F484477

General Info

Members Datasets Scaffolds Average Seq Length
880 368 1760 368

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10015684|rootH1_100156842
Length 397
Sequence MRSGIHPLALSLSKGCSAWLRRGFDKLSPNGVWAVLMAVALLGGCASSSKPKPTPLDPLTPTVTPKQIWNSRIDAVQYPLTVAVVGNAFTLAGSDGSVLALDADSGRELWRANAGAKLSAGVGTDGRFAAVVTRDGELIVFEQGQVKWRKPLSARVTTAPLVAGERVFVVGVDRIVRAFDALDGRRIWTLQRPSDPLTLAQAGVLVPFKDTLVVGQGPRMVGVDPTAGTVRWDVPVGSPRGANEIERLADLVAPSARVGNLICARSFQAAVGCVDAQRGATVWSRNIGGTDGVAADAEFVFAADATDRLTAWKTPSGDVAWTSDKYLYRGMSAPVIFGKSVVFGDVEGTVHWFARDTGEAQARQTTDGSAIVTAPVVAGSTMLVVTKNGGLYAYRQP

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
120 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
121 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
181 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
182 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
191 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
192 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
202 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
226 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
227 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
228 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
229 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
230 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
231 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
232 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
233 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
234 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
235 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
236 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
237 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
259 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
260 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
261 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
303 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
304 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
305 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
317 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
318 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
319 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
320 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
323 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
324 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
325 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
326 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
329 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
330 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
331 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
332 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
333 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
334 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
337 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
338 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 2547132374 Acidovorax radicis N35 Isolate Unclassified
341 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
342 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
343 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
344 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
345 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
346 2643221570 Acidovorax sp. Root568 Isolate Unclassified
347 2643221585 Pelomonas sp. Root662 Isolate Unclassified
348 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
349 2643221596 Acidovorax sp. Root70 Isolate Unclassified
350 2643221609 Acidovorax sp. Root217 Isolate Unclassified
351 2643221611 Acidovorax sp. Root219 Isolate Unclassified
352 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
353 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
354 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
355 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
356 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
357 2643221652 Acidovorax sp. Root402 Isolate Unclassified
358 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
359 2643221656 Pelomonas sp. Root405 Isolate Unclassified
360 2643221717 Acidovorax sp. Root267 Isolate Unclassified
361 2738541337 Pelomonas sp. BT06 Isolate Unclassified
362 2738543012 Acidovorax sp. CF301 Isolate Unclassified
363 2816332133 Acidovorax radicis 2721A Isolate Unclassified
364 2831864461 Roseateles noduli HZ7 Isolate Nodule
365 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
366 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
367 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
368 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0.68
Isolates 3.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.93
Nodule 0.57
Rhizoplane 2.73
Rhizosphere 69.43
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10015684 3300003316 Bacteria 2826
2 JGI25156J39149_1000581 3300002705 Bacteria 20815
3 JGI25157J39369_1000163 3300002741 Bacteria 55914
4 JGI25152J39213_1002264 3300002773 Bacteria 7426
5 JGI25153J46596_10009871 3300003215 Bacteria 4380
6 JGI25153J46596_10012943 3300003215 Bacteria 3561
7 rootH1_10025577 3300003316 Bacteria 4801
8 rootH1_10027067 3300003316 Bacteria 3617
9 rootH2_10011660 3300003320 Bacteria 8700
10 rootH2_10029880 3300003320 Bacteria 4608
11 rootL2_10000980 3300003322 Bacteria 20057
12 rootL2_10045989 3300003322 Bacteria 5182
13 rootL2_10259464 3300003322 Bacteria 2440
14 rootL2_10274554 3300003322 Bacteria 1247
15 rootL2_10321793 3300003322 Bacteria 1967
16 rootH1_10011477 3300003323 Bacteria 2676
17 rootH1_10036624 3300003323 Bacteria 4780
18 rootH1_10047957 3300003323 Bacteria 2722
19 rootH1_10058315 3300003323 Bacteria 2654
20 rootH1_10058316 3300003323 Bacteria 3331
21 rootH1_10141431 3300003323 Bacteria 2562
22 JGI26128J50194_1000130 3300003347 Bacteria 3187
23 Ga0055539_1000603 3300003752 Bacteria 9936
24 Ga0055539_1000826 3300003752 Bacteria 7281
25 Ga0055533_1000006 3300003756 Bacteria 635559
26 Ga0055525_1000026 3300003759 Bacteria 345798
27 Ga0055525_1000677 3300003759 Bacteria 12912
28 Ga0055535_1000881 3300003761 Bacteria 20958
29 Ga0055529_1000175 3300003763 Bacteria 87829
30 Ga0055526_1010561 3300003771 Bacteria 4278
31 Ga0055524_1000175 3300003775 Bacteria 72850
32 Ga0055524_1020352 3300003775 Bacteria 2237
33 Ga0055530_10005340 3300003791 Bacteria 6149
34 Ga0055540_1000062 3300003792 Bacteria 128474
35 Ga0055531_10000823 3300003794 Bacteria 25703
36 Ga0055531_10010250 3300003794 Bacteria 4685
37 Ga0055531_10024473 3300003794 Bacteria 2227
38 Ga0055531_10025337 3300003794 Bacteria 2158
39 Ga0055543_1002639 3300004625 Bacteria 5769
40 Ga0065165_1000006 3300005262 Bacteria 352298
41 Ga0065165_1002955 3300005262 Bacteria 12945
42 Ga0065165_1003031 3300005262 Bacteria 12647
43 Ga0070658_10016622 3300005327 Bacteria 5888
44 Ga0070658_10092351 3300005327 Bacteria 2496
45 Ga0070658_10100106 3300005327 Bacteria 2395
46 Ga0070658_10126284 3300005327 Bacteria 2129
47 Ga0070658_10157061 3300005327 Bacteria 1907
48 Ga0070676_10004487 3300005328 Bacteria 7346
49 Ga0070676_10007485 3300005328 Bacteria 5861
50 Ga0070676_10010804 3300005328 Bacteria 4953
51 Ga0070683_100024422 3300005329 Bacteria 5414
52 Ga0070683_100045692 3300005329 Bacteria 4043
53 Ga0070683_100083823 3300005329 Bacteria 2986
54 Ga0070690_100006323 3300005330 Bacteria 6717
55 Ga0070690_100025841 3300005330 Bacteria 3618
56 Ga0070690_100214400 3300005330 Bacteria 1346
57 Ga0070670_100011707 3300005331 Bacteria 7503
58 Ga0070670_100028084 3300005331 Bacteria 4841
59 Ga0070670_100099798 3300005331 Bacteria 2498
60 Ga0070670_100156408 3300005331 Bacteria 1974
61 Ga0070677_10005950 3300005333 Bacteria 4042
62 Ga0070677_10008103 3300005333 Bacteria 3526
63 Ga0068869_100006760 3300005334 Bacteria 7289
64 Ga0068869_100009857 3300005334 Bacteria 6204
65 Ga0068869_100013849 3300005334 Bacteria 5376
66 Ga0068869_100015658 3300005334 Bacteria 5093
67 Ga0070666_10009854 3300005335 Bacteria 5965
68 Ga0070666_10099867 3300005335 Bacteria 1999
69 Ga0070682_100045865 3300005337 Bacteria 2711
70 Ga0068868_100015136 3300005338 Bacteria 5699
71 Ga0068868_100015986 3300005338 Bacteria 5564
72 Ga0068868_100024050 3300005338 Bacteria 4618
73 Ga0070660_100038551 3300005339 Bacteria 3628
74 Ga0070689_100163417 3300005340 Bacteria 1801
75 Ga0070687_100006756 3300005343 Bacteria 4728
76 Ga0070661_100000264 3300005344 Bacteria 43037
77 Ga0070661_100007118 3300005344 Bacteria 7718
78 Ga0070661_100109713 3300005344 Bacteria 2059
79 Ga0070692_10081509 3300005345 Bacteria 1744
80 Ga0070668_100003264 3300005347 Bacteria 11958
81 Ga0070668_100038465 3300005347 Bacteria 3656
82 Ga0070668_100054526 3300005347 Bacteria 3084
83 Ga0070668_100289283 3300005347 Bacteria 1371
84 Ga0070669_100006416 3300005353 Bacteria 8464
85 Ga0070669_100023264 3300005353 Bacteria 4438
86 Ga0070669_100032799 3300005353 Bacteria 3752
87 Ga0070669_100047550 3300005353 Bacteria 3130
88 Ga0070675_100007196 3300005354 Bacteria 8576
89 Ga0070675_100010823 3300005354 Bacteria 7134
90 Ga0070675_100013850 3300005354 Bacteria 6349
91 Ga0070675_100028234 3300005354 Bacteria 4515
92 Ga0070675_100041764 3300005354 Bacteria 3746
93 Ga0070675_100050429 3300005354 Bacteria 3417
94 Ga0070675_100090433 3300005354 Bacteria 2564
95 Ga0070675_100111612 3300005354 Bacteria 2314
96 Ga0070671_100003736 3300005355 Bacteria 11951
97 Ga0070671_100012623 3300005355 Bacteria 6809
98 Ga0070671_100023315 3300005355 Bacteria 5064
99 Ga0070671_100025218 3300005355 Bacteria 4877
100 Ga0070671_100044580 3300005355 Bacteria 3685
101 Ga0070671_100070828 3300005355 Bacteria 2909
102 Ga0070671_100075778 3300005355 Bacteria 2811
103 Ga0070671_100174448 3300005355 Bacteria 1818
104 Ga0070671_100229158 3300005355 Bacteria 1576
105 Ga0070671_100250306 3300005355 Unclassified 1505
106 Ga0070674_100000872 3300005356 Bacteria 15687
107 Ga0070674_100007044 3300005356 Bacteria 6610
108 Ga0070674_100014286 3300005356 Bacteria 4934
109 Ga0070674_100075626 3300005356 Bacteria 2392
110 Ga0070674_100263364 3300005356 Bacteria 1359
111 Ga0070673_100002229 3300005364 Bacteria 11725
112 Ga0070673_100002506 3300005364 Bacteria 11201
113 Ga0070673_100055860 3300005364 Bacteria 3112
114 Ga0070673_100056823 3300005364 Bacteria 3089
115 Ga0070673_100083713 3300005364 Bacteria 2592
116 Ga0070673_100089865 3300005364 Bacteria 2508
117 Ga0070673_100153751 3300005364 Bacteria 1950
118 Ga0070673_100169270 3300005364 Bacteria 1864
119 Ga0070688_100150388 3300005365 Bacteria 1591
120 Ga0070659_100000798 3300005366 Bacteria 22978
121 Ga0070659_100004438 3300005366 Bacteria 10024
122 Ga0070659_100008843 3300005366 Bacteria 7379
123 Ga0070667_100001505 3300005367 Bacteria 20850
124 Ga0070667_100022532 3300005367 Bacteria 5222
125 Ga0070667_100033625 3300005367 Bacteria 4287
126 Ga0070667_100316638 3300005367 Bacteria 1407
127 Ga0070701_10016840 3300005438 Bacteria 3406
128 Ga0070663_100002931 3300005455 Bacteria 9711
129 Ga0070663_100006397 3300005455 Bacteria 7082
130 Ga0070663_100053479 3300005455 Bacteria 2883
131 Ga0070663_100133738 3300005455 Bacteria 1886
132 Ga0070678_100010708 3300005456 Bacteria 5615
133 Ga0070678_100037384 3300005456 Bacteria 3409
134 Ga0070662_100004274 3300005457 Bacteria 9015
135 Ga0070662_100011800 3300005457 Bacteria 5773
136 Ga0070662_100030909 3300005457 Bacteria 3752
137 Ga0070662_100072979 3300005457 Bacteria 2535
138 Ga0070662_100091378 3300005457 Bacteria 2286
139 Ga0068867_100000175 3300005459 Bacteria 41852
140 Ga0068867_100000820 3300005459 Bacteria 20957
141 Ga0068867_100004786 3300005459 Bacteria 9528
142 Ga0068867_100006286 3300005459 Bacteria 8400
143 Ga0068867_100024053 3300005459 Bacteria 4364
144 Ga0068867_100033157 3300005459 Bacteria 3738
145 Ga0068867_100057584 3300005459 Bacteria 2878
146 Ga0068867_100107576 3300005459 Bacteria 2137
147 Ga0068867_100212214 3300005459 Bacteria 1555
148 Ga0070706_100000212 3300005467 Bacteria 71525
149 Ga0070698_100108940 3300005471 Bacteria 2737
150 Ga0070679_100000691 3300005530 Bacteria 28927
151 Ga0070679_100102950 3300005530 Bacteria 2841
152 Ga0068853_100052483 3300005539 Bacteria 3512
153 Ga0068853_100124447 3300005539 Bacteria 2303
154 Ga0070672_100002531 3300005543 Bacteria 11641
155 Ga0070672_100017803 3300005543 Bacteria 5121
156 Ga0070672_100017849 3300005543 Bacteria 5116
157 Ga0070672_100082281 3300005543 Bacteria 2583
158 Ga0070672_100155527 3300005543 Bacteria 1894
159 Ga0070672_100294319 3300005543 Bacteria 1375
160 Ga0070693_100044860 3300005547 Bacteria 2503
161 Ga0070665_100018978 3300005548 Bacteria 6898
162 Ga0068855_100011038 3300005563 Bacteria 10902
163 Ga0068855_100097732 3300005563 Bacteria 3382
164 Ga0070664_100003853 3300005564 Bacteria 12108
165 Ga0070664_100014573 3300005564 Bacteria 6413
166 Ga0070664_100047862 3300005564 Bacteria 3614
167 Ga0070664_100088741 3300005564 Bacteria 2673
168 Ga0070664_100092220 3300005564 Bacteria 2622
169 Ga0068857_100020499 3300005577 Bacteria 5815
170 Ga0068857_100113306 3300005577 Bacteria 2438
171 Ga0068854_100001430 3300005578 Bacteria 14430
172 Ga0068854_100055949 3300005578 Bacteria 2842
173 Ga0068854_100061535 3300005578 Bacteria 2720
174 Ga0068856_100001213 3300005614 Bacteria 27067
175 Ga0068856_100008607 3300005614 Bacteria 9922
176 Ga0068852_100034935 3300005616 Bacteria 4187
177 Ga0068852_100067623 3300005616 Bacteria 3124
178 Ga0068852_100072433 3300005616 Bacteria 3028
179 Ga0068852_100108043 3300005616 Bacteria 2525
180 Ga0068852_100111780 3300005616 Bacteria 2485
181 Ga0068852_100147546 3300005616 Bacteria 2183
182 Ga0068859_100060368 3300005617 Bacteria 3821
183 Ga0068859_100069869 3300005617 Bacteria 3547
184 Ga0068859_100113840 3300005617 Bacteria 2769
185 Ga0068859_100275256 3300005617 Bacteria 1776
186 Ga0068864_100002247 3300005618 Bacteria 15969
187 Ga0068864_100014624 3300005618 Bacteria 6518
188 Ga0068864_100031800 3300005618 Bacteria 4479
189 Ga0068864_100036248 3300005618 Bacteria 4203
190 Ga0068864_100093790 3300005618 Bacteria 2652
191 Ga0068864_100104651 3300005618 Bacteria 2514
192 Ga0068866_10067699 3300005718 Bacteria 1875
193 Ga0068866_10084098 3300005718 Bacteria 1716
194 Ga0068861_100000343 3300005719 Bacteria 26498
195 Ga0068861_100006489 3300005719 Bacteria 7972
196 Ga0068861_100038625 3300005719 Bacteria 3558
197 Ga0068861_100043773 3300005719 Bacteria 3363
198 Ga0068861_100054344 3300005719 Bacteria 3050
199 Ga0068861_100155337 3300005719 Bacteria 1881
200 Ga0068861_100161480 3300005719 Bacteria 1849
201 Ga0068851_10002903 3300005834 Bacteria 7573
202 Ga0068851_10009782 3300005834 Bacteria 4466
203 Ga0068851_10018574 3300005834 Bacteria 3350
204 Ga0068870_10061740 3300005840 Bacteria 2016
205 Ga0068863_100007447 3300005841 Bacteria 10712
206 Ga0068863_100062745 3300005841 Bacteria 3514
207 Ga0068863_100103524 3300005841 Bacteria 2708
208 Ga0068858_100001875 3300005842 Bacteria 21440
209 Ga0068858_100002875 3300005842 Bacteria 17315
210 Ga0068858_100005928 3300005842 Bacteria 11931
211 Ga0068858_100266324 3300005842 Bacteria 1630
212 Ga0068860_100000707 3300005843 Bacteria 38265
213 Ga0068860_100000715 3300005843 Bacteria 37986
214 Ga0068860_100006018 3300005843 Bacteria 12209
215 Ga0068860_100120930 3300005843 Bacteria 2507
216 Ga0068860_100132386 3300005843 Bacteria 2394
217 Ga0068862_100047844 3300005844 Bacteria 3650
218 Ga0068862_100048239 3300005844 Bacteria 3636
219 Ga0068862_100053491 3300005844 Bacteria 3456
220 Ga0075365_10009206 3300006038 Bacteria 5664
221 Ga0075365_10044561 3300006038 Bacteria 2907
222 Ga0075368_10005570 3300006042 Bacteria 4339
223 Ga0075368_10026244 3300006042 Bacteria 2241
224 Ga0075363_100112717 3300006048 Bacteria 1513
225 Ga0075364_10009703 3300006051 Bacteria 5785
226 Ga0075364_10043054 3300006051 Bacteria 2935
227 Ga0075362_10006087 3300006177 Bacteria 4469
228 Ga0075362_10014577 3300006177 Bacteria 3175
229 Ga0075367_10002841 3300006178 Bacteria 8043
230 Ga0075367_10021959 3300006178 Bacteria 3573
231 Ga0075367_10022933 3300006178 Bacteria 3507
232 Ga0075367_10055639 3300006178 Bacteria 2349
233 Ga0075369_10012396 3300006186 Bacteria 3368
234 Ga0075369_10016575 3300006186 Bacteria 2976
235 Ga0075366_10000822 3300006195 Bacteria 14915
236 Ga0075366_10002910 3300006195 Bacteria 8897
237 Ga0075366_10023388 3300006195 Bacteria 3599
238 Ga0075366_10027415 3300006195 Bacteria 3342
239 Ga0075366_10028537 3300006195 Bacteria 3275
240 Ga0075366_10031525 3300006195 Bacteria 3120
241 Ga0075366_10063815 3300006195 Bacteria 2190
242 Ga0075366_10077598 3300006195 Bacteria 1982
243 Ga0075366_10105294 3300006195 Bacteria 1695
244 Ga0075366_10118128 3300006195 Bacteria 1597
245 Ga0097621_100034144 3300006237 Bacteria 4055
246 Ga0075370_10000245 3300006353 Bacteria 19479
247 Ga0075370_10000373 3300006353 Bacteria 16463
248 Ga0075370_10001845 3300006353 Bacteria 9489
249 Ga0075370_10003141 3300006353 Bacteria 7799
250 Ga0075370_10006552 3300006353 Bacteria 5865
251 Ga0075370_10007745 3300006353 Bacteria 5485
252 Ga0075370_10030190 3300006353 Bacteria 3023
253 Ga0075370_10040177 3300006353 Bacteria 2638
254 Ga0075370_10041160 3300006353 Bacteria 2608
255 Ga0075370_10048362 3300006353 Bacteria 2409
256 Ga0075370_10086367 3300006353 Bacteria 1807
257 Ga0075370_10116508 3300006353 Bacteria 1553
258 Ga0068871_100007319 3300006358 Bacteria 7878
259 Ga0068871_100051943 3300006358 Bacteria 3318
260 Ga0068871_100077187 3300006358 Bacteria 2753
261 Ga0075430_100030832 3300006846 Bacteria 4554
262 Ga0075429_100003825 3300006880 Bacteria 12856
263 Ga0075429_100044687 3300006880 Bacteria 3853
264 Ga0068865_100007045 3300006881 Bacteria 6901
265 Ga0068865_100062800 3300006881 Bacteria 2608
266 Ga0068865_100097476 3300006881 Bacteria 2146
267 Ga0097620_100060368 3300006931 Bacteria 3821
268 Ga0097620_100069871 3300006931 Bacteria 3547
269 Ga0097620_100113838 3300006931 Bacteria 2769
270 Ga0097620_100275236 3300006931 Bacteria 1776
271 Ga0099823_1001245 3300006944 Bacteria 20453
272 Ga0079104_1000186 3300006946 Bacteria 87104
273 Ga0105240_10007877 3300009093 Bacteria 15365
274 Ga0105240_10018656 3300009093 Bacteria 9298
275 Ga0105240_10203719 3300009093 Bacteria 2317
276 Ga0105240_10276166 3300009093 Bacteria 1933
277 Ga0105245_10044542 3300009098 Bacteria 3961
278 Ga0105245_10045165 3300009098 Bacteria 3933
279 Ga0105245_10058026 3300009098 Bacteria 3483
280 Ga0105243_10000770 3300009148 Bacteria 30670
281 Ga0105243_10071375 3300009148 Bacteria 2807
282 Ga0105243_10207955 3300009148 Bacteria 1721
283 Ga0105248_10002863 3300009177 Bacteria 19149
284 Ga0105248_10003419 3300009177 Bacteria 17638
285 Ga0105248_10040203 3300009177 Bacteria 5243
286 Ga0105248_10103094 3300009177 Bacteria 3215
287 Ga0105248_10252975 3300009177 Bacteria 1983
288 Ga0105237_10000367 3300009545 Bacteria 63983
289 Ga0105237_10010721 3300009545 Bacteria 9723
290 Ga0105238_10009305 3300009551 Bacteria 9837
291 Ga0105238_10019763 3300009551 Bacteria 6858
292 Ga0105238_10080890 3300009551 Bacteria 3238
293 Ga0105249_10030174 3300009553 Bacteria 4900
294 Ga0105239_10000150 3300010375 Bacteria 100349
295 Ga0105239_10019576 3300010375 Bacteria 7471
296 Ga0157319_1000009 3300012497 Bacteria 227971
297 Ga0157371_10216460 3300013102 Bacteria 1375
298 Ga0157369_10006554 3300013105 Bacteria 13478
299 Ga0157369_10131752 3300013105 Bacteria 2649
300 Ga0157369_10167164 3300013105 Bacteria 2319
301 Ga0157374_10004558 3300013296 Bacteria 11622
302 Ga0157374_10050751 3300013296 Bacteria 3857
303 Ga0157374_10066719 3300013296 Bacteria 3382
304 Ga0157374_10148076 3300013296 Bacteria 2281
305 Ga0157378_10009725 3300013297 Bacteria 8376
306 Ga0157378_10168281 3300013297 Bacteria 2054
307 Ga0163162_10002501 3300013306 Bacteria 17377
308 Ga0163162_10005242 3300013306 Bacteria 12495
309 Ga0163162_10064153 3300013306 Bacteria 3718
310 Ga0163162_10066285 3300013306 Bacteria 3659
311 Ga0163162_10511524 3300013306 Bacteria 1331
312 Ga0157372_10033047 3300013307 Bacteria 5678
313 Ga0157375_10001357 3300013308 Bacteria 21138
314 Ga0157375_10069367 3300013308 Bacteria 3531
315 Ga0157375_10075576 3300013308 Bacteria 3394
316 Ga0157375_10084089 3300013308 Bacteria 3230
317 Ga0157375_10183926 3300013308 Bacteria 2242
318 Ga0157380_10051418 3300014326 Bacteria 3259
319 Ga0157377_10000014 3300014745 Bacteria 213961
320 Ga0157377_10026579 3300014745 Bacteria 3099
321 Ga0157379_10000528 3300014968 Bacteria 30947
322 Ga0157379_10000717 3300014968 Bacteria 26869
323 Ga0157379_10004404 3300014968 Bacteria 12063
324 Ga0157379_10016935 3300014968 Bacteria 6412
325 Ga0157379_10066823 3300014968 Bacteria 3215
326 Ga0157379_10146152 3300014968 Bacteria 2132
327 Ga0157379_10288325 3300014968 Bacteria 1495
328 Ga0157376_10026261 3300014969 Bacteria 4599
329 Ga0157376_10026355 3300014969 Bacteria 4593
330 Ga0157376_10284085 3300014969 Bacteria 1560
331 Ga0182007_10030022 3300015262 Bacteria 1859
332 Ga0163161_10017116 3300017792 Bacteria 5071
333 Ga0163161_10042390 3300017792 Bacteria 3273
334 Ga0163161_10043582 3300017792 Bacteria 3231
335 Ga0163161_10052347 3300017792 Bacteria 2959
336 Ga0213872_10000004 3300021361 Bacteria 306230
337 Ga0213872_10000016 3300021361 Bacteria 180524
338 Ga0213872_10021606 3300021361 Bacteria 2965
339 Ga0209674_100003 3300025226 Bacteria 2196646
340 Ga0209563_100005 3300025230 Bacteria 1774893
341 Ga0209563_100010 3300025230 Bacteria 1337457
342 Ga0207427_101024 3300025231 Bacteria 11685
343 Ga0209258_100060 3300025242 Bacteria 319881
344 Ga0209258_100482 3300025242 Bacteria 41643
345 Ga0207425_1000596 3300025245 Bacteria 20990
346 Ga0209646_1000242 3300025246 Bacteria 56037
347 Ga0209026_1000311 3300025250 Bacteria 52155
348 Ga0209677_100274 3300025253 Bacteria 34497
349 Ga0209677_100396 3300025253 Bacteria 26411
350 Ga0209759_1000373 3300025256 Bacteria 56051
351 Ga0209759_1001241 3300025256 Bacteria 15482
352 Ga0209759_1001792 3300025256 Bacteria 10886
353 Ga0209759_1011322 3300025256 Bacteria 2542
354 Ga0209129_1000148 3300025258 Bacteria 114559
355 Ga0209455_1000093 3300025272 Bacteria 220487
356 Ga0209673_1014079 3300025273 Bacteria 3116
357 Ga0209673_1030300 3300025273 Bacteria 1706
358 Ga0209675_1007295 3300025291 Bacteria 4271
359 Ga0209564_1000003 3300025295 Bacteria 1585848
360 Ga0209564_1000251 3300025295 Bacteria 114511
361 Ga0209758_1000387 3300025297 Bacteria 76099
362 Ga0209758_1000439 3300025297 Bacteria 69980
363 Ga0209050_1001091 3300025298 Bacteria 32964
364 Ga0209050_1003695 3300025298 Bacteria 11025
365 Ga0209050_1008655 3300025298 Bacteria 5377
366 Ga0209256_1000024 3300025299 Bacteria 448909
367 Ga0209256_1003497 3300025299 Bacteria 10949
368 Ga0209256_1029936 3300025299 Bacteria 1509
369 Ga0209051_1000063 3300025303 Bacteria 249739
370 Ga0209051_1000674 3300025303 Bacteria 38231
371 Ga0209051_1007021 3300025303 Bacteria 6237
372 Ga0209051_1009412 3300025303 Bacteria 5041
373 Ga0209051_1013119 3300025303 Bacteria 3962
374 Ga0209257_1000118 3300025304 Bacteria 225963
375 Ga0209257_1000354 3300025304 Bacteria 93718
376 Ga0209257_1001690 3300025304 Bacteria 24813
377 Ga0209257_1005187 3300025304 Bacteria 9375
378 Ga0207697_10026681 3300025315 Bacteria 2362
379 Ga0207656_10033570 3300025321 Bacteria 2139
380 Ga0207682_10007000 3300025893 Bacteria 4520
381 Ga0207682_10019819 3300025893 Bacteria 2636
382 Ga0207642_10009348 3300025899 Bacteria 3406
383 Ga0207680_10024481 3300025903 Bacteria 3314
384 Ga0207645_10005371 3300025907 Bacteria 9312
385 Ga0207645_10006398 3300025907 Bacteria 8458
386 Ga0207645_10011247 3300025907 Bacteria 6121
387 Ga0207645_10012047 3300025907 Bacteria 5879
388 Ga0207643_10054635 3300025908 Bacteria 2270
389 Ga0207705_10041475 3300025909 Bacteria 3302
390 Ga0207705_10070454 3300025909 Bacteria 2534
391 Ga0207705_10101472 3300025909 Bacteria 2117
392 Ga0207705_10106674 3300025909 Bacteria 2066
393 Ga0207705_10109683 3300025909 Bacteria 2038
394 Ga0207684_10031655 3300025910 Bacteria 4499
395 Ga0207695_10022061 3300025913 Bacteria 7244
396 Ga0207695_10080409 3300025913 Bacteria 3300
397 Ga0207695_10214074 3300025913 Bacteria 1836
398 Ga0207671_10000808 3300025914 Bacteria 39539
399 Ga0207671_10051031 3300025914 Bacteria 3064
400 Ga0207660_10127668 3300025917 Bacteria 1932
401 Ga0207657_10025575 3300025919 Bacteria 5440
402 Ga0207657_10034414 3300025919 Bacteria 4556
403 Ga0207657_10069954 3300025919 Bacteria 2976
404 Ga0207657_10155427 3300025919 Bacteria 1860
405 Ga0207649_10002218 3300025920 Bacteria 10971
406 Ga0207649_10208085 3300025920 Unclassified 1386
407 Ga0207681_10003342 3300025923 Bacteria 10045
408 Ga0207681_10004604 3300025923 Bacteria 8484
409 Ga0207681_10040916 3300025923 Bacteria 3087
410 Ga0207681_10060654 3300025923 Bacteria 2597
411 Ga0207681_10268752 3300025923 Bacteria 1338
412 Ga0207694_10011050 3300025924 Bacteria 6820
413 Ga0207694_10018782 3300025924 Bacteria 5226
414 Ga0207694_10025116 3300025924 Bacteria 4527
415 Ga0207650_10000913 3300025925 Bacteria 22271
416 Ga0207650_10002352 3300025925 Bacteria 13138
417 Ga0207650_10055543 3300025925 Bacteria 2939
418 Ga0207650_10056571 3300025925 Bacteria 2915
419 Ga0207650_10095532 3300025925 Bacteria 2278
420 Ga0207650_10102942 3300025925 Bacteria 2201
421 Ga0207650_10124723 3300025925 Bacteria 2009
422 Ga0207659_10000189 3300025926 Bacteria 36771
423 Ga0207659_10023299 3300025926 Bacteria 4130
424 Ga0207659_10052768 3300025926 Bacteria 2898
425 Ga0207659_10060534 3300025926 Bacteria 2726
426 Ga0207659_10061752 3300025926 Bacteria 2702
427 Ga0207687_10163203 3300025927 Bacteria 1712
428 Ga0207687_10188937 3300025927 Bacteria 1602
429 Ga0207687_10266671 3300025927 Bacteria 1367
430 Ga0207644_10011782 3300025931 Bacteria 5790
431 Ga0207644_10011940 3300025931 Bacteria 5759
432 Ga0207644_10021306 3300025931 Bacteria 4414
433 Ga0207644_10062647 3300025931 Bacteria 2698
434 Ga0207644_10102739 3300025931 Bacteria 2150
435 Ga0207644_10128780 3300025931 Bacteria 1935
436 Ga0207644_10188502 3300025931 Bacteria 1620
437 Ga0207690_10005208 3300025932 Bacteria 7669
438 Ga0207690_10025524 3300025932 Bacteria 3712
439 Ga0207690_10051255 3300025932 Bacteria 2759
440 Ga0207706_10005764 3300025933 Bacteria 11526
441 Ga0207706_10202053 3300025933 Bacteria 1743
442 Ga0207706_10242710 3300025933 Bacteria 1575
443 Ga0207709_10008507 3300025935 Bacteria 5677
444 Ga0207709_10070045 3300025935 Bacteria 2222
445 Ga0207709_10214020 3300025935 Bacteria 1385
446 Ga0207670_10171453 3300025936 Bacteria 1627
447 Ga0207669_10001563 3300025937 Bacteria 9764
448 Ga0207669_10019506 3300025937 Bacteria 3533
449 Ga0207669_10042973 3300025937 Bacteria 2643
450 Ga0207704_10017226 3300025938 Bacteria 3738
451 Ga0207704_10037398 3300025938 Bacteria 2804
452 Ga0207691_10002491 3300025940 Bacteria 18008
453 Ga0207691_10031896 3300025940 Bacteria 4917
454 Ga0207691_10041039 3300025940 Bacteria 4275
455 Ga0207691_10066755 3300025940 Bacteria 3254
456 Ga0207691_10095480 3300025940 Bacteria 2659
457 Ga0207691_10106688 3300025940 Bacteria 2494
458 Ga0207691_10109068 3300025940 Bacteria 2463
459 Ga0207691_10136583 3300025940 Bacteria 2162
460 Ga0207711_10016270 3300025941 Bacteria 6177
461 Ga0207711_10021818 3300025941 Bacteria 5349
462 Ga0207711_10025880 3300025941 Bacteria 4921
463 Ga0207711_10041959 3300025941 Bacteria 3897
464 Ga0207711_10077719 3300025941 Bacteria 2894
465 Ga0207711_10108033 3300025941 Bacteria 2471
466 Ga0207689_10003071 3300025942 Bacteria 15384
467 Ga0207689_10005946 3300025942 Bacteria 10800
468 Ga0207689_10021427 3300025942 Bacteria 5433
469 Ga0207689_10070391 3300025942 Bacteria 2874
470 Ga0207689_10122290 3300025942 Bacteria 2141
471 Ga0207679_10001861 3300025945 Bacteria 13115
472 Ga0207679_10006511 3300025945 Bacteria 7384
473 Ga0207679_10024938 3300025945 Bacteria 4106
474 Ga0207679_10190752 3300025945 Bacteria 1704
475 Ga0207667_10026613 3300025949 Bacteria 6314
476 Ga0207667_10043775 3300025949 Bacteria 4749
477 Ga0207667_10313796 3300025949 Bacteria 1601
478 Ga0207651_10028921 3300025960 Bacteria 3504
479 Ga0207651_10113617 3300025960 Bacteria 2038
480 Ga0207651_10150055 3300025960 Bacteria 1813
481 Ga0207651_10165821 3300025960 Bacteria 1737
482 Ga0207651_10234102 3300025960 Bacteria 1493
483 Ga0207668_10019001 3300025972 Bacteria 4334
484 Ga0207668_10022822 3300025972 Bacteria 4011
485 Ga0207668_10028021 3300025972 Bacteria 3677
486 Ga0207668_10164836 3300025972 Bacteria 1731
487 Ga0207658_10002880 3300025986 Bacteria 12329
488 Ga0207658_10011427 3300025986 Bacteria 6043
489 Ga0207658_10103090 3300025986 Bacteria 2239
490 Ga0207658_10224549 3300025986 Bacteria 1582
491 Ga0207677_10006940 3300026023 Bacteria 6229
492 Ga0207677_10007467 3300026023 Bacteria 6052
493 Ga0207677_10107360 3300026023 Bacteria 2070
494 Ga0207703_10001371 3300026035 Bacteria 22250
495 Ga0207703_10003102 3300026035 Bacteria 14039
496 Ga0207703_10075044 3300026035 Bacteria 2801
497 Ga0207703_10337194 3300026035 Bacteria 1385
498 Ga0207639_10083633 3300026041 Bacteria 2533
499 Ga0207639_10093223 3300026041 Bacteria 2415
500 Ga0207639_10093396 3300026041 Bacteria 2413
501 Ga0207639_10132862 3300026041 Bacteria 2063
502 Ga0207678_10002552 3300026067 Bacteria 16593
503 Ga0207678_10028588 3300026067 Bacteria 4866
504 Ga0207678_10175820 3300026067 Bacteria 1828
505 Ga0207708_10113340 3300026075 Bacteria 2107
506 Ga0207702_10001598 3300026078 Bacteria 22413
507 Ga0207702_10007455 3300026078 Bacteria 9334
508 Ga0207641_10001848 3300026088 Bacteria 20315
509 Ga0207641_10003303 3300026088 Bacteria 14346
510 Ga0207641_10061733 3300026088 Bacteria 3197
511 Ga0207641_10198703 3300026088 Bacteria 1847
512 Ga0207648_10000142 3300026089 Bacteria 71593
513 Ga0207648_10001050 3300026089 Bacteria 30933
514 Ga0207648_10001133 3300026089 Bacteria 29959
515 Ga0207648_10008497 3300026089 Bacteria 9937
516 Ga0207648_10024671 3300026089 Bacteria 5363
517 Ga0207648_10045451 3300026089 Bacteria 3851
518 Ga0207648_10116109 3300026089 Bacteria 2352
519 Ga0207648_10147811 3300026089 Bacteria 2073
520 Ga0207648_10169411 3300026089 Bacteria 1930
521 Ga0207676_10005300 3300026095 Bacteria 9134
522 Ga0207676_10011402 3300026095 Bacteria 6352
523 Ga0207676_10105908 3300026095 Bacteria 2342
524 Ga0207676_10132508 3300026095 Bacteria 2121
525 Ga0207674_10014389 3300026116 Bacteria 8740
526 Ga0207674_10038360 3300026116 Bacteria 4973
527 Ga0207674_10073745 3300026116 Bacteria 3426
528 Ga0207674_10164584 3300026116 Bacteria 2172
529 Ga0207674_10206732 3300026116 Bacteria 1912
530 Ga0207675_100006272 3300026118 Bacteria 11285
531 Ga0207675_100009210 3300026118 Bacteria 9259
532 Ga0207675_100029352 3300026118 Bacteria 5125
533 Ga0207675_100107068 3300026118 Bacteria 2636
534 Ga0207675_100136627 3300026118 Bacteria 2327
535 Ga0207683_10008770 3300026121 Bacteria 8635
536 Ga0207683_10009813 3300026121 Bacteria 8166
537 Ga0207683_10054604 3300026121 Bacteria 3503
538 Ga0207683_10073314 3300026121 Bacteria 3028
539 Ga0207683_10087122 3300026121 Bacteria 2777
540 Ga0207683_10172117 3300026121 Bacteria 1961
541 Ga0207683_10352355 3300026121 Bacteria 1351
542 Ga0207698_10002851 3300026142 Bacteria 10340
543 Ga0207698_10005667 3300026142 Bacteria 7734
544 Ga0207698_10007500 3300026142 Bacteria 6837
545 Ga0207698_10061866 3300026142 Bacteria 2920
546 Ga0207698_10089223 3300026142 Bacteria 2517
547 Ga0207698_10208000 3300026142 Bacteria 1758
548 Ga0207698_10234734 3300026142 Bacteria 1667
549 Ga0209281_1000442 3300027111 Bacteria 59796
550 Ga0209389_1027328 3300027296 Bacteria 4924
551 Ga0209966_1000004 3300027695 Bacteria 108133
552 Ga0209974_10002124 3300027876 Bacteria 7251
553 Ga0268266_10020171 3300028379 Bacteria 5681
554 Ga0268266_10088313 3300028379 Bacteria 2713
555 Ga0268265_10008626 3300028380 Bacteria 6889
556 Ga0268265_10036142 3300028380 Bacteria 3616
557 Ga0268265_10047867 3300028380 Bacteria 3206
558 Ga0268265_10096698 3300028380 Bacteria 2374
559 Ga0268264_10007839 3300028381 Bacteria 8888
560 Ga0268264_10119005 3300028381 Bacteria 2325
561 Ga0265336_10000062 3300028666 Bacteria 101023
562 Ga0307517_10013803 3300028786 Bacteria 10936
563 Ga0307515_10000022 3300028794 Bacteria 404064
564 Ga0307515_10000191 3300028794 Bacteria 149201
565 Ga0307515_10003517 3300028794 Bacteria 32929
566 Ga0307515_10003519 3300028794 Bacteria 32915
567 Ga0307515_10021930 3300028794 Bacteria 11292
568 Ga0307515_10036215 3300028794 Bacteria 7992
569 Ga0307515_10063975 3300028794 Bacteria 5152
570 Ga0307515_10082008 3300028794 Bacteria 4179
571 Ga0307515_10135477 3300028794 Bacteria 2681
572 Ga0307515_10150616 3300028794 Bacteria 2434
573 Ga0307515_10187724 3300028794 Bacteria 1989
574 Ga0265324_10015589 3300029957 Bacteria 2791
575 Ga0307511_10068954 3300030521 Bacteria 2606
576 Ga0307512_10056761 3300030522 Bacteria 3070
577 Ga0307512_10141375 3300030522 Bacteria 1472
578 Ga0265330_10000032 3300031235 Bacteria 130592
579 Ga0265332_10000001 3300031238 Bacteria 863783
580 Ga0265328_10015973 3300031239 Bacteria 2930
581 Ga0265327_10000043 3300031251 Bacteria 285108
582 Ga0265316_10000151 3300031344 Bacteria 76436
583 Ga0307513_10011299 3300031456 Bacteria 11111
584 Ga0307513_10015357 3300031456 Bacteria 9285
585 Ga0307513_10023996 3300031456 Bacteria 7106
586 Ga0307513_10058698 3300031456 Bacteria 4087
587 Ga0307509_10000215 3300031507 Bacteria 92190
588 Ga0307509_10098502 3300031507 Bacteria 2968
589 Ga0307509_10118652 3300031507 Bacteria 2628
590 Ga0307509_10177294 3300031507 Bacteria 2002
591 Ga0307408_100000008 3300031548 Bacteria 456355
592 Ga0307408_100000513 3300031548 Bacteria 33428
593 Ga0307408_100188771 3300031548 Bacteria 1659
594 Ga0307508_10000017 3300031616 Bacteria 203567
595 Ga0307508_10000094 3300031616 Bacteria 104107
596 Ga0307508_10034900 3300031616 Bacteria 4532
597 Ga0307508_10067005 3300031616 Bacteria 3159
598 Ga0307508_10185848 3300031616 Bacteria 1680
599 Ga0307514_10002966 3300031649 Bacteria 16819
600 Ga0307514_10004466 3300031649 Bacteria 12861
601 Ga0265314_10000022 3300031711 Bacteria 297299
602 Ga0307516_10000254 3300031730 Bacteria 68771
603 Ga0307516_10001811 3300031730 Bacteria 29376
604 Ga0307516_10002501 3300031730 Bacteria 24512
605 Ga0307516_10006776 3300031730 Bacteria 13382
606 Ga0307516_10035350 3300031730 Bacteria 5014
607 Ga0307516_10132006 3300031730 Bacteria 2276
608 Ga0307516_10160601 3300031730 Bacteria 1998
609 Ga0307516_10175088 3300031730 Bacteria 1883
610 Ga0307406_10000279 3300031901 Bacteria 30071
611 Ga0307409_100001509 3300031995 Bacteria 11510
612 Ga0307409_100060955 3300031995 Bacteria 2945
613 Ga0307416_100031303 3300032002 Bacteria 4003
614 Ga0307416_100073842 3300032002 Bacteria 2846
615 Ga0307411_10030308 3300032005 Bacteria 3314
616 Ga0307411_10032183 3300032005 Bacteria 3237
617 Ga0307411_10038304 3300032005 Bacteria 3023
618 Ga0307411_10048742 3300032005 Bacteria 2748
619 Ga0307415_100004973 3300032126 Bacteria 6994
620 Ga0307507_10093838 3300033179 Bacteria 2554
621 Ga0307507_10098962 3300033179 Bacteria 2452
622 Ga0307510_10007507 3300033180 Bacteria 12984
623 Ga0307510_10027415 3300033180 Bacteria 6526
624 Ga0307510_10057953 3300033180 Bacteria 4014
625 Ga0373939_0000164 3300035114 Bacteria 18449
626 Ga0373960_0002111 3300035121 Bacteria 4477
627 Ga0373931_0002571 3300035691 Bacteria 8081
628 Ga0373931_0044183 3300035691 Bacteria 2349
629 Ga0373935_0155852 3300035692 Bacteria 1553
630 Ga0373927_0029351 3300035695 Bacteria 3584
631 Ga0373927_0091127 3300035695 Bacteria 1980
632 Ga0373937_0138413 3300036401 Bacteria 2277
633 Ga0373925_0004683 3300037068 Bacteria 10322
634 Ga0373925_0035343 3300037068 Bacteria 3686
635 Ga0373925_0169558 3300037068 Bacteria 1723
636 Ga0395899_0002565 3300037312 Bacteria 14691
637 Ga0395899_0028348 3300037312 Bacteria 4218
638 Ga0395900_0000188 3300037418 Bacteria 99195
639 Ga0395900_0005484 3300037418 Bacteria 13283
640 Ga0395900_0249015 3300037418 Bacteria 1779
641 Ga0395898_0006418 3300037466 Bacteria 12559
642 Ga0395898_0017271 3300037466 Bacteria 7370
643 Ga0395898_0028321 3300037466 Bacteria 5615
644 Ga0395898_0110946 3300037466 Bacteria 2629
645 Ga0395905_0000106 3300037471 Bacteria 140180
646 Ga0395905_0001392 3300037471 Bacteria 29351
647 Ga0395905_0002852 3300037471 Bacteria 18906
648 Ga0395905_0002964 3300037471 Bacteria 18450
649 Ga0395905_0004837 3300037471 Bacteria 13888
650 Ga0395905_0010220 3300037471 Bacteria 9146
651 Ga0395905_0020704 3300037471 Bacteria 6228
652 Ga0395905_0020789 3300037471 Bacteria 6215
653 Ga0395905_0060299 3300037471 Bacteria 3547
654 Ga0395905_0139665 3300037471 Bacteria 2279
655 Ga0395905_0213324 3300037471 Bacteria 1808
656 Ga0395905_0243284 3300037471 Bacteria 1681
657 Ga0395901_0006203 3300038443 Bacteria 12113
658 Ga0395901_0035718 3300038443 Bacteria 5135
659 Ga0395901_0092099 3300038443 Bacteria 3173
660 Ga0395901_0092493 3300038443 Bacteria 3166
661 Ga0395901_0189875 3300038443 Bacteria 2154
662 Ga0436361_0141959 3300039447 Bacteria 3063
663 Ga0436361_0376061 3300039447 Bacteria 200571
664 Ga0436361_0399628 3300039447 Bacteria 3018
665 Ga0436361_0583521 3300039447 Bacteria 71514
666 Ga0451791_1242034 3300041451 Bacteria 1203
667 Ga0451800_1626932 3300041459 Bacteria 1587
668 Ga0439431_0009009 3300041997 Bacteria 2249
669 Ga0439437_001198 3300042000 Bacteria 2718
670 Ga0450919_000269 3300042121 Bacteria 6030
671 Ga0450920_007520 3300042122 Bacteria 1976
672 Ga0450923_001458 3300042125 Bacteria 3139
673 Ga0450891_000891 3300042129 Bacteria 3126
674 Ga0450889_000608 3300042144 Bacteria 3976
675 Ga0439459_0000228 3300042438 Bacteria 6442
676 Ga0439464_0000764 3300042439 Bacteria 6994
677 Ga0439464_0003749 3300042439 Bacteria 3859
678 Ga0450918_000945 3300042531 Bacteria 6076
679 Ga0450893_0005693 3300042532 Bacteria 2007
680 Ga0451577_0001353 3300042876 Bacteria 33109
681 Ga0466969_0000002 3300044656 Bacteria 178693
682 Ga0466969_0007330 3300044656 Bacteria 5863
683 Ga0466969_0009526 3300044656 Bacteria 5147
684 Ga0466969_0037283 3300044656 Bacteria 2452
685 Ga0466965_0002506 3300044683 Bacteria 7817
686 Ga0466965_0014746 3300044683 Bacteria 3701
687 Ga0466965_0064093 3300044683 Bacteria 1839
688 Ga0466965_0081038 3300044683 Bacteria 1641
689 Ga0466966_0001339 3300044684 Bacteria 15826
690 Ga0466966_0007833 3300044684 Bacteria 7070
691 Ga0466966_0015276 3300044684 Bacteria 5077
692 Ga0466966_0020128 3300044684 Bacteria 4391
693 Ga0466961_0008620 3300044693 Bacteria 6498
694 Ga0466961_0026940 3300044693 Bacteria 3696
695 Ga0466961_0090320 3300044693 Bacteria 1934
696 Ga0466963_0074855 3300044694 Bacteria 2284
697 Ga0466963_0144363 3300044694 Bacteria 1650
698 Ga0466964_0002006 3300044706 Bacteria 7158
699 Ga0453684_0006474 3300044712 Bacteria 22221
700 Ga0453684_0083182 3300044712 Bacteria 3984
701 Ga0466971_0001980 3300044719 Bacteria 8667
702 Ga0466968_0017259 3300044735 Bacteria 2883
703 Ga0466970_0044954 3300044765 Bacteria 2351
704 Ga0466970_0140502 3300044765 Bacteria 1330
705 Ga0466959_0001562 3300045049 Bacteria 14096
706 Ga0466959_0004663 3300045049 Bacteria 9223
707 Ga0466959_0008282 3300045049 Bacteria 7343
708 Ga0451576_0079493 3300045051 Bacteria 3412
709 Ga0451576_0087359 3300045051 Bacteria 3243
710 Ga0451576_0271512 3300045051 Bacteria 1773
711 Ga0451576_0334921 3300045051 Bacteria 1584
712 Ga0466967_0026883 3300045976 Bacteria 4776
713 Ga0466967_0339891 3300045976 Bacteria 1451
714 Ga0495592_0001770 3300046454 Bacteria 15193
715 Ga0495638_0042795 3300046460 Bacteria 2860
716 Ga0495650_0008824 3300046471 Bacteria 5825
717 Ga0495650_0021298 3300046471 Bacteria 3138
718 Ga0495580_0033530 3300046472 Bacteria 3699
719 Ga0495639_0046092 3300046475 Bacteria 1973
720 Ga0495585_0005980 3300046492 Bacteria 7613
721 Ga0495583_0000153 3300046506 Bacteria 115755
722 Ga0495606_0002667 3300046507 Bacteria 20265
723 Ga0495606_0029123 3300046507 Bacteria 3882
724 Ga0495610_0026708 3300046512 Bacteria 3079
725 Ga0495610_0073678 3300046512 Bacteria 1586
726 Ga0495620_0022622 3300046515 Bacteria 3024
727 Ga0495632_0022786 3300046519 Bacteria 3352
728 Ga0495632_0072153 3300046519 Bacteria 1657
729 Ga0495643_0020062 3300046522 Bacteria 3861
730 Ga0495654_0000550 3300046530 Bacteria 30238
731 Ga0495586_0022236 3300046535 Bacteria 3383
732 Ga0495598_0035208 3300046537 Bacteria 1432
733 Ga0495597_0010147 3300046542 Bacteria 4614
734 Ga0495625_0005772 3300046660 Bacteria 11192
735 Ga0495625_0013423 3300046660 Bacteria 6584
736 Ga0495625_0043089 3300046660 Bacteria 3275
737 Ga0495658_0010441 3300046683 Bacteria 4646
738 Ga0495658_0088988 3300046683 Bacteria 1826
739 Ga0495658_0115747 3300046683 Bacteria 1616
740 Ga0495658_0168679 3300046683 Bacteria 1353
741 Ga0495649_0002833 3300046694 Bacteria 12031
742 Ga0495649_0013059 3300046694 Bacteria 4803
743 Ga0495660_0031092 3300046810 Bacteria 3004
744 Ga0495660_0038817 3300046810 Bacteria 2646
745 Ga0495676_0056004 3300047321 Bacteria 3121
746 Ga0495687_002210 3300047443 Bacteria 16075
747 Ga0495684_0177860 3300047471 Bacteria 1579
748 Ga0495686_0060940 3300047472 Bacteria 2345
749 Ga0495626_0078352 3300048091 Bacteria 1472
750 Ga0496102_0020879 3300048905 Bacteria 5789
751 Ga0496102_0026281 3300048905 Bacteria 5190
752 Ga0496102_0046041 3300048905 Bacteria 3961
753 Ga0496104_0008841 3300048907 Bacteria 8953
754 Ga0496105_0107002 3300048908 Bacteria 2309
755 Ga0496106_0089601 3300048909 Bacteria 2372
756 Ga0496108_0073683 3300048911 Bacteria 2882
757 Ga0496108_0118426 3300048911 Bacteria 2270
758 Ga0496108_0143944 3300048911 Bacteria 2054
759 Ga0496108_0229757 3300048911 Bacteria 1613
760 Ga0496109_0013396 3300048912 Bacteria 7111
761 Ga0496109_0125200 3300048912 Bacteria 2396
762 Ga0496109_0243456 3300048912 Bacteria 1693
763 Ga0496110_0073096 3300048913 Bacteria 3043
764 Ga0496111_0076891 3300048914 Bacteria 2433
765 Ga0496113_0032000 3300048916 Bacteria 3821
766 Ga0496113_0099656 3300048916 Bacteria 2250
767 Ga0496114_0003382 3300048917 Bacteria 12248
768 Ga0496114_0073018 3300048917 Bacteria 2887
769 Ga0496114_0122684 3300048917 Bacteria 2236
770 Ga0496114_0136188 3300048917 Bacteria 2124
771 Ga0496115_0057989 3300048918 Bacteria 3115
772 Ga0496121_0022752 3300048924 Bacteria 6064
773 Ga0496124_0000151 3300048927 Bacteria 142761
774 Ga0496124_0008805 3300048927 Bacteria 10481
775 Ga0496125_0005971 3300048928 Bacteria 13330
776 Ga0501309_000516 3300049129 Bacteria 3173
777 Ga0501310_000594 3300049130 Bacteria 3185
778 Ga0501305_003384 3300049161 Bacteria 1802
779 Ga0501312_000367 3300049528 Bacteria 3459
780 Ga0501314_000187 3300049530 Bacteria 3350
781 Ga0501322_000294 3300049538 Bacteria 2207
782 Ga0501034_0140259 3300049571 Bacteria 2397
783 Ga0501043_0000141 3300049579 Bacteria 67326
784 Ga0501046_0000047 3300049580 Bacteria 140344
785 Ga0501047_0000058 3300049581 Bacteria 139202
786 Ga0501048_0015863 3300049582 Bacteria 5559
787 Ga0501198_000002 3300049649 Bacteria 197356
788 Ga0501222_000002 3300049662 Bacteria 169093
789 Ga0501262_001512 3300049759 Bacteria 2609
790 Ga0501267_000119 3300049764 Bacteria 5089
791 Ga0501035_0107232 3300049822 Bacteria 2449
792 nmdc:mga03683_10537_c1 3300050489 Bacteria 3317
793 nmdc:mga03683_8491_c1 3300050489 Bacteria 3615
794 nmdc:mga03n38_39797_c1 3300050490 Bacteria 2040
795 nmdc:mga00v17_12324_c1 3300050491 Bacteria 4716
796 nmdc:mga0k408_11200_c1 3300050493 Bacteria 4877
797 nmdc:mga0k408_1236_c1 3300050493 Bacteria 13975
798 nmdc:mga0k408_140890_c1 3300050493 Bacteria 1435
799 nmdc:mga0k408_1461_c1 3300050493 Bacteria 12750
800 nmdc:mga0k408_23800_c1 3300050493 Bacteria 3459
801 nmdc:mga0k408_40389_c1 3300050493 Bacteria 2685
802 nmdc:mga0k408_41303_c1 3300050493 Bacteria 2655
803 nmdc:mga0k408_64737_c1 3300050493 Bacteria 2128
804 nmdc:mga0k408_7522_c1 3300050493 Bacteria 5818
805 nmdc:mga0k408_777_c1 3300050493 Bacteria 17540
806 nmdc:mga06z11_33118_c1 3300050494 Bacteria 2525
807 nmdc:mga06z11_3424_c1 3300050494 Bacteria 6130
808 nmdc:mga07m45_10379_c1 3300050496 Bacteria 4864
809 nmdc:mga07m45_1634_c1 3300050496 Bacteria 10321
810 nmdc:mga07m45_182_c1 3300050496 Bacteria 25233
811 nmdc:mga07m45_34095_c1 3300050496 Bacteria 2828
812 nmdc:mga07m45_43473_c1 3300050496 Bacteria 2519
813 nmdc:mga07m45_44545_c1 3300050496 Bacteria 2491
814 nmdc:mga07m45_4520_c1 3300050496 Bacteria 6814
815 nmdc:mga07m45_58545_c1 3300050496 Bacteria 2180
816 nmdc:mga07m45_61002_c1 3300050496 Bacteria 2136
817 nmdc:mga07m45_843_c1 3300050496 Bacteria 13299
818 nmdc:mga09592_3371_c1 3300050508 Bacteria 12912
819 nmdc:mga0sz30_31849_c1 3300050516 Bacteria 2184
820 Ga0495601_0030415 3300053077 Bacteria 3353
821 Ga0500635_0000033 3300053080 Bacteria 97175
822 Ga0500635_0061116 3300053080 Bacteria 1315
823 Ga0500578_0000002 3300053086 Bacteria 293507
824 Ga0500578_0043483 3300053086 Bacteria 2884
825 Ga0500644_0034098 3300053088 Bacteria 1640
826 Ga0500646_0004313 3300053090 Bacteria 3604
827 Ga0500646_0023026 3300053090 Bacteria 1669
828 Ga0500583_0011260 3300053092 Bacteria 3362
829 Ga0500583_0058658 3300053092 Bacteria 1811
830 Ga0500651_0009619 3300053093 Bacteria 5757
831 Ga0500593_001202 3300053117 Bacteria 9351
832 Ga0500594_0000251 3300053118 Bacteria 12824
833 Ga0500607_034061 3300053121 Bacteria 2790
834 Ga0500623_057724 3300053127 Bacteria 1929
835 Ga0500652_000102 3300053131 Bacteria 33562
836 Ga0500658_0009139 3300053134 Bacteria 3657
837 Ga0500559_0000392 3300053136 Bacteria 31988
838 Ga0500559_0010715 3300053136 Bacteria 3930
839 Ga0500568_0003681 3300053139 Bacteria 8423
840 Ga0500568_0006565 3300053139 Bacteria 5822
841 Ga0500577_0004869 3300053142 Bacteria 3574
842 Ga0500604_0025337 3300053151 Bacteria 1705
843 Ga0500619_000015 3300053154 Bacteria 54620
844 Ga0500622_0002031 3300053156 Bacteria 15103
845 Ga0500622_0007029 3300053156 Bacteria 6438
846 Ga0500634_0044624 3300053161 Bacteria 2400
847 Ga0500636_0044649 3300053177 Bacteria 2613
848 Ga0500645_006937 3300053730 Bacteria 3994
849 Ga0500587_002000 3300053739 Bacteria 2909
850 Ga0590071_000456 3300059421 Bacteria 11882
851 Ga0466962_0004675 3300061719 Bacteria 6574
852 2548500242 2547132374 Bacteria 5530232
853 2587727686 2585428057 Bacteria 6737412
854 2587733061 2585428058 Bacteria 6853932
855 2587755169 2585428062 Bacteria 6842168
856 2588291359 2588253510 Bacteria 6901809
857 2643742681 2643221544 Bacteria 5886209
858 2643864733 2643221570 Bacteria 5103772
859 2643936201 2643221585 Bacteria 5812563
860 2643969506 2643221592 Bacteria 6608788
861 2643991109 2643221596 Bacteria 5006805
862 2644062361 2643221609 Bacteria 6756331
863 2644075581 2643221611 Bacteria 6820941
864 2644143806 2643221625 Bacteria 6512927
865 2644217712 2643221639 Bacteria 6649903
866 2644243144 2643221644 Bacteria 6865017
867 2644258550 2643221646 Bacteria 6433402
868 2644276488 2643221648 Bacteria 6521465
869 2644294036 2643221652 Bacteria 5140275
870 2644304852 2643221654 Bacteria 5273570
871 2644316846 2643221656 Bacteria 5809961
872 2644644441 2643221717 Bacteria 5676132
873 2739056745 2738541337 Bacteria 6183410
874 2739241555 2738543012 Bacteria 7115078
875 2816476190 2816332133 Bacteria 7249298
876 2831866351 2831864461 Bacteria 6502356
877 2881102203 2881101125 Bacteria 4590519
878 2886849624 2886848708 Bacteria 5632523
879 2939636560 2939631187 Bacteria 6118131
880 2990711808 2990710928 Bacteria 5002431
881 rootH1_10015684
882 JGI25156J39149_1000581
883 JGI25157J39369_1000163
884 JGI25152J39213_1002264
885 JGI25153J46596_10009871
886 JGI25153J46596_10012943
887 rootH1_10025577
888 rootH1_10027067
889 rootH2_10011660
890 rootH2_10029880
891 rootL2_10000980
892 rootL2_10045989
893 rootL2_10259464
894 rootL2_10274554
895 rootL2_10321793
896 rootH1_10011477
897 rootH1_10036624
898 rootH1_10047957
899 rootH1_10058315
900 rootH1_10058316
901 rootH1_10141431
902 JGI26128J50194_1000130
903 Ga0055539_1000603
904 Ga0055539_1000826
905 Ga0055533_1000006
906 Ga0055525_1000026
907 Ga0055525_1000677
908 Ga0055535_1000881
909 Ga0055529_1000175
910 Ga0055526_1010561
911 Ga0055524_1000175
912 Ga0055524_1020352
913 Ga0055530_10005340
914 Ga0055540_1000062
915 Ga0055531_10000823
916 Ga0055531_10010250
917 Ga0055531_10024473
918 Ga0055531_10025337
919 Ga0055543_1002639
920 Ga0065165_1000006
921 Ga0065165_1002955
922 Ga0065165_1003031
923 Ga0070658_10016622
924 Ga0070658_10092351
925 Ga0070658_10100106
926 Ga0070658_10126284
927 Ga0070658_10157061
928 Ga0070676_10004487
929 Ga0070676_10007485
930 Ga0070676_10010804
931 Ga0070683_100024422
932 Ga0070683_100045692
933 Ga0070683_100083823
934 Ga0070690_100006323
935 Ga0070690_100025841
936 Ga0070690_100214400
937 Ga0070670_100011707
938 Ga0070670_100028084
939 Ga0070670_100099798
940 Ga0070670_100156408
941 Ga0070677_10005950
942 Ga0070677_10008103
943 Ga0068869_100006760
944 Ga0068869_100009857
945 Ga0068869_100013849
946 Ga0068869_100015658
947 Ga0070666_10009854
948 Ga0070666_10099867
949 Ga0070682_100045865
950 Ga0068868_100015136
951 Ga0068868_100015986
952 Ga0068868_100024050
953 Ga0070660_100038551
954 Ga0070689_100163417
955 Ga0070687_100006756
956 Ga0070661_100000264
957 Ga0070661_100007118
958 Ga0070661_100109713
959 Ga0070692_10081509
960 Ga0070668_100003264
961 Ga0070668_100038465
962 Ga0070668_100054526
963 Ga0070668_100289283
964 Ga0070669_100006416
965 Ga0070669_100023264
966 Ga0070669_100032799
967 Ga0070669_100047550
968 Ga0070675_100007196
969 Ga0070675_100010823
970 Ga0070675_100013850
971 Ga0070675_100028234
972 Ga0070675_100041764
973 Ga0070675_100050429
974 Ga0070675_100090433
975 Ga0070675_100111612
976 Ga0070671_100003736
977 Ga0070671_100012623
978 Ga0070671_100023315
979 Ga0070671_100025218
980 Ga0070671_100044580
981 Ga0070671_100070828
982 Ga0070671_100075778
983 Ga0070671_100174448
984 Ga0070671_100229158
985 Ga0070671_100250306
986 Ga0070674_100000872
987 Ga0070674_100007044
988 Ga0070674_100014286
989 Ga0070674_100075626
990 Ga0070674_100263364
991 Ga0070673_100002229
992 Ga0070673_100002506
993 Ga0070673_100055860
994 Ga0070673_100056823
995 Ga0070673_100083713
996 Ga0070673_100089865
997 Ga0070673_100153751
998 Ga0070673_100169270
999 Ga0070688_100150388
1000 Ga0070659_100000798
1001 Ga0070659_100004438
1002 Ga0070659_100008843
1003 Ga0070667_100001505
1004 Ga0070667_100022532
1005 Ga0070667_100033625
1006 Ga0070667_100316638
1007 Ga0070701_10016840
1008 Ga0070663_100002931
1009 Ga0070663_100006397
1010 Ga0070663_100053479
1011 Ga0070663_100133738
1012 Ga0070678_100010708
1013 Ga0070678_100037384
1014 Ga0070662_100004274
1015 Ga0070662_100011800
1016 Ga0070662_100030909
1017 Ga0070662_100072979
1018 Ga0070662_100091378
1019 Ga0068867_100000175
1020 Ga0068867_100000820
1021 Ga0068867_100004786
1022 Ga0068867_100006286
1023 Ga0068867_100024053
1024 Ga0068867_100033157
1025 Ga0068867_100057584
1026 Ga0068867_100107576
1027 Ga0068867_100212214
1028 Ga0070706_100000212
1029 Ga0070698_100108940
1030 Ga0070679_100000691
1031 Ga0070679_100102950
1032 Ga0068853_100052483
1033 Ga0068853_100124447
1034 Ga0070672_100002531
1035 Ga0070672_100017803
1036 Ga0070672_100017849
1037 Ga0070672_100082281
1038 Ga0070672_100155527
1039 Ga0070672_100294319
1040 Ga0070693_100044860
1041 Ga0070665_100018978
1042 Ga0068855_100011038
1043 Ga0068855_100097732
1044 Ga0070664_100003853
1045 Ga0070664_100014573
1046 Ga0070664_100047862
1047 Ga0070664_100088741
1048 Ga0070664_100092220
1049 Ga0068857_100020499
1050 Ga0068857_100113306
1051 Ga0068854_100001430
1052 Ga0068854_100055949
1053 Ga0068854_100061535
1054 Ga0068856_100001213
1055 Ga0068856_100008607
1056 Ga0068852_100034935
1057 Ga0068852_100067623
1058 Ga0068852_100072433
1059 Ga0068852_100108043
1060 Ga0068852_100111780
1061 Ga0068852_100147546
1062 Ga0068859_100060368
1063 Ga0068859_100069869
1064 Ga0068859_100113840
1065 Ga0068859_100275256
1066 Ga0068864_100002247
1067 Ga0068864_100014624
1068 Ga0068864_100031800
1069 Ga0068864_100036248
1070 Ga0068864_100093790
1071 Ga0068864_100104651
1072 Ga0068866_10067699
1073 Ga0068866_10084098
1074 Ga0068861_100000343
1075 Ga0068861_100006489
1076 Ga0068861_100038625
1077 Ga0068861_100043773
1078 Ga0068861_100054344
1079 Ga0068861_100155337
1080 Ga0068861_100161480
1081 Ga0068851_10002903
1082 Ga0068851_10009782
1083 Ga0068851_10018574
1084 Ga0068870_10061740
1085 Ga0068863_100007447
1086 Ga0068863_100062745
1087 Ga0068863_100103524
1088 Ga0068858_100001875
1089 Ga0068858_100002875
1090 Ga0068858_100005928
1091 Ga0068858_100266324
1092 Ga0068860_100000707
1093 Ga0068860_100000715
1094 Ga0068860_100006018
1095 Ga0068860_100120930
1096 Ga0068860_100132386
1097 Ga0068862_100047844
1098 Ga0068862_100048239
1099 Ga0068862_100053491
1100 Ga0075365_10009206
1101 Ga0075365_10044561
1102 Ga0075368_10005570
1103 Ga0075368_10026244
1104 Ga0075363_100112717
1105 Ga0075364_10009703
1106 Ga0075364_10043054
1107 Ga0075362_10006087
1108 Ga0075362_10014577
1109 Ga0075367_10002841
1110 Ga0075367_10021959
1111 Ga0075367_10022933
1112 Ga0075367_10055639
1113 Ga0075369_10012396
1114 Ga0075369_10016575
1115 Ga0075366_10000822
1116 Ga0075366_10002910
1117 Ga0075366_10023388
1118 Ga0075366_10027415
1119 Ga0075366_10028537
1120 Ga0075366_10031525
1121 Ga0075366_10063815
1122 Ga0075366_10077598
1123 Ga0075366_10105294
1124 Ga0075366_10118128
1125 Ga0097621_100034144
1126 Ga0075370_10000245
1127 Ga0075370_10000373
1128 Ga0075370_10001845
1129 Ga0075370_10003141
1130 Ga0075370_10006552
1131 Ga0075370_10007745
1132 Ga0075370_10030190
1133 Ga0075370_10040177
1134 Ga0075370_10041160
1135 Ga0075370_10048362
1136 Ga0075370_10086367
1137 Ga0075370_10116508
1138 Ga0068871_100007319
1139 Ga0068871_100051943
1140 Ga0068871_100077187
1141 Ga0075430_100030832
1142 Ga0075429_100003825
1143 Ga0075429_100044687
1144 Ga0068865_100007045
1145 Ga0068865_100062800
1146 Ga0068865_100097476
1147 Ga0097620_100060368
1148 Ga0097620_100069871
1149 Ga0097620_100113838
1150 Ga0097620_100275236
1151 Ga0099823_1001245
1152 Ga0079104_1000186
1153 Ga0105240_10007877
1154 Ga0105240_10018656
1155 Ga0105240_10203719
1156 Ga0105240_10276166
1157 Ga0105245_10044542
1158 Ga0105245_10045165
1159 Ga0105245_10058026
1160 Ga0105243_10000770
1161 Ga0105243_10071375
1162 Ga0105243_10207955
1163 Ga0105248_10002863
1164 Ga0105248_10003419
1165 Ga0105248_10040203
1166 Ga0105248_10103094
1167 Ga0105248_10252975
1168 Ga0105237_10000367
1169 Ga0105237_10010721
1170 Ga0105238_10009305
1171 Ga0105238_10019763
1172 Ga0105238_10080890
1173 Ga0105249_10030174
1174 Ga0105239_10000150
1175 Ga0105239_10019576
1176 Ga0157319_1000009
1177 Ga0157371_10216460
1178 Ga0157369_10006554
1179 Ga0157369_10131752
1180 Ga0157369_10167164
1181 Ga0157374_10004558
1182 Ga0157374_10050751
1183 Ga0157374_10066719
1184 Ga0157374_10148076
1185 Ga0157378_10009725
1186 Ga0157378_10168281
1187 Ga0163162_10002501
1188 Ga0163162_10005242
1189 Ga0163162_10064153
1190 Ga0163162_10066285
1191 Ga0163162_10511524
1192 Ga0157372_10033047
1193 Ga0157375_10001357
1194 Ga0157375_10069367
1195 Ga0157375_10075576
1196 Ga0157375_10084089
1197 Ga0157375_10183926
1198 Ga0157380_10051418
1199 Ga0157377_10000014
1200 Ga0157377_10026579
1201 Ga0157379_10000528
1202 Ga0157379_10000717
1203 Ga0157379_10004404
1204 Ga0157379_10016935
1205 Ga0157379_10066823
1206 Ga0157379_10146152
1207 Ga0157379_10288325
1208 Ga0157376_10026261
1209 Ga0157376_10026355
1210 Ga0157376_10284085
1211 Ga0182007_10030022
1212 Ga0163161_10017116
1213 Ga0163161_10042390
1214 Ga0163161_10043582
1215 Ga0163161_10052347
1216 Ga0213872_10000004
1217 Ga0213872_10000016
1218 Ga0213872_10021606
1219 Ga0209674_100003
1220 Ga0209563_100005
1221 Ga0209563_100010
1222 Ga0207427_101024
1223 Ga0209258_100060
1224 Ga0209258_100482
1225 Ga0207425_1000596
1226 Ga0209646_1000242
1227 Ga0209026_1000311
1228 Ga0209677_100274
1229 Ga0209677_100396
1230 Ga0209759_1000373
1231 Ga0209759_1001241
1232 Ga0209759_1001792
1233 Ga0209759_1011322
1234 Ga0209129_1000148
1235 Ga0209455_1000093
1236 Ga0209673_1014079
1237 Ga0209673_1030300
1238 Ga0209675_1007295
1239 Ga0209564_1000003
1240 Ga0209564_1000251
1241 Ga0209758_1000387
1242 Ga0209758_1000439
1243 Ga0209050_1001091
1244 Ga0209050_1003695
1245 Ga0209050_1008655
1246 Ga0209256_1000024
1247 Ga0209256_1003497
1248 Ga0209256_1029936
1249 Ga0209051_1000063
1250 Ga0209051_1000674
1251 Ga0209051_1007021
1252 Ga0209051_1009412
1253 Ga0209051_1013119
1254 Ga0209257_1000118
1255 Ga0209257_1000354
1256 Ga0209257_1001690
1257 Ga0209257_1005187
1258 Ga0207697_10026681
1259 Ga0207656_10033570
1260 Ga0207682_10007000
1261 Ga0207682_10019819
1262 Ga0207642_10009348
1263 Ga0207680_10024481
1264 Ga0207645_10005371
1265 Ga0207645_10006398
1266 Ga0207645_10011247
1267 Ga0207645_10012047
1268 Ga0207643_10054635
1269 Ga0207705_10041475
1270 Ga0207705_10070454
1271 Ga0207705_10101472
1272 Ga0207705_10106674
1273 Ga0207705_10109683
1274 Ga0207684_10031655
1275 Ga0207695_10022061
1276 Ga0207695_10080409
1277 Ga0207695_10214074
1278 Ga0207671_10000808
1279 Ga0207671_10051031
1280 Ga0207660_10127668
1281 Ga0207657_10025575
1282 Ga0207657_10034414
1283 Ga0207657_10069954
1284 Ga0207657_10155427
1285 Ga0207649_10002218
1286 Ga0207649_10208085
1287 Ga0207681_10003342
1288 Ga0207681_10004604
1289 Ga0207681_10040916
1290 Ga0207681_10060654
1291 Ga0207681_10268752
1292 Ga0207694_10011050
1293 Ga0207694_10018782
1294 Ga0207694_10025116
1295 Ga0207650_10000913
1296 Ga0207650_10002352
1297 Ga0207650_10055543
1298 Ga0207650_10056571
1299 Ga0207650_10095532
1300 Ga0207650_10102942
1301 Ga0207650_10124723
1302 Ga0207659_10000189
1303 Ga0207659_10023299
1304 Ga0207659_10052768
1305 Ga0207659_10060534
1306 Ga0207659_10061752
1307 Ga0207687_10163203
1308 Ga0207687_10188937
1309 Ga0207687_10266671
1310 Ga0207644_10011782
1311 Ga0207644_10011940
1312 Ga0207644_10021306
1313 Ga0207644_10062647
1314 Ga0207644_10102739
1315 Ga0207644_10128780
1316 Ga0207644_10188502
1317 Ga0207690_10005208
1318 Ga0207690_10025524
1319 Ga0207690_10051255
1320 Ga0207706_10005764
1321 Ga0207706_10202053
1322 Ga0207706_10242710
1323 Ga0207709_10008507
1324 Ga0207709_10070045
1325 Ga0207709_10214020
1326 Ga0207670_10171453
1327 Ga0207669_10001563
1328 Ga0207669_10019506
1329 Ga0207669_10042973
1330 Ga0207704_10017226
1331 Ga0207704_10037398
1332 Ga0207691_10002491
1333 Ga0207691_10031896
1334 Ga0207691_10041039
1335 Ga0207691_10066755
1336 Ga0207691_10095480
1337 Ga0207691_10106688
1338 Ga0207691_10109068
1339 Ga0207691_10136583
1340 Ga0207711_10016270
1341 Ga0207711_10021818
1342 Ga0207711_10025880
1343 Ga0207711_10041959
1344 Ga0207711_10077719
1345 Ga0207711_10108033
1346 Ga0207689_10003071
1347 Ga0207689_10005946
1348 Ga0207689_10021427
1349 Ga0207689_10070391
1350 Ga0207689_10122290
1351 Ga0207679_10001861
1352 Ga0207679_10006511
1353 Ga0207679_10024938
1354 Ga0207679_10190752
1355 Ga0207667_10026613
1356 Ga0207667_10043775
1357 Ga0207667_10313796
1358 Ga0207651_10028921
1359 Ga0207651_10113617
1360 Ga0207651_10150055
1361 Ga0207651_10165821
1362 Ga0207651_10234102
1363 Ga0207668_10019001
1364 Ga0207668_10022822
1365 Ga0207668_10028021
1366 Ga0207668_10164836
1367 Ga0207658_10002880
1368 Ga0207658_10011427
1369 Ga0207658_10103090
1370 Ga0207658_10224549
1371 Ga0207677_10006940
1372 Ga0207677_10007467
1373 Ga0207677_10107360
1374 Ga0207703_10001371
1375 Ga0207703_10003102
1376 Ga0207703_10075044
1377 Ga0207703_10337194
1378 Ga0207639_10083633
1379 Ga0207639_10093223
1380 Ga0207639_10093396
1381 Ga0207639_10132862
1382 Ga0207678_10002552
1383 Ga0207678_10028588
1384 Ga0207678_10175820
1385 Ga0207708_10113340
1386 Ga0207702_10001598
1387 Ga0207702_10007455
1388 Ga0207641_10001848
1389 Ga0207641_10003303
1390 Ga0207641_10061733
1391 Ga0207641_10198703
1392 Ga0207648_10000142
1393 Ga0207648_10001050
1394 Ga0207648_10001133
1395 Ga0207648_10008497
1396 Ga0207648_10024671
1397 Ga0207648_10045451
1398 Ga0207648_10116109
1399 Ga0207648_10147811
1400 Ga0207648_10169411
1401 Ga0207676_10005300
1402 Ga0207676_10011402
1403 Ga0207676_10105908
1404 Ga0207676_10132508
1405 Ga0207674_10014389
1406 Ga0207674_10038360
1407 Ga0207674_10073745
1408 Ga0207674_10164584
1409 Ga0207674_10206732
1410 Ga0207675_100006272
1411 Ga0207675_100009210
1412 Ga0207675_100029352
1413 Ga0207675_100107068
1414 Ga0207675_100136627
1415 Ga0207683_10008770
1416 Ga0207683_10009813
1417 Ga0207683_10054604
1418 Ga0207683_10073314
1419 Ga0207683_10087122
1420 Ga0207683_10172117
1421 Ga0207683_10352355
1422 Ga0207698_10002851
1423 Ga0207698_10005667
1424 Ga0207698_10007500
1425 Ga0207698_10061866
1426 Ga0207698_10089223
1427 Ga0207698_10208000
1428 Ga0207698_10234734
1429 Ga0209281_1000442
1430 Ga0209389_1027328
1431 Ga0209966_1000004
1432 Ga0209974_10002124
1433 Ga0268266_10020171
1434 Ga0268266_10088313
1435 Ga0268265_10008626
1436 Ga0268265_10036142
1437 Ga0268265_10047867
1438 Ga0268265_10096698
1439 Ga0268264_10007839
1440 Ga0268264_10119005
1441 Ga0265336_10000062
1442 Ga0307517_10013803
1443 Ga0307515_10000022
1444 Ga0307515_10000191
1445 Ga0307515_10003517
1446 Ga0307515_10003519
1447 Ga0307515_10021930
1448 Ga0307515_10036215
1449 Ga0307515_10063975
1450 Ga0307515_10082008
1451 Ga0307515_10135477
1452 Ga0307515_10150616
1453 Ga0307515_10187724
1454 Ga0265324_10015589
1455 Ga0307511_10068954
1456 Ga0307512_10056761
1457 Ga0307512_10141375
1458 Ga0265330_10000032
1459 Ga0265332_10000001
1460 Ga0265328_10015973
1461 Ga0265327_10000043
1462 Ga0265316_10000151
1463 Ga0307513_10011299
1464 Ga0307513_10015357
1465 Ga0307513_10023996
1466 Ga0307513_10058698
1467 Ga0307509_10000215
1468 Ga0307509_10098502
1469 Ga0307509_10118652
1470 Ga0307509_10177294
1471 Ga0307408_100000008
1472 Ga0307408_100000513
1473 Ga0307408_100188771
1474 Ga0307508_10000017
1475 Ga0307508_10000094
1476 Ga0307508_10034900
1477 Ga0307508_10067005
1478 Ga0307508_10185848
1479 Ga0307514_10002966
1480 Ga0307514_10004466
1481 Ga0265314_10000022
1482 Ga0307516_10000254
1483 Ga0307516_10001811
1484 Ga0307516_10002501
1485 Ga0307516_10006776
1486 Ga0307516_10035350
1487 Ga0307516_10132006
1488 Ga0307516_10160601
1489 Ga0307516_10175088
1490 Ga0307406_10000279
1491 Ga0307409_100001509
1492 Ga0307409_100060955
1493 Ga0307416_100031303
1494 Ga0307416_100073842
1495 Ga0307411_10030308
1496 Ga0307411_10032183
1497 Ga0307411_10038304
1498 Ga0307411_10048742
1499 Ga0307415_100004973
1500 Ga0307507_10093838
1501 Ga0307507_10098962
1502 Ga0307510_10007507
1503 Ga0307510_10027415
1504 Ga0307510_10057953
1505 Ga0373939_0000164
1506 Ga0373960_0002111
1507 Ga0373931_0002571
1508 Ga0373931_0044183
1509 Ga0373935_0155852
1510 Ga0373927_0029351
1511 Ga0373927_0091127
1512 Ga0373937_0138413
1513 Ga0373925_0004683
1514 Ga0373925_0035343
1515 Ga0373925_0169558
1516 Ga0395899_0002565
1517 Ga0395899_0028348
1518 Ga0395900_0000188
1519 Ga0395900_0005484
1520 Ga0395900_0249015
1521 Ga0395898_0006418
1522 Ga0395898_0017271
1523 Ga0395898_0028321
1524 Ga0395898_0110946
1525 Ga0395905_0000106
1526 Ga0395905_0001392
1527 Ga0395905_0002852
1528 Ga0395905_0002964
1529 Ga0395905_0004837
1530 Ga0395905_0010220
1531 Ga0395905_0020704
1532 Ga0395905_0020789
1533 Ga0395905_0060299
1534 Ga0395905_0139665
1535 Ga0395905_0213324
1536 Ga0395905_0243284
1537 Ga0395901_0006203
1538 Ga0395901_0035718
1539 Ga0395901_0092099
1540 Ga0395901_0092493
1541 Ga0395901_0189875
1542 Ga0436361_0141959
1543 Ga0436361_0376061
1544 Ga0436361_0399628
1545 Ga0436361_0583521
1546 Ga0451791_1242034
1547 Ga0451800_1626932
1548 Ga0439431_0009009
1549 Ga0439437_001198
1550 Ga0450919_000269
1551 Ga0450920_007520
1552 Ga0450923_001458
1553 Ga0450891_000891
1554 Ga0450889_000608
1555 Ga0439459_0000228
1556 Ga0439464_0000764
1557 Ga0439464_0003749
1558 Ga0450918_000945
1559 Ga0450893_0005693
1560 Ga0451577_0001353
1561 Ga0466969_0000002
1562 Ga0466969_0007330
1563 Ga0466969_0009526
1564 Ga0466969_0037283
1565 Ga0466965_0002506
1566 Ga0466965_0014746
1567 Ga0466965_0064093
1568 Ga0466965_0081038
1569 Ga0466966_0001339
1570 Ga0466966_0007833
1571 Ga0466966_0015276
1572 Ga0466966_0020128
1573 Ga0466961_0008620
1574 Ga0466961_0026940
1575 Ga0466961_0090320
1576 Ga0466963_0074855
1577 Ga0466963_0144363
1578 Ga0466964_0002006
1579 Ga0453684_0006474
1580 Ga0453684_0083182
1581 Ga0466971_0001980
1582 Ga0466968_0017259
1583 Ga0466970_0044954
1584 Ga0466970_0140502
1585 Ga0466959_0001562
1586 Ga0466959_0004663
1587 Ga0466959_0008282
1588 Ga0451576_0079493
1589 Ga0451576_0087359
1590 Ga0451576_0271512
1591 Ga0451576_0334921
1592 Ga0466967_0026883
1593 Ga0466967_0339891
1594 Ga0495592_0001770
1595 Ga0495638_0042795
1596 Ga0495650_0008824
1597 Ga0495650_0021298
1598 Ga0495580_0033530
1599 Ga0495639_0046092
1600 Ga0495585_0005980
1601 Ga0495583_0000153
1602 Ga0495606_0002667
1603 Ga0495606_0029123
1604 Ga0495610_0026708
1605 Ga0495610_0073678
1606 Ga0495620_0022622
1607 Ga0495632_0022786
1608 Ga0495632_0072153
1609 Ga0495643_0020062
1610 Ga0495654_0000550
1611 Ga0495586_0022236
1612 Ga0495598_0035208
1613 Ga0495597_0010147
1614 Ga0495625_0005772
1615 Ga0495625_0013423
1616 Ga0495625_0043089
1617 Ga0495658_0010441
1618 Ga0495658_0088988
1619 Ga0495658_0115747
1620 Ga0495658_0168679
1621 Ga0495649_0002833
1622 Ga0495649_0013059
1623 Ga0495660_0031092
1624 Ga0495660_0038817
1625 Ga0495676_0056004
1626 Ga0495687_002210
1627 Ga0495684_0177860
1628 Ga0495686_0060940
1629 Ga0495626_0078352
1630 Ga0496102_0020879
1631 Ga0496102_0026281
1632 Ga0496102_0046041
1633 Ga0496104_0008841
1634 Ga0496105_0107002
1635 Ga0496106_0089601
1636 Ga0496108_0073683
1637 Ga0496108_0118426
1638 Ga0496108_0143944
1639 Ga0496108_0229757
1640 Ga0496109_0013396
1641 Ga0496109_0125200
1642 Ga0496109_0243456
1643 Ga0496110_0073096
1644 Ga0496111_0076891
1645 Ga0496113_0032000
1646 Ga0496113_0099656
1647 Ga0496114_0003382
1648 Ga0496114_0073018
1649 Ga0496114_0122684
1650 Ga0496114_0136188
1651 Ga0496115_0057989
1652 Ga0496121_0022752
1653 Ga0496124_0000151
1654 Ga0496124_0008805
1655 Ga0496125_0005971
1656 Ga0501309_000516
1657 Ga0501310_000594
1658 Ga0501305_003384
1659 Ga0501312_000367
1660 Ga0501314_000187
1661 Ga0501322_000294
1662 Ga0501034_0140259
1663 Ga0501043_0000141
1664 Ga0501046_0000047
1665 Ga0501047_0000058
1666 Ga0501048_0015863
1667 Ga0501198_000002
1668 Ga0501222_000002
1669 Ga0501262_001512
1670 Ga0501267_000119
1671 Ga0501035_0107232
1672 nmdc:mga03683_10537_c1
1673 nmdc:mga03683_8491_c1
1674 nmdc:mga03n38_39797_c1
1675 nmdc:mga00v17_12324_c1
1676 nmdc:mga0k408_11200_c1
1677 nmdc:mga0k408_1236_c1
1678 nmdc:mga0k408_140890_c1
1679 nmdc:mga0k408_1461_c1
1680 nmdc:mga0k408_23800_c1
1681 nmdc:mga0k408_40389_c1
1682 nmdc:mga0k408_41303_c1
1683 nmdc:mga0k408_64737_c1
1684 nmdc:mga0k408_7522_c1
1685 nmdc:mga0k408_777_c1
1686 nmdc:mga06z11_33118_c1
1687 nmdc:mga06z11_3424_c1
1688 nmdc:mga07m45_10379_c1
1689 nmdc:mga07m45_1634_c1
1690 nmdc:mga07m45_182_c1
1691 nmdc:mga07m45_34095_c1
1692 nmdc:mga07m45_43473_c1
1693 nmdc:mga07m45_44545_c1
1694 nmdc:mga07m45_4520_c1
1695 nmdc:mga07m45_58545_c1
1696 nmdc:mga07m45_61002_c1
1697 nmdc:mga07m45_843_c1
1698 nmdc:mga09592_3371_c1
1699 nmdc:mga0sz30_31849_c1
1700 Ga0495601_0030415
1701 Ga0500635_0000033
1702 Ga0500635_0061116
1703 Ga0500578_0000002
1704 Ga0500578_0043483
1705 Ga0500644_0034098
1706 Ga0500646_0004313
1707 Ga0500646_0023026
1708 Ga0500583_0011260
1709 Ga0500583_0058658
1710 Ga0500651_0009619
1711 Ga0500593_001202
1712 Ga0500594_0000251
1713 Ga0500607_034061
1714 Ga0500623_057724
1715 Ga0500652_000102
1716 Ga0500658_0009139
1717 Ga0500559_0000392
1718 Ga0500559_0010715
1719 Ga0500568_0003681
1720 Ga0500568_0006565
1721 Ga0500577_0004869
1722 Ga0500604_0025337
1723 Ga0500619_000015
1724 Ga0500622_0002031
1725 Ga0500622_0007029
1726 Ga0500634_0044624
1727 Ga0500636_0044649
1728 Ga0500645_006937
1729 Ga0500587_002000
1730 Ga0590071_000456
1731 Ga0466962_0004675
1732 2548500242
1733 2587727686
1734 2587733061
1735 2587755169
1736 2588291359
1737 2643742681
1738 2643864733
1739 2643936201
1740 2643969506
1741 2643991109
1742 2644062361
1743 2644075581
1744 2644143806
1745 2644217712
1746 2644243144
1747 2644258550
1748 2644276488
1749 2644294036
1750 2644304852
1751 2644316846
1752 2644644441
1753 2739056745
1754 2739241555
1755 2816476190
1756 2831866351
1757 2881102203
1758 2886849624
1759 2939636560
1760 2990711808

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13360

PQQ_2

PQQ-like domain

94

323

0.99

PF13570

PQQ_3

PQQ-like domain

144

183

0.97

PF01011

PQQ

PQQ enzyme repeat

86

124

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hdj-assembly1.cif.gz_A crystal structure of bamb from pseudomonas aeruginosa 0.8807 31 369
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8637 72 186
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.847 150 223
4imm-assembly1.cif.gz_A the crystal structure of bamb from moraxella catarrhalis 0.8417 43 368
4hdj-assembly1.cif.gz_A crystal structure of bamb from pseudomonas aeruginosa 0.841 31 369
ID Description Score Start End Superfamily
4hdjA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8807 31 369 2.130.10.10
2ymsA00 Mainly Beta;Beta Barrel;Lipocalin; 0.8637 72 186 2.40.128.630
af_Q9FKT5_7_165_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8577 77 150 2.130.10.10
af_P77774_21_391_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8556 26 368 2.130.10.10
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.847 150 223 2.40.10.480
ID Description Score Start End GO Terms
AF-A0A7S1MWQ3-F1-model_v4 Outer membrane protein assembly factor BamB 0.9748 191 349
AF-A0A519IAL8-F1-model_v4 Outer membrane protein assembly factor BamB 0.971 134 356
AF-A0A7S1MWQ3-F1-model_v4 Outer membrane protein assembly factor BamB 0.9688 191 349
AF-A0A7V8BLV1-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9684 86 364
AF-A0A7C9J9B4-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9592 86 370

Map