
861 8005622551 8005619151 Bacteria 7030230
862 8005630053 8005626139 Bacteria 6534237
863 8005646003 8005645114 Bacteria 6950293
864 8005672602 8005668836 Bacteria 6953162
865 8005682613 8005682033 Bacteria 6726518
866 8005691817 8005688590 Bacteria 6610080
867 8005697703 8005695170 Bacteria 6912330
868 8018127426 8018127388 Bacteria 7351159
869 8018151280 8018150411 Bacteria 5549903
870 8018164279 8018163183 Bacteria 7277977
871 8018179524 8018176218 Bacteria 6896178
872 8024486288 8024479707 Bacteria 6954785
873 8024488323 8024486573 Bacteria 6540512
874 8046772361 8046767195 Bacteria 7547379
875 8054463193 8054460903 Bacteria 4872905
876 8055432349 8055431914 Bacteria 4551896
877 8056377553 8056375014 Bacteria 7006639
878 8056875850 8056875544 Bacteria 4355797
879 8057576683 8057575449 Bacteria 7367519
880 8057882065 8057874678 Bacteria 7494653
881 JGI24740J21852_10007862
882 JGI25155J39150_1000014
883 JGI25156J39149_1000083
884 JGI25162J39368_1000217
885 JGI25162J39368_1000272
886 JGI25162J39368_1000416
887 JGI25154J39366_1000052
888 JGI25157J39369_1000110
889 JGI25152J39213_1001348
890 JGI25152J39213_1002158
891 JGI25152J39213_1002644
892 JGI25152J39213_1004295
893 JGI25152J39213_1004334
894 JGI25152J39213_1021598
895 JGI25150J39212_1000100
896 JGI25150J39212_1002765
897 JGI25150J39212_1003426
898 JGI25159J45721_1000832
899 JGI25159J45721_1002615
900 JGI25151J46595_10000146
901 JGI25151J46595_10002021
902 JGI25151J46595_10003013
903 JGI25151J46595_10007505
904 JGI25151J46595_10043085
905 JGI25151J46595_10066878
906 JGI25165J46597_1000363
907 JGI25165J46597_1000767
908 JGI25165J46597_1005503
909 JGI25153J46596_10000764
910 JGI25153J46596_10002359
911 JGI25153J46596_10009056
912 JGI25153J46596_10009420
913 JGI25153J46596_10009505
914 JGI25153J46596_10052409
915 rootH1_10095586
916 rootL2_10044385
917 rootH1_10047163
918 JGI25160J50197_1000001
919 JGI25160J50197_1000351
920 JGI25160J50197_1013610
921 JGI25161J50226_1000001
922 JGI25161J50226_1000167
923 JGI25161J50226_1014399
924 Ga0055526_1000842
925 Ga0055526_1003643
926 Ga0055526_1004423
927 Ga0055526_1018827
928 Ga0055524_1002425
929 Ga0055524_1003892
930 Ga0055524_1007700
931 Ga0055524_1012307
932 Ga0055524_1013955
933 Ga0055536_1006441
934 Ga0055528_1000158
935 Ga0055528_1000707
936 Ga0055528_1000749
937 Ga0055528_1003189
938 Ga0055528_1006485
939 Ga0055528_1009987
940 Ga0055530_10021732
941 Ga0055540_1000518
942 Ga0055540_1005724
943 Ga0055540_1006013
944 Ga0055540_1034552
945 Ga0055531_10010704
946 Ga0058692_1001431
947 Ga0055543_1000060
948 Ga0055543_1000216
949 Ga0055543_1000699
950 Ga0065165_1000008
951 Ga0065165_1004363
952 Ga0065165_1064875
953 Ga0065165_1067950
954 Ga0065704_10475575
955 Ga0070666_10099735
956 Ga0070668_100017103
957 Ga0070668_101579046
958 Ga0070669_100135042
959 Ga0070671_100033648
960 Ga0070663_100013668
961 Ga0070665_100007074
962 Ga0068855_100081851
963 Ga0068854_100040374
964 Ga0068854_100410685
965 Ga0068856_100190581
966 Ga0068861_100942699
967 Ga0068851_10166693
968 Ga0068863_101719947
969 Ga0075365_10007766
970 Ga0075365_10010140
971 Ga0075365_10095352
972 Ga0075368_10005974
973 Ga0075368_10317028
974 Ga0075363_100015703
975 Ga0075363_100019422
976 Ga0075363_100055338
977 Ga0075364_10015660
978 Ga0075364_10349320
979 Ga0075364_11049827
980 Ga0075362_10075178
981 Ga0075367_10000779
982 Ga0075367_10011013
983 Ga0075367_10102795
984 Ga0075369_10003894
985 Ga0075369_10013982
986 Ga0075369_10021466
987 Ga0075366_10003058
988 Ga0075370_10002851
989 Ga0075370_10003951
990 Ga0075370_10042620
991 Ga0075370_10479373
992 Ga0079104_1000015
993 Ga0099826_10000102
994 Ga0099826_10018575
995 Ga0105251_10010023
996 Ga0105244_10097209
997 Ga0105244_10280460
998 Ga0105250_10067011
999 Ga0105240_10000014
1000 Ga0105243_10006869
1001 Ga0105243_10111991
1002 Ga0105248_10153015
1003 Ga0105237_10002158
1004 Ga0105249_10082826
1005 Ga0123340_1049595
1006 Ga0123341_1000035
1007 Ga0123341_1061365
1008 Ga0123341_1061371
1009 Ga0123342_1009440
1010 Ga0123342_1011443
1011 Ga0157373_10055636
1012 Ga0157373_10227511
1013 Ga0157371_10000017
1014 Ga0157370_10000329
1015 Ga0157370_10001031
1016 Ga0157369_10024034
1017 Ga0157369_10522116
1018 Ga0157369_10661880
1019 Ga0182008_10047466
1020 Ga0182008_10303399
1021 Ga0182007_10003468
1022 Ga0182005_1000982
1023 Ga0214542_1000268
1024 Ga0214543_1000022
1025 Ga0214543_1000219
1026 Ga0209435_100027
1027 Ga0209760_107985
1028 Ga0209436_100081
1029 Ga0209437_100051
1030 Ga0209437_100060
1031 Ga0207425_1000046
1032 Ga0207425_1002771
1033 Ga0207425_1004453
1034 Ga0207425_1005031
1035 Ga0207425_1020267
1036 Ga0209646_1000086
1037 Ga0209026_1000082
1038 Ga0209677_100540
1039 Ga0209148_1022470
1040 Ga0209759_1000063
1041 Ga0209129_1000171
1042 Ga0209129_1000283
1043 Ga0209129_1000450
1044 Ga0209129_1001443
1045 Ga0209129_1001916
1046 Ga0209129_1004411
1047 Ga0209129_1005600
1048 Ga0209233_1000095
1049 Ga0209233_1000190
1050 Ga0209233_1000228
1051 Ga0209673_1000010
1052 Ga0209673_1000025
1053 Ga0209673_1000112
1054 Ga0209673_1000637
1055 Ga0209673_1004043
1056 Ga0209130_1000003
1057 Ga0209130_1000023
1058 Ga0209130_1010464
1059 Ga0209675_1034800
1060 Ga0209676_1002751
1061 Ga0209025_1000091
1062 Ga0209025_1000137
1063 Ga0209025_1000152
1064 Ga0209025_1000154
1065 Ga0209025_1000545
1066 Ga0209025_1001424
1067 Ga0209025_1005945
1068 Ga0209025_1006114
1069 Ga0209025_1011337
1070 Ga0209025_1022784
1071 Ga0209025_1047100
1072 Ga0209564_1000564
1073 Ga0209564_1000672
1074 Ga0209564_1001566
1075 Ga0209564_1003798
1076 Ga0209564_1012665
1077 Ga0209758_1000058
1078 Ga0209758_1000123
1079 Ga0209758_1000725
1080 Ga0209758_1000863
1081 Ga0209758_1001901
1082 Ga0209758_1001960
1083 Ga0209758_1006925
1084 Ga0209758_1008712
1085 Ga0209050_1002725
1086 Ga0209050_1016627
1087 Ga0209256_1000914
1088 Ga0209256_1001132
1089 Ga0209256_1001499
1090 Ga0209256_1003097
1091 Ga0209256_1007950
1092 Ga0207426_1000008
1093 Ga0207426_1000011
1094 Ga0207426_1000228
1095 Ga0207426_1006647
1096 Ga0209051_1000462
1097 Ga0209051_1000785
1098 Ga0209051_1001635
1099 Ga0209051_1007538
1100 Ga0209051_1015498
1101 Ga0209257_1003221
1102 Ga0209257_1005494
1103 Ga0209257_1036976
1104 Ga0209257_1037140
1105 Ga0207713_1041996
1106 Ga0207680_10183137
1107 Ga0207695_10000037
1108 Ga0207671_10001228
1109 Ga0207681_10127084
1110 Ga0207650_10001248
1111 Ga0207644_10058528
1112 Ga0207706_10295850
1113 Ga0207709_10199828
1114 Ga0207711_10061404
1115 Ga0207712_10070189
1116 Ga0207658_10318477
1117 Ga0207639_10735315
1118 Ga0207678_10025462
1119 Ga0207702_10034211
1120 Ga0207702_10184423
1121 Ga0207641_11160395
1122 Ga0207675_101047242
1123 Ga0209281_1000034
1124 Ga0209371_1000022
1125 Ga0209371_1000341
1126 Ga0209371_1003792
1127 Ga0209282_1002798
1128 Ga0209282_1017894
1129 Ga0209813_10004580
1130 Ga0209813_10184410
1131 Ga0268266_10005469
1132 Ga0268266_10113508
1133 Ga0307515_10000017
1134 Ga0307515_10029550
1135 Ga0268256_1000019
1136 Ga0268256_1001403
1137 Ga0268256_1004051
1138 Ga0268256_1043464
1139 Ga0316181_1107412
1140 Ga0316182_1174290
1141 Ga0307513_10001095
1142 Ga0307513_10009210
1143 Ga0307408_100836973
1144 Ga0307405_10017156
1145 Ga0307412_10004052
1146 Ga0307412_10703297
1147 Ga0307510_10526875
1148 Ga0373927_0000419
1149 Ga0439436_0010510
1150 Ga0439466_0025917
1151 Ga0439465_0050912
1152 Ga0439465_0076364
1153 Ga0451795_0647420
1154 Ga0451807_1773350
1155 Ga0451833_0575078
1156 Ga0451835_0487282
1157 Ga0451837_0448786
1158 Ga0451839_0351025
1159 Ga0451841_0429116
1160 Ga0451845_0704804
1161 Ga0451847_0545907
1162 Ga0451847_0607285
1163 Ga0451849_0971194
1164 Ga0451851_0559086
1165 Ga0451855_0815820
1166 Ga0451855_1183387
1167 Ga0439432_026777
1168 Ga0439449_0080579
1169 Ga0439462_0021294
1170 Ga0450909_006211
1171 Ga0450918_012682
1172 Ga0466982_0343227
1173 Ga0466966_0074592
1174 Ga0466963_0018270
1175 Ga0466964_0101026
1176 Ga0466970_0000872
1177 Ga0466957_0176279
1178 Ga0466967_0060709
1179 Ga0466967_0099658
1180 Ga0495617_117724
1181 Ga0495617_145929
1182 Ga0495627_101476
1183 Ga0495592_0042081
1184 Ga0495590_0321806
1185 Ga0495638_0000953
1186 Ga0495651_0022780
1187 Ga0495650_0086473
1188 Ga0495605_0001474
1189 Ga0495605_0097803
1190 Ga0495662_0003309
1191 Ga0495585_0011346
1192 Ga0495585_0025457
1193 Ga0495585_0071440
1194 Ga0495585_0106941
1195 Ga0495596_0122860
1196 Ga0495607_0025745
1197 Ga0495583_0003748
1198 Ga0495583_0012759
1199 Ga0495583_0103731
1200 Ga0495606_0002168
1201 Ga0495606_0110593
1202 Ga0495610_0012771
1203 Ga0495610_0063587
1204 Ga0495610_0297126
1205 Ga0495616_0112151
1206 Ga0495618_0214161
1207 Ga0495620_0013879
1208 Ga0495620_0049847
1209 Ga0495620_0064131
1210 Ga0495631_0012885
1211 Ga0495631_0081293
1212 Ga0495632_0013526
1213 Ga0495632_0044287
1214 Ga0495632_0148593
1215 Ga0495643_0088887
1216 Ga0495643_0219943
1217 Ga0495648_0024217
1218 Ga0495648_0297118
1219 Ga0495652_0344343
1220 Ga0495654_0000758
1221 Ga0495654_0053584
1222 Ga0495640_0122447
1223 Ga0495609_0008203
1224 Ga0495622_0030020
1225 Ga0495633_0021557
1226 Ga0495633_0049675
1227 Ga0495633_0120220
1228 Ga0495633_0204623
1229 Ga0495656_0066770
1230 Ga0495668_0003159
1231 Ga0495668_0080778
1232 Ga0495611_0111483
1233 Ga0495625_0005331
1234 Ga0495625_0062307
1235 Ga0495625_0491495
1236 Ga0495635_0088343
1237 Ga0495661_0167154
1238 Ga0495588_0001565
1239 Ga0495588_0149404
1240 Ga0495657_0015576
1241 Ga0495658_0040425
1242 Ga0495624_0053180
1243 Ga0495670_0003394
1244 Ga0495670_0148823
1245 Ga0495671_0052719
1246 Ga0495671_0103852
1247 Ga0495671_0306891
1248 Ga0495649_0049124
1249 Ga0495600_0141875
1250 Ga0495660_0032206
1251 Ga0495660_0045004
1252 Ga0495604_0031909
1253 Ga0495672_0003408
1254 Ga0495683_0129898
1255 Ga0495681_0010603
1256 Ga0495681_0335685
1257 Ga0495686_0007900
1258 Ga0495686_0016439
1259 Ga0495686_0018844
1260 Ga0495615_0016963
1261 Ga0495615_0029692
1262 Ga0496101_0152268
1263 Ga0496101_0205390
1264 Ga0496101_0284143
1265 Ga0496101_0734581
1266 Ga0496102_0004330
1267 Ga0496102_0060372
1268 Ga0496103_0036078
1269 Ga0496103_0067827
1270 Ga0496104_0049484
1271 Ga0496104_0554104
1272 Ga0496105_0029943
1273 Ga0496106_0001496
1274 Ga0496110_0135447
1275 Ga0496112_0487960
1276 Ga0496113_0029675
1277 Ga0496113_0130856
1278 Ga0496113_0252125
1279 Ga0496113_0754236
1280 Ga0496114_0296181
1281 Ga0496114_0995822
1282 Ga0496116_0010698
1283 Ga0496116_0016794
1284 Ga0496116_0022826
1285 Ga0496116_0033222
1286 Ga0496116_0081123
1287 Ga0496116_0088663
1288 Ga0496116_0125237
1289 Ga0496116_0150895
1290 Ga0496116_0162805
1291 Ga0496116_0168676
1292 Ga0496116_0459327
1293 Ga0496117_0000002
1294 Ga0496117_0002241
1295 Ga0496117_0003292
1296 Ga0496117_0020448
1297 Ga0496117_0025317
1298 Ga0496117_0026153
1299 Ga0496117_0026472
1300 Ga0496117_0077801
1301 Ga0496117_0219603
1302 Ga0496118_0000566
1303 Ga0496118_0001388
1304 Ga0496118_0004636
1305 Ga0496118_0023728
1306 Ga0496118_0027341
1307 Ga0496118_0078264
1308 Ga0496119_0012920
1309 Ga0496119_0024130
1310 Ga0496119_0041712
1311 Ga0496119_0046892
1312 Ga0496119_0066220
1313 Ga0496119_0069863
1314 Ga0496119_0090750
1315 Ga0496119_0241108
1316 Ga0496120_0000309
1317 Ga0496120_0024822
1318 Ga0496120_0061705
1319 Ga0496120_0126591
1320 Ga0496120_0156937
1321 Ga0496120_0163707
1322 Ga0496120_0197631
1323 Ga0496121_0001287
1324 Ga0496121_0002836
1325 Ga0496121_0009257
1326 Ga0496121_0014795
1327 Ga0496121_0019082
1328 Ga0496121_0020642
1329 Ga0496121_0023780
1330 Ga0496121_0025505
1331 Ga0496121_0034993
1332 Ga0496121_0044494
1333 Ga0496121_0075202
1334 Ga0496121_0128385
1335 Ga0496121_0129721
1336 Ga0496121_0223713
1337 Ga0496122_0000004
1338 Ga0496122_0000414
1339 Ga0496122_0004472
1340 Ga0496122_0016318
1341 Ga0496122_0027013
1342 Ga0496122_0027041
1343 Ga0496122_0038145
1344 Ga0496122_0078425
1345 Ga0496122_0083743
1346 Ga0496122_0090029
1347 Ga0496122_0093356
1348 Ga0496122_0103890
1349 Ga0496122_0133124
1350 Ga0496122_0148042
1351 Ga0496122_0218112
1352 Ga0496123_0000007
1353 Ga0496123_0000147
1354 Ga0496123_0004704
1355 Ga0496123_0009287
1356 Ga0496123_0035340
1357 Ga0496123_0037920
1358 Ga0496123_0072249
1359 Ga0496123_0076381
1360 Ga0496123_0176583
1361 Ga0496123_0185765
1362 Ga0496123_0214230
1363 Ga0496123_0237938
1364 Ga0496123_0286424
1365 Ga0496124_0000348
1366 Ga0496124_0006920
1367 Ga0496124_0014287
1368 Ga0496124_0016689
1369 Ga0496124_0016988
1370 Ga0496124_0024351
1371 Ga0496124_0033989
1372 Ga0496124_0060381
1373 Ga0496124_0065366
1374 Ga0496124_0086611
1375 Ga0496124_0087575
1376 Ga0496124_0090792
1377 Ga0496124_0121346
1378 Ga0496124_0189057
1379 Ga0496124_0256330
1380 Ga0496124_0333557
1381 Ga0496124_0539301
1382 Ga0496125_0001144
1383 Ga0496125_0001465
1384 Ga0496125_0022507
1385 Ga0496125_0029569
1386 Ga0496125_0035651
1387 Ga0496125_0051306
1388 Ga0496125_0088459
1389 Ga0496125_0390359
1390 Ga0496125_0438870
1391 Ga0496126_0000188
1392 Ga0496126_0000879
1393 Ga0496126_0012445
1394 Ga0496126_0026789
1395 Ga0496126_0063420
1396 Ga0496126_0105356
1397 Ga0496126_0176748
1398 Ga0496126_0205108
1399 Ga0496126_0286753
1400 Ga0496126_0479075
1401 Ga0496126_0909609
1402 Ga0496126_0992794
1403 Ga0495678_008240
1404 Ga0495678_030026
1405 Ga0495678_124410
1406 Ga0495682_0131299
1407 Ga0501032_0055328
1408 Ga0501032_0083701
1409 Ga0501033_0002870
1410 Ga0501033_0088013
1411 Ga0501034_0056607
1412 Ga0501034_0233824
1413 Ga0501036_0050174
1414 Ga0501036_0144141
1415 Ga0501037_0068354
1416 Ga0501038_0106209
1417 Ga0501039_0040985
1418 Ga0501043_0042912
1419 Ga0501043_0219572
1420 Ga0501047_0213966
1421 Ga0501048_0124339
1422 Ga0501073_0371548
1423 Ga0501080_0110220
1424 Ga0501083_0347377
1425 Ga0501280_006841
1426 Ga0501280_018903
1427 Ga0501035_0006588
1428 Ga0501035_0046668
1429 Ga0501044_0051657
1430 Ga0501045_0247987
1431 nmdc:mga03683_5823_c1
1432 nmdc:mga03n38_167739_c1
1433 nmdc:mga03n38_62536_c1
1434 nmdc:mga03n38_670868_c1
1435 nmdc:mga00v17_144_c1
1436 nmdc:mga00v17_19824_c1
1437 nmdc:mga00v17_7_c1
1438 nmdc:mga0yw44_19943_c1
1439 nmdc:mga0yw44_40104_c1
1440 nmdc:mga0yw44_61836_c1
1441 nmdc:mga0k408_14201_c1
1442 nmdc:mga0k408_44480_c1
1443 nmdc:mga06z11_20051_c1
1444 nmdc:mga06z11_253717_c1
1445 nmdc:mga04h51_147569_c1
1446 nmdc:mga07m45_296705_c1
1447 nmdc:mga07m45_435_c1
1448 nmdc:mga0sz30_12651_c1
1449 nmdc:mga0sz30_1942_c1
1450 nmdc:mga0sz30_20686_c1
1451 nmdc:mga0sz30_4853_c1
1452 nmdc:mga0sz30_55891_c1
1453 Ga0495601_0072051
1454 Ga0500610_0086482
1455 Ga0500578_0060936
1456 Ga0500583_0476743
1457 Ga0500651_0094771
1458 Ga0500557_003467
1459 Ga0500560_096910
1460 Ga0500569_007398
1461 Ga0500594_0001767
1462 Ga0500607_248561
1463 Ga0500618_000056
1464 Ga0500618_008675
1465 Ga0500618_040706
1466 Ga0500658_0113569
1467 Ga0500658_0123087
1468 Ga0500561_0000236
1469 Ga0500568_0001459
1470 Ga0500568_0007906
1471 Ga0500573_0032288
1472 Ga0500588_0013233
1473 Ga0500604_0048553
1474 Ga0500616_0000363
1475 Ga0500616_0005056
1476 Ga0500620_040580
1477 Ga0500622_0001665
1478 Ga0500624_049336
1479 Ga0500633_0001402
1480 Ga0500634_0019481
1481 Ga0500634_0100106
1482 Ga0500636_0000003
1483 Ga0500636_0001041
1484 Ga0500636_0231095
1485 Ga0500645_025193
1486 2509376714
1487 2509391734
1488 2509447405
1489 2510134242
1490 2510840614
1491 2510895678
1492 2511134085
1493 2511169894
1494 2511182416
1495 2511199321
1496 2513567681
1497 2513597609
1498 2513631884
1499 2513707912
1500 2513870172
1501 2513997630
1502 2514018011
1503 2515113404
1504 2515635126
1505 2515645568
1506 2515655051
1507 2517037007
1508 2517096130
1509 2517407751
1510 2524458915
1511 2530646507
1512 2535517162
1513 2537877202
1514 2554248446
1515 2558863921
1516 2559295562
1517 2561469241
1518 2585201943
1519 2585225342
1520 2585228580
1521 2585258206
1522 2585271404
1523 2585279342
1524 2585323053
1525 2585331165
1526 2585401019
1527 2585531173
1528 2585538480
1529 2585547898
1530 2585552903
1531 2585559147
1532 2585822080
1533 2585836433
1534 2585843541
1535 2585898530
1536 2585903907
1537 2585996762
1538 2586001347
1539 2587980975
1540 2599332042
1541 2599601885
1542 2601609861
1543 2601746636
1544 2616293075
1545 2616311085
1546 2616554522
1547 2617385411
1548 2643811265
1549 2643856530
1550 2643920120
1551 2644006979
1552 2644191760
1553 2644242613
1554 2644298964
1555 2644521743
1556 2644657192
1557 2671111160
1558 2719182077
1559 2719386694
1560 2719666447
1561 2719732793
1562 2720492867
1563 2720614328
1564 2720621100
1565 2720632426
1566 2720776151
1567 2721148168
1568 2721159621
1569 2721165004
1570 2721400400
1571 2722841174
1572 2723027748
1573 2723561378
1574 2723568001
1575 2724039213
1576 2724045549
1577 2724090758
1578 2724105266
1579 2724111093
1580 2725950359
1581 2730108684
1582 2730165312
1583 2730299253
1584 2738804972
1585 2739033122
1586 2757571573
1587 2766066166
1588 2778175704
1589 2793280072
1590 2793318146
1591 2793319461
1592 2793328912
1593 2793339559
1594 2793362485
1595 2793367608
1596 2805926786
1597 2806045261
1598 2806049944
1599 2806056782
1600 2806064164
1601 2806071432
1602 2808987705
1603 2819241025
1604 2819559278
1605 2819609410
1606 2819641278
1607 2821125829
1608 2838020065
1609 2838023567
1610 2838033327
1611 2838045257
1612 2838053267
1613 2838065383
1614 2838069860
1615 2838675551
1616 2838683158
1617 2838697898
1618 2838711013
1619 2838714432
1620 2838721766
1621 2838725193
1622 2838737721
1623 2841841910
1624 2841848750
1625 2841862352
1626 2841867251
1627 2842079188
1628 2842112974
1629 2842118301
1630 2842125219
1631 2842130446
1632 2842141689
1633 2842154384
1634 2842170675
1635 2842178004
1636 2842187541
1637 2842199081
1638 2842211852
1639 2842218238
1640 2842226528
1641 2842240215
1642 2842267783
1643 2842285321
1644 2842292850
1645 2842298267
1646 2842313933
1647 2842319830
1648 2842348139
1649 2842360133
1650 2842368385
1651 2842373788
1652 2842379247
1653 2842384812
1654 2842400051
1655 2842402681
1656 2842409948
1657 2842416596
1658 2842423474
1659 2842430427
1660 2842436761
1661 2842443397
1662 2842449268
1663 2842466681
1664 2842471369
1665 2842480008
1666 2842483797
1667 2842493629
1668 2842497780
1669 2842505207
1670 2842514216
1671 2842519136
1672 2842522127
1673 2842924377
1674 2850081716
1675 2852390549
1676 2854901427
1677 2854918960
1678 2857517129
1679 2857532390
1680 2891051202
1681 2891373629
1682 2899794048
1683 2899806749
1684 2899848822
1685 2919106161
1686 2919114469
1687 2919173056
1688 2919410273
1689 2923561151
1690 2926755483
1691 2926762614
1692 2929141076
1693 2933009029
1694 2933014690
1695 2933588969
1696 2933596372
1697 2933600666
1698 2935896717
1699 2936371752
1700 2936379587
1701 2936388144
1702 2979092074
1703 2979100537
1704 2979104133
1705 2984511297
1706 2984522342
1707 2984541644
1708 2984603917
1709 2989350109
1710 2989773254
1711 2989779530
1712 2995396539
1713 2996892756
1714 2996897932
1715 3003934516
1716 3005414268
1717 3005418906
1718 3005448743
1719 3005454978
1720 639649462
1721 643826592
1722 650740771
1723 8003571847
1724 8005249861
1725 8005259477
1726 8005281504
1727 8005284527
1728 8005303411
1729 8005318202
1730 8005327283
1731 8005381215
1732 8005388824
1733 8005437570
1734 8005464088
1735 8005488921
1736 8005501184
1737 8005545977
1738 8005561509
1739 8005568287
1740 8005573173
1741 8005622551
1742 8005630053
1743 8005646003
1744 8005672602
1745 8005682613
1746 8005691817
1747 8005697703
1748 8018127426
1749 8018151280
1750 8018164279
1751 8018179524
1752 8024486288
1753 8024488323
1754 8046772361
1755 8054463193
1756 8055432349
1757 8056377553
1758 8056875850
1759 8057576683
1760 8057882065

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09349

OHCU_decarbox

OHCU decarboxylase

11

170

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z5m-assembly1.cif.gz_D crystal structure of (s)-allantoin synthase 0.9364 14 173
5z5m-assembly1.cif.gz_A crystal structure of (s)-allantoin synthase 0.9346 14 173
5z5m-assembly1.cif.gz_B crystal structure of (s)-allantoin synthase 0.9094 14 173
2o8i-assembly1.cif.gz_A-2 crystal structure of protein atu2327 from agrobacterium tumefaciens str. c58 0.8955 12 176
2o8i-assembly1.cif.gz_A-2 crystal structure of protein atu2327 from agrobacterium tumefaciens str. c58 0.8901 12 176
ID Description Score Start End Superfamily
2o8iA00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8965 13 176 1.10.3330.10
2o8iA00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.891 13 176 1.10.3330.10
2o70F00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8688 13 172 1.10.3330.10
2o70F00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8118 13 172 1.10.3330.10
3o7iB00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.7947 13 173 1.10.3330.10
ID Description Score Start End GO Terms
AF-A0A4Q3YCL0-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9879 104 175 GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A4Q3YCL0-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9745 104 175 GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A644V0B9-F1-model_v4 NodB homology domain-containing protein 0.9396 12 174 GO:0000255
GO:0005975
GO:0006144
GO:0016810
GO:0019628
GO:0051997
AF-A0A2T5B185-F1-model_v4 Ureidoglycolate lyase (EC 4.3.2.3) (Ureidoglycolatase) 0.9353 13 176 GO:0000256
GO:0004848
GO:0005777
GO:0006145
GO:0019628
GO:0050385
GO:0051997
AF-A0A259D081-F1-model_v4 Chitooligosaccharide deacetylase (Nodulation protein B) 0.9335 12 174 GO:0000255
GO:0005975
GO:0006144
GO:0016810
GO:0019628
GO:0051997

Map