F484479
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 880 | 322 | 880 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100053191|Ga0070713_1000531914 |
| Length | 222 |
| Sequence | MTKAPKERRSIRARWRGWRRSRPFWAGLFTLLSGAILTLIPMSGMRVAFVQGSVLWASLLVGLLMLLCGFTLFAFSLSVVCDIVTREIGRPWLWLQEVTSTFFIYGIFIGAAVATRRNDHLYLAAVGDSMTGRPRMIIESAIRMVVIGVGLFLVWFGYVNFLRGFASFRMPSMTPIASLYAAIPICGALIALFAFEQLVNGCRNGFETRPEDRLPEEGAGSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 105 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 106 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 200 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 234 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 235 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 236 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 303 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 307 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 318 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 319 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 320 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 321 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 322 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.93 |
| Nodule | 0 |
| Rhizoplane | 8.75 |
| Rhizosphere | 87.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10483230 | 3300005290 | Bacteria | 648 |
| 2 | Ga0070658_10081862 | 3300005327 | Bacteria | 2652 |
| 3 | Ga0070676_10000847 | 3300005328 | Bacteria | 15150 |
| 4 | Ga0070676_10076395 | 3300005328 | Bacteria | 2022 |
| 5 | Ga0070676_10126199 | 3300005328 | Bacteria | 1613 |
| 6 | Ga0070676_10194291 | 3300005328 | Bacteria | 1327 |
| 7 | Ga0070676_10302408 | 3300005328 | Bacteria | 1085 |
| 8 | Ga0070683_100323707 | 3300005329 | Bacteria | 1467 |
| 9 | Ga0070683_100467700 | 3300005329 | Bacteria | 1204 |
| 10 | Ga0070670_100026430 | 3300005331 | Bacteria | 4995 |
| 11 | Ga0070670_100034811 | 3300005331 | Bacteria | 4334 |
| 12 | Ga0070670_100371574 | 3300005331 | Bacteria | 1259 |
| 13 | Ga0070670_100474485 | 3300005331 | Bacteria | 1110 |
| 14 | Ga0070677_10130336 | 3300005333 | Bacteria | 1147 |
| 15 | Ga0068869_100039523 | 3300005334 | Bacteria | 3369 |
| 16 | Ga0068869_100100516 | 3300005334 | Bacteria | 2187 |
| 17 | Ga0068869_100158040 | 3300005334 | Bacteria | 1763 |
| 18 | Ga0070666_10007180 | 3300005335 | Bacteria | 6869 |
| 19 | Ga0070666_10016386 | 3300005335 | Bacteria | 4742 |
| 20 | Ga0070666_10089412 | 3300005335 | Bacteria | 2114 |
| 21 | Ga0070666_10107282 | 3300005335 | Bacteria | 1930 |
| 22 | Ga0070666_10861835 | 3300005335 | Bacteria | 669 |
| 23 | Ga0070680_100000933 | 3300005336 | Bacteria | 20696 |
| 24 | Ga0070682_100011560 | 3300005337 | Bacteria | 5047 |
| 25 | Ga0070682_100015105 | 3300005337 | Bacteria | 4470 |
| 26 | Ga0070682_100072844 | 3300005337 | Bacteria | 2202 |
| 27 | Ga0068868_100019189 | 3300005338 | Bacteria | 5123 |
| 28 | Ga0068868_100114985 | 3300005338 | Bacteria | 2190 |
| 29 | Ga0068868_100130503 | 3300005338 | Bacteria | 2056 |
| 30 | Ga0068868_100410314 | 3300005338 | Bacteria | 1171 |
| 31 | Ga0068868_100456767 | 3300005338 | Bacteria | 1112 |
| 32 | Ga0070660_100328813 | 3300005339 | Bacteria | 1256 |
| 33 | Ga0070660_100336016 | 3300005339 | Bacteria | 1243 |
| 34 | Ga0070689_100027304 | 3300005340 | Bacteria | 4303 |
| 35 | Ga0070689_100028079 | 3300005340 | Bacteria | 4250 |
| 36 | Ga0070689_100029734 | 3300005340 | Bacteria | 4139 |
| 37 | Ga0070689_100106442 | 3300005340 | Bacteria | 2225 |
| 38 | Ga0070689_100150431 | 3300005340 | Bacteria | 1877 |
| 39 | Ga0070689_100170817 | 3300005340 | Bacteria | 1762 |
| 40 | Ga0070691_10009000 | 3300005341 | Bacteria | 4567 |
| 41 | Ga0070687_100006230 | 3300005343 | Bacteria | 4879 |
| 42 | Ga0070687_100101598 | 3300005343 | Bacteria | 1611 |
| 43 | Ga0070661_100103487 | 3300005344 | Bacteria | 2120 |
| 44 | Ga0070661_101242938 | 3300005344 | Bacteria | 624 |
| 45 | Ga0070668_100004542 | 3300005347 | Bacteria | 10295 |
| 46 | Ga0070668_100668584 | 3300005347 | Bacteria | 914 |
| 47 | Ga0070669_100005778 | 3300005353 | Bacteria | 8918 |
| 48 | Ga0070669_100370722 | 3300005353 | Bacteria | 1166 |
| 49 | Ga0070675_100001685 | 3300005354 | Bacteria | 16306 |
| 50 | Ga0070675_100124241 | 3300005354 | Bacteria | 2195 |
| 51 | Ga0070675_100485032 | 3300005354 | Bacteria | 1112 |
| 52 | Ga0070675_100528793 | 3300005354 | Bacteria | 1065 |
| 53 | Ga0070675_100722109 | 3300005354 | Bacteria | 908 |
| 54 | Ga0070671_100010441 | 3300005355 | Bacteria | 7450 |
| 55 | Ga0070671_100021219 | 3300005355 | Bacteria | 5304 |
| 56 | Ga0070671_100163771 | 3300005355 | Bacteria | 1880 |
| 57 | Ga0070671_100449118 | 3300005355 | Bacteria | 1106 |
| 58 | Ga0070674_100003123 | 3300005356 | Bacteria | 9227 |
| 59 | Ga0070674_100034449 | 3300005356 | Bacteria | 3382 |
| 60 | Ga0070674_100093096 | 3300005356 | Bacteria | 2180 |
| 61 | Ga0070674_100422566 | 3300005356 | Bacteria | 1094 |
| 62 | Ga0070673_100031821 | 3300005364 | Bacteria | 3963 |
| 63 | Ga0070673_100052687 | 3300005364 | Bacteria | 3194 |
| 64 | Ga0070673_100082620 | 3300005364 | Bacteria | 2608 |
| 65 | Ga0070673_100083704 | 3300005364 | Bacteria | 2592 |
| 66 | Ga0070673_100117678 | 3300005364 | Bacteria | 2212 |
| 67 | Ga0070673_100607081 | 3300005364 | Unclassified | 998 |
| 68 | Ga0070688_100009043 | 3300005365 | Bacteria | 5431 |
| 69 | Ga0070688_100091149 | 3300005365 | Bacteria | 1992 |
| 70 | Ga0070659_100260774 | 3300005366 | Bacteria | 1438 |
| 71 | Ga0070659_100308486 | 3300005366 | Bacteria | 1321 |
| 72 | Ga0070659_100498768 | 3300005366 | Bacteria | 1037 |
| 73 | Ga0070667_100010578 | 3300005367 | Bacteria | 7617 |
| 74 | Ga0070667_100048749 | 3300005367 | Bacteria | 3566 |
| 75 | Ga0070667_100076418 | 3300005367 | Bacteria | 2859 |
| 76 | Ga0070667_100151466 | 3300005367 | Bacteria | 2037 |
| 77 | Ga0070667_100758360 | 3300005367 | Bacteria | 900 |
| 78 | Ga0070709_10005103 | 3300005434 | Bacteria | 7098 |
| 79 | Ga0070709_10015799 | 3300005434 | Bacteria | 4298 |
| 80 | Ga0070709_10112268 | 3300005434 | Bacteria | 1834 |
| 81 | Ga0070709_10205940 | 3300005434 | Bacteria | 1396 |
| 82 | Ga0070709_10226386 | 3300005434 | Bacteria | 1336 |
| 83 | Ga0070709_10452902 | 3300005434 | Bacteria | 967 |
| 84 | Ga0070714_100004407 | 3300005435 | Bacteria | 10595 |
| 85 | Ga0070714_100031975 | 3300005435 | Bacteria | 4393 |
| 86 | Ga0070714_100050832 | 3300005435 | Bacteria | 3532 |
| 87 | Ga0070714_100192350 | 3300005435 | Bacteria | 1862 |
| 88 | Ga0070714_100289260 | 3300005435 | Bacteria | 1524 |
| 89 | Ga0070714_100539274 | 3300005435 | Bacteria | 1116 |
| 90 | Ga0070713_100000039 | 3300005436 | Bacteria | 83384 |
| 91 | Ga0070713_100005026 | 3300005436 | Bacteria | 8988 |
| 92 | Ga0070713_100005783 | 3300005436 | Bacteria | 8500 |
| 93 | Ga0070713_100030937 | 3300005436 | Bacteria | 4257 |
| 94 | Ga0070713_100053191 | 3300005436 | Bacteria | 3355 |
| 95 | Ga0070713_100059691 | 3300005436 | Bacteria | 3186 |
| 96 | Ga0070713_100153211 | 3300005436 | Bacteria | 2052 |
| 97 | Ga0070710_10001919 | 3300005437 | Bacteria | 9846 |
| 98 | Ga0070710_10151809 | 3300005437 | Bacteria | 1429 |
| 99 | Ga0070710_10289472 | 3300005437 | Bacteria | 1066 |
| 100 | Ga0070701_10087033 | 3300005438 | Bacteria | 1704 |
| 101 | Ga0070711_100003421 | 3300005439 | Bacteria | 9245 |
| 102 | Ga0070711_100250160 | 3300005439 | Bacteria | 1390 |
| 103 | Ga0070711_100296402 | 3300005439 | Bacteria | 1284 |
| 104 | Ga0070711_100429923 | 3300005439 | Bacteria | 1077 |
| 105 | Ga0070711_100537556 | 3300005439 | Bacteria | 968 |
| 106 | Ga0070705_100145847 | 3300005440 | Bacteria | 1564 |
| 107 | Ga0070705_100275999 | 3300005440 | Bacteria | 1193 |
| 108 | Ga0070705_100666759 | 3300005440 | Bacteria | 813 |
| 109 | Ga0070700_100266928 | 3300005441 | Bacteria | 1235 |
| 110 | Ga0070708_100108249 | 3300005445 | Bacteria | 2552 |
| 111 | Ga0070663_100010454 | 3300005455 | Bacteria | 5784 |
| 112 | Ga0070663_100020275 | 3300005455 | Bacteria | 4399 |
| 113 | Ga0070663_100371418 | 3300005455 | Bacteria | 1163 |
| 114 | Ga0070663_100980063 | 3300005455 | Bacteria | 734 |
| 115 | Ga0070663_101012519 | 3300005455 | Bacteria | 723 |
| 116 | Ga0070678_100000728 | 3300005456 | Bacteria | 16377 |
| 117 | Ga0070678_100001027 | 3300005456 | Bacteria | 14545 |
| 118 | Ga0070678_100016483 | 3300005456 | Bacteria | 4729 |
| 119 | Ga0070678_100070575 | 3300005456 | Bacteria | 2612 |
| 120 | Ga0070678_100237585 | 3300005456 | Bacteria | 1522 |
| 121 | Ga0070662_100337719 | 3300005457 | Bacteria | 1232 |
| 122 | Ga0070681_10009517 | 3300005458 | Bacteria | 9562 |
| 123 | Ga0070681_10061084 | 3300005458 | Bacteria | 3745 |
| 124 | Ga0070681_10157011 | 3300005458 | Bacteria | 2199 |
| 125 | Ga0070681_10430920 | 3300005458 | Bacteria | 1231 |
| 126 | Ga0068867_100001109 | 3300005459 | Bacteria | 18410 |
| 127 | Ga0068867_100026711 | 3300005459 | Bacteria | 4147 |
| 128 | Ga0068867_100325004 | 3300005459 | Bacteria | 1276 |
| 129 | Ga0068867_100357024 | 3300005459 | Bacteria | 1221 |
| 130 | Ga0068867_100438499 | 3300005459 | Bacteria | 1110 |
| 131 | Ga0070685_10012319 | 3300005466 | Bacteria | 4491 |
| 132 | Ga0070685_10027399 | 3300005466 | Bacteria | 3148 |
| 133 | Ga0070706_100021874 | 3300005467 | Bacteria | 5889 |
| 134 | Ga0070706_100878300 | 3300005467 | Bacteria | 829 |
| 135 | Ga0070698_100002091 | 3300005471 | Bacteria | 22152 |
| 136 | Ga0070699_100013134 | 3300005518 | Bacteria | 7140 |
| 137 | Ga0070679_100009132 | 3300005530 | Bacteria | 9359 |
| 138 | Ga0070679_100088967 | 3300005530 | Bacteria | 3075 |
| 139 | Ga0070679_100207694 | 3300005530 | Bacteria | 1923 |
| 140 | Ga0070684_100085454 | 3300005535 | Bacteria | 2798 |
| 141 | Ga0070684_100262668 | 3300005535 | Bacteria | 1579 |
| 142 | Ga0070684_100305443 | 3300005535 | Bacteria | 1460 |
| 143 | Ga0070684_100333786 | 3300005535 | Bacteria | 1393 |
| 144 | Ga0070684_100761394 | 3300005535 | Bacteria | 904 |
| 145 | Ga0070697_100099113 | 3300005536 | Bacteria | 2419 |
| 146 | Ga0070697_100658826 | 3300005536 | Bacteria | 922 |
| 147 | Ga0068853_100052274 | 3300005539 | Bacteria | 3520 |
| 148 | Ga0068853_100269607 | 3300005539 | Bacteria | 1567 |
| 149 | Ga0070672_100001043 | 3300005543 | Bacteria | 16892 |
| 150 | Ga0070672_100105024 | 3300005543 | Bacteria | 2296 |
| 151 | Ga0070672_100125652 | 3300005543 | Bacteria | 2103 |
| 152 | Ga0070672_100228011 | 3300005543 | Bacteria | 1564 |
| 153 | Ga0070672_100293517 | 3300005543 | Bacteria | 1377 |
| 154 | Ga0070672_100437397 | 3300005543 | Bacteria | 1125 |
| 155 | Ga0070686_100005547 | 3300005544 | Bacteria | 6980 |
| 156 | Ga0070686_100025992 | 3300005544 | Bacteria | 3528 |
| 157 | Ga0070695_100298841 | 3300005545 | Bacteria | 1189 |
| 158 | Ga0070696_100082166 | 3300005546 | Bacteria | 2283 |
| 159 | Ga0070696_100677242 | 3300005546 | Bacteria | 839 |
| 160 | Ga0070693_100006850 | 3300005547 | Bacteria | 5539 |
| 161 | Ga0070693_100139528 | 3300005547 | Bacteria | 1524 |
| 162 | Ga0070693_100264257 | 3300005547 | Bacteria | 1146 |
| 163 | Ga0070665_100002989 | 3300005548 | Bacteria | 18261 |
| 164 | Ga0070665_100088331 | 3300005548 | Bacteria | 3105 |
| 165 | Ga0070665_100475083 | 3300005548 | Bacteria | 1261 |
| 166 | Ga0070665_100512216 | 3300005548 | Bacteria | 1211 |
| 167 | Ga0070665_100948496 | 3300005548 | Bacteria | 873 |
| 168 | Ga0070704_100308004 | 3300005549 | Bacteria | 1322 |
| 169 | Ga0070704_100363471 | 3300005549 | Bacteria | 1225 |
| 170 | Ga0070704_100532462 | 3300005549 | Bacteria | 1024 |
| 171 | Ga0068855_100455754 | 3300005563 | Bacteria | 1395 |
| 172 | Ga0068855_100994653 | 3300005563 | Bacteria | 881 |
| 173 | Ga0070664_100034445 | 3300005564 | Bacteria | 4248 |
| 174 | Ga0070664_100189837 | 3300005564 | Bacteria | 1830 |
| 175 | Ga0070664_100252212 | 3300005564 | Bacteria | 1586 |
| 176 | Ga0070664_100723375 | 3300005564 | Bacteria | 928 |
| 177 | Ga0068857_100119758 | 3300005577 | Bacteria | 2369 |
| 178 | Ga0068857_100206745 | 3300005577 | Bacteria | 1790 |
| 179 | Ga0068854_100273307 | 3300005578 | Bacteria | 1358 |
| 180 | Ga0068854_100649616 | 3300005578 | Bacteria | 905 |
| 181 | Ga0068856_100150900 | 3300005614 | Bacteria | 2333 |
| 182 | Ga0068856_100180424 | 3300005614 | Bacteria | 2124 |
| 183 | Ga0068856_100305419 | 3300005614 | Bacteria | 1609 |
| 184 | Ga0070702_100012876 | 3300005615 | Bacteria | 4210 |
| 185 | Ga0070702_100381995 | 3300005615 | Bacteria | 1002 |
| 186 | Ga0068859_100140301 | 3300005617 | Bacteria | 2490 |
| 187 | Ga0068859_100162478 | 3300005617 | Bacteria | 2313 |
| 188 | Ga0068859_100715312 | 3300005617 | Bacteria | 1092 |
| 189 | Ga0068864_100010322 | 3300005618 | Bacteria | 7713 |
| 190 | Ga0068864_100021942 | 3300005618 | Bacteria | 5352 |
| 191 | Ga0068864_100026129 | 3300005618 | Bacteria | 4922 |
| 192 | Ga0068866_10045919 | 3300005718 | Bacteria | 2194 |
| 193 | Ga0068866_10083519 | 3300005718 | Bacteria | 1721 |
| 194 | Ga0068861_100162574 | 3300005719 | Bacteria | 1843 |
| 195 | Ga0068863_100190757 | 3300005841 | Bacteria | 1969 |
| 196 | Ga0068863_100740153 | 3300005841 | Unclassified | 979 |
| 197 | Ga0068863_101157154 | 3300005841 | Bacteria | 779 |
| 198 | Ga0068858_100003682 | 3300005842 | Bacteria | 15187 |
| 199 | Ga0068858_100056529 | 3300005842 | Bacteria | 3626 |
| 200 | Ga0068858_100083784 | 3300005842 | Bacteria | 2965 |
| 201 | Ga0068858_100402662 | 3300005842 | Bacteria | 1315 |
| 202 | Ga0068858_100819590 | 3300005842 | Bacteria | 908 |
| 203 | Ga0068860_100012825 | 3300005843 | Bacteria | 8239 |
| 204 | Ga0068860_100106733 | 3300005843 | Bacteria | 2675 |
| 205 | Ga0068862_100039466 | 3300005844 | Bacteria | 4010 |
| 206 | Ga0081455_10034958 | 3300005937 | Bacteria | 4497 |
| 207 | Ga0070717_10000217 | 3300006028 | Bacteria | 39845 |
| 208 | Ga0070717_10005760 | 3300006028 | Bacteria | 9073 |
| 209 | Ga0070717_10077749 | 3300006028 | Bacteria | 2779 |
| 210 | Ga0070717_10388727 | 3300006028 | Bacteria | 1252 |
| 211 | Ga0070717_10697980 | 3300006028 | Bacteria | 922 |
| 212 | Ga0075365_10533119 | 3300006038 | Bacteria | 830 |
| 213 | Ga0075363_100599798 | 3300006048 | Bacteria | 660 |
| 214 | Ga0070715_10013506 | 3300006163 | Bacteria | 3002 |
| 215 | Ga0070715_10018821 | 3300006163 | Bacteria | 2639 |
| 216 | Ga0070715_10022051 | 3300006163 | Bacteria | 2479 |
| 217 | Ga0070715_10169171 | 3300006163 | Bacteria | 1087 |
| 218 | Ga0070715_10342259 | 3300006163 | Bacteria | 814 |
| 219 | Ga0070716_100000793 | 3300006173 | Bacteria | 13575 |
| 220 | Ga0070716_100002302 | 3300006173 | Bacteria | 8796 |
| 221 | Ga0070716_100023037 | 3300006173 | Bacteria | 3298 |
| 222 | Ga0070716_100089845 | 3300006173 | Bacteria | 1857 |
| 223 | Ga0070716_100454115 | 3300006173 | Bacteria | 935 |
| 224 | Ga0070712_100009890 | 3300006175 | Bacteria | 6014 |
| 225 | Ga0070712_100013119 | 3300006175 | Bacteria | 5285 |
| 226 | Ga0070712_100043893 | 3300006175 | Bacteria | 3080 |
| 227 | Ga0070712_100067602 | 3300006175 | Bacteria | 2543 |
| 228 | Ga0070712_100170328 | 3300006175 | Bacteria | 1689 |
| 229 | Ga0070712_100191421 | 3300006175 | Bacteria | 1601 |
| 230 | Ga0070712_100230118 | 3300006175 | Bacteria | 1472 |
| 231 | Ga0070712_100318807 | 3300006175 | Bacteria | 1263 |
| 232 | Ga0075367_10220166 | 3300006178 | Bacteria | 1188 |
| 233 | Ga0075369_10044353 | 3300006186 | Bacteria | 1910 |
| 234 | Ga0097621_100002390 | 3300006237 | Bacteria | 12862 |
| 235 | Ga0097621_100008604 | 3300006237 | Bacteria | 7357 |
| 236 | Ga0097621_100010225 | 3300006237 | Bacteria | 6852 |
| 237 | Ga0097621_100113837 | 3300006237 | Bacteria | 2288 |
| 238 | Ga0097621_100194548 | 3300006237 | Bacteria | 1758 |
| 239 | Ga0097621_100586033 | 3300006237 | Bacteria | 1018 |
| 240 | Ga0097621_100775284 | 3300006237 | Bacteria | 887 |
| 241 | Ga0075370_10022929 | 3300006353 | Bacteria | 3434 |
| 242 | Ga0068871_100001576 | 3300006358 | Bacteria | 15330 |
| 243 | Ga0068871_100003994 | 3300006358 | Bacteria | 10204 |
| 244 | Ga0068871_100009547 | 3300006358 | Bacteria | 7040 |
| 245 | Ga0068871_100041628 | 3300006358 | Bacteria | 3684 |
| 246 | Ga0068871_100317186 | 3300006358 | Bacteria | 1372 |
| 247 | Ga0068871_100319267 | 3300006358 | Bacteria | 1367 |
| 248 | Ga0075434_100081494 | 3300006871 | Bacteria | 3233 |
| 249 | Ga0075434_100623383 | 3300006871 | Bacteria | 1097 |
| 250 | Ga0075434_100736699 | 3300006871 | Bacteria | 1003 |
| 251 | Ga0075434_101836747 | 3300006871 | Unclassified | 612 |
| 252 | Ga0068865_100038086 | 3300006881 | Bacteria | 3252 |
| 253 | Ga0068865_100094688 | 3300006881 | Bacteria | 2174 |
| 254 | Ga0068865_100564237 | 3300006881 | Bacteria | 958 |
| 255 | Ga0068865_100791873 | 3300006881 | Bacteria | 817 |
| 256 | Ga0068865_101089029 | 3300006881 | Unclassified | 703 |
| 257 | Ga0075436_100101786 | 3300006914 | Bacteria | 2001 |
| 258 | Ga0075436_100181462 | 3300006914 | Bacteria | 1488 |
| 259 | Ga0097620_100128607 | 3300006931 | Bacteria | 2604 |
| 260 | Ga0097620_100140316 | 3300006931 | Bacteria | 2490 |
| 261 | Ga0097620_100162473 | 3300006931 | Bacteria | 2313 |
| 262 | Ga0097620_100715278 | 3300006931 | Bacteria | 1092 |
| 263 | Ga0075435_100768089 | 3300007076 | Bacteria | 839 |
| 264 | Ga0099794_10006876 | 3300007265 | Bacteria | 4636 |
| 265 | Ga0099795_10010690 | 3300007788 | Bacteria | 2713 |
| 266 | Ga0099795_10070276 | 3300007788 | Bacteria | 1319 |
| 267 | Ga0105251_10023867 | 3300009011 | Bacteria | 3149 |
| 268 | Ga0105250_10024795 | 3300009092 | Bacteria | 2416 |
| 269 | Ga0105240_10004752 | 3300009093 | Bacteria | 20518 |
| 270 | Ga0105240_10583003 | 3300009093 | Bacteria | 1233 |
| 271 | Ga0111539_10499406 | 3300009094 | Bacteria | 1417 |
| 272 | Ga0105245_10029333 | 3300009098 | Bacteria | 4859 |
| 273 | Ga0105245_10072585 | 3300009098 | Bacteria | 3127 |
| 274 | Ga0105245_10127957 | 3300009098 | Bacteria | 2379 |
| 275 | Ga0105245_10261620 | 3300009098 | Bacteria | 1684 |
| 276 | Ga0105245_10363129 | 3300009098 | Bacteria | 1437 |
| 277 | Ga0105245_10446651 | 3300009098 | Bacteria | 1301 |
| 278 | Ga0105247_10029031 | 3300009101 | Bacteria | 3349 |
| 279 | Ga0105247_10173383 | 3300009101 | Bacteria | 1435 |
| 280 | Ga0105247_10197289 | 3300009101 | Bacteria | 1351 |
| 281 | Ga0105247_10225357 | 3300009101 | Bacteria | 1271 |
| 282 | Ga0105243_10023934 | 3300009148 | Bacteria | 4654 |
| 283 | Ga0105243_10026026 | 3300009148 | Bacteria | 4477 |
| 284 | Ga0105243_10071930 | 3300009148 | Bacteria | 2798 |
| 285 | Ga0105241_10014601 | 3300009174 | Bacteria | 5751 |
| 286 | Ga0105241_10018681 | 3300009174 | Bacteria | 5104 |
| 287 | Ga0105241_10166234 | 3300009174 | Bacteria | 1818 |
| 288 | Ga0105241_10177093 | 3300009174 | Bacteria | 1766 |
| 289 | Ga0105241_10493190 | 3300009174 | Bacteria | 1091 |
| 290 | Ga0105242_10009790 | 3300009176 | Bacteria | 7346 |
| 291 | Ga0105242_10010141 | 3300009176 | Bacteria | 7218 |
| 292 | Ga0105242_10014350 | 3300009176 | Bacteria | 6137 |
| 293 | Ga0105242_10685281 | 3300009176 | Bacteria | 1001 |
| 294 | Ga0105242_11102524 | 3300009176 | Unclassified | 808 |
| 295 | Ga0105248_10001952 | 3300009177 | Bacteria | 22922 |
| 296 | Ga0105248_10043581 | 3300009177 | Bacteria | 5031 |
| 297 | Ga0105248_10097657 | 3300009177 | Bacteria | 3309 |
| 298 | Ga0105248_10124081 | 3300009177 | Bacteria | 2913 |
| 299 | Ga0105248_10265100 | 3300009177 | Bacteria | 1934 |
| 300 | Ga0105248_10295765 | 3300009177 | Bacteria | 1823 |
| 301 | Ga0105248_10651701 | 3300009177 | Bacteria | 1188 |
| 302 | Ga0105248_11796547 | 3300009177 | Bacteria | 695 |
| 303 | Ga0105237_10054170 | 3300009545 | Bacteria | 4019 |
| 304 | Ga0105237_10111632 | 3300009545 | Bacteria | 2726 |
| 305 | Ga0105237_10138192 | 3300009545 | Bacteria | 2431 |
| 306 | Ga0105237_10254079 | 3300009545 | Bacteria | 1760 |
| 307 | Ga0105237_10422871 | 3300009545 | Bacteria | 1338 |
| 308 | Ga0105237_10602444 | 3300009545 | Bacteria | 1106 |
| 309 | Ga0105238_10082146 | 3300009551 | Bacteria | 3212 |
| 310 | Ga0105238_10157549 | 3300009551 | Bacteria | 2246 |
| 311 | Ga0105238_10276775 | 3300009551 | Bacteria | 1659 |
| 312 | Ga0105238_10288779 | 3300009551 | Bacteria | 1622 |
| 313 | Ga0105249_10104828 | 3300009553 | Bacteria | 2665 |
| 314 | Ga0105249_10178494 | 3300009553 | Bacteria | 2064 |
| 315 | Ga0105249_10379928 | 3300009553 | Bacteria | 1438 |
| 316 | Ga0105249_11354522 | 3300009553 | Unclassified | 783 |
| 317 | Ga0099796_10055649 | 3300010159 | Bacteria | 1386 |
| 318 | Ga0105239_10062965 | 3300010375 | Bacteria | 4072 |
| 319 | Ga0105239_10190768 | 3300010375 | Bacteria | 2294 |
| 320 | Ga0105239_10200568 | 3300010375 | Bacteria | 2235 |
| 321 | Ga0105239_10249737 | 3300010375 | Bacteria | 1992 |
| 322 | Ga0105239_10379095 | 3300010375 | Bacteria | 1599 |
| 323 | Ga0105246_10173807 | 3300011119 | Bacteria | 1652 |
| 324 | Ga0105246_11430036 | 3300011119 | Bacteria | 646 |
| 325 | Ga0157328_1000881 | 3300012478 | Bacteria | 1183 |
| 326 | Ga0157313_1018652 | 3300012503 | Unclassified | 685 |
| 327 | Ga0157342_1006406 | 3300012507 | Bacteria | 1113 |
| 328 | Ga0157373_10095337 | 3300013100 | Bacteria | 2094 |
| 329 | Ga0157373_10115335 | 3300013100 | Bacteria | 1888 |
| 330 | Ga0157370_10160708 | 3300013104 | Bacteria | 2090 |
| 331 | Ga0157370_10200552 | 3300013104 | Bacteria | 1851 |
| 332 | Ga0157370_10540463 | 3300013104 | Bacteria | 1069 |
| 333 | Ga0157374_10008845 | 3300013296 | Bacteria | 8621 |
| 334 | Ga0157374_10009414 | 3300013296 | Bacteria | 8384 |
| 335 | Ga0157374_10128543 | 3300013296 | Bacteria | 2450 |
| 336 | Ga0157374_10309945 | 3300013296 | Bacteria | 1562 |
| 337 | Ga0157374_10554852 | 3300013296 | Bacteria | 1157 |
| 338 | Ga0157374_10780799 | 3300013296 | Bacteria | 971 |
| 339 | Ga0157378_10028760 | 3300013297 | Bacteria | 4907 |
| 340 | Ga0157378_10029323 | 3300013297 | Bacteria | 4857 |
| 341 | Ga0157378_10122317 | 3300013297 | Bacteria | 2401 |
| 342 | Ga0157378_10141988 | 3300013297 | Bacteria | 2230 |
| 343 | Ga0157378_10161621 | 3300013297 | Bacteria | 2095 |
| 344 | Ga0157378_10381392 | 3300013297 | Bacteria | 1384 |
| 345 | Ga0157378_10477251 | 3300013297 | Bacteria | 1242 |
| 346 | Ga0157378_10918132 | 3300013297 | Bacteria | 907 |
| 347 | Ga0163162_10001709 | 3300013306 | Bacteria | 20590 |
| 348 | Ga0163162_10045452 | 3300013306 | Bacteria | 4399 |
| 349 | Ga0157372_10413301 | 3300013307 | Bacteria | 1572 |
| 350 | Ga0157375_10009216 | 3300013308 | Bacteria | 8657 |
| 351 | Ga0157375_10020260 | 3300013308 | Bacteria | 6071 |
| 352 | Ga0157375_10079270 | 3300013308 | Bacteria | 3319 |
| 353 | Ga0157375_10269533 | 3300013308 | Bacteria | 1864 |
| 354 | Ga0157375_10299424 | 3300013308 | Bacteria | 1772 |
| 355 | Ga0157375_10476049 | 3300013308 | Bacteria | 1414 |
| 356 | Ga0157375_10708299 | 3300013308 | Bacteria | 1160 |
| 357 | Ga0163163_10023573 | 3300014325 | Bacteria | 5843 |
| 358 | Ga0163163_10347580 | 3300014325 | Bacteria | 1539 |
| 359 | Ga0163163_10542852 | 3300014325 | Bacteria | 1225 |
| 360 | Ga0157380_10334421 | 3300014326 | Bacteria | 1410 |
| 361 | Ga0157380_10372182 | 3300014326 | Bacteria | 1345 |
| 362 | Ga0157377_10105301 | 3300014745 | Bacteria | 1688 |
| 363 | Ga0157377_10933187 | 3300014745 | Bacteria | 652 |
| 364 | Ga0157379_10002943 | 3300014968 | Bacteria | 14369 |
| 365 | Ga0157379_10025689 | 3300014968 | Bacteria | 5234 |
| 366 | Ga0157379_10027789 | 3300014968 | Bacteria | 5036 |
| 367 | Ga0157379_10346149 | 3300014968 | Bacteria | 1360 |
| 368 | Ga0157379_10351343 | 3300014968 | Bacteria | 1350 |
| 369 | Ga0157376_10003569 | 3300014969 | Bacteria | 10722 |
| 370 | Ga0157376_10153633 | 3300014969 | Bacteria | 2078 |
| 371 | Ga0157376_10177971 | 3300014969 | Bacteria | 1942 |
| 372 | Ga0157376_10202990 | 3300014969 | Bacteria | 1825 |
| 373 | Ga0157376_10310276 | 3300014969 | Bacteria | 1496 |
| 374 | Ga0157376_10332841 | 3300014969 | Bacteria | 1447 |
| 375 | Ga0157376_11215520 | 3300014969 | Bacteria | 782 |
| 376 | Ga0157376_11267269 | 3300014969 | Unclassified | 767 |
| 377 | Ga0163161_10069944 | 3300017792 | Bacteria | 2566 |
| 378 | Ga0163161_10197934 | 3300017792 | Bacteria | 1547 |
| 379 | Ga0163161_10275425 | 3300017792 | Bacteria | 1318 |
| 380 | Ga0213873_10013063 | 3300021358 | Bacteria | 1814 |
| 381 | Ga0213874_10084189 | 3300021377 | Bacteria | 1035 |
| 382 | Ga0213876_10036782 | 3300021384 | Bacteria | 2583 |
| 383 | Ga0213876_10273573 | 3300021384 | Bacteria | 898 |
| 384 | Ga0213875_10308522 | 3300021388 | Bacteria | 749 |
| 385 | Ga0207426_1022401 | 3300025302 | Bacteria | 2168 |
| 386 | Ga0207697_10003098 | 3300025315 | Bacteria | 8320 |
| 387 | Ga0207656_10200211 | 3300025321 | Bacteria | 964 |
| 388 | Ga0207682_10074864 | 3300025893 | Bacteria | 1440 |
| 389 | Ga0207692_10001674 | 3300025898 | Bacteria | 8378 |
| 390 | Ga0207692_10014567 | 3300025898 | Bacteria | 3439 |
| 391 | Ga0207642_10046942 | 3300025899 | Bacteria | 1928 |
| 392 | Ga0207642_10057025 | 3300025899 | Bacteria | 1795 |
| 393 | Ga0207642_10411742 | 3300025899 | Bacteria | 811 |
| 394 | Ga0207710_10001666 | 3300025900 | Bacteria | 10815 |
| 395 | Ga0207710_10002946 | 3300025900 | Bacteria | 7718 |
| 396 | Ga0207710_10017187 | 3300025900 | Bacteria | 3066 |
| 397 | Ga0207710_10458589 | 3300025900 | Bacteria | 659 |
| 398 | Ga0207688_10305378 | 3300025901 | Bacteria | 974 |
| 399 | Ga0207680_10020003 | 3300025903 | Bacteria | 3592 |
| 400 | Ga0207680_10092028 | 3300025903 | Bacteria | 1931 |
| 401 | Ga0207680_10109528 | 3300025903 | Bacteria | 1788 |
| 402 | Ga0207685_10000852 | 3300025905 | Bacteria | 5726 |
| 403 | Ga0207685_10010994 | 3300025905 | Bacteria | 2702 |
| 404 | Ga0207685_10014352 | 3300025905 | Bacteria | 2478 |
| 405 | Ga0207699_10000138 | 3300025906 | Bacteria | 49255 |
| 406 | Ga0207699_10006404 | 3300025906 | Bacteria | 5697 |
| 407 | Ga0207699_10012288 | 3300025906 | Bacteria | 4353 |
| 408 | Ga0207699_10369612 | 3300025906 | Bacteria | 1016 |
| 409 | Ga0207645_10000588 | 3300025907 | Bacteria | 30197 |
| 410 | Ga0207645_10035490 | 3300025907 | Bacteria | 3201 |
| 411 | Ga0207645_10052631 | 3300025907 | Bacteria | 2601 |
| 412 | Ga0207645_10094801 | 3300025907 | Bacteria | 1921 |
| 413 | Ga0207645_10191258 | 3300025907 | Bacteria | 1345 |
| 414 | Ga0207705_10020452 | 3300025909 | Bacteria | 4729 |
| 415 | Ga0207684_10025016 | 3300025910 | Bacteria | 5088 |
| 416 | Ga0207684_10141231 | 3300025910 | Bacteria | 2070 |
| 417 | Ga0207654_10002446 | 3300025911 | Bacteria | 9470 |
| 418 | Ga0207654_10172411 | 3300025911 | Bacteria | 1406 |
| 419 | Ga0207654_10236912 | 3300025911 | Bacteria | 1218 |
| 420 | Ga0207707_10010605 | 3300025912 | Bacteria | 8001 |
| 421 | Ga0207707_10106369 | 3300025912 | Bacteria | 2452 |
| 422 | Ga0207695_10009523 | 3300025913 | Bacteria | 12011 |
| 423 | Ga0207695_10800230 | 3300025913 | Bacteria | 823 |
| 424 | Ga0207671_10039867 | 3300025914 | Bacteria | 3478 |
| 425 | Ga0207671_10907036 | 3300025914 | Bacteria | 697 |
| 426 | Ga0207693_10002257 | 3300025915 | Bacteria | 16770 |
| 427 | Ga0207693_10007885 | 3300025915 | Bacteria | 8745 |
| 428 | Ga0207693_10034136 | 3300025915 | Unclassified | 4013 |
| 429 | Ga0207693_10049736 | 3300025915 | Bacteria | 3292 |
| 430 | Ga0207693_10059404 | 3300025915 | Bacteria | 2995 |
| 431 | Ga0207693_10062001 | 3300025915 | Bacteria | 2929 |
| 432 | Ga0207693_10068703 | 3300025915 | Bacteria | 2773 |
| 433 | Ga0207693_10092385 | 3300025915 | Bacteria | 2372 |
| 434 | Ga0207693_10188144 | 3300025915 | Bacteria | 1625 |
| 435 | Ga0207663_10004484 | 3300025916 | Bacteria | 6951 |
| 436 | Ga0207663_10009885 | 3300025916 | Bacteria | 5051 |
| 437 | Ga0207663_10049960 | 3300025916 | Bacteria | 2597 |
| 438 | Ga0207663_10272334 | 3300025916 | Bacteria | 1255 |
| 439 | Ga0207663_10546715 | 3300025916 | Bacteria | 905 |
| 440 | Ga0207663_10584609 | 3300025916 | Bacteria | 876 |
| 441 | Ga0207660_10069311 | 3300025917 | Bacteria | 2560 |
| 442 | Ga0207662_10109126 | 3300025918 | Bacteria | 1724 |
| 443 | Ga0207657_10058704 | 3300025919 | Bacteria | 3309 |
| 444 | Ga0207657_10103652 | 3300025919 | Bacteria | 2358 |
| 445 | Ga0207657_10115039 | 3300025919 | Bacteria | 2217 |
| 446 | Ga0207649_10077536 | 3300025920 | Bacteria | 2141 |
| 447 | Ga0207652_10006590 | 3300025921 | Bacteria | 9362 |
| 448 | Ga0207646_10189428 | 3300025922 | Bacteria | 1858 |
| 449 | Ga0207646_10303334 | 3300025922 | Bacteria | 1443 |
| 450 | Ga0207681_10008861 | 3300025923 | Bacteria | 6147 |
| 451 | Ga0207694_10269481 | 3300025924 | Bacteria | 1396 |
| 452 | Ga0207694_10532443 | 3300025924 | Bacteria | 985 |
| 453 | Ga0207650_10008427 | 3300025925 | Bacteria | 7036 |
| 454 | Ga0207650_10023679 | 3300025925 | Bacteria | 4359 |
| 455 | Ga0207650_10032631 | 3300025925 | Bacteria | 3767 |
| 456 | Ga0207650_10107696 | 3300025925 | Bacteria | 2153 |
| 457 | Ga0207650_10610848 | 3300025925 | Bacteria | 917 |
| 458 | Ga0207659_10001888 | 3300025926 | Bacteria | 12411 |
| 459 | Ga0207659_10207470 | 3300025926 | Bacteria | 1568 |
| 460 | Ga0207659_10558219 | 3300025926 | Bacteria | 974 |
| 461 | Ga0207659_10773830 | 3300025926 | Bacteria | 824 |
| 462 | Ga0207687_10002691 | 3300025927 | Bacteria | 12023 |
| 463 | Ga0207687_10017501 | 3300025927 | Bacteria | 4720 |
| 464 | Ga0207687_10071298 | 3300025927 | Bacteria | 2482 |
| 465 | Ga0207687_10561229 | 3300025927 | Bacteria | 959 |
| 466 | Ga0207700_10000082 | 3300025928 | Bacteria | 58939 |
| 467 | Ga0207700_10001380 | 3300025928 | Bacteria | 13781 |
| 468 | Ga0207700_10005532 | 3300025928 | Bacteria | 7579 |
| 469 | Ga0207700_10006593 | 3300025928 | Bacteria | 7029 |
| 470 | Ga0207700_10013374 | 3300025928 | Bacteria | 5337 |
| 471 | Ga0207700_10071967 | 3300025928 | Bacteria | 2664 |
| 472 | Ga0207700_10380501 | 3300025928 | Bacteria | 1234 |
| 473 | Ga0207700_10449311 | 3300025928 | Bacteria | 1136 |
| 474 | Ga0207700_10775904 | 3300025928 | Bacteria | 857 |
| 475 | Ga0207664_10007607 | 3300025929 | Bacteria | 7517 |
| 476 | Ga0207664_10019090 | 3300025929 | Bacteria | 5060 |
| 477 | Ga0207664_10065103 | 3300025929 | Bacteria | 2917 |
| 478 | Ga0207664_10175216 | 3300025929 | Bacteria | 1838 |
| 479 | Ga0207664_10626436 | 3300025929 | Bacteria | 966 |
| 480 | Ga0207664_10701535 | 3300025929 | Bacteria | 910 |
| 481 | Ga0207644_10000935 | 3300025931 | Bacteria | 18571 |
| 482 | Ga0207644_10005948 | 3300025931 | Bacteria | 7952 |
| 483 | Ga0207644_10023814 | 3300025931 | Bacteria | 4198 |
| 484 | Ga0207644_10071137 | 3300025931 | Bacteria | 2544 |
| 485 | Ga0207644_10199204 | 3300025931 | Bacteria | 1579 |
| 486 | Ga0207644_10227425 | 3300025931 | Bacteria | 1481 |
| 487 | Ga0207644_10315610 | 3300025931 | Bacteria | 1263 |
| 488 | Ga0207644_10510639 | 3300025931 | Bacteria | 992 |
| 489 | Ga0207644_10555580 | 3300025931 | Bacteria | 950 |
| 490 | Ga0207690_10027669 | 3300025932 | Bacteria | 3585 |
| 491 | Ga0207690_10257216 | 3300025932 | Bacteria | 1351 |
| 492 | Ga0207706_10007456 | 3300025933 | Bacteria | 10116 |
| 493 | Ga0207706_10094134 | 3300025933 | Bacteria | 2635 |
| 494 | Ga0207706_10505190 | 3300025933 | Bacteria | 1043 |
| 495 | Ga0207686_10039576 | 3300025934 | Bacteria | 2861 |
| 496 | Ga0207686_10072241 | 3300025934 | Bacteria | 2223 |
| 497 | Ga0207686_10082835 | 3300025934 | Bacteria | 2098 |
| 498 | Ga0207709_10018229 | 3300025935 | Bacteria | 3928 |
| 499 | Ga0207709_10022885 | 3300025935 | Bacteria | 3550 |
| 500 | Ga0207670_10059938 | 3300025936 | Bacteria | 2591 |
| 501 | Ga0207670_10122899 | 3300025936 | Bacteria | 1890 |
| 502 | Ga0207670_10172597 | 3300025936 | Bacteria | 1622 |
| 503 | Ga0207670_10373369 | 3300025936 | Bacteria | 1134 |
| 504 | Ga0207669_10027702 | 3300025937 | Bacteria | 3107 |
| 505 | Ga0207669_10158660 | 3300025937 | Bacteria | 1594 |
| 506 | Ga0207669_10640651 | 3300025937 | Bacteria | 868 |
| 507 | Ga0207669_10686317 | 3300025937 | Bacteria | 840 |
| 508 | Ga0207704_10003966 | 3300025938 | Bacteria | 6733 |
| 509 | Ga0207704_10034813 | 3300025938 | Bacteria | 2878 |
| 510 | Ga0207704_10068626 | 3300025938 | Bacteria | 2236 |
| 511 | Ga0207665_10004818 | 3300025939 | Bacteria | 8981 |
| 512 | Ga0207665_10024706 | 3300025939 | Bacteria | 3962 |
| 513 | Ga0207691_10000899 | 3300025940 | Bacteria | 29484 |
| 514 | Ga0207691_10039440 | 3300025940 | Bacteria | 4370 |
| 515 | Ga0207691_10076199 | 3300025940 | Bacteria | 3023 |
| 516 | Ga0207691_10355046 | 3300025940 | Bacteria | 1254 |
| 517 | Ga0207711_10002933 | 3300025941 | Bacteria | 14911 |
| 518 | Ga0207711_10003009 | 3300025941 | Bacteria | 14738 |
| 519 | Ga0207711_10008791 | 3300025941 | Bacteria | 8446 |
| 520 | Ga0207711_10009116 | 3300025941 | Bacteria | 8285 |
| 521 | Ga0207711_10076825 | 3300025941 | Bacteria | 2909 |
| 522 | Ga0207711_11076564 | 3300025941 | Bacteria | 744 |
| 523 | Ga0207689_10001983 | 3300025942 | Bacteria | 19334 |
| 524 | Ga0207689_10046798 | 3300025942 | Bacteria | 3574 |
| 525 | Ga0207689_10050225 | 3300025942 | Bacteria | 3440 |
| 526 | Ga0207689_10128129 | 3300025942 | Bacteria | 2088 |
| 527 | Ga0207661_10055119 | 3300025944 | Bacteria | 3187 |
| 528 | Ga0207661_10064941 | 3300025944 | Bacteria | 2961 |
| 529 | Ga0207661_10482685 | 3300025944 | Bacteria | 1131 |
| 530 | Ga0207661_10689277 | 3300025944 | Bacteria | 939 |
| 531 | Ga0207679_10276040 | 3300025945 | Bacteria | 1439 |
| 532 | Ga0207679_10678892 | 3300025945 | Bacteria | 933 |
| 533 | Ga0207667_10007731 | 3300025949 | Bacteria | 12852 |
| 534 | Ga0207667_10634872 | 3300025949 | Bacteria | 1075 |
| 535 | Ga0207651_10008269 | 3300025960 | Bacteria | 5610 |
| 536 | Ga0207651_10069283 | 3300025960 | Bacteria | 2490 |
| 537 | Ga0207651_10090793 | 3300025960 | Bacteria | 2234 |
| 538 | Ga0207651_10632879 | 3300025960 | Bacteria | 938 |
| 539 | Ga0207651_10761422 | 3300025960 | Unclassified | 856 |
| 540 | Ga0207651_11122415 | 3300025960 | Bacteria | 705 |
| 541 | Ga0207712_10056019 | 3300025961 | Bacteria | 2776 |
| 542 | Ga0207712_10157687 | 3300025961 | Bacteria | 1760 |
| 543 | Ga0207712_10309288 | 3300025961 | Bacteria | 1300 |
| 544 | Ga0207712_10486734 | 3300025961 | Bacteria | 1052 |
| 545 | Ga0207668_10005107 | 3300025972 | Bacteria | 7723 |
| 546 | Ga0207668_10287708 | 3300025972 | Bacteria | 1351 |
| 547 | Ga0207640_10077434 | 3300025981 | Bacteria | 2261 |
| 548 | Ga0207640_10292019 | 3300025981 | Bacteria | 1286 |
| 549 | Ga0207640_10786704 | 3300025981 | Bacteria | 823 |
| 550 | Ga0207658_10003966 | 3300025986 | Bacteria | 10396 |
| 551 | Ga0207658_10043132 | 3300025986 | Bacteria | 3277 |
| 552 | Ga0207658_10134960 | 3300025986 | Bacteria | 1988 |
| 553 | Ga0207658_10137294 | 3300025986 | Bacteria | 1974 |
| 554 | Ga0207658_10274986 | 3300025986 | Bacteria | 1441 |
| 555 | Ga0207677_10014584 | 3300026023 | Bacteria | 4595 |
| 556 | Ga0207677_10039478 | 3300026023 | Bacteria | 3104 |
| 557 | Ga0207677_10043068 | 3300026023 | Bacteria | 2999 |
| 558 | Ga0207677_10053908 | 3300026023 | Bacteria | 2741 |
| 559 | Ga0207677_10904651 | 3300026023 | Bacteria | 796 |
| 560 | Ga0207703_10011838 | 3300026035 | Bacteria | 6792 |
| 561 | Ga0207703_10021693 | 3300026035 | Bacteria | 5027 |
| 562 | Ga0207703_10028873 | 3300026035 | Bacteria | 4377 |
| 563 | Ga0207703_10059365 | 3300026035 | Bacteria | 3124 |
| 564 | Ga0207639_10087372 | 3300026041 | Bacteria | 2485 |
| 565 | Ga0207639_10503493 | 3300026041 | Bacteria | 1107 |
| 566 | Ga0207678_10018666 | 3300026067 | Bacteria | 6089 |
| 567 | Ga0207678_10128643 | 3300026067 | Bacteria | 2160 |
| 568 | Ga0207678_10144614 | 3300026067 | Bacteria | 2030 |
| 569 | Ga0207708_10119935 | 3300026075 | Bacteria | 2049 |
| 570 | Ga0207708_10230239 | 3300026075 | Bacteria | 1488 |
| 571 | Ga0207708_10307722 | 3300026075 | Bacteria | 1290 |
| 572 | Ga0207708_10560777 | 3300026075 | Bacteria | 964 |
| 573 | Ga0207702_10037311 | 3300026078 | Bacteria | 4067 |
| 574 | Ga0207702_10337087 | 3300026078 | Bacteria | 1440 |
| 575 | Ga0207702_10394779 | 3300026078 | Bacteria | 1333 |
| 576 | Ga0207702_10436872 | 3300026078 | Bacteria | 1268 |
| 577 | Ga0207702_10473895 | 3300026078 | Bacteria | 1217 |
| 578 | Ga0207641_10003310 | 3300026088 | Bacteria | 14332 |
| 579 | Ga0207641_10059622 | 3300026088 | Bacteria | 3250 |
| 580 | Ga0207641_10138937 | 3300026088 | Bacteria | 2189 |
| 581 | Ga0207648_10000949 | 3300026089 | Bacteria | 32818 |
| 582 | Ga0207648_10097767 | 3300026089 | Bacteria | 2569 |
| 583 | Ga0207648_10994207 | 3300026089 | Bacteria | 785 |
| 584 | Ga0207676_10007601 | 3300026095 | Bacteria | 7694 |
| 585 | Ga0207676_10019980 | 3300026095 | Bacteria | 4893 |
| 586 | Ga0207676_10820288 | 3300026095 | Bacteria | 908 |
| 587 | Ga0207674_10070740 | 3300026116 | Bacteria | 3508 |
| 588 | Ga0207674_10135299 | 3300026116 | Bacteria | 2426 |
| 589 | Ga0207674_10291894 | 3300026116 | Bacteria | 1579 |
| 590 | Ga0207675_100089500 | 3300026118 | Bacteria | 2893 |
| 591 | Ga0207683_10000210 | 3300026121 | Bacteria | 50885 |
| 592 | Ga0207683_10000480 | 3300026121 | Bacteria | 36946 |
| 593 | Ga0207683_10001479 | 3300026121 | Bacteria | 21177 |
| 594 | Ga0207683_10009436 | 3300026121 | Bacteria | 8315 |
| 595 | Ga0207683_10062449 | 3300026121 | Bacteria | 3281 |
| 596 | Ga0207683_10270802 | 3300026121 | Bacteria | 1551 |
| 597 | Ga0207698_10027778 | 3300026142 | Bacteria | 4024 |
| 598 | Ga0207698_11620535 | 3300026142 | Bacteria | 663 |
| 599 | Ga0207428_10760941 | 3300027907 | Unclassified | 690 |
| 600 | Ga0268266_10005275 | 3300028379 | Bacteria | 12134 |
| 601 | Ga0268266_10028221 | 3300028379 | Bacteria | 4771 |
| 602 | Ga0268266_10045267 | 3300028379 | Bacteria | 3764 |
| 603 | Ga0268266_10287372 | 3300028379 | Bacteria | 1530 |
| 604 | Ga0268266_10434179 | 3300028379 | Bacteria | 1246 |
| 605 | Ga0268266_10467240 | 3300028379 | Bacteria | 1201 |
| 606 | Ga0268265_10202704 | 3300028380 | Bacteria | 1722 |
| 607 | Ga0268265_10356902 | 3300028380 | Bacteria | 1337 |
| 608 | Ga0268264_10016111 | 3300028381 | Bacteria | 6125 |
| 609 | Ga0268264_10665660 | 3300028381 | Bacteria | 1031 |
| 610 | Ga0265332_10239652 | 3300031238 | Unclassified | 751 |
| 611 | Ga0265339_10111078 | 3300031249 | Bacteria | 1418 |
| 612 | Ga0307513_10296736 | 3300031456 | Bacteria | 1385 |
| 613 | Ga0307509_10130561 | 3300031507 | Bacteria | 2469 |
| 614 | Ga0265313_10015163 | 3300031595 | Bacteria | 4508 |
| 615 | Ga0373950_0014700 | 3300034818 | Bacteria | 1319 |
| 616 | Ga0373938_0014105 | 3300034957 | Bacteria | 1529 |
| 617 | Ga0373938_0063768 | 3300034957 | Bacteria | 867 |
| 618 | Ga0373926_0044929 | 3300035083 | Bacteria | 1583 |
| 619 | Ga0373926_0053387 | 3300035083 | Bacteria | 1462 |
| 620 | Ga0373934_0014177 | 3300035086 | Bacteria | 3019 |
| 621 | Ga0373944_0003706 | 3300035089 | Bacteria | 3950 |
| 622 | Ga0373944_0022547 | 3300035089 | Bacteria | 1830 |
| 623 | Ga0373949_0053951 | 3300035090 | Bacteria | 1019 |
| 624 | Ga0373952_0015400 | 3300035092 | Bacteria | 1544 |
| 625 | Ga0373923_0004472 | 3300035111 | Bacteria | 4641 |
| 626 | Ga0373936_0088302 | 3300035113 | Bacteria | 1297 |
| 627 | Ga0373936_0154046 | 3300035113 | Bacteria | 998 |
| 628 | Ga0373939_0157285 | 3300035114 | Bacteria | 832 |
| 629 | Ga0373941_0044152 | 3300035115 | Bacteria | 1390 |
| 630 | Ga0373945_0014083 | 3300035116 | Bacteria | 2676 |
| 631 | Ga0373953_0005116 | 3300035117 | Bacteria | 4236 |
| 632 | Ga0373954_0005514 | 3300035118 | Bacteria | 5473 |
| 633 | Ga0373957_0001985 | 3300035120 | Bacteria | 5712 |
| 634 | Ga0373960_0011455 | 3300035121 | Bacteria | 2186 |
| 635 | Ga0373960_0180484 | 3300035121 | Unclassified | 737 |
| 636 | Ga0373943_0016010 | 3300035170 | Bacteria | 3414 |
| 637 | Ga0373943_0016358 | 3300035170 | Bacteria | 3381 |
| 638 | Ga0373943_0118281 | 3300035170 | Bacteria | 1406 |
| 639 | Ga0373946_0010307 | 3300035171 | Bacteria | 3456 |
| 640 | Ga0373946_0064686 | 3300035171 | Bacteria | 1565 |
| 641 | Ga0373961_0041732 | 3300035241 | Bacteria | 1327 |
| 642 | Ga0373962_0043302 | 3300035242 | Bacteria | 1276 |
| 643 | Ga0373924_0061551 | 3300035410 | Bacteria | 1571 |
| 644 | Ga0373931_0045589 | 3300035691 | Bacteria | 2316 |
| 645 | Ga0373931_0055066 | 3300035691 | Bacteria | 2127 |
| 646 | Ga0373931_0060654 | 3300035691 | Bacteria | 2037 |
| 647 | Ga0373931_0219834 | 3300035691 | Bacteria | 1143 |
| 648 | Ga0373931_0371679 | 3300035691 | Bacteria | 899 |
| 649 | Ga0373935_0001749 | 3300035692 | Bacteria | 12185 |
| 650 | Ga0373935_0050340 | 3300035692 | Bacteria | 2643 |
| 651 | Ga0373935_0154447 | 3300035692 | Bacteria | 1560 |
| 652 | Ga0373935_0689937 | 3300035692 | Bacteria | 751 |
| 653 | Ga0373927_0049597 | 3300035695 | Bacteria | 2714 |
| 654 | Ga0373927_0114758 | 3300035695 | Bacteria | 1756 |
| 655 | Ga0373933_0009136 | 3300035724 | Bacteria | 5411 |
| 656 | Ga0373933_0055799 | 3300035724 | Bacteria | 2371 |
| 657 | Ga0373933_0186062 | 3300035724 | Bacteria | 1326 |
| 658 | Ga0373947_0001187 | 3300035725 | Bacteria | 16034 |
| 659 | Ga0373947_0055216 | 3300035725 | Bacteria | 2398 |
| 660 | Ga0373947_0088994 | 3300035725 | Bacteria | 1922 |
| 661 | Ga0373947_0218404 | 3300035725 | Bacteria | 1252 |
| 662 | Ga0373947_0328429 | 3300035725 | Bacteria | 1024 |
| 663 | Ga0373937_0027974 | 3300036401 | Bacteria | 5100 |
| 664 | Ga0373925_0004244 | 3300037068 | Bacteria | 10859 |
| 665 | Ga0373925_0031296 | 3300037068 | Bacteria | 3909 |
| 666 | Ga0373925_0098000 | 3300037068 | Bacteria | 2249 |
| 667 | Ga0373925_0280237 | 3300037068 | Bacteria | 1342 |
| 668 | Ga0373925_0407901 | 3300037068 | Bacteria | 1109 |
| 669 | Ga0373925_0720753 | 3300037068 | Bacteria | 822 |
| 670 | Ga0395899_0226593 | 3300037312 | Bacteria | 1292 |
| 671 | Ga0395898_0584294 | 3300037466 | Bacteria | 1059 |
| 672 | Ga0436364_0355624 | 3300037853 | Unclassified | 632 |
| 673 | Ga0436364_0518470 | 3300037853 | Bacteria | 958 |
| 674 | Ga0436364_1028562 | 3300037853 | Bacteria | 2308 |
| 675 | Ga0395901_0387110 | 3300038443 | Bacteria | 1438 |
| 676 | Ga0395901_0718909 | 3300038443 | Bacteria | 994 |
| 677 | Ga0436365_0149298 | 3300039437 | Bacteria | 3877 |
| 678 | Ga0436365_0197847 | 3300039437 | Bacteria | 1387 |
| 679 | Ga0436365_0824382 | 3300039437 | Bacteria | 33017 |
| 680 | Ga0436365_0935211 | 3300039437 | Bacteria | 4319 |
| 681 | Ga0436365_1674695 | 3300039437 | Bacteria | 1636 |
| 682 | Ga0436365_1830793 | 3300039437 | Bacteria | 7430 |
| 683 | Ga0436365_1847958 | 3300039437 | Bacteria | 1444 |
| 684 | Ga0436360_0240872 | 3300039438 | Bacteria | 1876 |
| 685 | Ga0436360_0439418 | 3300039438 | Bacteria | 618 |
| 686 | Ga0436360_0499041 | 3300039438 | Unclassified | 1164 |
| 687 | Ga0436363_1542522 | 3300039450 | Bacteria | 1800 |
| 688 | Ga0436362_0355831 | 3300039453 | Bacteria | 6148 |
| 689 | Ga0436362_0450274 | 3300039453 | Bacteria | 1059 |
| 690 | Ga0451853_0763982 | 3300041512 | Bacteria | 895 |
| 691 | Ga0466964_0323269 | 3300044706 | Bacteria | 785 |
| 692 | Ga0466957_0106069 | 3300044842 | Bacteria | 1777 |
| 693 | Ga0466967_0148355 | 3300045976 | Bacteria | 2189 |
| 694 | Ga0495592_0010242 | 3300046454 | Bacteria | 7067 |
| 695 | Ga0495603_0019912 | 3300046455 | Bacteria | 4064 |
| 696 | Ga0495603_0061344 | 3300046455 | Bacteria | 2220 |
| 697 | Ga0495603_0092761 | 3300046455 | Bacteria | 1765 |
| 698 | Ga0495603_0360030 | 3300046455 | Bacteria | 835 |
| 699 | Ga0495629_0000968 | 3300046459 | Bacteria | 23136 |
| 700 | Ga0495629_0002739 | 3300046459 | Bacteria | 13484 |
| 701 | Ga0495629_0170466 | 3300046459 | Bacteria | 1510 |
| 702 | Ga0495629_0194292 | 3300046459 | Bacteria | 1404 |
| 703 | Ga0495629_0237156 | 3300046459 | Bacteria | 1256 |
| 704 | Ga0495641_0017865 | 3300046461 | Bacteria | 3678 |
| 705 | Ga0495641_0067514 | 3300046461 | Bacteria | 1608 |
| 706 | Ga0495651_0002173 | 3300046462 | Bacteria | 15168 |
| 707 | Ga0495580_0169764 | 3300046472 | Bacteria | 1508 |
| 708 | Ga0495580_0207559 | 3300046472 | Bacteria | 1348 |
| 709 | Ga0495582_0002401 | 3300046473 | Bacteria | 10460 |
| 710 | Ga0495582_0125756 | 3300046473 | Bacteria | 1446 |
| 711 | Ga0495639_0010527 | 3300046475 | Bacteria | 3983 |
| 712 | Ga0495662_0033198 | 3300046476 | Bacteria | 2494 |
| 713 | Ga0495664_0048328 | 3300046477 | Bacteria | 2525 |
| 714 | Ga0495664_0050516 | 3300046477 | Bacteria | 2469 |
| 715 | Ga0495584_0116793 | 3300046491 | Bacteria | 1351 |
| 716 | Ga0495608_0009348 | 3300046511 | Bacteria | 6852 |
| 717 | Ga0495618_0137727 | 3300046514 | Bacteria | 1561 |
| 718 | Ga0495618_0172602 | 3300046514 | Bacteria | 1375 |
| 719 | Ga0495628_0019118 | 3300046516 | Bacteria | 5666 |
| 720 | Ga0495630_0103761 | 3300046517 | Bacteria | 2151 |
| 721 | Ga0495666_0069639 | 3300046526 | Bacteria | 1673 |
| 722 | Ga0495652_0040582 | 3300046529 | Bacteria | 4022 |
| 723 | Ga0495652_0204387 | 3300046529 | Bacteria | 1496 |
| 724 | Ga0495665_0047177 | 3300046531 | Bacteria | 2285 |
| 725 | Ga0495640_0029383 | 3300046533 | Bacteria | 3947 |
| 726 | Ga0495640_0039156 | 3300046533 | Bacteria | 3328 |
| 727 | Ga0495586_0058031 | 3300046535 | Bacteria | 2101 |
| 728 | Ga0495586_0059730 | 3300046535 | Bacteria | 2072 |
| 729 | Ga0495586_0234475 | 3300046535 | Bacteria | 1045 |
| 730 | Ga0495587_0008084 | 3300046536 | Bacteria | 6783 |
| 731 | Ga0495621_0102654 | 3300046539 | Bacteria | 1090 |
| 732 | Ga0495645_0015451 | 3300046543 | Bacteria | 5428 |
| 733 | Ga0495622_0112543 | 3300046557 | Bacteria | 1246 |
| 734 | Ga0495667_0000293 | 3300046559 | Bacteria | 32233 |
| 735 | Ga0495634_0041569 | 3300046642 | Bacteria | 3121 |
| 736 | Ga0495634_0116882 | 3300046642 | Bacteria | 1710 |
| 737 | Ga0495635_0067993 | 3300046663 | Bacteria | 2443 |
| 738 | Ga0495635_0248520 | 3300046663 | Bacteria | 1199 |
| 739 | Ga0495588_0023331 | 3300046674 | Bacteria | 3063 |
| 740 | Ga0495657_0009103 | 3300046675 | Bacteria | 7544 |
| 741 | Ga0495599_0006529 | 3300046678 | Bacteria | 7036 |
| 742 | Ga0495623_0000668 | 3300046679 | Bacteria | 22825 |
| 743 | Ga0495646_0022084 | 3300046680 | Bacteria | 4016 |
| 744 | Ga0495647_0061937 | 3300046681 | Bacteria | 1478 |
| 745 | Ga0495658_0016691 | 3300046683 | Bacteria | 3780 |
| 746 | Ga0495658_0018823 | 3300046683 | Bacteria | 3596 |
| 747 | Ga0495658_0028467 | 3300046683 | Bacteria | 3016 |
| 748 | Ga0495613_0004415 | 3300046689 | Bacteria | 10535 |
| 749 | Ga0495613_0129516 | 3300046689 | Bacteria | 1807 |
| 750 | Ga0495624_0059043 | 3300046690 | Bacteria | 2407 |
| 751 | Ga0495624_0115959 | 3300046690 | Bacteria | 1646 |
| 752 | Ga0495600_0004765 | 3300046809 | Bacteria | 8139 |
| 753 | Ga0495581_0010403 | 3300047315 | Bacteria | 5382 |
| 754 | Ga0495581_0056406 | 3300047315 | Bacteria | 2267 |
| 755 | Ga0495581_0159070 | 3300047315 | Bacteria | 1320 |
| 756 | Ga0495604_0005199 | 3300047317 | Bacteria | 10311 |
| 757 | Ga0495674_0009612 | 3300047319 | Bacteria | 9185 |
| 758 | Ga0495674_0311394 | 3300047319 | Bacteria | 1284 |
| 759 | Ga0495676_0038286 | 3300047321 | Bacteria | 3983 |
| 760 | Ga0495680_0003160 | 3300047322 | Bacteria | 16401 |
| 761 | Ga0495680_0013735 | 3300047322 | Bacteria | 7048 |
| 762 | Ga0495680_0072609 | 3300047322 | Bacteria | 2617 |
| 763 | Ga0495680_0273544 | 3300047322 | Bacteria | 1192 |
| 764 | Ga0495675_0002509 | 3300047444 | Bacteria | 10987 |
| 765 | Ga0495684_0037697 | 3300047471 | Bacteria | 3708 |
| 766 | Ga0495684_0240931 | 3300047471 | Bacteria | 1319 |
| 767 | Ga0495684_0258369 | 3300047471 | Bacteria | 1264 |
| 768 | Ga0495593_0063278 | 3300047673 | Bacteria | 1932 |
| 769 | Ga0495602_0020889 | 3300048088 | Bacteria | 6460 |
| 770 | Ga0495614_0327169 | 3300048089 | Unclassified | 712 |
| 771 | Ga0496100_0000750 | 3300048903 | Bacteria | 15473 |
| 772 | Ga0496100_0017698 | 3300048903 | Bacteria | 4212 |
| 773 | Ga0496100_0355975 | 3300048903 | Bacteria | 1106 |
| 774 | Ga0496101_0001812 | 3300048904 | Bacteria | 12875 |
| 775 | Ga0496101_0002124 | 3300048904 | Bacteria | 12082 |
| 776 | Ga0496102_0004194 | 3300048905 | Bacteria | 12188 |
| 777 | Ga0496102_0217808 | 3300048905 | Bacteria | 1799 |
| 778 | Ga0496102_0545231 | 3300048905 | Bacteria | 1082 |
| 779 | Ga0496102_0604557 | 3300048905 | Bacteria | 1019 |
| 780 | Ga0496103_0018426 | 3300048906 | Bacteria | 4187 |
| 781 | Ga0496103_0332495 | 3300048906 | Bacteria | 977 |
| 782 | Ga0496103_0374971 | 3300048906 | Bacteria | 914 |
| 783 | Ga0496104_0029377 | 3300048907 | Bacteria | 5098 |
| 784 | Ga0496104_0035486 | 3300048907 | Bacteria | 4655 |
| 785 | Ga0496104_0059292 | 3300048907 | Bacteria | 3623 |
| 786 | Ga0496104_0061938 | 3300048907 | Bacteria | 3547 |
| 787 | Ga0496104_0065245 | 3300048907 | Bacteria | 3454 |
| 788 | Ga0496104_0090101 | 3300048907 | Bacteria | 2930 |
| 789 | Ga0496104_0092744 | 3300048907 | Bacteria | 2888 |
| 790 | Ga0496104_0607820 | 3300048907 | Bacteria | 1003 |
| 791 | Ga0496104_0914367 | 3300048907 | Bacteria | 782 |
| 792 | Ga0496105_0020983 | 3300048908 | Bacteria | 5283 |
| 793 | Ga0496105_0032117 | 3300048908 | Bacteria | 4306 |
| 794 | Ga0496105_0063766 | 3300048908 | Bacteria | 3040 |
| 795 | Ga0496105_0126202 | 3300048908 | Bacteria | 2109 |
| 796 | Ga0496106_0006214 | 3300048909 | Bacteria | 8836 |
| 797 | Ga0496106_0051165 | 3300048909 | Bacteria | 3114 |
| 798 | Ga0496106_0072695 | 3300048909 | Bacteria | 2630 |
| 799 | Ga0496106_0125465 | 3300048909 | Bacteria | 2009 |
| 800 | Ga0496106_0257141 | 3300048909 | Bacteria | 1397 |
| 801 | Ga0496107_0001758 | 3300048910 | Bacteria | 13650 |
| 802 | Ga0496107_0018485 | 3300048910 | Bacteria | 4907 |
| 803 | Ga0496107_0029092 | 3300048910 | Bacteria | 3928 |
| 804 | Ga0496107_0031019 | 3300048910 | Bacteria | 3811 |
| 805 | Ga0496107_0289079 | 3300048910 | Unclassified | 1220 |
| 806 | Ga0496108_0004140 | 3300048911 | Bacteria | 11661 |
| 807 | Ga0496108_0075310 | 3300048911 | Bacteria | 2851 |
| 808 | Ga0496108_0127310 | 3300048911 | Bacteria | 2187 |
| 809 | Ga0496108_0210282 | 3300048911 | Bacteria | 1689 |
| 810 | Ga0496109_0011017 | 3300048912 | Bacteria | 7749 |
| 811 | Ga0496109_0043248 | 3300048912 | Bacteria | 4082 |
| 812 | Ga0496109_0053904 | 3300048912 | Bacteria | 3669 |
| 813 | Ga0496109_0057152 | 3300048912 | Bacteria | 3560 |
| 814 | Ga0496109_0067238 | 3300048912 | Bacteria | 3283 |
| 815 | Ga0496109_0087812 | 3300048912 | Bacteria | 2872 |
| 816 | Ga0496109_1083213 | 3300048912 | Bacteria | 738 |
| 817 | Ga0496110_0006110 | 3300048913 | Bacteria | 9492 |
| 818 | Ga0496110_0029921 | 3300048913 | Bacteria | 4692 |
| 819 | Ga0496110_0098292 | 3300048913 | Bacteria | 2623 |
| 820 | Ga0496110_0161538 | 3300048913 | Bacteria | 2031 |
| 821 | Ga0496110_0237197 | 3300048913 | Bacteria | 1659 |
| 822 | Ga0496111_0003203 | 3300048914 | Bacteria | 10103 |
| 823 | Ga0496111_0005507 | 3300048914 | Bacteria | 8129 |
| 824 | Ga0496111_0008722 | 3300048914 | Bacteria | 6728 |
| 825 | Ga0496111_0288518 | 3300048914 | Bacteria | 1217 |
| 826 | Ga0496112_0020496 | 3300048915 | Bacteria | 6269 |
| 827 | Ga0496112_0022976 | 3300048915 | Bacteria | 5950 |
| 828 | Ga0496112_0048980 | 3300048915 | Bacteria | 4140 |
| 829 | Ga0496112_0132298 | 3300048915 | Bacteria | 2465 |
| 830 | Ga0496112_0143502 | 3300048915 | Bacteria | 2356 |
| 831 | Ga0496112_0308903 | 3300048915 | Bacteria | 1526 |
| 832 | Ga0496112_1068710 | 3300048915 | Bacteria | 726 |
| 833 | Ga0496113_0011380 | 3300048916 | Bacteria | 5932 |
| 834 | Ga0496113_0016379 | 3300048916 | Bacteria | 5120 |
| 835 | Ga0496113_0020122 | 3300048916 | Bacteria | 4685 |
| 836 | Ga0496113_0081844 | 3300048916 | Bacteria | 2475 |
| 837 | Ga0496113_0216394 | 3300048916 | Bacteria | 1526 |
| 838 | Ga0496114_0002778 | 3300048917 | Bacteria | 13400 |
| 839 | Ga0496114_0015488 | 3300048917 | Bacteria | 6131 |
| 840 | Ga0496114_0211590 | 3300048917 | Bacteria | 1701 |
| 841 | Ga0496114_0356194 | 3300048917 | Bacteria | 1294 |
| 842 | Ga0496115_0007409 | 3300048918 | Bacteria | 8072 |
| 843 | Ga0496115_0025791 | 3300048918 | Bacteria | 4580 |
| 844 | Ga0496115_0042324 | 3300048918 | Bacteria | 3628 |
| 845 | Ga0496115_0105287 | 3300048918 | Bacteria | 2315 |
| 846 | Ga0496115_0259452 | 3300048918 | Bacteria | 1429 |
| 847 | Ga0496115_0579949 | 3300048918 | Bacteria | 893 |
| 848 | Ga0496124_0297108 | 3300048927 | Bacteria | 1169 |
| 849 | Ga0501034_0193514 | 3300049571 | Bacteria | 1995 |
| 850 | nmdc:mga03683_1814_c1 | 3300050489 | Bacteria | 6480 |
| 851 | nmdc:mga0yw44_210807_c2 | 3300050492 | Bacteria | 824 |
| 852 | nmdc:mga0k408_657126_c1 | 3300050493 | Unclassified | 616 |
| 853 | nmdc:mga07m45_13018_c1 | 3300050496 | Bacteria | 4402 |
| 854 | nmdc:mga08y16_1274714_c1 | 3300050511 | Unclassified | 703 |
| 855 | nmdc:mga0n895_1498942_c1 | 3300050512 | Bacteria | 641 |
| 856 | nmdc:mga0n895_340577_c1 | 3300050512 | Bacteria | 1519 |
| 857 | nmdc:mga0n895_340581_c1 | 3300050512 | Bacteria | 1519 |
| 858 | nmdc:mga0n895_840153_c1 | 3300050512 | Bacteria | 907 |
| 859 | nmdc:mga0rr50_398764_c1 | 3300050513 | Bacteria | 1162 |
| 860 | nmdc:mga0rr50_709556_c1 | 3300050513 | Bacteria | 858 |
| 861 | nmdc:mga08x19_143908_c1 | 3300050514 | Bacteria | 1611 |
| 862 | nmdc:mga08x19_601871_c1 | 3300050514 | Unclassified | 779 |
| 863 | nmdc:mga0sz30_14243_c1 | 3300050516 | Bacteria | 3126 |
| 864 | Ga0495601_0001091 | 3300053077 | Bacteria | 14889 |
| 865 | Ga0495601_0259441 | 3300053077 | Bacteria | 1134 |
| 866 | Ga0495612_0008078 | 3300053078 | Bacteria | 4283 |
| 867 | Ga0495612_0073496 | 3300053078 | Bacteria | 1428 |
| 868 | Ga0495612_0130860 | 3300053078 | Bacteria | 1084 |
| 869 | Ga0495612_0265321 | 3300053078 | Bacteria | 766 |
| 870 | Ga0495595_0001076 | 3300053084 | Bacteria | 10560 |
| 871 | Ga0495619_0000324 | 3300053085 | Bacteria | 33369 |
| 872 | Ga0495619_0002201 | 3300053085 | Bacteria | 12906 |
| 873 | Ga0495619_0007062 | 3300053085 | Bacteria | 7106 |
| 874 | Ga0495619_0132260 | 3300053085 | Bacteria | 1715 |
| 875 | Ga0500643_110651 | 3300053087 | Unclassified | 742 |
| 876 | Ga0500647_0128028 | 3300053091 | Bacteria | 1198 |
| 877 | Ga0500650_0346865 | 3300053098 | Unclassified | 650 |
| 878 | Ga0500642_0024659 | 3300053130 | Bacteria | 2433 |
| 879 | Ga0500559_0138601 | 3300053136 | Bacteria | 1139 |
| 880 | Ga0500616_0001916 | 3300053153 | Bacteria | 18590 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039438 | Ga0436360_0499041 | Ga0436360_0499041_18_572 | 175 |
| 2 | 3300053078 | Ga0495612_0265321 | Ga0495612_0265321_194_742 | 175 |
| 3 | 3300005467 | Ga0070706_100878300 | Ga0070706_1008783002 | 176 |
| 4 | 3300005536 | Ga0070697_100099113 | Ga0070697_1000991132 | 176 |
| 5 | 3300005329 | Ga0070683_100467700 | Ga0070683_1004677001 | 177 |
| 6 | 3300005366 | Ga0070659_100498768 | Ga0070659_1004987681 | 177 |
| 7 | 3300005436 | Ga0070713_100053191 | Ga0070713_1000531914 | 177 |
| 8 | 3300005455 | Ga0070663_101012519 | Ga0070663_1010125192 | 177 |
| 9 | 3300005578 | Ga0068854_100649616 | Ga0068854_1006496162 | 177 |
| 10 | 3300006881 | Ga0068865_101089029 | Ga0068865_1010890292 | 177 |
| 11 | 3300013297 | Ga0157378_10918132 | Ga0157378_109181322 | 177 |
| 12 | 3300021358 | Ga0213873_10013063 | Ga0213873_100130632 | 177 |
| 13 | 3300021384 | Ga0213876_10036782 | Ga0213876_100367822 | 177 |
| 14 | 3300025907 | Ga0207645_10094801 | Ga0207645_100948012 | 177 |
| 15 | 3300025916 | Ga0207663_10584609 | Ga0207663_105846092 | 177 |
| 16 | 3300025929 | Ga0207664_10626436 | Ga0207664_106264362 | 177 |
| 17 | 3300034957 | Ga0373938_0014105 | Ga0373938_0014105_857_1411 | 177 |
| 18 | 3300039437 | Ga0436365_1830793 | Ga0436365_1830793_4427_4999 | 177 |
| 19 | 3300039453 | Ga0436362_0355831 | Ga0436362_0355831_410_982 | 177 |
| 20 | 3300046535 | Ga0495586_0234475 | Ga0495586_0234475_83_637 | 177 |
| 21 | 3300050492 | nmdc:mga0yw44_210807_c2 | nmdc:mga0yw44_210807_c2_51_629 | 177 |
| 22 | 3300005331 | Ga0070670_100371574 | Ga0070670_1003715742 | 178 |
| 23 | 3300005340 | Ga0070689_100027304 | Ga0070689_1000273044 | 178 |
| 24 | 3300005354 | Ga0070675_100528793 | Ga0070675_1005287932 | 178 |
| 25 | 3300005435 | Ga0070714_100050832 | Ga0070714_1000508323 | 178 |
| 26 | 3300005617 | Ga0068859_100140301 | Ga0068859_1001403013 | 178 |
| 27 | 3300006048 | Ga0075363_100599798 | Ga0075363_1005997981 | 178 |
| 28 | 3300006163 | Ga0070715_10018821 | Ga0070715_100188212 | 178 |
| 29 | 3300006173 | Ga0070716_100089845 | Ga0070716_1000898452 | 178 |
| 30 | 3300006178 | Ga0075367_10220166 | Ga0075367_102201662 | 178 |
| 31 | 3300006186 | Ga0075369_10044353 | Ga0075369_100443532 | 178 |
| 32 | 3300006931 | Ga0097620_100140316 | Ga0097620_1001403162 | 178 |
| 33 | 3300007788 | Ga0099795_10010690 | Ga0099795_100106902 | 178 |
| 34 | 3300007788 | Ga0099795_10070276 | Ga0099795_100702762 | 178 |
| 35 | 3300009177 | Ga0105248_10651701 | Ga0105248_106517013 | 178 |
| 36 | 3300009177 | Ga0105248_11796547 | Ga0105248_117965472 | 178 |
| 37 | 3300011119 | Ga0105246_11430036 | Ga0105246_114300361 | 178 |
| 38 | 3300013296 | Ga0157374_10780799 | Ga0157374_107807992 | 178 |
| 39 | 3300014969 | Ga0157376_10332841 | Ga0157376_103328412 | 178 |
| 40 | 3300017792 | Ga0163161_10275425 | Ga0163161_102754252 | 178 |
| 41 | 3300021384 | Ga0213876_10273573 | Ga0213876_102735732 | 178 |
| 42 | 3300025302 | Ga0207426_1022401 | Ga0207426_10224012 | 178 |
| 43 | 3300025925 | Ga0207650_10610848 | Ga0207650_106108482 | 178 |
| 44 | 3300025926 | Ga0207659_10207470 | Ga0207659_102074702 | 178 |
| 45 | 3300025929 | Ga0207664_10019090 | Ga0207664_100190902 | 178 |
| 46 | 3300025931 | Ga0207644_10227425 | Ga0207644_102274252 | 178 |
| 47 | 3300025934 | Ga0207686_10072241 | Ga0207686_100722412 | 178 |
| 48 | 3300025937 | Ga0207669_10027702 | Ga0207669_100277023 | 178 |
| 49 | 3300025939 | Ga0207665_10024706 | Ga0207665_100247064 | 178 |
| 50 | 3300026075 | Ga0207708_10119935 | Ga0207708_101199352 | 178 |
| 51 | 3300026121 | Ga0207683_10009436 | Ga0207683_100094366 | 178 |
| 52 | 3300026142 | Ga0207698_11620535 | Ga0207698_116205351 | 178 |
| 53 | 3300028380 | Ga0268265_10356902 | Ga0268265_103569022 | 178 |
| 54 | 3300031238 | Ga0265332_10239652 | Ga0265332_102396521 | 178 |
| 55 | 3300031456 | Ga0307513_10296736 | Ga0307513_102967362 | 178 |
| 56 | 3300035083 | Ga0373926_0044929 | Ga0373926_0044929_214_762 | 178 |
| 57 | 3300035113 | Ga0373936_0154046 | Ga0373936_0154046_176_724 | 178 |
| 58 | 3300035170 | Ga0373943_0118281 | Ga0373943_0118281_115_663 | 178 |
| 59 | 3300035171 | Ga0373946_0064686 | Ga0373946_0064686_107_655 | 178 |
| 60 | 3300035691 | Ga0373931_0371679 | Ga0373931_0371679_11_565 | 178 |
| 61 | 3300035692 | Ga0373935_0154447 | Ga0373935_0154447_80_628 | 178 |
| 62 | 3300035692 | Ga0373935_0689937 | Ga0373935_0689937_131_685 | 178 |
| 63 | 3300035725 | Ga0373947_0218404 | Ga0373947_0218404_313_861 | 178 |
| 64 | 3300037068 | Ga0373925_0098000 | Ga0373925_0098000_222_770 | 178 |
| 65 | 3300039437 | Ga0436365_0197847 | Ga0436365_0197847_110_691 | 178 |
| 66 | 3300039437 | Ga0436365_0824382 | Ga0436365_0824382_10144_10755 | 178 |
| 67 | 3300039437 | Ga0436365_0935211 | Ga0436365_0935211_807_1388 | 178 |
| 68 | 3300039437 | Ga0436365_1674695 | Ga0436365_1674695_784_1338 | 178 |
| 69 | 3300039438 | Ga0436360_0240872 | Ga0436360_0240872_616_1197 | 178 |
| 70 | 3300039438 | Ga0436360_0439418 | Ga0436360_0439418_28_582 | 178 |
| 71 | 3300039453 | Ga0436362_0450274 | Ga0436362_0450274_162_728 | 178 |
| 72 | 3300046472 | Ga0495580_0207559 | Ga0495580_0207559_187_735 | 178 |
| 73 | 3300049571 | Ga0501034_0193514 | Ga0501034_0193514_628_1182 | 178 |
| 74 | 3300050493 | nmdc:mga0k408_657126_c1 | nmdc:mga0k408_657126_c1_21_575 | 178 |
| 75 | 3300050516 | nmdc:mga0sz30_14243_c1 | nmdc:mga0sz30_14243_c1_1513_2067 | 178 |
| 76 | 3300053078 | Ga0495612_0130860 | Ga0495612_0130860_15_596 | 178 |
| 77 | 3300053087 | Ga0500643_110651 | Ga0500643_110651_168_722 | 178 |
| 78 | 3300053098 | Ga0500650_0346865 | Ga0500650_0346865_65_619 | 178 |
| 79 | 3300053130 | Ga0500642_0024659 | Ga0500642_0024659_1337_1891 | 178 |
| 80 | 3300053153 | Ga0500616_0001916 | Ga0500616_0001916_17257_17811 | 178 |
| 81 | 3300005327 | Ga0070658_10081862 | Ga0070658_100818623 | 179 |
| 82 | 3300005334 | Ga0068869_100100516 | Ga0068869_1001005161 | 179 |
| 83 | 3300005335 | Ga0070666_10861835 | Ga0070666_108618351 | 179 |
| 84 | 3300005336 | Ga0070680_100000933 | Ga0070680_1000009339 | 179 |
| 85 | 3300005338 | Ga0068868_100130503 | Ga0068868_1001305031 | 179 |
| 86 | 3300005338 | Ga0068868_100456767 | Ga0068868_1004567672 | 179 |
| 87 | 3300005340 | Ga0070689_100106442 | Ga0070689_1001064422 | 179 |
| 88 | 3300005341 | Ga0070691_10009000 | Ga0070691_100090004 | 179 |
| 89 | 3300005354 | Ga0070675_100722109 | Ga0070675_1007221091 | 179 |
| 90 | 3300005434 | Ga0070709_10205940 | Ga0070709_102059402 | 179 |
| 91 | 3300005440 | Ga0070705_100666759 | Ga0070705_1006667591 | 179 |
| 92 | 3300005445 | Ga0070708_100108249 | Ga0070708_1001082492 | 179 |
| 93 | 3300005457 | Ga0070662_100337719 | Ga0070662_1003377192 | 179 |
| 94 | 3300005458 | Ga0070681_10157011 | Ga0070681_101570113 | 179 |
| 95 | 3300005458 | Ga0070681_10430920 | Ga0070681_104309202 | 179 |
| 96 | 3300005467 | Ga0070706_100021874 | Ga0070706_1000218744 | 179 |
| 97 | 3300005471 | Ga0070698_100002091 | Ga0070698_10000209124 | 179 |
| 98 | 3300005518 | Ga0070699_100013134 | Ga0070699_1000131344 | 179 |
| 99 | 3300005530 | Ga0070679_100009132 | Ga0070679_1000091328 | 179 |
| 100 | 3300005535 | Ga0070684_100262668 | Ga0070684_1002626682 | 179 |
| 101 | 3300005548 | Ga0070665_100475083 | Ga0070665_1004750832 | 179 |
| 102 | 3300005563 | Ga0068855_100994653 | Ga0068855_1009946532 | 179 |
| 103 | 3300005564 | Ga0070664_100252212 | Ga0070664_1002522122 | 179 |
| 104 | 3300005577 | Ga0068857_100119758 | Ga0068857_1001197582 | 179 |
| 105 | 3300005577 | Ga0068857_100206745 | Ga0068857_1002067451 | 179 |
| 106 | 3300005614 | Ga0068856_100180424 | Ga0068856_1001804242 | 179 |
| 107 | 3300005937 | Ga0081455_10034958 | Ga0081455_100349583 | 179 |
| 108 | 3300006353 | Ga0075370_10022929 | Ga0075370_100229292 | 179 |
| 109 | 3300007265 | Ga0099794_10006876 | Ga0099794_100068762 | 179 |
| 110 | 3300009093 | Ga0105240_10004752 | Ga0105240_1000475211 | 179 |
| 111 | 3300009093 | Ga0105240_10583003 | Ga0105240_105830032 | 179 |
| 112 | 3300009098 | Ga0105245_10261620 | Ga0105245_102616202 | 179 |
| 113 | 3300009174 | Ga0105241_10493190 | Ga0105241_104931902 | 179 |
| 114 | 3300009545 | Ga0105237_10422871 | Ga0105237_104228712 | 179 |
| 115 | 3300009545 | Ga0105237_10602444 | Ga0105237_106024442 | 179 |
| 116 | 3300009551 | Ga0105238_10157549 | Ga0105238_101575492 | 179 |
| 117 | 3300010159 | Ga0099796_10055649 | Ga0099796_100556492 | 179 |
| 118 | 3300010375 | Ga0105239_10249737 | Ga0105239_102497372 | 179 |
| 119 | 3300013100 | Ga0157373_10095337 | Ga0157373_100953371 | 179 |
| 120 | 3300013104 | Ga0157370_10160708 | Ga0157370_101607081 | 179 |
| 121 | 3300013104 | Ga0157370_10200552 | Ga0157370_102005522 | 179 |
| 122 | 3300014745 | Ga0157377_10933187 | Ga0157377_109331871 | 179 |
| 123 | 3300025909 | Ga0207705_10020452 | Ga0207705_100204522 | 179 |
| 124 | 3300025910 | Ga0207684_10025016 | Ga0207684_100250162 | 179 |
| 125 | 3300025910 | Ga0207684_10141231 | Ga0207684_101412312 | 179 |
| 126 | 3300025912 | Ga0207707_10106369 | Ga0207707_101063692 | 179 |
| 127 | 3300025913 | Ga0207695_10009523 | Ga0207695_100095234 | 179 |
| 128 | 3300025913 | Ga0207695_10800230 | Ga0207695_108002302 | 179 |
| 129 | 3300025917 | Ga0207660_10069311 | Ga0207660_100693112 | 179 |
| 130 | 3300025921 | Ga0207652_10006590 | Ga0207652_100065904 | 179 |
| 131 | 3300025922 | Ga0207646_10189428 | Ga0207646_101894282 | 179 |
| 132 | 3300025927 | Ga0207687_10561229 | Ga0207687_105612292 | 179 |
| 133 | 3300025928 | Ga0207700_10013374 | Ga0207700_100133743 | 179 |
| 134 | 3300025929 | Ga0207664_10701535 | Ga0207664_107015352 | 179 |
| 135 | 3300025936 | Ga0207670_10373369 | Ga0207670_103733692 | 179 |
| 136 | 3300025942 | Ga0207689_10046798 | Ga0207689_100467984 | 179 |
| 137 | 3300025944 | Ga0207661_10055119 | Ga0207661_100551194 | 179 |
| 138 | 3300025945 | Ga0207679_10276040 | Ga0207679_102760402 | 179 |
| 139 | 3300025949 | Ga0207667_10007731 | Ga0207667_100077319 | 179 |
| 140 | 3300025960 | Ga0207651_10632879 | Ga0207651_106328792 | 179 |
| 141 | 3300025981 | Ga0207640_10077434 | Ga0207640_100774342 | 179 |
| 142 | 3300025981 | Ga0207640_10292019 | Ga0207640_102920192 | 179 |
| 143 | 3300026023 | Ga0207677_10053908 | Ga0207677_100539084 | 179 |
| 144 | 3300026023 | Ga0207677_10904651 | Ga0207677_109046511 | 179 |
| 145 | 3300026041 | Ga0207639_10503493 | Ga0207639_105034932 | 179 |
| 146 | 3300026078 | Ga0207702_10037311 | Ga0207702_100373114 | 179 |
| 147 | 3300026078 | Ga0207702_10394779 | Ga0207702_103947791 | 179 |
| 148 | 3300026089 | Ga0207648_10994207 | Ga0207648_109942072 | 179 |
| 149 | 3300026116 | Ga0207674_10135299 | Ga0207674_101352993 | 179 |
| 150 | 3300026142 | Ga0207698_10027778 | Ga0207698_100277782 | 179 |
| 151 | 3300028379 | Ga0268266_10467240 | Ga0268266_104672402 | 179 |
| 152 | 3300035691 | Ga0373931_0055066 | Ga0373931_0055066_1042_1602 | 179 |
| 153 | 3300035724 | Ga0373933_0186062 | Ga0373933_0186062_114_671 | 179 |
| 154 | 3300035725 | Ga0373947_0328429 | Ga0373947_0328429_66_626 | 179 |
| 155 | 3300037068 | Ga0373925_0407901 | Ga0373925_0407901_142_699 | 179 |
| 156 | 3300037312 | Ga0395899_0226593 | Ga0395899_0226593_46_603 | 179 |
| 157 | 3300037466 | Ga0395898_0584294 | Ga0395898_0584294_429_986 | 179 |
| 158 | 3300038443 | Ga0395901_0387110 | Ga0395901_0387110_549_1106 | 179 |
| 159 | 3300038443 | Ga0395901_0718909 | Ga0395901_0718909_334_891 | 179 |
| 160 | 3300044842 | Ga0466957_0106069 | Ga0466957_0106069_667_1224 | 179 |
| 161 | 3300045976 | Ga0466967_0148355 | Ga0466967_0148355_148_705 | 179 |
| 162 | 3300048909 | Ga0496106_0257141 | Ga0496106_0257141_302_889 | 179 |
| 163 | 3300048913 | Ga0496110_0098292 | Ga0496110_0098292_1891_2478 | 179 |
| 164 | 3300048914 | Ga0496111_0288518 | Ga0496111_0288518_330_917 | 179 |
| 165 | 3300050489 | nmdc:mga03683_1814_c1 | nmdc:mga03683_1814_c1_4697_5284 | 179 |
| 166 | 3300050496 | nmdc:mga07m45_13018_c1 | nmdc:mga07m45_13018_c1_3253_3840 | 179 |
| 167 | 3300053091 | Ga0500647_0128028 | Ga0500647_0128028_168_731 | 179 |
| 168 | 3300006038 | Ga0075365_10533119 | Ga0075365_105331192 | 180 |
| 169 | 3300007076 | Ga0075435_100768089 | Ga0075435_1007680892 | 180 |
| 170 | 3300028381 | Ga0268264_10665660 | Ga0268264_106656602 | 180 |
| 171 | 3300050513 | nmdc:mga0rr50_709556_c1 | nmdc:mga0rr50_709556_c1_113_679 | 180 |
| 172 | 3300005328 | Ga0070676_10194291 | Ga0070676_101942911 | 181 |
| 173 | 3300005331 | Ga0070670_100474485 | Ga0070670_1004744852 | 181 |
| 174 | 3300005335 | Ga0070666_10007180 | Ga0070666_100071802 | 181 |
| 175 | 3300005339 | Ga0070660_100328813 | Ga0070660_1003288132 | 181 |
| 176 | 3300005340 | Ga0070689_100170817 | Ga0070689_1001708172 | 181 |
| 177 | 3300005343 | Ga0070687_100101598 | Ga0070687_1001015982 | 181 |
| 178 | 3300005347 | Ga0070668_100668584 | Ga0070668_1006685841 | 181 |
| 179 | 3300005356 | Ga0070674_100422566 | Ga0070674_1004225662 | 181 |
| 180 | 3300005364 | Ga0070673_100031821 | Ga0070673_1000318213 | 181 |
| 181 | 3300005365 | Ga0070688_100091149 | Ga0070688_1000911491 | 181 |
| 182 | 3300005434 | Ga0070709_10005103 | Ga0070709_100051033 | 181 |
| 183 | 3300005435 | Ga0070714_100004407 | Ga0070714_1000044079 | 181 |
| 184 | 3300005436 | Ga0070713_100005783 | Ga0070713_1000057836 | 181 |
| 185 | 3300005437 | Ga0070710_10289472 | Ga0070710_102894722 | 181 |
| 186 | 3300005439 | Ga0070711_100003421 | Ga0070711_1000034213 | 181 |
| 187 | 3300005440 | Ga0070705_100275999 | Ga0070705_1002759991 | 181 |
| 188 | 3300005455 | Ga0070663_100010454 | Ga0070663_1000104545 | 181 |
| 189 | 3300005456 | Ga0070678_100016483 | Ga0070678_1000164834 | 181 |
| 190 | 3300005459 | Ga0068867_100438499 | Ga0068867_1004384991 | 181 |
| 191 | 3300005466 | Ga0070685_10012319 | Ga0070685_100123192 | 181 |
| 192 | 3300005535 | Ga0070684_100333786 | Ga0070684_1003337862 | 181 |
| 193 | 3300005544 | Ga0070686_100025992 | Ga0070686_1000259924 | 181 |
| 194 | 3300005547 | Ga0070693_100264257 | Ga0070693_1002642571 | 181 |
| 195 | 3300005549 | Ga0070704_100308004 | Ga0070704_1003080042 | 181 |
| 196 | 3300005564 | Ga0070664_100034445 | Ga0070664_1000344455 | 181 |
| 197 | 3300005615 | Ga0070702_100381995 | Ga0070702_1003819951 | 181 |
| 198 | 3300005618 | Ga0068864_100026129 | Ga0068864_1000261292 | 181 |
| 199 | 3300005718 | Ga0068866_10083519 | Ga0068866_100835192 | 181 |
| 200 | 3300005841 | Ga0068863_100740153 | Ga0068863_1007401532 | 181 |
| 201 | 3300005842 | Ga0068858_100083784 | Ga0068858_1000837843 | 181 |
| 202 | 3300006028 | Ga0070717_10000217 | Ga0070717_1000021718 | 181 |
| 203 | 3300006163 | Ga0070715_10169171 | Ga0070715_101691712 | 181 |
| 204 | 3300006173 | Ga0070716_100000793 | Ga0070716_1000007935 | 181 |
| 205 | 3300006175 | Ga0070712_100230118 | Ga0070712_1002301182 | 181 |
| 206 | 3300006237 | Ga0097621_100008604 | Ga0097621_1000086046 | 181 |
| 207 | 3300006358 | Ga0068871_100009547 | Ga0068871_1000095472 | 181 |
| 208 | 3300006871 | Ga0075434_100623383 | Ga0075434_1006233831 | 181 |
| 209 | 3300006871 | Ga0075434_101836747 | Ga0075434_1018367471 | 181 |
| 210 | 3300006914 | Ga0075436_100101786 | Ga0075436_1001017863 | 181 |
| 211 | 3300006931 | Ga0097620_100128607 | Ga0097620_1001286072 | 181 |
| 212 | 3300009011 | Ga0105251_10023867 | Ga0105251_100238672 | 181 |
| 213 | 3300009094 | Ga0111539_10499406 | Ga0111539_104994062 | 181 |
| 214 | 3300009098 | Ga0105245_10072585 | Ga0105245_100725853 | 181 |
| 215 | 3300009101 | Ga0105247_10225357 | Ga0105247_102253571 | 181 |
| 216 | 3300009148 | Ga0105243_10071930 | Ga0105243_100719302 | 181 |
| 217 | 3300009174 | Ga0105241_10177093 | Ga0105241_101770932 | 181 |
| 218 | 3300009176 | Ga0105242_10009790 | Ga0105242_100097905 | 181 |
| 219 | 3300009553 | Ga0105249_11354522 | Ga0105249_113545221 | 181 |
| 220 | 3300012503 | Ga0157313_1018652 | Ga0157313_10186521 | 181 |
| 221 | 3300013297 | Ga0157378_10028760 | Ga0157378_100287604 | 181 |
| 222 | 3300013307 | Ga0157372_10413301 | Ga0157372_104133012 | 181 |
| 223 | 3300013308 | Ga0157375_10020260 | Ga0157375_100202602 | 181 |
| 224 | 3300013308 | Ga0157375_10476049 | Ga0157375_104760492 | 181 |
| 225 | 3300014325 | Ga0163163_10023573 | Ga0163163_100235732 | 181 |
| 226 | 3300014326 | Ga0157380_10372182 | Ga0157380_103721822 | 181 |
| 227 | 3300014968 | Ga0157379_10027789 | Ga0157379_100277895 | 181 |
| 228 | 3300014969 | Ga0157376_10310276 | Ga0157376_103102762 | 181 |
| 229 | 3300014969 | Ga0157376_11267269 | Ga0157376_112672691 | 181 |
| 230 | 3300017792 | Ga0163161_10197934 | Ga0163161_101979342 | 181 |
| 231 | 3300025899 | Ga0207642_10057025 | Ga0207642_100570252 | 181 |
| 232 | 3300025900 | Ga0207710_10002946 | Ga0207710_100029466 | 181 |
| 233 | 3300025900 | Ga0207710_10017187 | Ga0207710_100171872 | 181 |
| 234 | 3300025901 | Ga0207688_10305378 | Ga0207688_103053782 | 181 |
| 235 | 3300025903 | Ga0207680_10109528 | Ga0207680_101095282 | 181 |
| 236 | 3300025905 | Ga0207685_10010994 | Ga0207685_100109942 | 181 |
| 237 | 3300025906 | Ga0207699_10000138 | Ga0207699_1000013836 | 181 |
| 238 | 3300025907 | Ga0207645_10035490 | Ga0207645_100354903 | 181 |
| 239 | 3300025911 | Ga0207654_10172411 | Ga0207654_101724112 | 181 |
| 240 | 3300025915 | Ga0207693_10068703 | Ga0207693_100687033 | 181 |
| 241 | 3300025916 | Ga0207663_10009885 | Ga0207663_100098855 | 181 |
| 242 | 3300025918 | Ga0207662_10109126 | Ga0207662_101091262 | 181 |
| 243 | 3300025919 | Ga0207657_10115039 | Ga0207657_101150391 | 181 |
| 244 | 3300025924 | Ga0207694_10532443 | Ga0207694_105324431 | 181 |
| 245 | 3300025925 | Ga0207650_10107696 | Ga0207650_101076962 | 181 |
| 246 | 3300025927 | Ga0207687_10002691 | Ga0207687_100026918 | 181 |
| 247 | 3300025928 | Ga0207700_10001380 | Ga0207700_100013807 | 181 |
| 248 | 3300025929 | Ga0207664_10065103 | Ga0207664_100651032 | 181 |
| 249 | 3300025931 | Ga0207644_10000935 | Ga0207644_1000093513 | 181 |
| 250 | 3300025932 | Ga0207690_10257216 | Ga0207690_102572162 | 181 |
| 251 | 3300025933 | Ga0207706_10094134 | Ga0207706_100941342 | 181 |
| 252 | 3300025934 | Ga0207686_10082835 | Ga0207686_100828352 | 181 |
| 253 | 3300025935 | Ga0207709_10018229 | Ga0207709_100182293 | 181 |
| 254 | 3300025937 | Ga0207669_10686317 | Ga0207669_106863172 | 181 |
| 255 | 3300025938 | Ga0207704_10034813 | Ga0207704_100348132 | 181 |
| 256 | 3300025941 | Ga0207711_10003009 | Ga0207711_1000300912 | 181 |
| 257 | 3300025944 | Ga0207661_10482685 | Ga0207661_104826852 | 181 |
| 258 | 3300025960 | Ga0207651_10008269 | Ga0207651_100082694 | 181 |
| 259 | 3300025961 | Ga0207712_10056019 | Ga0207712_100560193 | 181 |
| 260 | 3300025972 | Ga0207668_10287708 | Ga0207668_102877082 | 181 |
| 261 | 3300025986 | Ga0207658_10043132 | Ga0207658_100431323 | 181 |
| 262 | 3300026023 | Ga0207677_10014584 | Ga0207677_100145843 | 181 |
| 263 | 3300026035 | Ga0207703_10059365 | Ga0207703_100593652 | 181 |
| 264 | 3300026067 | Ga0207678_10018666 | Ga0207678_100186662 | 181 |
| 265 | 3300026075 | Ga0207708_10560777 | Ga0207708_105607772 | 181 |
| 266 | 3300026078 | Ga0207702_10337087 | Ga0207702_103370871 | 181 |
| 267 | 3300026088 | Ga0207641_10059622 | Ga0207641_100596223 | 181 |
| 268 | 3300026095 | Ga0207676_10007601 | Ga0207676_100076016 | 181 |
| 269 | 3300026116 | Ga0207674_10291894 | Ga0207674_102918942 | 181 |
| 270 | 3300026121 | Ga0207683_10001479 | Ga0207683_1000147918 | 181 |
| 271 | 3300027907 | Ga0207428_10760941 | Ga0207428_107609411 | 181 |
| 272 | 3300028379 | Ga0268266_10287372 | Ga0268266_102873722 | 181 |
| 273 | 3300035092 | Ga0373952_0015400 | Ga0373952_0015400_177_755 | 181 |
| 274 | 3300035121 | Ga0373960_0180484 | Ga0373960_0180484_73_651 | 181 |
| 275 | 3300035242 | Ga0373962_0043302 | Ga0373962_0043302_419_997 | 181 |
| 276 | 3300035691 | Ga0373931_0219834 | Ga0373931_0219834_92_670 | 181 |
| 277 | 3300035725 | Ga0373947_0055216 | Ga0373947_0055216_1649_2227 | 181 |
| 278 | 3300037068 | Ga0373925_0031296 | Ga0373925_0031296_399_977 | 181 |
| 279 | 3300046455 | Ga0495603_0092761 | Ga0495603_0092761_1073_1651 | 181 |
| 280 | 3300046459 | Ga0495629_0002739 | Ga0495629_0002739_681_1259 | 181 |
| 281 | 3300046461 | Ga0495641_0067514 | Ga0495641_0067514_192_770 | 181 |
| 282 | 3300046683 | Ga0495658_0028467 | Ga0495658_0028467_1258_1836 | 181 |
| 283 | 3300046689 | Ga0495613_0004415 | Ga0495613_0004415_494_1072 | 181 |
| 284 | 3300047315 | Ga0495581_0010403 | Ga0495581_0010403_115_693 | 181 |
| 285 | 3300047322 | Ga0495680_0013735 | Ga0495680_0013735_4152_4730 | 181 |
| 286 | 3300048089 | Ga0495614_0327169 | Ga0495614_0327169_61_639 | 181 |
| 287 | 3300048903 | Ga0496100_0017698 | Ga0496100_0017698_505_1083 | 181 |
| 288 | 3300048905 | Ga0496102_0545231 | Ga0496102_0545231_161_739 | 181 |
| 289 | 3300048906 | Ga0496103_0018426 | Ga0496103_0018426_1599_2177 | 181 |
| 290 | 3300048906 | Ga0496103_0374971 | Ga0496103_0374971_15_581 | 181 |
| 291 | 3300048907 | Ga0496104_0029377 | Ga0496104_0029377_3806_4384 | 181 |
| 292 | 3300048907 | Ga0496104_0090101 | Ga0496104_0090101_864_1442 | 181 |
| 293 | 3300048908 | Ga0496105_0032117 | Ga0496105_0032117_3258_3836 | 181 |
| 294 | 3300048908 | Ga0496105_0063766 | Ga0496105_0063766_1058_1636 | 181 |
| 295 | 3300048908 | Ga0496105_0126202 | Ga0496105_0126202_772_1350 | 181 |
| 296 | 3300048909 | Ga0496106_0051165 | Ga0496106_0051165_1627_2205 | 181 |
| 297 | 3300048910 | Ga0496107_0001758 | Ga0496107_0001758_10395_10973 | 181 |
| 298 | 3300048912 | Ga0496109_0011017 | Ga0496109_0011017_3535_4113 | 181 |
| 299 | 3300048912 | Ga0496109_0057152 | Ga0496109_0057152_30_608 | 181 |
| 300 | 3300048913 | Ga0496110_0029921 | Ga0496110_0029921_3258_3836 | 181 |
| 301 | 3300048914 | Ga0496111_0005507 | Ga0496111_0005507_5355_5933 | 181 |
| 302 | 3300048915 | Ga0496112_0022976 | Ga0496112_0022976_4516_5094 | 181 |
| 303 | 3300048915 | Ga0496112_0132298 | Ga0496112_0132298_1108_1686 | 181 |
| 304 | 3300048916 | Ga0496113_0020122 | Ga0496113_0020122_850_1428 | 181 |
| 305 | 3300048917 | Ga0496114_0002778 | Ga0496114_0002778_5504_6082 | 181 |
| 306 | 3300048918 | Ga0496115_0025791 | Ga0496115_0025791_1806_2384 | 181 |
| 307 | 3300048927 | Ga0496124_0297108 | Ga0496124_0297108_184_762 | 181 |
| 308 | 3300050511 | nmdc:mga08y16_1274714_c1 | nmdc:mga08y16_1274714_c1_68_646 | 181 |
| 309 | 3300050512 | nmdc:mga0n895_340577_c1 | nmdc:mga0n895_340577_c1_515_1093 | 181 |
| 310 | 3300050512 | nmdc:mga0n895_840153_c1 | nmdc:mga0n895_840153_c1_245_823 | 181 |
| 311 | 3300050514 | nmdc:mga08x19_601871_c1 | nmdc:mga08x19_601871_c1_117_695 | 181 |
| 312 | 3300053085 | Ga0495619_0002201 | Ga0495619_0002201_89_667 | 181 |
| 313 | 3300037853 | Ga0436364_0355624 | Ga0436364_0355624_52_621 | 182 |
| 314 | 3300050513 | nmdc:mga0rr50_398764_c1 | nmdc:mga0rr50_398764_c1_471_1058 | 182 |
| 315 | 3300005355 | Ga0070671_100449118 | Ga0070671_1004491182 | 183 |
| 316 | 3300005841 | Ga0068863_101157154 | Ga0068863_1011571542 | 183 |
| 317 | 3300014969 | Ga0157376_11215520 | Ga0157376_112155201 | 184 |
| 318 | 3300037853 | Ga0436364_0518470 | Ga0436364_0518470_162_773 | 184 |
| 319 | 3300009098 | Ga0105245_10446651 | Ga0105245_104466512 | 185 |
| 320 | 3300005367 | Ga0070667_100758360 | Ga0070667_1007583602 | 186 |
| 321 | 3300005434 | Ga0070709_10112268 | Ga0070709_101122682 | 186 |
| 322 | 3300005435 | Ga0070714_100192350 | Ga0070714_1001923501 | 186 |
| 323 | 3300005436 | Ga0070713_100059691 | Ga0070713_1000596912 | 186 |
| 324 | 3300005437 | Ga0070710_10151809 | Ga0070710_101518092 | 186 |
| 325 | 3300005439 | Ga0070711_100296402 | Ga0070711_1002964022 | 186 |
| 326 | 3300005441 | Ga0070700_100266928 | Ga0070700_1002669281 | 186 |
| 327 | 3300005459 | Ga0068867_100325004 | Ga0068867_1003250042 | 186 |
| 328 | 3300005543 | Ga0070672_100293517 | Ga0070672_1002935172 | 186 |
| 329 | 3300005548 | Ga0070665_100948496 | Ga0070665_1009484961 | 186 |
| 330 | 3300005617 | Ga0068859_100715312 | Ga0068859_1007153122 | 186 |
| 331 | 3300006028 | Ga0070717_10077749 | Ga0070717_100777492 | 186 |
| 332 | 3300006163 | Ga0070715_10013506 | Ga0070715_100135063 | 186 |
| 333 | 3300006163 | Ga0070715_10342259 | Ga0070715_103422591 | 186 |
| 334 | 3300006237 | Ga0097621_100775284 | Ga0097621_1007752841 | 186 |
| 335 | 3300006931 | Ga0097620_100715278 | Ga0097620_1007152782 | 186 |
| 336 | 3300009176 | Ga0105242_10685281 | Ga0105242_106852811 | 186 |
| 337 | 3300010375 | Ga0105239_10190768 | Ga0105239_101907682 | 186 |
| 338 | 3300013296 | Ga0157374_10554852 | Ga0157374_105548521 | 186 |
| 339 | 3300013297 | Ga0157378_10141988 | Ga0157378_101419883 | 186 |
| 340 | 3300025899 | Ga0207642_10046942 | Ga0207642_100469422 | 186 |
| 341 | 3300025905 | Ga0207685_10014352 | Ga0207685_100143522 | 186 |
| 342 | 3300025906 | Ga0207699_10012288 | Ga0207699_100122883 | 186 |
| 343 | 3300025915 | Ga0207693_10188144 | Ga0207693_101881442 | 186 |
| 344 | 3300025926 | Ga0207659_10773830 | Ga0207659_107738301 | 186 |
| 345 | 3300025928 | Ga0207700_10005532 | Ga0207700_100055326 | 186 |
| 346 | 3300025960 | Ga0207651_11122415 | Ga0207651_111224151 | 186 |
| 347 | 3300026035 | Ga0207703_10028873 | Ga0207703_100288733 | 186 |
| 348 | 3300026075 | Ga0207708_10307722 | Ga0207708_103077222 | 186 |
| 349 | 3300026089 | Ga0207648_10097767 | Ga0207648_100977673 | 186 |
| 350 | 3300028379 | Ga0268266_10434179 | Ga0268266_104341791 | 186 |
| 351 | 3300031249 | Ga0265339_10111078 | Ga0265339_101110782 | 187 |
| 352 | 3300039437 | Ga0436365_1847958 | Ga0436365_1847958_667_1248 | 187 |
| 353 | 3300046455 | Ga0495603_0360030 | Ga0495603_0360030_52_636 | 187 |
| 354 | 3300005328 | Ga0070676_10000847 | Ga0070676_1000084717 | 188 |
| 355 | 3300005328 | Ga0070676_10302408 | Ga0070676_103024081 | 188 |
| 356 | 3300005331 | Ga0070670_100034811 | Ga0070670_1000348113 | 188 |
| 357 | 3300005333 | Ga0070677_10130336 | Ga0070677_101303362 | 188 |
| 358 | 3300005335 | Ga0070666_10089412 | Ga0070666_100894122 | 188 |
| 359 | 3300005338 | Ga0068868_100410314 | Ga0068868_1004103142 | 188 |
| 360 | 3300005340 | Ga0070689_100028079 | Ga0070689_1000280794 | 188 |
| 361 | 3300005340 | Ga0070689_100150431 | Ga0070689_1001504312 | 188 |
| 362 | 3300005347 | Ga0070668_100004542 | Ga0070668_1000045429 | 188 |
| 363 | 3300005353 | Ga0070669_100005778 | Ga0070669_1000057782 | 188 |
| 364 | 3300005353 | Ga0070669_100370722 | Ga0070669_1003707222 | 188 |
| 365 | 3300005354 | Ga0070675_100001685 | Ga0070675_10000168517 | 188 |
| 366 | 3300005356 | Ga0070674_100003123 | Ga0070674_1000031232 | 188 |
| 367 | 3300005364 | Ga0070673_100083704 | Ga0070673_1000837042 | 188 |
| 368 | 3300005364 | Ga0070673_100117678 | Ga0070673_1001176783 | 188 |
| 369 | 3300005367 | Ga0070667_100010578 | Ga0070667_1000105782 | 188 |
| 370 | 3300005367 | Ga0070667_100076418 | Ga0070667_1000764182 | 188 |
| 371 | 3300005435 | Ga0070714_100539274 | Ga0070714_1005392742 | 188 |
| 372 | 3300005438 | Ga0070701_10087033 | Ga0070701_100870332 | 188 |
| 373 | 3300005456 | Ga0070678_100001027 | Ga0070678_1000010279 | 188 |
| 374 | 3300005459 | Ga0068867_100001109 | Ga0068867_1000011096 | 188 |
| 375 | 3300005535 | Ga0070684_100761394 | Ga0070684_1007613941 | 188 |
| 376 | 3300005543 | Ga0070672_100105024 | Ga0070672_1001050242 | 188 |
| 377 | 3300005543 | Ga0070672_100125652 | Ga0070672_1001256522 | 188 |
| 378 | 3300005548 | Ga0070665_100088331 | Ga0070665_1000883313 | 188 |
| 379 | 3300005617 | Ga0068859_100162478 | Ga0068859_1001624782 | 188 |
| 380 | 3300005618 | Ga0068864_100010322 | Ga0068864_1000103222 | 188 |
| 381 | 3300005719 | Ga0068861_100162574 | Ga0068861_1001625742 | 188 |
| 382 | 3300005842 | Ga0068858_100003682 | Ga0068858_1000036828 | 188 |
| 383 | 3300005843 | Ga0068860_100012825 | Ga0068860_1000128257 | 188 |
| 384 | 3300005844 | Ga0068862_100039466 | Ga0068862_1000394663 | 188 |
| 385 | 3300006173 | Ga0070716_100023037 | Ga0070716_1000230373 | 188 |
| 386 | 3300006173 | Ga0070716_100454115 | Ga0070716_1004541151 | 188 |
| 387 | 3300006175 | Ga0070712_100191421 | Ga0070712_1001914212 | 188 |
| 388 | 3300006237 | Ga0097621_100002390 | Ga0097621_1000023908 | 188 |
| 389 | 3300006358 | Ga0068871_100001576 | Ga0068871_1000015769 | 188 |
| 390 | 3300006881 | Ga0068865_100038086 | Ga0068865_1000380862 | 188 |
| 391 | 3300006881 | Ga0068865_100791873 | Ga0068865_1007918731 | 188 |
| 392 | 3300006931 | Ga0097620_100162473 | Ga0097620_1001624732 | 188 |
| 393 | 3300009177 | Ga0105248_10001952 | Ga0105248_1000195227 | 188 |
| 394 | 3300009177 | Ga0105248_10124081 | Ga0105248_101240813 | 188 |
| 395 | 3300009545 | Ga0105237_10254079 | Ga0105237_102540792 | 188 |
| 396 | 3300009551 | Ga0105238_10276775 | Ga0105238_102767751 | 188 |
| 397 | 3300009553 | Ga0105249_10104828 | Ga0105249_101048282 | 188 |
| 398 | 3300013296 | Ga0157374_10009414 | Ga0157374_100094146 | 188 |
| 399 | 3300013297 | Ga0157378_10122317 | Ga0157378_101223172 | 188 |
| 400 | 3300013297 | Ga0157378_10477251 | Ga0157378_104772512 | 188 |
| 401 | 3300013306 | Ga0163162_10001709 | Ga0163162_100017098 | 188 |
| 402 | 3300013306 | Ga0163162_10045452 | Ga0163162_100454522 | 188 |
| 403 | 3300013308 | Ga0157375_10009216 | Ga0157375_100092162 | 188 |
| 404 | 3300013308 | Ga0157375_10708299 | Ga0157375_107082992 | 188 |
| 405 | 3300014968 | Ga0157379_10002943 | Ga0157379_100029436 | 188 |
| 406 | 3300014969 | Ga0157376_10003569 | Ga0157376_100035699 | 188 |
| 407 | 3300021388 | Ga0213875_10308522 | Ga0213875_103085221 | 188 |
| 408 | 3300025315 | Ga0207697_10003098 | Ga0207697_100030983 | 188 |
| 409 | 3300025321 | Ga0207656_10200211 | Ga0207656_102002112 | 188 |
| 410 | 3300025893 | Ga0207682_10074864 | Ga0207682_100748642 | 188 |
| 411 | 3300025907 | Ga0207645_10000588 | Ga0207645_100005887 | 188 |
| 412 | 3300025914 | Ga0207671_10907036 | Ga0207671_109070361 | 188 |
| 413 | 3300025915 | Ga0207693_10049736 | Ga0207693_100497362 | 188 |
| 414 | 3300025923 | Ga0207681_10008861 | Ga0207681_100088612 | 188 |
| 415 | 3300025925 | Ga0207650_10008427 | Ga0207650_100084272 | 188 |
| 416 | 3300025925 | Ga0207650_10023679 | Ga0207650_100236793 | 188 |
| 417 | 3300025926 | Ga0207659_10001888 | Ga0207659_100018884 | 188 |
| 418 | 3300025928 | Ga0207700_10775904 | Ga0207700_107759042 | 188 |
| 419 | 3300025931 | Ga0207644_10023814 | Ga0207644_100238144 | 188 |
| 420 | 3300025931 | Ga0207644_10071137 | Ga0207644_100711372 | 188 |
| 421 | 3300025931 | Ga0207644_10315610 | Ga0207644_103156103 | 188 |
| 422 | 3300025931 | Ga0207644_10555580 | Ga0207644_105555802 | 188 |
| 423 | 3300025933 | Ga0207706_10505190 | Ga0207706_105051902 | 188 |
| 424 | 3300025936 | Ga0207670_10122899 | Ga0207670_101228992 | 188 |
| 425 | 3300025936 | Ga0207670_10172597 | Ga0207670_101725971 | 188 |
| 426 | 3300025938 | Ga0207704_10003966 | Ga0207704_100039664 | 188 |
| 427 | 3300025940 | Ga0207691_10000899 | Ga0207691_1000089919 | 188 |
| 428 | 3300025940 | Ga0207691_10076199 | Ga0207691_100761993 | 188 |
| 429 | 3300025941 | Ga0207711_10002933 | Ga0207711_100029334 | 188 |
| 430 | 3300025941 | Ga0207711_10008791 | Ga0207711_100087911 | 188 |
| 431 | 3300025942 | Ga0207689_10001983 | Ga0207689_1000198310 | 188 |
| 432 | 3300025944 | Ga0207661_10064941 | Ga0207661_100649412 | 188 |
| 433 | 3300025960 | Ga0207651_10069283 | Ga0207651_100692832 | 188 |
| 434 | 3300025961 | Ga0207712_10309288 | Ga0207712_103092882 | 188 |
| 435 | 3300025972 | Ga0207668_10005107 | Ga0207668_100051072 | 188 |
| 436 | 3300025986 | Ga0207658_10003966 | Ga0207658_100039663 | 188 |
| 437 | 3300025986 | Ga0207658_10134960 | Ga0207658_101349602 | 188 |
| 438 | 3300026023 | Ga0207677_10043068 | Ga0207677_100430682 | 188 |
| 439 | 3300026035 | Ga0207703_10021693 | Ga0207703_100216936 | 188 |
| 440 | 3300026088 | Ga0207641_10003310 | Ga0207641_1000331010 | 188 |
| 441 | 3300026089 | Ga0207648_10000949 | Ga0207648_100009498 | 188 |
| 442 | 3300026118 | Ga0207675_100089500 | Ga0207675_1000895003 | 188 |
| 443 | 3300026121 | Ga0207683_10000210 | Ga0207683_1000021018 | 188 |
| 444 | 3300028379 | Ga0268266_10045267 | Ga0268266_100452672 | 188 |
| 445 | 3300028380 | Ga0268265_10202704 | Ga0268265_102027042 | 188 |
| 446 | 3300028381 | Ga0268264_10016111 | Ga0268264_100161114 | 188 |
| 447 | 3300034818 | Ga0373950_0014700 | Ga0373950_0014700_436_1017 | 188 |
| 448 | 3300037853 | Ga0436364_1028562 | Ga0436364_1028562_1532_2164 | 188 |
| 449 | 3300039437 | Ga0436365_0149298 | Ga0436365_0149298_2693_3274 | 188 |
| 450 | 3300044706 | Ga0466964_0323269 | Ga0466964_0323269_36_623 | 188 |
| 451 | 3300048903 | Ga0496100_0000750 | Ga0496100_0000750_1790_2377 | 188 |
| 452 | 3300048904 | Ga0496101_0002124 | Ga0496101_0002124_3507_4094 | 188 |
| 453 | 3300048905 | Ga0496102_0004194 | Ga0496102_0004194_11474_12061 | 188 |
| 454 | 3300048907 | Ga0496104_0035486 | Ga0496104_0035486_168_755 | 188 |
| 455 | 3300048909 | Ga0496106_0072695 | Ga0496106_0072695_1856_2443 | 188 |
| 456 | 3300048910 | Ga0496107_0031019 | Ga0496107_0031019_2193_2780 | 188 |
| 457 | 3300048911 | Ga0496108_0004140 | Ga0496108_0004140_3788_4375 | 188 |
| 458 | 3300048911 | Ga0496108_0075310 | Ga0496108_0075310_12_599 | 188 |
| 459 | 3300048911 | Ga0496108_0210282 | Ga0496108_0210282_77_685 | 188 |
| 460 | 3300048912 | Ga0496109_0043248 | Ga0496109_0043248_2265_2852 | 188 |
| 461 | 3300048912 | Ga0496109_0053904 | Ga0496109_0053904_2050_2637 | 188 |
| 462 | 3300048912 | Ga0496109_1083213 | Ga0496109_1083213_37_618 | 188 |
| 463 | 3300048913 | Ga0496110_0006110 | Ga0496110_0006110_2133_2720 | 188 |
| 464 | 3300048914 | Ga0496111_0003203 | Ga0496111_0003203_4766_5353 | 188 |
| 465 | 3300048915 | Ga0496112_0020496 | Ga0496112_0020496_1276_1863 | 188 |
| 466 | 3300048915 | Ga0496112_0308903 | Ga0496112_0308903_911_1498 | 188 |
| 467 | 3300048916 | Ga0496113_0011380 | Ga0496113_0011380_4832_5419 | 188 |
| 468 | 3300048916 | Ga0496113_0016379 | Ga0496113_0016379_775_1362 | 188 |
| 469 | 3300048917 | Ga0496114_0211590 | Ga0496114_0211590_942_1550 | 188 |
| 470 | 3300048918 | Ga0496115_0105287 | Ga0496115_0105287_1516_2097 | 188 |
| 471 | 3300005290 | Ga0065712_10483230 | Ga0065712_104832301 | 189 |
| 472 | 3300005328 | Ga0070676_10076395 | Ga0070676_100763952 | 189 |
| 473 | 3300005328 | Ga0070676_10126199 | Ga0070676_101261992 | 189 |
| 474 | 3300005329 | Ga0070683_100323707 | Ga0070683_1003237071 | 189 |
| 475 | 3300005331 | Ga0070670_100026430 | Ga0070670_1000264304 | 189 |
| 476 | 3300005334 | Ga0068869_100039523 | Ga0068869_1000395235 | 189 |
| 477 | 3300005334 | Ga0068869_100158040 | Ga0068869_1001580402 | 189 |
| 478 | 3300005335 | Ga0070666_10016386 | Ga0070666_100163863 | 189 |
| 479 | 3300005335 | Ga0070666_10107282 | Ga0070666_101072822 | 189 |
| 480 | 3300005337 | Ga0070682_100011560 | Ga0070682_1000115606 | 189 |
| 481 | 3300005337 | Ga0070682_100015105 | Ga0070682_1000151055 | 189 |
| 482 | 3300005337 | Ga0070682_100072844 | Ga0070682_1000728442 | 189 |
| 483 | 3300005338 | Ga0068868_100019189 | Ga0068868_1000191893 | 189 |
| 484 | 3300005338 | Ga0068868_100114985 | Ga0068868_1001149852 | 189 |
| 485 | 3300005339 | Ga0070660_100336016 | Ga0070660_1003360162 | 189 |
| 486 | 3300005340 | Ga0070689_100029734 | Ga0070689_1000297344 | 189 |
| 487 | 3300005343 | Ga0070687_100006230 | Ga0070687_1000062303 | 189 |
| 488 | 3300005344 | Ga0070661_100103487 | Ga0070661_1001034872 | 189 |
| 489 | 3300005344 | Ga0070661_101242938 | Ga0070661_1012429381 | 189 |
| 490 | 3300005354 | Ga0070675_100124241 | Ga0070675_1001242412 | 189 |
| 491 | 3300005354 | Ga0070675_100485032 | Ga0070675_1004850321 | 189 |
| 492 | 3300005355 | Ga0070671_100010441 | Ga0070671_1000104416 | 189 |
| 493 | 3300005355 | Ga0070671_100021219 | Ga0070671_1000212192 | 189 |
| 494 | 3300005355 | Ga0070671_100163771 | Ga0070671_1001637712 | 189 |
| 495 | 3300005356 | Ga0070674_100034449 | Ga0070674_1000344494 | 189 |
| 496 | 3300005356 | Ga0070674_100093096 | Ga0070674_1000930961 | 189 |
| 497 | 3300005364 | Ga0070673_100052687 | Ga0070673_1000526872 | 189 |
| 498 | 3300005364 | Ga0070673_100082620 | Ga0070673_1000826202 | 189 |
| 499 | 3300005364 | Ga0070673_100607081 | Ga0070673_1006070812 | 189 |
| 500 | 3300005365 | Ga0070688_100009043 | Ga0070688_1000090433 | 189 |
| 501 | 3300005366 | Ga0070659_100260774 | Ga0070659_1002607742 | 189 |
| 502 | 3300005366 | Ga0070659_100308486 | Ga0070659_1003084862 | 189 |
| 503 | 3300005367 | Ga0070667_100048749 | Ga0070667_1000487494 | 189 |
| 504 | 3300005367 | Ga0070667_100151466 | Ga0070667_1001514663 | 189 |
| 505 | 3300005434 | Ga0070709_10015799 | Ga0070709_100157993 | 189 |
| 506 | 3300005434 | Ga0070709_10226386 | Ga0070709_102263862 | 189 |
| 507 | 3300005434 | Ga0070709_10452902 | Ga0070709_104529022 | 189 |
| 508 | 3300005435 | Ga0070714_100031975 | Ga0070714_1000319754 | 189 |
| 509 | 3300005435 | Ga0070714_100289260 | Ga0070714_1002892601 | 189 |
| 510 | 3300005436 | Ga0070713_100000039 | Ga0070713_10000003913 | 189 |
| 511 | 3300005436 | Ga0070713_100005026 | Ga0070713_1000050264 | 189 |
| 512 | 3300005436 | Ga0070713_100030937 | Ga0070713_1000309373 | 189 |
| 513 | 3300005436 | Ga0070713_100153211 | Ga0070713_1001532112 | 189 |
| 514 | 3300005437 | Ga0070710_10001919 | Ga0070710_100019196 | 189 |
| 515 | 3300005439 | Ga0070711_100250160 | Ga0070711_1002501602 | 189 |
| 516 | 3300005439 | Ga0070711_100429923 | Ga0070711_1004299231 | 189 |
| 517 | 3300005439 | Ga0070711_100537556 | Ga0070711_1005375562 | 189 |
| 518 | 3300005440 | Ga0070705_100145847 | Ga0070705_1001458472 | 189 |
| 519 | 3300005455 | Ga0070663_100020275 | Ga0070663_1000202756 | 189 |
| 520 | 3300005455 | Ga0070663_100371418 | Ga0070663_1003714181 | 189 |
| 521 | 3300005455 | Ga0070663_100980063 | Ga0070663_1009800631 | 189 |
| 522 | 3300005456 | Ga0070678_100000728 | Ga0070678_10000072811 | 189 |
| 523 | 3300005456 | Ga0070678_100070575 | Ga0070678_1000705753 | 189 |
| 524 | 3300005456 | Ga0070678_100237585 | Ga0070678_1002375852 | 189 |
| 525 | 3300005458 | Ga0070681_10009517 | Ga0070681_100095174 | 189 |
| 526 | 3300005458 | Ga0070681_10061084 | Ga0070681_100610842 | 189 |
| 527 | 3300005459 | Ga0068867_100026711 | Ga0068867_1000267114 | 189 |
| 528 | 3300005459 | Ga0068867_100357024 | Ga0068867_1003570242 | 189 |
| 529 | 3300005466 | Ga0070685_10027399 | Ga0070685_100273992 | 189 |
| 530 | 3300005530 | Ga0070679_100088967 | Ga0070679_1000889673 | 189 |
| 531 | 3300005530 | Ga0070679_100207694 | Ga0070679_1002076942 | 189 |
| 532 | 3300005535 | Ga0070684_100085454 | Ga0070684_1000854542 | 189 |
| 533 | 3300005535 | Ga0070684_100305443 | Ga0070684_1003054432 | 189 |
| 534 | 3300005536 | Ga0070697_100658826 | Ga0070697_1006588261 | 189 |
| 535 | 3300005539 | Ga0068853_100052274 | Ga0068853_1000522743 | 189 |
| 536 | 3300005539 | Ga0068853_100269607 | Ga0068853_1002696072 | 189 |
| 537 | 3300005543 | Ga0070672_100001043 | Ga0070672_1000010437 | 189 |
| 538 | 3300005543 | Ga0070672_100228011 | Ga0070672_1002280112 | 189 |
| 539 | 3300005543 | Ga0070672_100437397 | Ga0070672_1004373972 | 189 |
| 540 | 3300005544 | Ga0070686_100005547 | Ga0070686_1000055475 | 189 |
| 541 | 3300005545 | Ga0070695_100298841 | Ga0070695_1002988412 | 189 |
| 542 | 3300005546 | Ga0070696_100082166 | Ga0070696_1000821663 | 189 |
| 543 | 3300005546 | Ga0070696_100677242 | Ga0070696_1006772421 | 189 |
| 544 | 3300005547 | Ga0070693_100006850 | Ga0070693_1000068504 | 189 |
| 545 | 3300005547 | Ga0070693_100139528 | Ga0070693_1001395282 | 189 |
| 546 | 3300005548 | Ga0070665_100002989 | Ga0070665_10000298910 | 189 |
| 547 | 3300005548 | Ga0070665_100512216 | Ga0070665_1005122162 | 189 |
| 548 | 3300005549 | Ga0070704_100363471 | Ga0070704_1003634711 | 189 |
| 549 | 3300005549 | Ga0070704_100532462 | Ga0070704_1005324621 | 189 |
| 550 | 3300005563 | Ga0068855_100455754 | Ga0068855_1004557542 | 189 |
| 551 | 3300005564 | Ga0070664_100189837 | Ga0070664_1001898372 | 189 |
| 552 | 3300005564 | Ga0070664_100723375 | Ga0070664_1007233752 | 189 |
| 553 | 3300005578 | Ga0068854_100273307 | Ga0068854_1002733072 | 189 |
| 554 | 3300005614 | Ga0068856_100150900 | Ga0068856_1001509003 | 189 |
| 555 | 3300005614 | Ga0068856_100305419 | Ga0068856_1003054192 | 189 |
| 556 | 3300005615 | Ga0070702_100012876 | Ga0070702_1000128763 | 189 |
| 557 | 3300005618 | Ga0068864_100021942 | Ga0068864_1000219425 | 189 |
| 558 | 3300005718 | Ga0068866_10045919 | Ga0068866_100459192 | 189 |
| 559 | 3300005841 | Ga0068863_100190757 | Ga0068863_1001907572 | 189 |
| 560 | 3300005842 | Ga0068858_100056529 | Ga0068858_1000565295 | 189 |
| 561 | 3300005842 | Ga0068858_100402662 | Ga0068858_1004026622 | 189 |
| 562 | 3300005842 | Ga0068858_100819590 | Ga0068858_1008195901 | 189 |
| 563 | 3300005843 | Ga0068860_100106733 | Ga0068860_1001067332 | 189 |
| 564 | 3300006028 | Ga0070717_10005760 | Ga0070717_100057605 | 189 |
| 565 | 3300006028 | Ga0070717_10388727 | Ga0070717_103887272 | 189 |
| 566 | 3300006028 | Ga0070717_10697980 | Ga0070717_106979802 | 189 |
| 567 | 3300006163 | Ga0070715_10022051 | Ga0070715_100220512 | 189 |
| 568 | 3300006173 | Ga0070716_100002302 | Ga0070716_1000023026 | 189 |
| 569 | 3300006175 | Ga0070712_100009890 | Ga0070712_1000098905 | 189 |
| 570 | 3300006175 | Ga0070712_100013119 | Ga0070712_1000131195 | 189 |
| 571 | 3300006175 | Ga0070712_100043893 | Ga0070712_1000438932 | 189 |
| 572 | 3300006175 | Ga0070712_100067602 | Ga0070712_1000676022 | 189 |
| 573 | 3300006175 | Ga0070712_100170328 | Ga0070712_1001703282 | 189 |
| 574 | 3300006175 | Ga0070712_100318807 | Ga0070712_1003188072 | 189 |
| 575 | 3300006237 | Ga0097621_100010225 | Ga0097621_1000102252 | 189 |
| 576 | 3300006237 | Ga0097621_100113837 | Ga0097621_1001138372 | 189 |
| 577 | 3300006237 | Ga0097621_100194548 | Ga0097621_1001945482 | 189 |
| 578 | 3300006237 | Ga0097621_100586033 | Ga0097621_1005860332 | 189 |
| 579 | 3300006358 | Ga0068871_100003994 | Ga0068871_1000039943 | 189 |
| 580 | 3300006358 | Ga0068871_100041628 | Ga0068871_1000416282 | 189 |
| 581 | 3300006358 | Ga0068871_100317186 | Ga0068871_1003171861 | 189 |
| 582 | 3300006358 | Ga0068871_100319267 | Ga0068871_1003192673 | 189 |
| 583 | 3300006871 | Ga0075434_100081494 | Ga0075434_1000814942 | 189 |
| 584 | 3300006871 | Ga0075434_100736699 | Ga0075434_1007366992 | 189 |
| 585 | 3300006881 | Ga0068865_100094688 | Ga0068865_1000946882 | 189 |
| 586 | 3300006881 | Ga0068865_100564237 | Ga0068865_1005642372 | 189 |
| 587 | 3300006914 | Ga0075436_100181462 | Ga0075436_1001814622 | 189 |
| 588 | 3300009092 | Ga0105250_10024795 | Ga0105250_100247953 | 189 |
| 589 | 3300009098 | Ga0105245_10029333 | Ga0105245_100293332 | 189 |
| 590 | 3300009098 | Ga0105245_10127957 | Ga0105245_101279572 | 189 |
| 591 | 3300009098 | Ga0105245_10363129 | Ga0105245_103631292 | 189 |
| 592 | 3300009101 | Ga0105247_10029031 | Ga0105247_100290313 | 189 |
| 593 | 3300009101 | Ga0105247_10173383 | Ga0105247_101733832 | 189 |
| 594 | 3300009101 | Ga0105247_10197289 | Ga0105247_101972892 | 189 |
| 595 | 3300009148 | Ga0105243_10023934 | Ga0105243_100239345 | 189 |
| 596 | 3300009148 | Ga0105243_10026026 | Ga0105243_100260263 | 189 |
| 597 | 3300009174 | Ga0105241_10014601 | Ga0105241_100146012 | 189 |
| 598 | 3300009174 | Ga0105241_10018681 | Ga0105241_100186812 | 189 |
| 599 | 3300009174 | Ga0105241_10166234 | Ga0105241_101662342 | 189 |
| 600 | 3300009176 | Ga0105242_10010141 | Ga0105242_100101415 | 189 |
| 601 | 3300009176 | Ga0105242_10014350 | Ga0105242_100143502 | 189 |
| 602 | 3300009176 | Ga0105242_11102524 | Ga0105242_111025241 | 189 |
| 603 | 3300009177 | Ga0105248_10043581 | Ga0105248_100435814 | 189 |
| 604 | 3300009177 | Ga0105248_10097657 | Ga0105248_100976572 | 189 |
| 605 | 3300009177 | Ga0105248_10265100 | Ga0105248_102651002 | 189 |
| 606 | 3300009177 | Ga0105248_10295765 | Ga0105248_102957652 | 189 |
| 607 | 3300009545 | Ga0105237_10054170 | Ga0105237_100541704 | 189 |
| 608 | 3300009545 | Ga0105237_10111632 | Ga0105237_101116322 | 189 |
| 609 | 3300009545 | Ga0105237_10138192 | Ga0105237_101381924 | 189 |
| 610 | 3300009551 | Ga0105238_10082146 | Ga0105238_100821462 | 189 |
| 611 | 3300009551 | Ga0105238_10288779 | Ga0105238_102887792 | 189 |
| 612 | 3300009553 | Ga0105249_10178494 | Ga0105249_101784942 | 189 |
| 613 | 3300009553 | Ga0105249_10379928 | Ga0105249_103799282 | 189 |
| 614 | 3300010375 | Ga0105239_10062965 | Ga0105239_100629652 | 189 |
| 615 | 3300010375 | Ga0105239_10200568 | Ga0105239_102005682 | 189 |
| 616 | 3300010375 | Ga0105239_10379095 | Ga0105239_103790952 | 189 |
| 617 | 3300011119 | Ga0105246_10173807 | Ga0105246_101738072 | 189 |
| 618 | 3300012478 | Ga0157328_1000881 | Ga0157328_10008812 | 189 |
| 619 | 3300012507 | Ga0157342_1006406 | Ga0157342_10064062 | 189 |
| 620 | 3300013100 | Ga0157373_10115335 | Ga0157373_101153352 | 189 |
| 621 | 3300013104 | Ga0157370_10540463 | Ga0157370_105404632 | 189 |
| 622 | 3300013296 | Ga0157374_10008845 | Ga0157374_100088454 | 189 |
| 623 | 3300013296 | Ga0157374_10128543 | Ga0157374_101285432 | 189 |
| 624 | 3300013296 | Ga0157374_10309945 | Ga0157374_103099452 | 189 |
| 625 | 3300013297 | Ga0157378_10029323 | Ga0157378_100293232 | 189 |
| 626 | 3300013297 | Ga0157378_10161621 | Ga0157378_101616212 | 189 |
| 627 | 3300013297 | Ga0157378_10381392 | Ga0157378_103813922 | 189 |
| 628 | 3300013308 | Ga0157375_10079270 | Ga0157375_100792702 | 189 |
| 629 | 3300013308 | Ga0157375_10269533 | Ga0157375_102695332 | 189 |
| 630 | 3300013308 | Ga0157375_10299424 | Ga0157375_102994242 | 189 |
| 631 | 3300014325 | Ga0163163_10347580 | Ga0163163_103475802 | 189 |
| 632 | 3300014325 | Ga0163163_10542852 | Ga0163163_105428522 | 189 |
| 633 | 3300014326 | Ga0157380_10334421 | Ga0157380_103344212 | 189 |
| 634 | 3300014745 | Ga0157377_10105301 | Ga0157377_101053013 | 189 |
| 635 | 3300014968 | Ga0157379_10025689 | Ga0157379_100256894 | 189 |
| 636 | 3300014968 | Ga0157379_10346149 | Ga0157379_103461492 | 189 |
| 637 | 3300014968 | Ga0157379_10351343 | Ga0157379_103513432 | 189 |
| 638 | 3300014969 | Ga0157376_10153633 | Ga0157376_101536332 | 189 |
| 639 | 3300014969 | Ga0157376_10177971 | Ga0157376_101779712 | 189 |
| 640 | 3300014969 | Ga0157376_10202990 | Ga0157376_102029902 | 189 |
| 641 | 3300017792 | Ga0163161_10069944 | Ga0163161_100699442 | 189 |
| 642 | 3300021377 | Ga0213874_10084189 | Ga0213874_100841892 | 189 |
| 643 | 3300025898 | Ga0207692_10001674 | Ga0207692_100016745 | 189 |
| 644 | 3300025898 | Ga0207692_10014567 | Ga0207692_100145672 | 189 |
| 645 | 3300025899 | Ga0207642_10411742 | Ga0207642_104117422 | 189 |
| 646 | 3300025900 | Ga0207710_10001666 | Ga0207710_100016668 | 189 |
| 647 | 3300025900 | Ga0207710_10458589 | Ga0207710_104585891 | 189 |
| 648 | 3300025903 | Ga0207680_10020003 | Ga0207680_100200032 | 189 |
| 649 | 3300025903 | Ga0207680_10092028 | Ga0207680_100920283 | 189 |
| 650 | 3300025905 | Ga0207685_10000852 | Ga0207685_100008527 | 189 |
| 651 | 3300025906 | Ga0207699_10006404 | Ga0207699_100064044 | 189 |
| 652 | 3300025906 | Ga0207699_10369612 | Ga0207699_103696121 | 189 |
| 653 | 3300025907 | Ga0207645_10052631 | Ga0207645_100526312 | 189 |
| 654 | 3300025907 | Ga0207645_10191258 | Ga0207645_101912582 | 189 |
| 655 | 3300025911 | Ga0207654_10002446 | Ga0207654_100024468 | 189 |
| 656 | 3300025911 | Ga0207654_10236912 | Ga0207654_102369122 | 189 |
| 657 | 3300025912 | Ga0207707_10010605 | Ga0207707_100106052 | 189 |
| 658 | 3300025914 | Ga0207671_10039867 | Ga0207671_100398672 | 189 |
| 659 | 3300025915 | Ga0207693_10002257 | Ga0207693_1000225712 | 189 |
| 660 | 3300025915 | Ga0207693_10007885 | Ga0207693_100078853 | 189 |
| 661 | 3300025915 | Ga0207693_10034136 | Ga0207693_100341361 | 189 |
| 662 | 3300025915 | Ga0207693_10059404 | Ga0207693_100594042 | 189 |
| 663 | 3300025915 | Ga0207693_10062001 | Ga0207693_100620013 | 189 |
| 664 | 3300025915 | Ga0207693_10092385 | Ga0207693_100923852 | 189 |
| 665 | 3300025916 | Ga0207663_10004484 | Ga0207663_100044846 | 189 |
| 666 | 3300025916 | Ga0207663_10049960 | Ga0207663_100499603 | 189 |
| 667 | 3300025916 | Ga0207663_10272334 | Ga0207663_102723342 | 189 |
| 668 | 3300025916 | Ga0207663_10546715 | Ga0207663_105467152 | 189 |
| 669 | 3300025919 | Ga0207657_10058704 | Ga0207657_100587042 | 189 |
| 670 | 3300025919 | Ga0207657_10103652 | Ga0207657_101036523 | 189 |
| 671 | 3300025920 | Ga0207649_10077536 | Ga0207649_100775362 | 189 |
| 672 | 3300025922 | Ga0207646_10303334 | Ga0207646_103033342 | 189 |
| 673 | 3300025924 | Ga0207694_10269481 | Ga0207694_102694812 | 189 |
| 674 | 3300025925 | Ga0207650_10032631 | Ga0207650_100326315 | 189 |
| 675 | 3300025926 | Ga0207659_10558219 | Ga0207659_105582192 | 189 |
| 676 | 3300025927 | Ga0207687_10017501 | Ga0207687_100175013 | 189 |
| 677 | 3300025927 | Ga0207687_10071298 | Ga0207687_100712982 | 189 |
| 678 | 3300025928 | Ga0207700_10000082 | Ga0207700_1000008233 | 189 |
| 679 | 3300025928 | Ga0207700_10006593 | Ga0207700_100065931 | 189 |
| 680 | 3300025928 | Ga0207700_10071967 | Ga0207700_100719673 | 189 |
| 681 | 3300025928 | Ga0207700_10380501 | Ga0207700_103805012 | 189 |
| 682 | 3300025928 | Ga0207700_10449311 | Ga0207700_104493112 | 189 |
| 683 | 3300025929 | Ga0207664_10007607 | Ga0207664_100076075 | 189 |
| 684 | 3300025929 | Ga0207664_10175216 | Ga0207664_101752162 | 189 |
| 685 | 3300025931 | Ga0207644_10005948 | Ga0207644_100059485 | 189 |
| 686 | 3300025931 | Ga0207644_10199204 | Ga0207644_101992042 | 189 |
| 687 | 3300025931 | Ga0207644_10510639 | Ga0207644_105106392 | 189 |
| 688 | 3300025932 | Ga0207690_10027669 | Ga0207690_100276693 | 189 |
| 689 | 3300025933 | Ga0207706_10007456 | Ga0207706_100074562 | 189 |
| 690 | 3300025934 | Ga0207686_10039576 | Ga0207686_100395762 | 189 |
| 691 | 3300025935 | Ga0207709_10022885 | Ga0207709_100228852 | 189 |
| 692 | 3300025936 | Ga0207670_10059938 | Ga0207670_100599382 | 189 |
| 693 | 3300025937 | Ga0207669_10158660 | Ga0207669_101586601 | 189 |
| 694 | 3300025937 | Ga0207669_10640651 | Ga0207669_106406512 | 189 |
| 695 | 3300025938 | Ga0207704_10068626 | Ga0207704_100686262 | 189 |
| 696 | 3300025939 | Ga0207665_10004818 | Ga0207665_100048186 | 189 |
| 697 | 3300025940 | Ga0207691_10039440 | Ga0207691_100394403 | 189 |
| 698 | 3300025940 | Ga0207691_10355046 | Ga0207691_103550462 | 189 |
| 699 | 3300025941 | Ga0207711_10009116 | Ga0207711_100091165 | 189 |
| 700 | 3300025941 | Ga0207711_10076825 | Ga0207711_100768252 | 189 |
| 701 | 3300025941 | Ga0207711_11076564 | Ga0207711_110765642 | 189 |
| 702 | 3300025942 | Ga0207689_10050225 | Ga0207689_100502255 | 189 |
| 703 | 3300025942 | Ga0207689_10128129 | Ga0207689_101281292 | 189 |
| 704 | 3300025944 | Ga0207661_10689277 | Ga0207661_106892772 | 189 |
| 705 | 3300025945 | Ga0207679_10678892 | Ga0207679_106788922 | 189 |
| 706 | 3300025949 | Ga0207667_10634872 | Ga0207667_106348722 | 189 |
| 707 | 3300025960 | Ga0207651_10090793 | Ga0207651_100907932 | 189 |
| 708 | 3300025960 | Ga0207651_10761422 | Ga0207651_107614221 | 189 |
| 709 | 3300025961 | Ga0207712_10157687 | Ga0207712_101576872 | 189 |
| 710 | 3300025961 | Ga0207712_10486734 | Ga0207712_104867341 | 189 |
| 711 | 3300025981 | Ga0207640_10786704 | Ga0207640_107867042 | 189 |
| 712 | 3300025986 | Ga0207658_10137294 | Ga0207658_101372942 | 189 |
| 713 | 3300025986 | Ga0207658_10274986 | Ga0207658_102749862 | 189 |
| 714 | 3300026023 | Ga0207677_10039478 | Ga0207677_100394785 | 189 |
| 715 | 3300026035 | Ga0207703_10011838 | Ga0207703_100118385 | 189 |
| 716 | 3300026041 | Ga0207639_10087372 | Ga0207639_100873722 | 189 |
| 717 | 3300026067 | Ga0207678_10128643 | Ga0207678_101286432 | 189 |
| 718 | 3300026067 | Ga0207678_10144614 | Ga0207678_101446142 | 189 |
| 719 | 3300026075 | Ga0207708_10230239 | Ga0207708_102302392 | 189 |
| 720 | 3300026078 | Ga0207702_10436872 | Ga0207702_104368722 | 189 |
| 721 | 3300026078 | Ga0207702_10473895 | Ga0207702_104738952 | 189 |
| 722 | 3300026088 | Ga0207641_10138937 | Ga0207641_101389372 | 189 |
| 723 | 3300026095 | Ga0207676_10019980 | Ga0207676_100199803 | 189 |
| 724 | 3300026095 | Ga0207676_10820288 | Ga0207676_108202882 | 189 |
| 725 | 3300026116 | Ga0207674_10070740 | Ga0207674_100707402 | 189 |
| 726 | 3300026121 | Ga0207683_10000480 | Ga0207683_1000048022 | 189 |
| 727 | 3300026121 | Ga0207683_10062449 | Ga0207683_100624492 | 189 |
| 728 | 3300026121 | Ga0207683_10270802 | Ga0207683_102708022 | 189 |
| 729 | 3300028379 | Ga0268266_10005275 | Ga0268266_100052754 | 189 |
| 730 | 3300028379 | Ga0268266_10028221 | Ga0268266_100282211 | 189 |
| 731 | 3300031507 | Ga0307509_10130561 | Ga0307509_101305613 | 189 |
| 732 | 3300031595 | Ga0265313_10015163 | Ga0265313_100151633 | 189 |
| 733 | 3300034957 | Ga0373938_0063768 | Ga0373938_0063768_31_600 | 189 |
| 734 | 3300035083 | Ga0373926_0053387 | Ga0373926_0053387_787_1371 | 189 |
| 735 | 3300035086 | Ga0373934_0014177 | Ga0373934_0014177_1158_1742 | 189 |
| 736 | 3300035089 | Ga0373944_0003706 | Ga0373944_0003706_1236_1805 | 189 |
| 737 | 3300035089 | Ga0373944_0022547 | Ga0373944_0022547_746_1330 | 189 |
| 738 | 3300035090 | Ga0373949_0053951 | Ga0373949_0053951_292_861 | 189 |
| 739 | 3300035111 | Ga0373923_0004472 | Ga0373923_0004472_2894_3478 | 189 |
| 740 | 3300035113 | Ga0373936_0088302 | Ga0373936_0088302_195_779 | 189 |
| 741 | 3300035114 | Ga0373939_0157285 | Ga0373939_0157285_208_792 | 189 |
| 742 | 3300035115 | Ga0373941_0044152 | Ga0373941_0044152_400_969 | 189 |
| 743 | 3300035116 | Ga0373945_0014083 | Ga0373945_0014083_339_908 | 189 |
| 744 | 3300035117 | Ga0373953_0005116 | Ga0373953_0005116_2679_3263 | 189 |
| 745 | 3300035118 | Ga0373954_0005514 | Ga0373954_0005514_2940_3524 | 189 |
| 746 | 3300035120 | Ga0373957_0001985 | Ga0373957_0001985_773_1357 | 189 |
| 747 | 3300035121 | Ga0373960_0011455 | Ga0373960_0011455_207_776 | 189 |
| 748 | 3300035170 | Ga0373943_0016010 | Ga0373943_0016010_575_1144 | 189 |
| 749 | 3300035170 | Ga0373943_0016358 | Ga0373943_0016358_2292_2876 | 189 |
| 750 | 3300035171 | Ga0373946_0010307 | Ga0373946_0010307_1835_2404 | 189 |
| 751 | 3300035241 | Ga0373961_0041732 | Ga0373961_0041732_75_644 | 189 |
| 752 | 3300035410 | Ga0373924_0061551 | Ga0373924_0061551_341_925 | 189 |
| 753 | 3300035691 | Ga0373931_0045589 | Ga0373931_0045589_1690_2274 | 189 |
| 754 | 3300035691 | Ga0373931_0060654 | Ga0373931_0060654_1398_1967 | 189 |
| 755 | 3300035692 | Ga0373935_0001749 | Ga0373935_0001749_2191_2760 | 189 |
| 756 | 3300035692 | Ga0373935_0050340 | Ga0373935_0050340_822_1406 | 189 |
| 757 | 3300035695 | Ga0373927_0049597 | Ga0373927_0049597_1507_2091 | 189 |
| 758 | 3300035695 | Ga0373927_0114758 | Ga0373927_0114758_998_1567 | 189 |
| 759 | 3300035724 | Ga0373933_0009136 | Ga0373933_0009136_3171_3755 | 189 |
| 760 | 3300035724 | Ga0373933_0055799 | Ga0373933_0055799_354_938 | 189 |
| 761 | 3300035725 | Ga0373947_0001187 | Ga0373947_0001187_11998_12567 | 189 |
| 762 | 3300035725 | Ga0373947_0088994 | Ga0373947_0088994_1124_1708 | 189 |
| 763 | 3300036401 | Ga0373937_0027974 | Ga0373937_0027974_1746_2330 | 189 |
| 764 | 3300037068 | Ga0373925_0004244 | Ga0373925_0004244_2232_2801 | 189 |
| 765 | 3300037068 | Ga0373925_0280237 | Ga0373925_0280237_406_990 | 189 |
| 766 | 3300037068 | Ga0373925_0720753 | Ga0373925_0720753_32_625 | 189 |
| 767 | 3300039450 | Ga0436363_1542522 | Ga0436363_1542522_502_1095 | 189 |
| 768 | 3300041512 | Ga0451853_0763982 | Ga0451853_0763982_137_721 | 189 |
| 769 | 3300046454 | Ga0495592_0010242 | Ga0495592_0010242_4596_5180 | 189 |
| 770 | 3300046455 | Ga0495603_0019912 | Ga0495603_0019912_1854_2438 | 189 |
| 771 | 3300046455 | Ga0495603_0061344 | Ga0495603_0061344_1133_1702 | 189 |
| 772 | 3300046459 | Ga0495629_0000968 | Ga0495629_0000968_14935_15504 | 189 |
| 773 | 3300046459 | Ga0495629_0170466 | Ga0495629_0170466_261_845 | 189 |
| 774 | 3300046459 | Ga0495629_0194292 | Ga0495629_0194292_52_636 | 189 |
| 775 | 3300046459 | Ga0495629_0237156 | Ga0495629_0237156_444_1028 | 189 |
| 776 | 3300046461 | Ga0495641_0017865 | Ga0495641_0017865_1545_2129 | 189 |
| 777 | 3300046462 | Ga0495651_0002173 | Ga0495651_0002173_9482_10066 | 189 |
| 778 | 3300046472 | Ga0495580_0169764 | Ga0495580_0169764_525_1109 | 189 |
| 779 | 3300046473 | Ga0495582_0002401 | Ga0495582_0002401_9172_9741 | 189 |
| 780 | 3300046473 | Ga0495582_0125756 | Ga0495582_0125756_290_874 | 189 |
| 781 | 3300046475 | Ga0495639_0010527 | Ga0495639_0010527_2236_2820 | 189 |
| 782 | 3300046476 | Ga0495662_0033198 | Ga0495662_0033198_682_1266 | 189 |
| 783 | 3300046477 | Ga0495664_0048328 | Ga0495664_0048328_177_761 | 189 |
| 784 | 3300046477 | Ga0495664_0050516 | Ga0495664_0050516_183_767 | 189 |
| 785 | 3300046491 | Ga0495584_0116793 | Ga0495584_0116793_425_1009 | 189 |
| 786 | 3300046511 | Ga0495608_0009348 | Ga0495608_0009348_3105_3689 | 189 |
| 787 | 3300046514 | Ga0495618_0137727 | Ga0495618_0137727_407_991 | 189 |
| 788 | 3300046514 | Ga0495618_0172602 | Ga0495618_0172602_401_985 | 189 |
| 789 | 3300046516 | Ga0495628_0019118 | Ga0495628_0019118_4596_5180 | 189 |
| 790 | 3300046517 | Ga0495630_0103761 | Ga0495630_0103761_198_782 | 189 |
| 791 | 3300046526 | Ga0495666_0069639 | Ga0495666_0069639_566_1150 | 189 |
| 792 | 3300046529 | Ga0495652_0040582 | Ga0495652_0040582_1756_2340 | 189 |
| 793 | 3300046529 | Ga0495652_0204387 | Ga0495652_0204387_171_755 | 189 |
| 794 | 3300046531 | Ga0495665_0047177 | Ga0495665_0047177_669_1253 | 189 |
| 795 | 3300046533 | Ga0495640_0029383 | Ga0495640_0029383_271_855 | 189 |
| 796 | 3300046533 | Ga0495640_0039156 | Ga0495640_0039156_140_724 | 189 |
| 797 | 3300046535 | Ga0495586_0058031 | Ga0495586_0058031_489_1073 | 189 |
| 798 | 3300046535 | Ga0495586_0059730 | Ga0495586_0059730_49_633 | 189 |
| 799 | 3300046536 | Ga0495587_0008084 | Ga0495587_0008084_3170_3754 | 189 |
| 800 | 3300046539 | Ga0495621_0102654 | Ga0495621_0102654_297_881 | 189 |
| 801 | 3300046543 | Ga0495645_0015451 | Ga0495645_0015451_2712_3296 | 189 |
| 802 | 3300046557 | Ga0495622_0112543 | Ga0495622_0112543_326_895 | 189 |
| 803 | 3300046559 | Ga0495667_0000293 | Ga0495667_0000293_2771_3355 | 189 |
| 804 | 3300046642 | Ga0495634_0041569 | Ga0495634_0041569_1463_2047 | 189 |
| 805 | 3300046642 | Ga0495634_0116882 | Ga0495634_0116882_158_742 | 189 |
| 806 | 3300046663 | Ga0495635_0067993 | Ga0495635_0067993_1501_2085 | 189 |
| 807 | 3300046663 | Ga0495635_0248520 | Ga0495635_0248520_573_1157 | 189 |
| 808 | 3300046674 | Ga0495588_0023331 | Ga0495588_0023331_1940_2524 | 189 |
| 809 | 3300046675 | Ga0495657_0009103 | Ga0495657_0009103_4322_4906 | 189 |
| 810 | 3300046678 | Ga0495599_0006529 | Ga0495599_0006529_6094_6678 | 189 |
| 811 | 3300046679 | Ga0495623_0000668 | Ga0495623_0000668_14781_15365 | 189 |
| 812 | 3300046680 | Ga0495646_0022084 | Ga0495646_0022084_1175_1759 | 189 |
| 813 | 3300046681 | Ga0495647_0061937 | Ga0495647_0061937_527_1096 | 189 |
| 814 | 3300046683 | Ga0495658_0016691 | Ga0495658_0016691_326_895 | 189 |
| 815 | 3300046683 | Ga0495658_0018823 | Ga0495658_0018823_846_1430 | 189 |
| 816 | 3300046689 | Ga0495613_0129516 | Ga0495613_0129516_526_1110 | 189 |
| 817 | 3300046690 | Ga0495624_0059043 | Ga0495624_0059043_1320_1904 | 189 |
| 818 | 3300046690 | Ga0495624_0115959 | Ga0495624_0115959_891_1475 | 189 |
| 819 | 3300046809 | Ga0495600_0004765 | Ga0495600_0004765_4875_5459 | 189 |
| 820 | 3300047315 | Ga0495581_0056406 | Ga0495581_0056406_931_1515 | 189 |
| 821 | 3300047315 | Ga0495581_0159070 | Ga0495581_0159070_603_1172 | 189 |
| 822 | 3300047317 | Ga0495604_0005199 | Ga0495604_0005199_5372_5956 | 189 |
| 823 | 3300047319 | Ga0495674_0009612 | Ga0495674_0009612_8425_9009 | 189 |
| 824 | 3300047319 | Ga0495674_0311394 | Ga0495674_0311394_353_937 | 189 |
| 825 | 3300047321 | Ga0495676_0038286 | Ga0495676_0038286_1069_1653 | 189 |
| 826 | 3300047322 | Ga0495680_0003160 | Ga0495680_0003160_401_985 | 189 |
| 827 | 3300047322 | Ga0495680_0072609 | Ga0495680_0072609_1626_2195 | 189 |
| 828 | 3300047322 | Ga0495680_0273544 | Ga0495680_0273544_277_861 | 189 |
| 829 | 3300047444 | Ga0495675_0002509 | Ga0495675_0002509_1903_2487 | 189 |
| 830 | 3300047471 | Ga0495684_0037697 | Ga0495684_0037697_2724_3308 | 189 |
| 831 | 3300047471 | Ga0495684_0240931 | Ga0495684_0240931_273_857 | 189 |
| 832 | 3300047471 | Ga0495684_0258369 | Ga0495684_0258369_50_619 | 189 |
| 833 | 3300047673 | Ga0495593_0063278 | Ga0495593_0063278_492_1076 | 189 |
| 834 | 3300048088 | Ga0495602_0020889 | Ga0495602_0020889_3292_3876 | 189 |
| 835 | 3300048903 | Ga0496100_0355975 | Ga0496100_0355975_108_692 | 189 |
| 836 | 3300048904 | Ga0496101_0001812 | Ga0496101_0001812_529_1113 | 189 |
| 837 | 3300048905 | Ga0496102_0217808 | Ga0496102_0217808_452_1021 | 189 |
| 838 | 3300048905 | Ga0496102_0604557 | Ga0496102_0604557_266_835 | 189 |
| 839 | 3300048906 | Ga0496103_0332495 | Ga0496103_0332495_77_661 | 189 |
| 840 | 3300048907 | Ga0496104_0059292 | Ga0496104_0059292_2548_3117 | 189 |
| 841 | 3300048907 | Ga0496104_0061938 | Ga0496104_0061938_896_1480 | 189 |
| 842 | 3300048907 | Ga0496104_0065245 | Ga0496104_0065245_1807_2376 | 189 |
| 843 | 3300048907 | Ga0496104_0092744 | Ga0496104_0092744_186_755 | 189 |
| 844 | 3300048907 | Ga0496104_0607820 | Ga0496104_0607820_413_982 | 189 |
| 845 | 3300048907 | Ga0496104_0914367 | Ga0496104_0914367_169_753 | 189 |
| 846 | 3300048908 | Ga0496105_0020983 | Ga0496105_0020983_4218_4787 | 189 |
| 847 | 3300048909 | Ga0496106_0006214 | Ga0496106_0006214_3072_3641 | 189 |
| 848 | 3300048909 | Ga0496106_0125465 | Ga0496106_0125465_1189_1773 | 189 |
| 849 | 3300048910 | Ga0496107_0018485 | Ga0496107_0018485_2871_3455 | 189 |
| 850 | 3300048910 | Ga0496107_0029092 | Ga0496107_0029092_3289_3858 | 189 |
| 851 | 3300048910 | Ga0496107_0289079 | Ga0496107_0289079_561_1145 | 189 |
| 852 | 3300048911 | Ga0496108_0127310 | Ga0496108_0127310_394_963 | 189 |
| 853 | 3300048912 | Ga0496109_0067238 | Ga0496109_0067238_165_752 | 189 |
| 854 | 3300048912 | Ga0496109_0087812 | Ga0496109_0087812_1807_2376 | 189 |
| 855 | 3300048913 | Ga0496110_0161538 | Ga0496110_0161538_217_801 | 189 |
| 856 | 3300048913 | Ga0496110_0237197 | Ga0496110_0237197_372_941 | 189 |
| 857 | 3300048914 | Ga0496111_0008722 | Ga0496111_0008722_4353_4922 | 189 |
| 858 | 3300048915 | Ga0496112_0048980 | Ga0496112_0048980_500_1069 | 189 |
| 859 | 3300048915 | Ga0496112_0143502 | Ga0496112_0143502_1290_1859 | 189 |
| 860 | 3300048915 | Ga0496112_1068710 | Ga0496112_1068710_81_665 | 189 |
| 861 | 3300048916 | Ga0496113_0081844 | Ga0496113_0081844_498_1067 | 189 |
| 862 | 3300048916 | Ga0496113_0216394 | Ga0496113_0216394_672_1256 | 189 |
| 863 | 3300048917 | Ga0496114_0015488 | Ga0496114_0015488_2462_3031 | 189 |
| 864 | 3300048917 | Ga0496114_0356194 | Ga0496114_0356194_331_915 | 189 |
| 865 | 3300048918 | Ga0496115_0007409 | Ga0496115_0007409_6773_7357 | 189 |
| 866 | 3300048918 | Ga0496115_0042324 | Ga0496115_0042324_2671_3240 | 189 |
| 867 | 3300048918 | Ga0496115_0259452 | Ga0496115_0259452_477_1061 | 189 |
| 868 | 3300048918 | Ga0496115_0579949 | Ga0496115_0579949_275_859 | 189 |
| 869 | 3300050512 | nmdc:mga0n895_1498942_c1 | nmdc:mga0n895_1498942_c1_58_627 | 189 |
| 870 | 3300050512 | nmdc:mga0n895_340581_c1 | nmdc:mga0n895_340581_c1_130_699 | 189 |
| 871 | 3300050514 | nmdc:mga08x19_143908_c1 | nmdc:mga08x19_143908_c1_260_829 | 189 |
| 872 | 3300053077 | Ga0495601_0001091 | Ga0495601_0001091_14061_14645 | 189 |
| 873 | 3300053077 | Ga0495601_0259441 | Ga0495601_0259441_192_776 | 189 |
| 874 | 3300053078 | Ga0495612_0008078 | Ga0495612_0008078_170_754 | 189 |
| 875 | 3300053078 | Ga0495612_0073496 | Ga0495612_0073496_359_943 | 189 |
| 876 | 3300053084 | Ga0495595_0001076 | Ga0495595_0001076_1974_2558 | 189 |
| 877 | 3300053085 | Ga0495619_0000324 | Ga0495619_0000324_22996_23565 | 189 |
| 878 | 3300053085 | Ga0495619_0007062 | Ga0495619_0007062_3703_4287 | 189 |
| 879 | 3300053085 | Ga0495619_0132260 | Ga0495619_0132260_870_1454 | 189 |
| 880 | 3300053136 | Ga0500559_0138601 | Ga0500559_0138601_540_1124 | 189 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.8053 | 16 | 168 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.796 | 16 | 168 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.79 | 17 | 168 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.6412 | 17 | 168 |
| 8u4v-assembly1.cif.gz_A | cryo-em structure of human claudin-4 complex with clostridium perfringens enterotoxin c-terminal domain, sfab cop-1, and nanobody | 0.4955 | 54 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8586 | 39 | 166 | 1.20.120.550 |
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.835 | 39 | 166 | 1.20.120.550 |
| af_I1JXM9_128_228_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.6431 | 59 | 177 | 1.20.1280.290 |
| af_I1JXM9_128_228_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.6048 | 59 | 177 | 1.20.1280.290 |
| af_O13657_599_717_1.20.58.340 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.6042 | 63 | 163 | 1.20.58.340 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536V873-F1-model_v4 | TRAP transporter small permease protein | 0.933 | 1 | 173 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A2V7ADU2-F1-model_v4 | C4-dicarboxylate ABC transporter permease | 0.928 | 4 | 173 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A847PBP4-F1-model_v4 | TRAP transporter small permease | 0.9266 | 18 | 167 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A537NAW7-F1-model_v4 | TRAP transporter small permease protein | 0.9254 | 1 | 175 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-V8QV81-F1-model_v4 | TRAP transporter small permease protein | 0.9238 | 23 | 167 |
GO:0005886
GO:0015740 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar