F484479

General Info

Members Datasets Scaffolds Average Seq Length
880 322 880 191

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100053191|Ga0070713_1000531914
Length 222
Sequence MTKAPKERRSIRARWRGWRRSRPFWAGLFTLLSGAILTLIPMSGMRVAFVQGSVLWASLLVGLLMLLCGFTLFAFSLSVVCDIVTREIGRPWLWLQEVTSTFFIYGIFIGAAVATRRNDHLYLAAVGDSMTGRPRMIIESAIRMVVIGVGLFLVWFGYVNFLRGFASFRMPSMTPIASLYAAIPICGALIALFAFEQLVNGCRNGFETRPEDRLPEEGAGSP

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
105 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
106 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
200 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
235 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
318 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
319 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
320 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0
Rhizoplane 8.75
Rhizosphere 87.16
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10483230 3300005290 Bacteria 648
2 Ga0070658_10081862 3300005327 Bacteria 2652
3 Ga0070676_10000847 3300005328 Bacteria 15150
4 Ga0070676_10076395 3300005328 Bacteria 2022
5 Ga0070676_10126199 3300005328 Bacteria 1613
6 Ga0070676_10194291 3300005328 Bacteria 1327
7 Ga0070676_10302408 3300005328 Bacteria 1085
8 Ga0070683_100323707 3300005329 Bacteria 1467
9 Ga0070683_100467700 3300005329 Bacteria 1204
10 Ga0070670_100026430 3300005331 Bacteria 4995
11 Ga0070670_100034811 3300005331 Bacteria 4334
12 Ga0070670_100371574 3300005331 Bacteria 1259
13 Ga0070670_100474485 3300005331 Bacteria 1110
14 Ga0070677_10130336 3300005333 Bacteria 1147
15 Ga0068869_100039523 3300005334 Bacteria 3369
16 Ga0068869_100100516 3300005334 Bacteria 2187
17 Ga0068869_100158040 3300005334 Bacteria 1763
18 Ga0070666_10007180 3300005335 Bacteria 6869
19 Ga0070666_10016386 3300005335 Bacteria 4742
20 Ga0070666_10089412 3300005335 Bacteria 2114
21 Ga0070666_10107282 3300005335 Bacteria 1930
22 Ga0070666_10861835 3300005335 Bacteria 669
23 Ga0070680_100000933 3300005336 Bacteria 20696
24 Ga0070682_100011560 3300005337 Bacteria 5047
25 Ga0070682_100015105 3300005337 Bacteria 4470
26 Ga0070682_100072844 3300005337 Bacteria 2202
27 Ga0068868_100019189 3300005338 Bacteria 5123
28 Ga0068868_100114985 3300005338 Bacteria 2190
29 Ga0068868_100130503 3300005338 Bacteria 2056
30 Ga0068868_100410314 3300005338 Bacteria 1171
31 Ga0068868_100456767 3300005338 Bacteria 1112
32 Ga0070660_100328813 3300005339 Bacteria 1256
33 Ga0070660_100336016 3300005339 Bacteria 1243
34 Ga0070689_100027304 3300005340 Bacteria 4303
35 Ga0070689_100028079 3300005340 Bacteria 4250
36 Ga0070689_100029734 3300005340 Bacteria 4139
37 Ga0070689_100106442 3300005340 Bacteria 2225
38 Ga0070689_100150431 3300005340 Bacteria 1877
39 Ga0070689_100170817 3300005340 Bacteria 1762
40 Ga0070691_10009000 3300005341 Bacteria 4567
41 Ga0070687_100006230 3300005343 Bacteria 4879
42 Ga0070687_100101598 3300005343 Bacteria 1611
43 Ga0070661_100103487 3300005344 Bacteria 2120
44 Ga0070661_101242938 3300005344 Bacteria 624
45 Ga0070668_100004542 3300005347 Bacteria 10295
46 Ga0070668_100668584 3300005347 Bacteria 914
47 Ga0070669_100005778 3300005353 Bacteria 8918
48 Ga0070669_100370722 3300005353 Bacteria 1166
49 Ga0070675_100001685 3300005354 Bacteria 16306
50 Ga0070675_100124241 3300005354 Bacteria 2195
51 Ga0070675_100485032 3300005354 Bacteria 1112
52 Ga0070675_100528793 3300005354 Bacteria 1065
53 Ga0070675_100722109 3300005354 Bacteria 908
54 Ga0070671_100010441 3300005355 Bacteria 7450
55 Ga0070671_100021219 3300005355 Bacteria 5304
56 Ga0070671_100163771 3300005355 Bacteria 1880
57 Ga0070671_100449118 3300005355 Bacteria 1106
58 Ga0070674_100003123 3300005356 Bacteria 9227
59 Ga0070674_100034449 3300005356 Bacteria 3382
60 Ga0070674_100093096 3300005356 Bacteria 2180
61 Ga0070674_100422566 3300005356 Bacteria 1094
62 Ga0070673_100031821 3300005364 Bacteria 3963
63 Ga0070673_100052687 3300005364 Bacteria 3194
64 Ga0070673_100082620 3300005364 Bacteria 2608
65 Ga0070673_100083704 3300005364 Bacteria 2592
66 Ga0070673_100117678 3300005364 Bacteria 2212
67 Ga0070673_100607081 3300005364 Unclassified 998
68 Ga0070688_100009043 3300005365 Bacteria 5431
69 Ga0070688_100091149 3300005365 Bacteria 1992
70 Ga0070659_100260774 3300005366 Bacteria 1438
71 Ga0070659_100308486 3300005366 Bacteria 1321
72 Ga0070659_100498768 3300005366 Bacteria 1037
73 Ga0070667_100010578 3300005367 Bacteria 7617
74 Ga0070667_100048749 3300005367 Bacteria 3566
75 Ga0070667_100076418 3300005367 Bacteria 2859
76 Ga0070667_100151466 3300005367 Bacteria 2037
77 Ga0070667_100758360 3300005367 Bacteria 900
78 Ga0070709_10005103 3300005434 Bacteria 7098
79 Ga0070709_10015799 3300005434 Bacteria 4298
80 Ga0070709_10112268 3300005434 Bacteria 1834
81 Ga0070709_10205940 3300005434 Bacteria 1396
82 Ga0070709_10226386 3300005434 Bacteria 1336
83 Ga0070709_10452902 3300005434 Bacteria 967
84 Ga0070714_100004407 3300005435 Bacteria 10595
85 Ga0070714_100031975 3300005435 Bacteria 4393
86 Ga0070714_100050832 3300005435 Bacteria 3532
87 Ga0070714_100192350 3300005435 Bacteria 1862
88 Ga0070714_100289260 3300005435 Bacteria 1524
89 Ga0070714_100539274 3300005435 Bacteria 1116
90 Ga0070713_100000039 3300005436 Bacteria 83384
91 Ga0070713_100005026 3300005436 Bacteria 8988
92 Ga0070713_100005783 3300005436 Bacteria 8500
93 Ga0070713_100030937 3300005436 Bacteria 4257
94 Ga0070713_100053191 3300005436 Bacteria 3355
95 Ga0070713_100059691 3300005436 Bacteria 3186
96 Ga0070713_100153211 3300005436 Bacteria 2052
97 Ga0070710_10001919 3300005437 Bacteria 9846
98 Ga0070710_10151809 3300005437 Bacteria 1429
99 Ga0070710_10289472 3300005437 Bacteria 1066
100 Ga0070701_10087033 3300005438 Bacteria 1704
101 Ga0070711_100003421 3300005439 Bacteria 9245
102 Ga0070711_100250160 3300005439 Bacteria 1390
103 Ga0070711_100296402 3300005439 Bacteria 1284
104 Ga0070711_100429923 3300005439 Bacteria 1077
105 Ga0070711_100537556 3300005439 Bacteria 968
106 Ga0070705_100145847 3300005440 Bacteria 1564
107 Ga0070705_100275999 3300005440 Bacteria 1193
108 Ga0070705_100666759 3300005440 Bacteria 813
109 Ga0070700_100266928 3300005441 Bacteria 1235
110 Ga0070708_100108249 3300005445 Bacteria 2552
111 Ga0070663_100010454 3300005455 Bacteria 5784
112 Ga0070663_100020275 3300005455 Bacteria 4399
113 Ga0070663_100371418 3300005455 Bacteria 1163
114 Ga0070663_100980063 3300005455 Bacteria 734
115 Ga0070663_101012519 3300005455 Bacteria 723
116 Ga0070678_100000728 3300005456 Bacteria 16377
117 Ga0070678_100001027 3300005456 Bacteria 14545
118 Ga0070678_100016483 3300005456 Bacteria 4729
119 Ga0070678_100070575 3300005456 Bacteria 2612
120 Ga0070678_100237585 3300005456 Bacteria 1522
121 Ga0070662_100337719 3300005457 Bacteria 1232
122 Ga0070681_10009517 3300005458 Bacteria 9562
123 Ga0070681_10061084 3300005458 Bacteria 3745
124 Ga0070681_10157011 3300005458 Bacteria 2199
125 Ga0070681_10430920 3300005458 Bacteria 1231
126 Ga0068867_100001109 3300005459 Bacteria 18410
127 Ga0068867_100026711 3300005459 Bacteria 4147
128 Ga0068867_100325004 3300005459 Bacteria 1276
129 Ga0068867_100357024 3300005459 Bacteria 1221
130 Ga0068867_100438499 3300005459 Bacteria 1110
131 Ga0070685_10012319 3300005466 Bacteria 4491
132 Ga0070685_10027399 3300005466 Bacteria 3148
133 Ga0070706_100021874 3300005467 Bacteria 5889
134 Ga0070706_100878300 3300005467 Bacteria 829
135 Ga0070698_100002091 3300005471 Bacteria 22152
136 Ga0070699_100013134 3300005518 Bacteria 7140
137 Ga0070679_100009132 3300005530 Bacteria 9359
138 Ga0070679_100088967 3300005530 Bacteria 3075
139 Ga0070679_100207694 3300005530 Bacteria 1923
140 Ga0070684_100085454 3300005535 Bacteria 2798
141 Ga0070684_100262668 3300005535 Bacteria 1579
142 Ga0070684_100305443 3300005535 Bacteria 1460
143 Ga0070684_100333786 3300005535 Bacteria 1393
144 Ga0070684_100761394 3300005535 Bacteria 904
145 Ga0070697_100099113 3300005536 Bacteria 2419
146 Ga0070697_100658826 3300005536 Bacteria 922
147 Ga0068853_100052274 3300005539 Bacteria 3520
148 Ga0068853_100269607 3300005539 Bacteria 1567
149 Ga0070672_100001043 3300005543 Bacteria 16892
150 Ga0070672_100105024 3300005543 Bacteria 2296
151 Ga0070672_100125652 3300005543 Bacteria 2103
152 Ga0070672_100228011 3300005543 Bacteria 1564
153 Ga0070672_100293517 3300005543 Bacteria 1377
154 Ga0070672_100437397 3300005543 Bacteria 1125
155 Ga0070686_100005547 3300005544 Bacteria 6980
156 Ga0070686_100025992 3300005544 Bacteria 3528
157 Ga0070695_100298841 3300005545 Bacteria 1189
158 Ga0070696_100082166 3300005546 Bacteria 2283
159 Ga0070696_100677242 3300005546 Bacteria 839
160 Ga0070693_100006850 3300005547 Bacteria 5539
161 Ga0070693_100139528 3300005547 Bacteria 1524
162 Ga0070693_100264257 3300005547 Bacteria 1146
163 Ga0070665_100002989 3300005548 Bacteria 18261
164 Ga0070665_100088331 3300005548 Bacteria 3105
165 Ga0070665_100475083 3300005548 Bacteria 1261
166 Ga0070665_100512216 3300005548 Bacteria 1211
167 Ga0070665_100948496 3300005548 Bacteria 873
168 Ga0070704_100308004 3300005549 Bacteria 1322
169 Ga0070704_100363471 3300005549 Bacteria 1225
170 Ga0070704_100532462 3300005549 Bacteria 1024
171 Ga0068855_100455754 3300005563 Bacteria 1395
172 Ga0068855_100994653 3300005563 Bacteria 881
173 Ga0070664_100034445 3300005564 Bacteria 4248
174 Ga0070664_100189837 3300005564 Bacteria 1830
175 Ga0070664_100252212 3300005564 Bacteria 1586
176 Ga0070664_100723375 3300005564 Bacteria 928
177 Ga0068857_100119758 3300005577 Bacteria 2369
178 Ga0068857_100206745 3300005577 Bacteria 1790
179 Ga0068854_100273307 3300005578 Bacteria 1358
180 Ga0068854_100649616 3300005578 Bacteria 905
181 Ga0068856_100150900 3300005614 Bacteria 2333
182 Ga0068856_100180424 3300005614 Bacteria 2124
183 Ga0068856_100305419 3300005614 Bacteria 1609
184 Ga0070702_100012876 3300005615 Bacteria 4210
185 Ga0070702_100381995 3300005615 Bacteria 1002
186 Ga0068859_100140301 3300005617 Bacteria 2490
187 Ga0068859_100162478 3300005617 Bacteria 2313
188 Ga0068859_100715312 3300005617 Bacteria 1092
189 Ga0068864_100010322 3300005618 Bacteria 7713
190 Ga0068864_100021942 3300005618 Bacteria 5352
191 Ga0068864_100026129 3300005618 Bacteria 4922
192 Ga0068866_10045919 3300005718 Bacteria 2194
193 Ga0068866_10083519 3300005718 Bacteria 1721
194 Ga0068861_100162574 3300005719 Bacteria 1843
195 Ga0068863_100190757 3300005841 Bacteria 1969
196 Ga0068863_100740153 3300005841 Unclassified 979
197 Ga0068863_101157154 3300005841 Bacteria 779
198 Ga0068858_100003682 3300005842 Bacteria 15187
199 Ga0068858_100056529 3300005842 Bacteria 3626
200 Ga0068858_100083784 3300005842 Bacteria 2965
201 Ga0068858_100402662 3300005842 Bacteria 1315
202 Ga0068858_100819590 3300005842 Bacteria 908
203 Ga0068860_100012825 3300005843 Bacteria 8239
204 Ga0068860_100106733 3300005843 Bacteria 2675
205 Ga0068862_100039466 3300005844 Bacteria 4010
206 Ga0081455_10034958 3300005937 Bacteria 4497
207 Ga0070717_10000217 3300006028 Bacteria 39845
208 Ga0070717_10005760 3300006028 Bacteria 9073
209 Ga0070717_10077749 3300006028 Bacteria 2779
210 Ga0070717_10388727 3300006028 Bacteria 1252
211 Ga0070717_10697980 3300006028 Bacteria 922
212 Ga0075365_10533119 3300006038 Bacteria 830
213 Ga0075363_100599798 3300006048 Bacteria 660
214 Ga0070715_10013506 3300006163 Bacteria 3002
215 Ga0070715_10018821 3300006163 Bacteria 2639
216 Ga0070715_10022051 3300006163 Bacteria 2479
217 Ga0070715_10169171 3300006163 Bacteria 1087
218 Ga0070715_10342259 3300006163 Bacteria 814
219 Ga0070716_100000793 3300006173 Bacteria 13575
220 Ga0070716_100002302 3300006173 Bacteria 8796
221 Ga0070716_100023037 3300006173 Bacteria 3298
222 Ga0070716_100089845 3300006173 Bacteria 1857
223 Ga0070716_100454115 3300006173 Bacteria 935
224 Ga0070712_100009890 3300006175 Bacteria 6014
225 Ga0070712_100013119 3300006175 Bacteria 5285
226 Ga0070712_100043893 3300006175 Bacteria 3080
227 Ga0070712_100067602 3300006175 Bacteria 2543
228 Ga0070712_100170328 3300006175 Bacteria 1689
229 Ga0070712_100191421 3300006175 Bacteria 1601
230 Ga0070712_100230118 3300006175 Bacteria 1472
231 Ga0070712_100318807 3300006175 Bacteria 1263
232 Ga0075367_10220166 3300006178 Bacteria 1188
233 Ga0075369_10044353 3300006186 Bacteria 1910
234 Ga0097621_100002390 3300006237 Bacteria 12862
235 Ga0097621_100008604 3300006237 Bacteria 7357
236 Ga0097621_100010225 3300006237 Bacteria 6852
237 Ga0097621_100113837 3300006237 Bacteria 2288
238 Ga0097621_100194548 3300006237 Bacteria 1758
239 Ga0097621_100586033 3300006237 Bacteria 1018
240 Ga0097621_100775284 3300006237 Bacteria 887
241 Ga0075370_10022929 3300006353 Bacteria 3434
242 Ga0068871_100001576 3300006358 Bacteria 15330
243 Ga0068871_100003994 3300006358 Bacteria 10204
244 Ga0068871_100009547 3300006358 Bacteria 7040
245 Ga0068871_100041628 3300006358 Bacteria 3684
246 Ga0068871_100317186 3300006358 Bacteria 1372
247 Ga0068871_100319267 3300006358 Bacteria 1367
248 Ga0075434_100081494 3300006871 Bacteria 3233
249 Ga0075434_100623383 3300006871 Bacteria 1097
250 Ga0075434_100736699 3300006871 Bacteria 1003
251 Ga0075434_101836747 3300006871 Unclassified 612
252 Ga0068865_100038086 3300006881 Bacteria 3252
253 Ga0068865_100094688 3300006881 Bacteria 2174
254 Ga0068865_100564237 3300006881 Bacteria 958
255 Ga0068865_100791873 3300006881 Bacteria 817
256 Ga0068865_101089029 3300006881 Unclassified 703
257 Ga0075436_100101786 3300006914 Bacteria 2001
258 Ga0075436_100181462 3300006914 Bacteria 1488
259 Ga0097620_100128607 3300006931 Bacteria 2604
260 Ga0097620_100140316 3300006931 Bacteria 2490
261 Ga0097620_100162473 3300006931 Bacteria 2313
262 Ga0097620_100715278 3300006931 Bacteria 1092
263 Ga0075435_100768089 3300007076 Bacteria 839
264 Ga0099794_10006876 3300007265 Bacteria 4636
265 Ga0099795_10010690 3300007788 Bacteria 2713
266 Ga0099795_10070276 3300007788 Bacteria 1319
267 Ga0105251_10023867 3300009011 Bacteria 3149
268 Ga0105250_10024795 3300009092 Bacteria 2416
269 Ga0105240_10004752 3300009093 Bacteria 20518
270 Ga0105240_10583003 3300009093 Bacteria 1233
271 Ga0111539_10499406 3300009094 Bacteria 1417
272 Ga0105245_10029333 3300009098 Bacteria 4859
273 Ga0105245_10072585 3300009098 Bacteria 3127
274 Ga0105245_10127957 3300009098 Bacteria 2379
275 Ga0105245_10261620 3300009098 Bacteria 1684
276 Ga0105245_10363129 3300009098 Bacteria 1437
277 Ga0105245_10446651 3300009098 Bacteria 1301
278 Ga0105247_10029031 3300009101 Bacteria 3349
279 Ga0105247_10173383 3300009101 Bacteria 1435
280 Ga0105247_10197289 3300009101 Bacteria 1351
281 Ga0105247_10225357 3300009101 Bacteria 1271
282 Ga0105243_10023934 3300009148 Bacteria 4654
283 Ga0105243_10026026 3300009148 Bacteria 4477
284 Ga0105243_10071930 3300009148 Bacteria 2798
285 Ga0105241_10014601 3300009174 Bacteria 5751
286 Ga0105241_10018681 3300009174 Bacteria 5104
287 Ga0105241_10166234 3300009174 Bacteria 1818
288 Ga0105241_10177093 3300009174 Bacteria 1766
289 Ga0105241_10493190 3300009174 Bacteria 1091
290 Ga0105242_10009790 3300009176 Bacteria 7346
291 Ga0105242_10010141 3300009176 Bacteria 7218
292 Ga0105242_10014350 3300009176 Bacteria 6137
293 Ga0105242_10685281 3300009176 Bacteria 1001
294 Ga0105242_11102524 3300009176 Unclassified 808
295 Ga0105248_10001952 3300009177 Bacteria 22922
296 Ga0105248_10043581 3300009177 Bacteria 5031
297 Ga0105248_10097657 3300009177 Bacteria 3309
298 Ga0105248_10124081 3300009177 Bacteria 2913
299 Ga0105248_10265100 3300009177 Bacteria 1934
300 Ga0105248_10295765 3300009177 Bacteria 1823
301 Ga0105248_10651701 3300009177 Bacteria 1188
302 Ga0105248_11796547 3300009177 Bacteria 695
303 Ga0105237_10054170 3300009545 Bacteria 4019
304 Ga0105237_10111632 3300009545 Bacteria 2726
305 Ga0105237_10138192 3300009545 Bacteria 2431
306 Ga0105237_10254079 3300009545 Bacteria 1760
307 Ga0105237_10422871 3300009545 Bacteria 1338
308 Ga0105237_10602444 3300009545 Bacteria 1106
309 Ga0105238_10082146 3300009551 Bacteria 3212
310 Ga0105238_10157549 3300009551 Bacteria 2246
311 Ga0105238_10276775 3300009551 Bacteria 1659
312 Ga0105238_10288779 3300009551 Bacteria 1622
313 Ga0105249_10104828 3300009553 Bacteria 2665
314 Ga0105249_10178494 3300009553 Bacteria 2064
315 Ga0105249_10379928 3300009553 Bacteria 1438
316 Ga0105249_11354522 3300009553 Unclassified 783
317 Ga0099796_10055649 3300010159 Bacteria 1386
318 Ga0105239_10062965 3300010375 Bacteria 4072
319 Ga0105239_10190768 3300010375 Bacteria 2294
320 Ga0105239_10200568 3300010375 Bacteria 2235
321 Ga0105239_10249737 3300010375 Bacteria 1992
322 Ga0105239_10379095 3300010375 Bacteria 1599
323 Ga0105246_10173807 3300011119 Bacteria 1652
324 Ga0105246_11430036 3300011119 Bacteria 646
325 Ga0157328_1000881 3300012478 Bacteria 1183
326 Ga0157313_1018652 3300012503 Unclassified 685
327 Ga0157342_1006406 3300012507 Bacteria 1113
328 Ga0157373_10095337 3300013100 Bacteria 2094
329 Ga0157373_10115335 3300013100 Bacteria 1888
330 Ga0157370_10160708 3300013104 Bacteria 2090
331 Ga0157370_10200552 3300013104 Bacteria 1851
332 Ga0157370_10540463 3300013104 Bacteria 1069
333 Ga0157374_10008845 3300013296 Bacteria 8621
334 Ga0157374_10009414 3300013296 Bacteria 8384
335 Ga0157374_10128543 3300013296 Bacteria 2450
336 Ga0157374_10309945 3300013296 Bacteria 1562
337 Ga0157374_10554852 3300013296 Bacteria 1157
338 Ga0157374_10780799 3300013296 Bacteria 971
339 Ga0157378_10028760 3300013297 Bacteria 4907
340 Ga0157378_10029323 3300013297 Bacteria 4857
341 Ga0157378_10122317 3300013297 Bacteria 2401
342 Ga0157378_10141988 3300013297 Bacteria 2230
343 Ga0157378_10161621 3300013297 Bacteria 2095
344 Ga0157378_10381392 3300013297 Bacteria 1384
345 Ga0157378_10477251 3300013297 Bacteria 1242
346 Ga0157378_10918132 3300013297 Bacteria 907
347 Ga0163162_10001709 3300013306 Bacteria 20590
348 Ga0163162_10045452 3300013306 Bacteria 4399
349 Ga0157372_10413301 3300013307 Bacteria 1572
350 Ga0157375_10009216 3300013308 Bacteria 8657
351 Ga0157375_10020260 3300013308 Bacteria 6071
352 Ga0157375_10079270 3300013308 Bacteria 3319
353 Ga0157375_10269533 3300013308 Bacteria 1864
354 Ga0157375_10299424 3300013308 Bacteria 1772
355 Ga0157375_10476049 3300013308 Bacteria 1414
356 Ga0157375_10708299 3300013308 Bacteria 1160
357 Ga0163163_10023573 3300014325 Bacteria 5843
358 Ga0163163_10347580 3300014325 Bacteria 1539
359 Ga0163163_10542852 3300014325 Bacteria 1225
360 Ga0157380_10334421 3300014326 Bacteria 1410
361 Ga0157380_10372182 3300014326 Bacteria 1345
362 Ga0157377_10105301 3300014745 Bacteria 1688
363 Ga0157377_10933187 3300014745 Bacteria 652
364 Ga0157379_10002943 3300014968 Bacteria 14369
365 Ga0157379_10025689 3300014968 Bacteria 5234
366 Ga0157379_10027789 3300014968 Bacteria 5036
367 Ga0157379_10346149 3300014968 Bacteria 1360
368 Ga0157379_10351343 3300014968 Bacteria 1350
369 Ga0157376_10003569 3300014969 Bacteria 10722
370 Ga0157376_10153633 3300014969 Bacteria 2078
371 Ga0157376_10177971 3300014969 Bacteria 1942
372 Ga0157376_10202990 3300014969 Bacteria 1825
373 Ga0157376_10310276 3300014969 Bacteria 1496
374 Ga0157376_10332841 3300014969 Bacteria 1447
375 Ga0157376_11215520 3300014969 Bacteria 782
376 Ga0157376_11267269 3300014969 Unclassified 767
377 Ga0163161_10069944 3300017792 Bacteria 2566
378 Ga0163161_10197934 3300017792 Bacteria 1547
379 Ga0163161_10275425 3300017792 Bacteria 1318
380 Ga0213873_10013063 3300021358 Bacteria 1814
381 Ga0213874_10084189 3300021377 Bacteria 1035
382 Ga0213876_10036782 3300021384 Bacteria 2583
383 Ga0213876_10273573 3300021384 Bacteria 898
384 Ga0213875_10308522 3300021388 Bacteria 749
385 Ga0207426_1022401 3300025302 Bacteria 2168
386 Ga0207697_10003098 3300025315 Bacteria 8320
387 Ga0207656_10200211 3300025321 Bacteria 964
388 Ga0207682_10074864 3300025893 Bacteria 1440
389 Ga0207692_10001674 3300025898 Bacteria 8378
390 Ga0207692_10014567 3300025898 Bacteria 3439
391 Ga0207642_10046942 3300025899 Bacteria 1928
392 Ga0207642_10057025 3300025899 Bacteria 1795
393 Ga0207642_10411742 3300025899 Bacteria 811
394 Ga0207710_10001666 3300025900 Bacteria 10815
395 Ga0207710_10002946 3300025900 Bacteria 7718
396 Ga0207710_10017187 3300025900 Bacteria 3066
397 Ga0207710_10458589 3300025900 Bacteria 659
398 Ga0207688_10305378 3300025901 Bacteria 974
399 Ga0207680_10020003 3300025903 Bacteria 3592
400 Ga0207680_10092028 3300025903 Bacteria 1931
401 Ga0207680_10109528 3300025903 Bacteria 1788
402 Ga0207685_10000852 3300025905 Bacteria 5726
403 Ga0207685_10010994 3300025905 Bacteria 2702
404 Ga0207685_10014352 3300025905 Bacteria 2478
405 Ga0207699_10000138 3300025906 Bacteria 49255
406 Ga0207699_10006404 3300025906 Bacteria 5697
407 Ga0207699_10012288 3300025906 Bacteria 4353
408 Ga0207699_10369612 3300025906 Bacteria 1016
409 Ga0207645_10000588 3300025907 Bacteria 30197
410 Ga0207645_10035490 3300025907 Bacteria 3201
411 Ga0207645_10052631 3300025907 Bacteria 2601
412 Ga0207645_10094801 3300025907 Bacteria 1921
413 Ga0207645_10191258 3300025907 Bacteria 1345
414 Ga0207705_10020452 3300025909 Bacteria 4729
415 Ga0207684_10025016 3300025910 Bacteria 5088
416 Ga0207684_10141231 3300025910 Bacteria 2070
417 Ga0207654_10002446 3300025911 Bacteria 9470
418 Ga0207654_10172411 3300025911 Bacteria 1406
419 Ga0207654_10236912 3300025911 Bacteria 1218
420 Ga0207707_10010605 3300025912 Bacteria 8001
421 Ga0207707_10106369 3300025912 Bacteria 2452
422 Ga0207695_10009523 3300025913 Bacteria 12011
423 Ga0207695_10800230 3300025913 Bacteria 823
424 Ga0207671_10039867 3300025914 Bacteria 3478
425 Ga0207671_10907036 3300025914 Bacteria 697
426 Ga0207693_10002257 3300025915 Bacteria 16770
427 Ga0207693_10007885 3300025915 Bacteria 8745
428 Ga0207693_10034136 3300025915 Unclassified 4013
429 Ga0207693_10049736 3300025915 Bacteria 3292
430 Ga0207693_10059404 3300025915 Bacteria 2995
431 Ga0207693_10062001 3300025915 Bacteria 2929
432 Ga0207693_10068703 3300025915 Bacteria 2773
433 Ga0207693_10092385 3300025915 Bacteria 2372
434 Ga0207693_10188144 3300025915 Bacteria 1625
435 Ga0207663_10004484 3300025916 Bacteria 6951
436 Ga0207663_10009885 3300025916 Bacteria 5051
437 Ga0207663_10049960 3300025916 Bacteria 2597
438 Ga0207663_10272334 3300025916 Bacteria 1255
439 Ga0207663_10546715 3300025916 Bacteria 905
440 Ga0207663_10584609 3300025916 Bacteria 876
441 Ga0207660_10069311 3300025917 Bacteria 2560
442 Ga0207662_10109126 3300025918 Bacteria 1724
443 Ga0207657_10058704 3300025919 Bacteria 3309
444 Ga0207657_10103652 3300025919 Bacteria 2358
445 Ga0207657_10115039 3300025919 Bacteria 2217
446 Ga0207649_10077536 3300025920 Bacteria 2141
447 Ga0207652_10006590 3300025921 Bacteria 9362
448 Ga0207646_10189428 3300025922 Bacteria 1858
449 Ga0207646_10303334 3300025922 Bacteria 1443
450 Ga0207681_10008861 3300025923 Bacteria 6147
451 Ga0207694_10269481 3300025924 Bacteria 1396
452 Ga0207694_10532443 3300025924 Bacteria 985
453 Ga0207650_10008427 3300025925 Bacteria 7036
454 Ga0207650_10023679 3300025925 Bacteria 4359
455 Ga0207650_10032631 3300025925 Bacteria 3767
456 Ga0207650_10107696 3300025925 Bacteria 2153
457 Ga0207650_10610848 3300025925 Bacteria 917
458 Ga0207659_10001888 3300025926 Bacteria 12411
459 Ga0207659_10207470 3300025926 Bacteria 1568
460 Ga0207659_10558219 3300025926 Bacteria 974
461 Ga0207659_10773830 3300025926 Bacteria 824
462 Ga0207687_10002691 3300025927 Bacteria 12023
463 Ga0207687_10017501 3300025927 Bacteria 4720
464 Ga0207687_10071298 3300025927 Bacteria 2482
465 Ga0207687_10561229 3300025927 Bacteria 959
466 Ga0207700_10000082 3300025928 Bacteria 58939
467 Ga0207700_10001380 3300025928 Bacteria 13781
468 Ga0207700_10005532 3300025928 Bacteria 7579
469 Ga0207700_10006593 3300025928 Bacteria 7029
470 Ga0207700_10013374 3300025928 Bacteria 5337
471 Ga0207700_10071967 3300025928 Bacteria 2664
472 Ga0207700_10380501 3300025928 Bacteria 1234
473 Ga0207700_10449311 3300025928 Bacteria 1136
474 Ga0207700_10775904 3300025928 Bacteria 857
475 Ga0207664_10007607 3300025929 Bacteria 7517
476 Ga0207664_10019090 3300025929 Bacteria 5060
477 Ga0207664_10065103 3300025929 Bacteria 2917
478 Ga0207664_10175216 3300025929 Bacteria 1838
479 Ga0207664_10626436 3300025929 Bacteria 966
480 Ga0207664_10701535 3300025929 Bacteria 910
481 Ga0207644_10000935 3300025931 Bacteria 18571
482 Ga0207644_10005948 3300025931 Bacteria 7952
483 Ga0207644_10023814 3300025931 Bacteria 4198
484 Ga0207644_10071137 3300025931 Bacteria 2544
485 Ga0207644_10199204 3300025931 Bacteria 1579
486 Ga0207644_10227425 3300025931 Bacteria 1481
487 Ga0207644_10315610 3300025931 Bacteria 1263
488 Ga0207644_10510639 3300025931 Bacteria 992
489 Ga0207644_10555580 3300025931 Bacteria 950
490 Ga0207690_10027669 3300025932 Bacteria 3585
491 Ga0207690_10257216 3300025932 Bacteria 1351
492 Ga0207706_10007456 3300025933 Bacteria 10116
493 Ga0207706_10094134 3300025933 Bacteria 2635
494 Ga0207706_10505190 3300025933 Bacteria 1043
495 Ga0207686_10039576 3300025934 Bacteria 2861
496 Ga0207686_10072241 3300025934 Bacteria 2223
497 Ga0207686_10082835 3300025934 Bacteria 2098
498 Ga0207709_10018229 3300025935 Bacteria 3928
499 Ga0207709_10022885 3300025935 Bacteria 3550
500 Ga0207670_10059938 3300025936 Bacteria 2591
501 Ga0207670_10122899 3300025936 Bacteria 1890
502 Ga0207670_10172597 3300025936 Bacteria 1622
503 Ga0207670_10373369 3300025936 Bacteria 1134
504 Ga0207669_10027702 3300025937 Bacteria 3107
505 Ga0207669_10158660 3300025937 Bacteria 1594
506 Ga0207669_10640651 3300025937 Bacteria 868
507 Ga0207669_10686317 3300025937 Bacteria 840
508 Ga0207704_10003966 3300025938 Bacteria 6733
509 Ga0207704_10034813 3300025938 Bacteria 2878
510 Ga0207704_10068626 3300025938 Bacteria 2236
511 Ga0207665_10004818 3300025939 Bacteria 8981
512 Ga0207665_10024706 3300025939 Bacteria 3962
513 Ga0207691_10000899 3300025940 Bacteria 29484
514 Ga0207691_10039440 3300025940 Bacteria 4370
515 Ga0207691_10076199 3300025940 Bacteria 3023
516 Ga0207691_10355046 3300025940 Bacteria 1254
517 Ga0207711_10002933 3300025941 Bacteria 14911
518 Ga0207711_10003009 3300025941 Bacteria 14738
519 Ga0207711_10008791 3300025941 Bacteria 8446
520 Ga0207711_10009116 3300025941 Bacteria 8285
521 Ga0207711_10076825 3300025941 Bacteria 2909
522 Ga0207711_11076564 3300025941 Bacteria 744
523 Ga0207689_10001983 3300025942 Bacteria 19334
524 Ga0207689_10046798 3300025942 Bacteria 3574
525 Ga0207689_10050225 3300025942 Bacteria 3440
526 Ga0207689_10128129 3300025942 Bacteria 2088
527 Ga0207661_10055119 3300025944 Bacteria 3187
528 Ga0207661_10064941 3300025944 Bacteria 2961
529 Ga0207661_10482685 3300025944 Bacteria 1131
530 Ga0207661_10689277 3300025944 Bacteria 939
531 Ga0207679_10276040 3300025945 Bacteria 1439
532 Ga0207679_10678892 3300025945 Bacteria 933
533 Ga0207667_10007731 3300025949 Bacteria 12852
534 Ga0207667_10634872 3300025949 Bacteria 1075
535 Ga0207651_10008269 3300025960 Bacteria 5610
536 Ga0207651_10069283 3300025960 Bacteria 2490
537 Ga0207651_10090793 3300025960 Bacteria 2234
538 Ga0207651_10632879 3300025960 Bacteria 938
539 Ga0207651_10761422 3300025960 Unclassified 856
540 Ga0207651_11122415 3300025960 Bacteria 705
541 Ga0207712_10056019 3300025961 Bacteria 2776
542 Ga0207712_10157687 3300025961 Bacteria 1760
543 Ga0207712_10309288 3300025961 Bacteria 1300
544 Ga0207712_10486734 3300025961 Bacteria 1052
545 Ga0207668_10005107 3300025972 Bacteria 7723
546 Ga0207668_10287708 3300025972 Bacteria 1351
547 Ga0207640_10077434 3300025981 Bacteria 2261
548 Ga0207640_10292019 3300025981 Bacteria 1286
549 Ga0207640_10786704 3300025981 Bacteria 823
550 Ga0207658_10003966 3300025986 Bacteria 10396
551 Ga0207658_10043132 3300025986 Bacteria 3277
552 Ga0207658_10134960 3300025986 Bacteria 1988
553 Ga0207658_10137294 3300025986 Bacteria 1974
554 Ga0207658_10274986 3300025986 Bacteria 1441
555 Ga0207677_10014584 3300026023 Bacteria 4595
556 Ga0207677_10039478 3300026023 Bacteria 3104
557 Ga0207677_10043068 3300026023 Bacteria 2999
558 Ga0207677_10053908 3300026023 Bacteria 2741
559 Ga0207677_10904651 3300026023 Bacteria 796
560 Ga0207703_10011838 3300026035 Bacteria 6792
561 Ga0207703_10021693 3300026035 Bacteria 5027
562 Ga0207703_10028873 3300026035 Bacteria 4377
563 Ga0207703_10059365 3300026035 Bacteria 3124
564 Ga0207639_10087372 3300026041 Bacteria 2485
565 Ga0207639_10503493 3300026041 Bacteria 1107
566 Ga0207678_10018666 3300026067 Bacteria 6089
567 Ga0207678_10128643 3300026067 Bacteria 2160
568 Ga0207678_10144614 3300026067 Bacteria 2030
569 Ga0207708_10119935 3300026075 Bacteria 2049
570 Ga0207708_10230239 3300026075 Bacteria 1488
571 Ga0207708_10307722 3300026075 Bacteria 1290
572 Ga0207708_10560777 3300026075 Bacteria 964
573 Ga0207702_10037311 3300026078 Bacteria 4067
574 Ga0207702_10337087 3300026078 Bacteria 1440
575 Ga0207702_10394779 3300026078 Bacteria 1333
576 Ga0207702_10436872 3300026078 Bacteria 1268
577 Ga0207702_10473895 3300026078 Bacteria 1217
578 Ga0207641_10003310 3300026088 Bacteria 14332
579 Ga0207641_10059622 3300026088 Bacteria 3250
580 Ga0207641_10138937 3300026088 Bacteria 2189
581 Ga0207648_10000949 3300026089 Bacteria 32818
582 Ga0207648_10097767 3300026089 Bacteria 2569
583 Ga0207648_10994207 3300026089 Bacteria 785
584 Ga0207676_10007601 3300026095 Bacteria 7694
585 Ga0207676_10019980 3300026095 Bacteria 4893
586 Ga0207676_10820288 3300026095 Bacteria 908
587 Ga0207674_10070740 3300026116 Bacteria 3508
588 Ga0207674_10135299 3300026116 Bacteria 2426
589 Ga0207674_10291894 3300026116 Bacteria 1579
590 Ga0207675_100089500 3300026118 Bacteria 2893
591 Ga0207683_10000210 3300026121 Bacteria 50885
592 Ga0207683_10000480 3300026121 Bacteria 36946
593 Ga0207683_10001479 3300026121 Bacteria 21177
594 Ga0207683_10009436 3300026121 Bacteria 8315
595 Ga0207683_10062449 3300026121 Bacteria 3281
596 Ga0207683_10270802 3300026121 Bacteria 1551
597 Ga0207698_10027778 3300026142 Bacteria 4024
598 Ga0207698_11620535 3300026142 Bacteria 663
599 Ga0207428_10760941 3300027907 Unclassified 690
600 Ga0268266_10005275 3300028379 Bacteria 12134
601 Ga0268266_10028221 3300028379 Bacteria 4771
602 Ga0268266_10045267 3300028379 Bacteria 3764
603 Ga0268266_10287372 3300028379 Bacteria 1530
604 Ga0268266_10434179 3300028379 Bacteria 1246
605 Ga0268266_10467240 3300028379 Bacteria 1201
606 Ga0268265_10202704 3300028380 Bacteria 1722
607 Ga0268265_10356902 3300028380 Bacteria 1337
608 Ga0268264_10016111 3300028381 Bacteria 6125
609 Ga0268264_10665660 3300028381 Bacteria 1031
610 Ga0265332_10239652 3300031238 Unclassified 751
611 Ga0265339_10111078 3300031249 Bacteria 1418
612 Ga0307513_10296736 3300031456 Bacteria 1385
613 Ga0307509_10130561 3300031507 Bacteria 2469
614 Ga0265313_10015163 3300031595 Bacteria 4508
615 Ga0373950_0014700 3300034818 Bacteria 1319
616 Ga0373938_0014105 3300034957 Bacteria 1529
617 Ga0373938_0063768 3300034957 Bacteria 867
618 Ga0373926_0044929 3300035083 Bacteria 1583
619 Ga0373926_0053387 3300035083 Bacteria 1462
620 Ga0373934_0014177 3300035086 Bacteria 3019
621 Ga0373944_0003706 3300035089 Bacteria 3950
622 Ga0373944_0022547 3300035089 Bacteria 1830
623 Ga0373949_0053951 3300035090 Bacteria 1019
624 Ga0373952_0015400 3300035092 Bacteria 1544
625 Ga0373923_0004472 3300035111 Bacteria 4641
626 Ga0373936_0088302 3300035113 Bacteria 1297
627 Ga0373936_0154046 3300035113 Bacteria 998
628 Ga0373939_0157285 3300035114 Bacteria 832
629 Ga0373941_0044152 3300035115 Bacteria 1390
630 Ga0373945_0014083 3300035116 Bacteria 2676
631 Ga0373953_0005116 3300035117 Bacteria 4236
632 Ga0373954_0005514 3300035118 Bacteria 5473
633 Ga0373957_0001985 3300035120 Bacteria 5712
634 Ga0373960_0011455 3300035121 Bacteria 2186
635 Ga0373960_0180484 3300035121 Unclassified 737
636 Ga0373943_0016010 3300035170 Bacteria 3414
637 Ga0373943_0016358 3300035170 Bacteria 3381
638 Ga0373943_0118281 3300035170 Bacteria 1406
639 Ga0373946_0010307 3300035171 Bacteria 3456
640 Ga0373946_0064686 3300035171 Bacteria 1565
641 Ga0373961_0041732 3300035241 Bacteria 1327
642 Ga0373962_0043302 3300035242 Bacteria 1276
643 Ga0373924_0061551 3300035410 Bacteria 1571
644 Ga0373931_0045589 3300035691 Bacteria 2316
645 Ga0373931_0055066 3300035691 Bacteria 2127
646 Ga0373931_0060654 3300035691 Bacteria 2037
647 Ga0373931_0219834 3300035691 Bacteria 1143
648 Ga0373931_0371679 3300035691 Bacteria 899
649 Ga0373935_0001749 3300035692 Bacteria 12185
650 Ga0373935_0050340 3300035692 Bacteria 2643
651 Ga0373935_0154447 3300035692 Bacteria 1560
652 Ga0373935_0689937 3300035692 Bacteria 751
653 Ga0373927_0049597 3300035695 Bacteria 2714
654 Ga0373927_0114758 3300035695 Bacteria 1756
655 Ga0373933_0009136 3300035724 Bacteria 5411
656 Ga0373933_0055799 3300035724 Bacteria 2371
657 Ga0373933_0186062 3300035724 Bacteria 1326
658 Ga0373947_0001187 3300035725 Bacteria 16034
659 Ga0373947_0055216 3300035725 Bacteria 2398
660 Ga0373947_0088994 3300035725 Bacteria 1922
661 Ga0373947_0218404 3300035725 Bacteria 1252
662 Ga0373947_0328429 3300035725 Bacteria 1024
663 Ga0373937_0027974 3300036401 Bacteria 5100
664 Ga0373925_0004244 3300037068 Bacteria 10859
665 Ga0373925_0031296 3300037068 Bacteria 3909
666 Ga0373925_0098000 3300037068 Bacteria 2249
667 Ga0373925_0280237 3300037068 Bacteria 1342
668 Ga0373925_0407901 3300037068 Bacteria 1109
669 Ga0373925_0720753 3300037068 Bacteria 822
670 Ga0395899_0226593 3300037312 Bacteria 1292
671 Ga0395898_0584294 3300037466 Bacteria 1059
672 Ga0436364_0355624 3300037853 Unclassified 632
673 Ga0436364_0518470 3300037853 Bacteria 958
674 Ga0436364_1028562 3300037853 Bacteria 2308
675 Ga0395901_0387110 3300038443 Bacteria 1438
676 Ga0395901_0718909 3300038443 Bacteria 994
677 Ga0436365_0149298 3300039437 Bacteria 3877
678 Ga0436365_0197847 3300039437 Bacteria 1387
679 Ga0436365_0824382 3300039437 Bacteria 33017
680 Ga0436365_0935211 3300039437 Bacteria 4319
681 Ga0436365_1674695 3300039437 Bacteria 1636
682 Ga0436365_1830793 3300039437 Bacteria 7430
683 Ga0436365_1847958 3300039437 Bacteria 1444
684 Ga0436360_0240872 3300039438 Bacteria 1876
685 Ga0436360_0439418 3300039438 Bacteria 618
686 Ga0436360_0499041 3300039438 Unclassified 1164
687 Ga0436363_1542522 3300039450 Bacteria 1800
688 Ga0436362_0355831 3300039453 Bacteria 6148
689 Ga0436362_0450274 3300039453 Bacteria 1059
690 Ga0451853_0763982 3300041512 Bacteria 895
691 Ga0466964_0323269 3300044706 Bacteria 785
692 Ga0466957_0106069 3300044842 Bacteria 1777
693 Ga0466967_0148355 3300045976 Bacteria 2189
694 Ga0495592_0010242 3300046454 Bacteria 7067
695 Ga0495603_0019912 3300046455 Bacteria 4064
696 Ga0495603_0061344 3300046455 Bacteria 2220
697 Ga0495603_0092761 3300046455 Bacteria 1765
698 Ga0495603_0360030 3300046455 Bacteria 835
699 Ga0495629_0000968 3300046459 Bacteria 23136
700 Ga0495629_0002739 3300046459 Bacteria 13484
701 Ga0495629_0170466 3300046459 Bacteria 1510
702 Ga0495629_0194292 3300046459 Bacteria 1404
703 Ga0495629_0237156 3300046459 Bacteria 1256
704 Ga0495641_0017865 3300046461 Bacteria 3678
705 Ga0495641_0067514 3300046461 Bacteria 1608
706 Ga0495651_0002173 3300046462 Bacteria 15168
707 Ga0495580_0169764 3300046472 Bacteria 1508
708 Ga0495580_0207559 3300046472 Bacteria 1348
709 Ga0495582_0002401 3300046473 Bacteria 10460
710 Ga0495582_0125756 3300046473 Bacteria 1446
711 Ga0495639_0010527 3300046475 Bacteria 3983
712 Ga0495662_0033198 3300046476 Bacteria 2494
713 Ga0495664_0048328 3300046477 Bacteria 2525
714 Ga0495664_0050516 3300046477 Bacteria 2469
715 Ga0495584_0116793 3300046491 Bacteria 1351
716 Ga0495608_0009348 3300046511 Bacteria 6852
717 Ga0495618_0137727 3300046514 Bacteria 1561
718 Ga0495618_0172602 3300046514 Bacteria 1375
719 Ga0495628_0019118 3300046516 Bacteria 5666
720 Ga0495630_0103761 3300046517 Bacteria 2151
721 Ga0495666_0069639 3300046526 Bacteria 1673
722 Ga0495652_0040582 3300046529 Bacteria 4022
723 Ga0495652_0204387 3300046529 Bacteria 1496
724 Ga0495665_0047177 3300046531 Bacteria 2285
725 Ga0495640_0029383 3300046533 Bacteria 3947
726 Ga0495640_0039156 3300046533 Bacteria 3328
727 Ga0495586_0058031 3300046535 Bacteria 2101
728 Ga0495586_0059730 3300046535 Bacteria 2072
729 Ga0495586_0234475 3300046535 Bacteria 1045
730 Ga0495587_0008084 3300046536 Bacteria 6783
731 Ga0495621_0102654 3300046539 Bacteria 1090
732 Ga0495645_0015451 3300046543 Bacteria 5428
733 Ga0495622_0112543 3300046557 Bacteria 1246
734 Ga0495667_0000293 3300046559 Bacteria 32233
735 Ga0495634_0041569 3300046642 Bacteria 3121
736 Ga0495634_0116882 3300046642 Bacteria 1710
737 Ga0495635_0067993 3300046663 Bacteria 2443
738 Ga0495635_0248520 3300046663 Bacteria 1199
739 Ga0495588_0023331 3300046674 Bacteria 3063
740 Ga0495657_0009103 3300046675 Bacteria 7544
741 Ga0495599_0006529 3300046678 Bacteria 7036
742 Ga0495623_0000668 3300046679 Bacteria 22825
743 Ga0495646_0022084 3300046680 Bacteria 4016
744 Ga0495647_0061937 3300046681 Bacteria 1478
745 Ga0495658_0016691 3300046683 Bacteria 3780
746 Ga0495658_0018823 3300046683 Bacteria 3596
747 Ga0495658_0028467 3300046683 Bacteria 3016
748 Ga0495613_0004415 3300046689 Bacteria 10535
749 Ga0495613_0129516 3300046689 Bacteria 1807
750 Ga0495624_0059043 3300046690 Bacteria 2407
751 Ga0495624_0115959 3300046690 Bacteria 1646
752 Ga0495600_0004765 3300046809 Bacteria 8139
753 Ga0495581_0010403 3300047315 Bacteria 5382
754 Ga0495581_0056406 3300047315 Bacteria 2267
755 Ga0495581_0159070 3300047315 Bacteria 1320
756 Ga0495604_0005199 3300047317 Bacteria 10311
757 Ga0495674_0009612 3300047319 Bacteria 9185
758 Ga0495674_0311394 3300047319 Bacteria 1284
759 Ga0495676_0038286 3300047321 Bacteria 3983
760 Ga0495680_0003160 3300047322 Bacteria 16401
761 Ga0495680_0013735 3300047322 Bacteria 7048
762 Ga0495680_0072609 3300047322 Bacteria 2617
763 Ga0495680_0273544 3300047322 Bacteria 1192
764 Ga0495675_0002509 3300047444 Bacteria 10987
765 Ga0495684_0037697 3300047471 Bacteria 3708
766 Ga0495684_0240931 3300047471 Bacteria 1319
767 Ga0495684_0258369 3300047471 Bacteria 1264
768 Ga0495593_0063278 3300047673 Bacteria 1932
769 Ga0495602_0020889 3300048088 Bacteria 6460
770 Ga0495614_0327169 3300048089 Unclassified 712
771 Ga0496100_0000750 3300048903 Bacteria 15473
772 Ga0496100_0017698 3300048903 Bacteria 4212
773 Ga0496100_0355975 3300048903 Bacteria 1106
774 Ga0496101_0001812 3300048904 Bacteria 12875
775 Ga0496101_0002124 3300048904 Bacteria 12082
776 Ga0496102_0004194 3300048905 Bacteria 12188
777 Ga0496102_0217808 3300048905 Bacteria 1799
778 Ga0496102_0545231 3300048905 Bacteria 1082
779 Ga0496102_0604557 3300048905 Bacteria 1019
780 Ga0496103_0018426 3300048906 Bacteria 4187
781 Ga0496103_0332495 3300048906 Bacteria 977
782 Ga0496103_0374971 3300048906 Bacteria 914
783 Ga0496104_0029377 3300048907 Bacteria 5098
784 Ga0496104_0035486 3300048907 Bacteria 4655
785 Ga0496104_0059292 3300048907 Bacteria 3623
786 Ga0496104_0061938 3300048907 Bacteria 3547
787 Ga0496104_0065245 3300048907 Bacteria 3454
788 Ga0496104_0090101 3300048907 Bacteria 2930
789 Ga0496104_0092744 3300048907 Bacteria 2888
790 Ga0496104_0607820 3300048907 Bacteria 1003
791 Ga0496104_0914367 3300048907 Bacteria 782
792 Ga0496105_0020983 3300048908 Bacteria 5283
793 Ga0496105_0032117 3300048908 Bacteria 4306
794 Ga0496105_0063766 3300048908 Bacteria 3040
795 Ga0496105_0126202 3300048908 Bacteria 2109
796 Ga0496106_0006214 3300048909 Bacteria 8836
797 Ga0496106_0051165 3300048909 Bacteria 3114
798 Ga0496106_0072695 3300048909 Bacteria 2630
799 Ga0496106_0125465 3300048909 Bacteria 2009
800 Ga0496106_0257141 3300048909 Bacteria 1397
801 Ga0496107_0001758 3300048910 Bacteria 13650
802 Ga0496107_0018485 3300048910 Bacteria 4907
803 Ga0496107_0029092 3300048910 Bacteria 3928
804 Ga0496107_0031019 3300048910 Bacteria 3811
805 Ga0496107_0289079 3300048910 Unclassified 1220
806 Ga0496108_0004140 3300048911 Bacteria 11661
807 Ga0496108_0075310 3300048911 Bacteria 2851
808 Ga0496108_0127310 3300048911 Bacteria 2187
809 Ga0496108_0210282 3300048911 Bacteria 1689
810 Ga0496109_0011017 3300048912 Bacteria 7749
811 Ga0496109_0043248 3300048912 Bacteria 4082
812 Ga0496109_0053904 3300048912 Bacteria 3669
813 Ga0496109_0057152 3300048912 Bacteria 3560
814 Ga0496109_0067238 3300048912 Bacteria 3283
815 Ga0496109_0087812 3300048912 Bacteria 2872
816 Ga0496109_1083213 3300048912 Bacteria 738
817 Ga0496110_0006110 3300048913 Bacteria 9492
818 Ga0496110_0029921 3300048913 Bacteria 4692
819 Ga0496110_0098292 3300048913 Bacteria 2623
820 Ga0496110_0161538 3300048913 Bacteria 2031
821 Ga0496110_0237197 3300048913 Bacteria 1659
822 Ga0496111_0003203 3300048914 Bacteria 10103
823 Ga0496111_0005507 3300048914 Bacteria 8129
824 Ga0496111_0008722 3300048914 Bacteria 6728
825 Ga0496111_0288518 3300048914 Bacteria 1217
826 Ga0496112_0020496 3300048915 Bacteria 6269
827 Ga0496112_0022976 3300048915 Bacteria 5950
828 Ga0496112_0048980 3300048915 Bacteria 4140
829 Ga0496112_0132298 3300048915 Bacteria 2465
830 Ga0496112_0143502 3300048915 Bacteria 2356
831 Ga0496112_0308903 3300048915 Bacteria 1526
832 Ga0496112_1068710 3300048915 Bacteria 726
833 Ga0496113_0011380 3300048916 Bacteria 5932
834 Ga0496113_0016379 3300048916 Bacteria 5120
835 Ga0496113_0020122 3300048916 Bacteria 4685
836 Ga0496113_0081844 3300048916 Bacteria 2475
837 Ga0496113_0216394 3300048916 Bacteria 1526
838 Ga0496114_0002778 3300048917 Bacteria 13400
839 Ga0496114_0015488 3300048917 Bacteria 6131
840 Ga0496114_0211590 3300048917 Bacteria 1701
841 Ga0496114_0356194 3300048917 Bacteria 1294
842 Ga0496115_0007409 3300048918 Bacteria 8072
843 Ga0496115_0025791 3300048918 Bacteria 4580
844 Ga0496115_0042324 3300048918 Bacteria 3628
845 Ga0496115_0105287 3300048918 Bacteria 2315
846 Ga0496115_0259452 3300048918 Bacteria 1429
847 Ga0496115_0579949 3300048918 Bacteria 893
848 Ga0496124_0297108 3300048927 Bacteria 1169
849 Ga0501034_0193514 3300049571 Bacteria 1995
850 nmdc:mga03683_1814_c1 3300050489 Bacteria 6480
851 nmdc:mga0yw44_210807_c2 3300050492 Bacteria 824
852 nmdc:mga0k408_657126_c1 3300050493 Unclassified 616
853 nmdc:mga07m45_13018_c1 3300050496 Bacteria 4402
854 nmdc:mga08y16_1274714_c1 3300050511 Unclassified 703
855 nmdc:mga0n895_1498942_c1 3300050512 Bacteria 641
856 nmdc:mga0n895_340577_c1 3300050512 Bacteria 1519
857 nmdc:mga0n895_340581_c1 3300050512 Bacteria 1519
858 nmdc:mga0n895_840153_c1 3300050512 Bacteria 907
859 nmdc:mga0rr50_398764_c1 3300050513 Bacteria 1162
860 nmdc:mga0rr50_709556_c1 3300050513 Bacteria 858
861 nmdc:mga08x19_143908_c1 3300050514 Bacteria 1611
862 nmdc:mga08x19_601871_c1 3300050514 Unclassified 779
863 nmdc:mga0sz30_14243_c1 3300050516 Bacteria 3126
864 Ga0495601_0001091 3300053077 Bacteria 14889
865 Ga0495601_0259441 3300053077 Bacteria 1134
866 Ga0495612_0008078 3300053078 Bacteria 4283
867 Ga0495612_0073496 3300053078 Bacteria 1428
868 Ga0495612_0130860 3300053078 Bacteria 1084
869 Ga0495612_0265321 3300053078 Bacteria 766
870 Ga0495595_0001076 3300053084 Bacteria 10560
871 Ga0495619_0000324 3300053085 Bacteria 33369
872 Ga0495619_0002201 3300053085 Bacteria 12906
873 Ga0495619_0007062 3300053085 Bacteria 7106
874 Ga0495619_0132260 3300053085 Bacteria 1715
875 Ga0500643_110651 3300053087 Unclassified 742
876 Ga0500647_0128028 3300053091 Bacteria 1198
877 Ga0500650_0346865 3300053098 Unclassified 650
878 Ga0500642_0024659 3300053130 Bacteria 2433
879 Ga0500559_0138601 3300053136 Bacteria 1139
880 Ga0500616_0001916 3300053153 Bacteria 18590

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0499041 Ga0436360_0499041_18_572 175
2 3300053078 Ga0495612_0265321 Ga0495612_0265321_194_742 175
3 3300005467 Ga0070706_100878300 Ga0070706_1008783002 176
4 3300005536 Ga0070697_100099113 Ga0070697_1000991132 176
5 3300005329 Ga0070683_100467700 Ga0070683_1004677001 177
6 3300005366 Ga0070659_100498768 Ga0070659_1004987681 177
7 3300005436 Ga0070713_100053191 Ga0070713_1000531914 177
8 3300005455 Ga0070663_101012519 Ga0070663_1010125192 177
9 3300005578 Ga0068854_100649616 Ga0068854_1006496162 177
10 3300006881 Ga0068865_101089029 Ga0068865_1010890292 177
11 3300013297 Ga0157378_10918132 Ga0157378_109181322 177
12 3300021358 Ga0213873_10013063 Ga0213873_100130632 177
13 3300021384 Ga0213876_10036782 Ga0213876_100367822 177
14 3300025907 Ga0207645_10094801 Ga0207645_100948012 177
15 3300025916 Ga0207663_10584609 Ga0207663_105846092 177
16 3300025929 Ga0207664_10626436 Ga0207664_106264362 177
17 3300034957 Ga0373938_0014105 Ga0373938_0014105_857_1411 177
18 3300039437 Ga0436365_1830793 Ga0436365_1830793_4427_4999 177
19 3300039453 Ga0436362_0355831 Ga0436362_0355831_410_982 177
20 3300046535 Ga0495586_0234475 Ga0495586_0234475_83_637 177
21 3300050492 nmdc:mga0yw44_210807_c2 nmdc:mga0yw44_210807_c2_51_629 177
22 3300005331 Ga0070670_100371574 Ga0070670_1003715742 178
23 3300005340 Ga0070689_100027304 Ga0070689_1000273044 178
24 3300005354 Ga0070675_100528793 Ga0070675_1005287932 178
25 3300005435 Ga0070714_100050832 Ga0070714_1000508323 178
26 3300005617 Ga0068859_100140301 Ga0068859_1001403013 178
27 3300006048 Ga0075363_100599798 Ga0075363_1005997981 178
28 3300006163 Ga0070715_10018821 Ga0070715_100188212 178
29 3300006173 Ga0070716_100089845 Ga0070716_1000898452 178
30 3300006178 Ga0075367_10220166 Ga0075367_102201662 178
31 3300006186 Ga0075369_10044353 Ga0075369_100443532 178
32 3300006931 Ga0097620_100140316 Ga0097620_1001403162 178
33 3300007788 Ga0099795_10010690 Ga0099795_100106902 178
34 3300007788 Ga0099795_10070276 Ga0099795_100702762 178
35 3300009177 Ga0105248_10651701 Ga0105248_106517013 178
36 3300009177 Ga0105248_11796547 Ga0105248_117965472 178
37 3300011119 Ga0105246_11430036 Ga0105246_114300361 178
38 3300013296 Ga0157374_10780799 Ga0157374_107807992 178
39 3300014969 Ga0157376_10332841 Ga0157376_103328412 178
40 3300017792 Ga0163161_10275425 Ga0163161_102754252 178
41 3300021384 Ga0213876_10273573 Ga0213876_102735732 178
42 3300025302 Ga0207426_1022401 Ga0207426_10224012 178
43 3300025925 Ga0207650_10610848 Ga0207650_106108482 178
44 3300025926 Ga0207659_10207470 Ga0207659_102074702 178
45 3300025929 Ga0207664_10019090 Ga0207664_100190902 178
46 3300025931 Ga0207644_10227425 Ga0207644_102274252 178
47 3300025934 Ga0207686_10072241 Ga0207686_100722412 178
48 3300025937 Ga0207669_10027702 Ga0207669_100277023 178
49 3300025939 Ga0207665_10024706 Ga0207665_100247064 178
50 3300026075 Ga0207708_10119935 Ga0207708_101199352 178
51 3300026121 Ga0207683_10009436 Ga0207683_100094366 178
52 3300026142 Ga0207698_11620535 Ga0207698_116205351 178
53 3300028380 Ga0268265_10356902 Ga0268265_103569022 178
54 3300031238 Ga0265332_10239652 Ga0265332_102396521 178
55 3300031456 Ga0307513_10296736 Ga0307513_102967362 178
56 3300035083 Ga0373926_0044929 Ga0373926_0044929_214_762 178
57 3300035113 Ga0373936_0154046 Ga0373936_0154046_176_724 178
58 3300035170 Ga0373943_0118281 Ga0373943_0118281_115_663 178
59 3300035171 Ga0373946_0064686 Ga0373946_0064686_107_655 178
60 3300035691 Ga0373931_0371679 Ga0373931_0371679_11_565 178
61 3300035692 Ga0373935_0154447 Ga0373935_0154447_80_628 178
62 3300035692 Ga0373935_0689937 Ga0373935_0689937_131_685 178
63 3300035725 Ga0373947_0218404 Ga0373947_0218404_313_861 178
64 3300037068 Ga0373925_0098000 Ga0373925_0098000_222_770 178
65 3300039437 Ga0436365_0197847 Ga0436365_0197847_110_691 178
66 3300039437 Ga0436365_0824382 Ga0436365_0824382_10144_10755 178
67 3300039437 Ga0436365_0935211 Ga0436365_0935211_807_1388 178
68 3300039437 Ga0436365_1674695 Ga0436365_1674695_784_1338 178
69 3300039438 Ga0436360_0240872 Ga0436360_0240872_616_1197 178
70 3300039438 Ga0436360_0439418 Ga0436360_0439418_28_582 178
71 3300039453 Ga0436362_0450274 Ga0436362_0450274_162_728 178
72 3300046472 Ga0495580_0207559 Ga0495580_0207559_187_735 178
73 3300049571 Ga0501034_0193514 Ga0501034_0193514_628_1182 178
74 3300050493 nmdc:mga0k408_657126_c1 nmdc:mga0k408_657126_c1_21_575 178
75 3300050516 nmdc:mga0sz30_14243_c1 nmdc:mga0sz30_14243_c1_1513_2067 178
76 3300053078 Ga0495612_0130860 Ga0495612_0130860_15_596 178
77 3300053087 Ga0500643_110651 Ga0500643_110651_168_722 178
78 3300053098 Ga0500650_0346865 Ga0500650_0346865_65_619 178
79 3300053130 Ga0500642_0024659 Ga0500642_0024659_1337_1891 178
80 3300053153 Ga0500616_0001916 Ga0500616_0001916_17257_17811 178
81 3300005327 Ga0070658_10081862 Ga0070658_100818623 179
82 3300005334 Ga0068869_100100516 Ga0068869_1001005161 179
83 3300005335 Ga0070666_10861835 Ga0070666_108618351 179
84 3300005336 Ga0070680_100000933 Ga0070680_1000009339 179
85 3300005338 Ga0068868_100130503 Ga0068868_1001305031 179
86 3300005338 Ga0068868_100456767 Ga0068868_1004567672 179
87 3300005340 Ga0070689_100106442 Ga0070689_1001064422 179
88 3300005341 Ga0070691_10009000 Ga0070691_100090004 179
89 3300005354 Ga0070675_100722109 Ga0070675_1007221091 179
90 3300005434 Ga0070709_10205940 Ga0070709_102059402 179
91 3300005440 Ga0070705_100666759 Ga0070705_1006667591 179
92 3300005445 Ga0070708_100108249 Ga0070708_1001082492 179
93 3300005457 Ga0070662_100337719 Ga0070662_1003377192 179
94 3300005458 Ga0070681_10157011 Ga0070681_101570113 179
95 3300005458 Ga0070681_10430920 Ga0070681_104309202 179
96 3300005467 Ga0070706_100021874 Ga0070706_1000218744 179
97 3300005471 Ga0070698_100002091 Ga0070698_10000209124 179
98 3300005518 Ga0070699_100013134 Ga0070699_1000131344 179
99 3300005530 Ga0070679_100009132 Ga0070679_1000091328 179
100 3300005535 Ga0070684_100262668 Ga0070684_1002626682 179
101 3300005548 Ga0070665_100475083 Ga0070665_1004750832 179
102 3300005563 Ga0068855_100994653 Ga0068855_1009946532 179
103 3300005564 Ga0070664_100252212 Ga0070664_1002522122 179
104 3300005577 Ga0068857_100119758 Ga0068857_1001197582 179
105 3300005577 Ga0068857_100206745 Ga0068857_1002067451 179
106 3300005614 Ga0068856_100180424 Ga0068856_1001804242 179
107 3300005937 Ga0081455_10034958 Ga0081455_100349583 179
108 3300006353 Ga0075370_10022929 Ga0075370_100229292 179
109 3300007265 Ga0099794_10006876 Ga0099794_100068762 179
110 3300009093 Ga0105240_10004752 Ga0105240_1000475211 179
111 3300009093 Ga0105240_10583003 Ga0105240_105830032 179
112 3300009098 Ga0105245_10261620 Ga0105245_102616202 179
113 3300009174 Ga0105241_10493190 Ga0105241_104931902 179
114 3300009545 Ga0105237_10422871 Ga0105237_104228712 179
115 3300009545 Ga0105237_10602444 Ga0105237_106024442 179
116 3300009551 Ga0105238_10157549 Ga0105238_101575492 179
117 3300010159 Ga0099796_10055649 Ga0099796_100556492 179
118 3300010375 Ga0105239_10249737 Ga0105239_102497372 179
119 3300013100 Ga0157373_10095337 Ga0157373_100953371 179
120 3300013104 Ga0157370_10160708 Ga0157370_101607081 179
121 3300013104 Ga0157370_10200552 Ga0157370_102005522 179
122 3300014745 Ga0157377_10933187 Ga0157377_109331871 179
123 3300025909 Ga0207705_10020452 Ga0207705_100204522 179
124 3300025910 Ga0207684_10025016 Ga0207684_100250162 179
125 3300025910 Ga0207684_10141231 Ga0207684_101412312 179
126 3300025912 Ga0207707_10106369 Ga0207707_101063692 179
127 3300025913 Ga0207695_10009523 Ga0207695_100095234 179
128 3300025913 Ga0207695_10800230 Ga0207695_108002302 179
129 3300025917 Ga0207660_10069311 Ga0207660_100693112 179
130 3300025921 Ga0207652_10006590 Ga0207652_100065904 179
131 3300025922 Ga0207646_10189428 Ga0207646_101894282 179
132 3300025927 Ga0207687_10561229 Ga0207687_105612292 179
133 3300025928 Ga0207700_10013374 Ga0207700_100133743 179
134 3300025929 Ga0207664_10701535 Ga0207664_107015352 179
135 3300025936 Ga0207670_10373369 Ga0207670_103733692 179
136 3300025942 Ga0207689_10046798 Ga0207689_100467984 179
137 3300025944 Ga0207661_10055119 Ga0207661_100551194 179
138 3300025945 Ga0207679_10276040 Ga0207679_102760402 179
139 3300025949 Ga0207667_10007731 Ga0207667_100077319 179
140 3300025960 Ga0207651_10632879 Ga0207651_106328792 179
141 3300025981 Ga0207640_10077434 Ga0207640_100774342 179
142 3300025981 Ga0207640_10292019 Ga0207640_102920192 179
143 3300026023 Ga0207677_10053908 Ga0207677_100539084 179
144 3300026023 Ga0207677_10904651 Ga0207677_109046511 179
145 3300026041 Ga0207639_10503493 Ga0207639_105034932 179
146 3300026078 Ga0207702_10037311 Ga0207702_100373114 179
147 3300026078 Ga0207702_10394779 Ga0207702_103947791 179
148 3300026089 Ga0207648_10994207 Ga0207648_109942072 179
149 3300026116 Ga0207674_10135299 Ga0207674_101352993 179
150 3300026142 Ga0207698_10027778 Ga0207698_100277782 179
151 3300028379 Ga0268266_10467240 Ga0268266_104672402 179
152 3300035691 Ga0373931_0055066 Ga0373931_0055066_1042_1602 179
153 3300035724 Ga0373933_0186062 Ga0373933_0186062_114_671 179
154 3300035725 Ga0373947_0328429 Ga0373947_0328429_66_626 179
155 3300037068 Ga0373925_0407901 Ga0373925_0407901_142_699 179
156 3300037312 Ga0395899_0226593 Ga0395899_0226593_46_603 179
157 3300037466 Ga0395898_0584294 Ga0395898_0584294_429_986 179
158 3300038443 Ga0395901_0387110 Ga0395901_0387110_549_1106 179
159 3300038443 Ga0395901_0718909 Ga0395901_0718909_334_891 179
160 3300044842 Ga0466957_0106069 Ga0466957_0106069_667_1224 179
161 3300045976 Ga0466967_0148355 Ga0466967_0148355_148_705 179
162 3300048909 Ga0496106_0257141 Ga0496106_0257141_302_889 179
163 3300048913 Ga0496110_0098292 Ga0496110_0098292_1891_2478 179
164 3300048914 Ga0496111_0288518 Ga0496111_0288518_330_917 179
165 3300050489 nmdc:mga03683_1814_c1 nmdc:mga03683_1814_c1_4697_5284 179
166 3300050496 nmdc:mga07m45_13018_c1 nmdc:mga07m45_13018_c1_3253_3840 179
167 3300053091 Ga0500647_0128028 Ga0500647_0128028_168_731 179
168 3300006038 Ga0075365_10533119 Ga0075365_105331192 180
169 3300007076 Ga0075435_100768089 Ga0075435_1007680892 180
170 3300028381 Ga0268264_10665660 Ga0268264_106656602 180
171 3300050513 nmdc:mga0rr50_709556_c1 nmdc:mga0rr50_709556_c1_113_679 180
172 3300005328 Ga0070676_10194291 Ga0070676_101942911 181
173 3300005331 Ga0070670_100474485 Ga0070670_1004744852 181
174 3300005335 Ga0070666_10007180 Ga0070666_100071802 181
175 3300005339 Ga0070660_100328813 Ga0070660_1003288132 181
176 3300005340 Ga0070689_100170817 Ga0070689_1001708172 181
177 3300005343 Ga0070687_100101598 Ga0070687_1001015982 181
178 3300005347 Ga0070668_100668584 Ga0070668_1006685841 181
179 3300005356 Ga0070674_100422566 Ga0070674_1004225662 181
180 3300005364 Ga0070673_100031821 Ga0070673_1000318213 181
181 3300005365 Ga0070688_100091149 Ga0070688_1000911491 181
182 3300005434 Ga0070709_10005103 Ga0070709_100051033 181
183 3300005435 Ga0070714_100004407 Ga0070714_1000044079 181
184 3300005436 Ga0070713_100005783 Ga0070713_1000057836 181
185 3300005437 Ga0070710_10289472 Ga0070710_102894722 181
186 3300005439 Ga0070711_100003421 Ga0070711_1000034213 181
187 3300005440 Ga0070705_100275999 Ga0070705_1002759991 181
188 3300005455 Ga0070663_100010454 Ga0070663_1000104545 181
189 3300005456 Ga0070678_100016483 Ga0070678_1000164834 181
190 3300005459 Ga0068867_100438499 Ga0068867_1004384991 181
191 3300005466 Ga0070685_10012319 Ga0070685_100123192 181
192 3300005535 Ga0070684_100333786 Ga0070684_1003337862 181
193 3300005544 Ga0070686_100025992 Ga0070686_1000259924 181
194 3300005547 Ga0070693_100264257 Ga0070693_1002642571 181
195 3300005549 Ga0070704_100308004 Ga0070704_1003080042 181
196 3300005564 Ga0070664_100034445 Ga0070664_1000344455 181
197 3300005615 Ga0070702_100381995 Ga0070702_1003819951 181
198 3300005618 Ga0068864_100026129 Ga0068864_1000261292 181
199 3300005718 Ga0068866_10083519 Ga0068866_100835192 181
200 3300005841 Ga0068863_100740153 Ga0068863_1007401532 181
201 3300005842 Ga0068858_100083784 Ga0068858_1000837843 181
202 3300006028 Ga0070717_10000217 Ga0070717_1000021718 181
203 3300006163 Ga0070715_10169171 Ga0070715_101691712 181
204 3300006173 Ga0070716_100000793 Ga0070716_1000007935 181
205 3300006175 Ga0070712_100230118 Ga0070712_1002301182 181
206 3300006237 Ga0097621_100008604 Ga0097621_1000086046 181
207 3300006358 Ga0068871_100009547 Ga0068871_1000095472 181
208 3300006871 Ga0075434_100623383 Ga0075434_1006233831 181
209 3300006871 Ga0075434_101836747 Ga0075434_1018367471 181
210 3300006914 Ga0075436_100101786 Ga0075436_1001017863 181
211 3300006931 Ga0097620_100128607 Ga0097620_1001286072 181
212 3300009011 Ga0105251_10023867 Ga0105251_100238672 181
213 3300009094 Ga0111539_10499406 Ga0111539_104994062 181
214 3300009098 Ga0105245_10072585 Ga0105245_100725853 181
215 3300009101 Ga0105247_10225357 Ga0105247_102253571 181
216 3300009148 Ga0105243_10071930 Ga0105243_100719302 181
217 3300009174 Ga0105241_10177093 Ga0105241_101770932 181
218 3300009176 Ga0105242_10009790 Ga0105242_100097905 181
219 3300009553 Ga0105249_11354522 Ga0105249_113545221 181
220 3300012503 Ga0157313_1018652 Ga0157313_10186521 181
221 3300013297 Ga0157378_10028760 Ga0157378_100287604 181
222 3300013307 Ga0157372_10413301 Ga0157372_104133012 181
223 3300013308 Ga0157375_10020260 Ga0157375_100202602 181
224 3300013308 Ga0157375_10476049 Ga0157375_104760492 181
225 3300014325 Ga0163163_10023573 Ga0163163_100235732 181
226 3300014326 Ga0157380_10372182 Ga0157380_103721822 181
227 3300014968 Ga0157379_10027789 Ga0157379_100277895 181
228 3300014969 Ga0157376_10310276 Ga0157376_103102762 181
229 3300014969 Ga0157376_11267269 Ga0157376_112672691 181
230 3300017792 Ga0163161_10197934 Ga0163161_101979342 181
231 3300025899 Ga0207642_10057025 Ga0207642_100570252 181
232 3300025900 Ga0207710_10002946 Ga0207710_100029466 181
233 3300025900 Ga0207710_10017187 Ga0207710_100171872 181
234 3300025901 Ga0207688_10305378 Ga0207688_103053782 181
235 3300025903 Ga0207680_10109528 Ga0207680_101095282 181
236 3300025905 Ga0207685_10010994 Ga0207685_100109942 181
237 3300025906 Ga0207699_10000138 Ga0207699_1000013836 181
238 3300025907 Ga0207645_10035490 Ga0207645_100354903 181
239 3300025911 Ga0207654_10172411 Ga0207654_101724112 181
240 3300025915 Ga0207693_10068703 Ga0207693_100687033 181
241 3300025916 Ga0207663_10009885 Ga0207663_100098855 181
242 3300025918 Ga0207662_10109126 Ga0207662_101091262 181
243 3300025919 Ga0207657_10115039 Ga0207657_101150391 181
244 3300025924 Ga0207694_10532443 Ga0207694_105324431 181
245 3300025925 Ga0207650_10107696 Ga0207650_101076962 181
246 3300025927 Ga0207687_10002691 Ga0207687_100026918 181
247 3300025928 Ga0207700_10001380 Ga0207700_100013807 181
248 3300025929 Ga0207664_10065103 Ga0207664_100651032 181
249 3300025931 Ga0207644_10000935 Ga0207644_1000093513 181
250 3300025932 Ga0207690_10257216 Ga0207690_102572162 181
251 3300025933 Ga0207706_10094134 Ga0207706_100941342 181
252 3300025934 Ga0207686_10082835 Ga0207686_100828352 181
253 3300025935 Ga0207709_10018229 Ga0207709_100182293 181
254 3300025937 Ga0207669_10686317 Ga0207669_106863172 181
255 3300025938 Ga0207704_10034813 Ga0207704_100348132 181
256 3300025941 Ga0207711_10003009 Ga0207711_1000300912 181
257 3300025944 Ga0207661_10482685 Ga0207661_104826852 181
258 3300025960 Ga0207651_10008269 Ga0207651_100082694 181
259 3300025961 Ga0207712_10056019 Ga0207712_100560193 181
260 3300025972 Ga0207668_10287708 Ga0207668_102877082 181
261 3300025986 Ga0207658_10043132 Ga0207658_100431323 181
262 3300026023 Ga0207677_10014584 Ga0207677_100145843 181
263 3300026035 Ga0207703_10059365 Ga0207703_100593652 181
264 3300026067 Ga0207678_10018666 Ga0207678_100186662 181
265 3300026075 Ga0207708_10560777 Ga0207708_105607772 181
266 3300026078 Ga0207702_10337087 Ga0207702_103370871 181
267 3300026088 Ga0207641_10059622 Ga0207641_100596223 181
268 3300026095 Ga0207676_10007601 Ga0207676_100076016 181
269 3300026116 Ga0207674_10291894 Ga0207674_102918942 181
270 3300026121 Ga0207683_10001479 Ga0207683_1000147918 181
271 3300027907 Ga0207428_10760941 Ga0207428_107609411 181
272 3300028379 Ga0268266_10287372 Ga0268266_102873722 181
273 3300035092 Ga0373952_0015400 Ga0373952_0015400_177_755 181
274 3300035121 Ga0373960_0180484 Ga0373960_0180484_73_651 181
275 3300035242 Ga0373962_0043302 Ga0373962_0043302_419_997 181
276 3300035691 Ga0373931_0219834 Ga0373931_0219834_92_670 181
277 3300035725 Ga0373947_0055216 Ga0373947_0055216_1649_2227 181
278 3300037068 Ga0373925_0031296 Ga0373925_0031296_399_977 181
279 3300046455 Ga0495603_0092761 Ga0495603_0092761_1073_1651 181
280 3300046459 Ga0495629_0002739 Ga0495629_0002739_681_1259 181
281 3300046461 Ga0495641_0067514 Ga0495641_0067514_192_770 181
282 3300046683 Ga0495658_0028467 Ga0495658_0028467_1258_1836 181
283 3300046689 Ga0495613_0004415 Ga0495613_0004415_494_1072 181
284 3300047315 Ga0495581_0010403 Ga0495581_0010403_115_693 181
285 3300047322 Ga0495680_0013735 Ga0495680_0013735_4152_4730 181
286 3300048089 Ga0495614_0327169 Ga0495614_0327169_61_639 181
287 3300048903 Ga0496100_0017698 Ga0496100_0017698_505_1083 181
288 3300048905 Ga0496102_0545231 Ga0496102_0545231_161_739 181
289 3300048906 Ga0496103_0018426 Ga0496103_0018426_1599_2177 181
290 3300048906 Ga0496103_0374971 Ga0496103_0374971_15_581 181
291 3300048907 Ga0496104_0029377 Ga0496104_0029377_3806_4384 181
292 3300048907 Ga0496104_0090101 Ga0496104_0090101_864_1442 181
293 3300048908 Ga0496105_0032117 Ga0496105_0032117_3258_3836 181
294 3300048908 Ga0496105_0063766 Ga0496105_0063766_1058_1636 181
295 3300048908 Ga0496105_0126202 Ga0496105_0126202_772_1350 181
296 3300048909 Ga0496106_0051165 Ga0496106_0051165_1627_2205 181
297 3300048910 Ga0496107_0001758 Ga0496107_0001758_10395_10973 181
298 3300048912 Ga0496109_0011017 Ga0496109_0011017_3535_4113 181
299 3300048912 Ga0496109_0057152 Ga0496109_0057152_30_608 181
300 3300048913 Ga0496110_0029921 Ga0496110_0029921_3258_3836 181
301 3300048914 Ga0496111_0005507 Ga0496111_0005507_5355_5933 181
302 3300048915 Ga0496112_0022976 Ga0496112_0022976_4516_5094 181
303 3300048915 Ga0496112_0132298 Ga0496112_0132298_1108_1686 181
304 3300048916 Ga0496113_0020122 Ga0496113_0020122_850_1428 181
305 3300048917 Ga0496114_0002778 Ga0496114_0002778_5504_6082 181
306 3300048918 Ga0496115_0025791 Ga0496115_0025791_1806_2384 181
307 3300048927 Ga0496124_0297108 Ga0496124_0297108_184_762 181
308 3300050511 nmdc:mga08y16_1274714_c1 nmdc:mga08y16_1274714_c1_68_646 181
309 3300050512 nmdc:mga0n895_340577_c1 nmdc:mga0n895_340577_c1_515_1093 181
310 3300050512 nmdc:mga0n895_840153_c1 nmdc:mga0n895_840153_c1_245_823 181
311 3300050514 nmdc:mga08x19_601871_c1 nmdc:mga08x19_601871_c1_117_695 181
312 3300053085 Ga0495619_0002201 Ga0495619_0002201_89_667 181
313 3300037853 Ga0436364_0355624 Ga0436364_0355624_52_621 182
314 3300050513 nmdc:mga0rr50_398764_c1 nmdc:mga0rr50_398764_c1_471_1058 182
315 3300005355 Ga0070671_100449118 Ga0070671_1004491182 183
316 3300005841 Ga0068863_101157154 Ga0068863_1011571542 183
317 3300014969 Ga0157376_11215520 Ga0157376_112155201 184
318 3300037853 Ga0436364_0518470 Ga0436364_0518470_162_773 184
319 3300009098 Ga0105245_10446651 Ga0105245_104466512 185
320 3300005367 Ga0070667_100758360 Ga0070667_1007583602 186
321 3300005434 Ga0070709_10112268 Ga0070709_101122682 186
322 3300005435 Ga0070714_100192350 Ga0070714_1001923501 186
323 3300005436 Ga0070713_100059691 Ga0070713_1000596912 186
324 3300005437 Ga0070710_10151809 Ga0070710_101518092 186
325 3300005439 Ga0070711_100296402 Ga0070711_1002964022 186
326 3300005441 Ga0070700_100266928 Ga0070700_1002669281 186
327 3300005459 Ga0068867_100325004 Ga0068867_1003250042 186
328 3300005543 Ga0070672_100293517 Ga0070672_1002935172 186
329 3300005548 Ga0070665_100948496 Ga0070665_1009484961 186
330 3300005617 Ga0068859_100715312 Ga0068859_1007153122 186
331 3300006028 Ga0070717_10077749 Ga0070717_100777492 186
332 3300006163 Ga0070715_10013506 Ga0070715_100135063 186
333 3300006163 Ga0070715_10342259 Ga0070715_103422591 186
334 3300006237 Ga0097621_100775284 Ga0097621_1007752841 186
335 3300006931 Ga0097620_100715278 Ga0097620_1007152782 186
336 3300009176 Ga0105242_10685281 Ga0105242_106852811 186
337 3300010375 Ga0105239_10190768 Ga0105239_101907682 186
338 3300013296 Ga0157374_10554852 Ga0157374_105548521 186
339 3300013297 Ga0157378_10141988 Ga0157378_101419883 186
340 3300025899 Ga0207642_10046942 Ga0207642_100469422 186
341 3300025905 Ga0207685_10014352 Ga0207685_100143522 186
342 3300025906 Ga0207699_10012288 Ga0207699_100122883 186
343 3300025915 Ga0207693_10188144 Ga0207693_101881442 186
344 3300025926 Ga0207659_10773830 Ga0207659_107738301 186
345 3300025928 Ga0207700_10005532 Ga0207700_100055326 186
346 3300025960 Ga0207651_11122415 Ga0207651_111224151 186
347 3300026035 Ga0207703_10028873 Ga0207703_100288733 186
348 3300026075 Ga0207708_10307722 Ga0207708_103077222 186
349 3300026089 Ga0207648_10097767 Ga0207648_100977673 186
350 3300028379 Ga0268266_10434179 Ga0268266_104341791 186
351 3300031249 Ga0265339_10111078 Ga0265339_101110782 187
352 3300039437 Ga0436365_1847958 Ga0436365_1847958_667_1248 187
353 3300046455 Ga0495603_0360030 Ga0495603_0360030_52_636 187
354 3300005328 Ga0070676_10000847 Ga0070676_1000084717 188
355 3300005328 Ga0070676_10302408 Ga0070676_103024081 188
356 3300005331 Ga0070670_100034811 Ga0070670_1000348113 188
357 3300005333 Ga0070677_10130336 Ga0070677_101303362 188
358 3300005335 Ga0070666_10089412 Ga0070666_100894122 188
359 3300005338 Ga0068868_100410314 Ga0068868_1004103142 188
360 3300005340 Ga0070689_100028079 Ga0070689_1000280794 188
361 3300005340 Ga0070689_100150431 Ga0070689_1001504312 188
362 3300005347 Ga0070668_100004542 Ga0070668_1000045429 188
363 3300005353 Ga0070669_100005778 Ga0070669_1000057782 188
364 3300005353 Ga0070669_100370722 Ga0070669_1003707222 188
365 3300005354 Ga0070675_100001685 Ga0070675_10000168517 188
366 3300005356 Ga0070674_100003123 Ga0070674_1000031232 188
367 3300005364 Ga0070673_100083704 Ga0070673_1000837042 188
368 3300005364 Ga0070673_100117678 Ga0070673_1001176783 188
369 3300005367 Ga0070667_100010578 Ga0070667_1000105782 188
370 3300005367 Ga0070667_100076418 Ga0070667_1000764182 188
371 3300005435 Ga0070714_100539274 Ga0070714_1005392742 188
372 3300005438 Ga0070701_10087033 Ga0070701_100870332 188
373 3300005456 Ga0070678_100001027 Ga0070678_1000010279 188
374 3300005459 Ga0068867_100001109 Ga0068867_1000011096 188
375 3300005535 Ga0070684_100761394 Ga0070684_1007613941 188
376 3300005543 Ga0070672_100105024 Ga0070672_1001050242 188
377 3300005543 Ga0070672_100125652 Ga0070672_1001256522 188
378 3300005548 Ga0070665_100088331 Ga0070665_1000883313 188
379 3300005617 Ga0068859_100162478 Ga0068859_1001624782 188
380 3300005618 Ga0068864_100010322 Ga0068864_1000103222 188
381 3300005719 Ga0068861_100162574 Ga0068861_1001625742 188
382 3300005842 Ga0068858_100003682 Ga0068858_1000036828 188
383 3300005843 Ga0068860_100012825 Ga0068860_1000128257 188
384 3300005844 Ga0068862_100039466 Ga0068862_1000394663 188
385 3300006173 Ga0070716_100023037 Ga0070716_1000230373 188
386 3300006173 Ga0070716_100454115 Ga0070716_1004541151 188
387 3300006175 Ga0070712_100191421 Ga0070712_1001914212 188
388 3300006237 Ga0097621_100002390 Ga0097621_1000023908 188
389 3300006358 Ga0068871_100001576 Ga0068871_1000015769 188
390 3300006881 Ga0068865_100038086 Ga0068865_1000380862 188
391 3300006881 Ga0068865_100791873 Ga0068865_1007918731 188
392 3300006931 Ga0097620_100162473 Ga0097620_1001624732 188
393 3300009177 Ga0105248_10001952 Ga0105248_1000195227 188
394 3300009177 Ga0105248_10124081 Ga0105248_101240813 188
395 3300009545 Ga0105237_10254079 Ga0105237_102540792 188
396 3300009551 Ga0105238_10276775 Ga0105238_102767751 188
397 3300009553 Ga0105249_10104828 Ga0105249_101048282 188
398 3300013296 Ga0157374_10009414 Ga0157374_100094146 188
399 3300013297 Ga0157378_10122317 Ga0157378_101223172 188
400 3300013297 Ga0157378_10477251 Ga0157378_104772512 188
401 3300013306 Ga0163162_10001709 Ga0163162_100017098 188
402 3300013306 Ga0163162_10045452 Ga0163162_100454522 188
403 3300013308 Ga0157375_10009216 Ga0157375_100092162 188
404 3300013308 Ga0157375_10708299 Ga0157375_107082992 188
405 3300014968 Ga0157379_10002943 Ga0157379_100029436 188
406 3300014969 Ga0157376_10003569 Ga0157376_100035699 188
407 3300021388 Ga0213875_10308522 Ga0213875_103085221 188
408 3300025315 Ga0207697_10003098 Ga0207697_100030983 188
409 3300025321 Ga0207656_10200211 Ga0207656_102002112 188
410 3300025893 Ga0207682_10074864 Ga0207682_100748642 188
411 3300025907 Ga0207645_10000588 Ga0207645_100005887 188
412 3300025914 Ga0207671_10907036 Ga0207671_109070361 188
413 3300025915 Ga0207693_10049736 Ga0207693_100497362 188
414 3300025923 Ga0207681_10008861 Ga0207681_100088612 188
415 3300025925 Ga0207650_10008427 Ga0207650_100084272 188
416 3300025925 Ga0207650_10023679 Ga0207650_100236793 188
417 3300025926 Ga0207659_10001888 Ga0207659_100018884 188
418 3300025928 Ga0207700_10775904 Ga0207700_107759042 188
419 3300025931 Ga0207644_10023814 Ga0207644_100238144 188
420 3300025931 Ga0207644_10071137 Ga0207644_100711372 188
421 3300025931 Ga0207644_10315610 Ga0207644_103156103 188
422 3300025931 Ga0207644_10555580 Ga0207644_105555802 188
423 3300025933 Ga0207706_10505190 Ga0207706_105051902 188
424 3300025936 Ga0207670_10122899 Ga0207670_101228992 188
425 3300025936 Ga0207670_10172597 Ga0207670_101725971 188
426 3300025938 Ga0207704_10003966 Ga0207704_100039664 188
427 3300025940 Ga0207691_10000899 Ga0207691_1000089919 188
428 3300025940 Ga0207691_10076199 Ga0207691_100761993 188
429 3300025941 Ga0207711_10002933 Ga0207711_100029334 188
430 3300025941 Ga0207711_10008791 Ga0207711_100087911 188
431 3300025942 Ga0207689_10001983 Ga0207689_1000198310 188
432 3300025944 Ga0207661_10064941 Ga0207661_100649412 188
433 3300025960 Ga0207651_10069283 Ga0207651_100692832 188
434 3300025961 Ga0207712_10309288 Ga0207712_103092882 188
435 3300025972 Ga0207668_10005107 Ga0207668_100051072 188
436 3300025986 Ga0207658_10003966 Ga0207658_100039663 188
437 3300025986 Ga0207658_10134960 Ga0207658_101349602 188
438 3300026023 Ga0207677_10043068 Ga0207677_100430682 188
439 3300026035 Ga0207703_10021693 Ga0207703_100216936 188
440 3300026088 Ga0207641_10003310 Ga0207641_1000331010 188
441 3300026089 Ga0207648_10000949 Ga0207648_100009498 188
442 3300026118 Ga0207675_100089500 Ga0207675_1000895003 188
443 3300026121 Ga0207683_10000210 Ga0207683_1000021018 188
444 3300028379 Ga0268266_10045267 Ga0268266_100452672 188
445 3300028380 Ga0268265_10202704 Ga0268265_102027042 188
446 3300028381 Ga0268264_10016111 Ga0268264_100161114 188
447 3300034818 Ga0373950_0014700 Ga0373950_0014700_436_1017 188
448 3300037853 Ga0436364_1028562 Ga0436364_1028562_1532_2164 188
449 3300039437 Ga0436365_0149298 Ga0436365_0149298_2693_3274 188
450 3300044706 Ga0466964_0323269 Ga0466964_0323269_36_623 188
451 3300048903 Ga0496100_0000750 Ga0496100_0000750_1790_2377 188
452 3300048904 Ga0496101_0002124 Ga0496101_0002124_3507_4094 188
453 3300048905 Ga0496102_0004194 Ga0496102_0004194_11474_12061 188
454 3300048907 Ga0496104_0035486 Ga0496104_0035486_168_755 188
455 3300048909 Ga0496106_0072695 Ga0496106_0072695_1856_2443 188
456 3300048910 Ga0496107_0031019 Ga0496107_0031019_2193_2780 188
457 3300048911 Ga0496108_0004140 Ga0496108_0004140_3788_4375 188
458 3300048911 Ga0496108_0075310 Ga0496108_0075310_12_599 188
459 3300048911 Ga0496108_0210282 Ga0496108_0210282_77_685 188
460 3300048912 Ga0496109_0043248 Ga0496109_0043248_2265_2852 188
461 3300048912 Ga0496109_0053904 Ga0496109_0053904_2050_2637 188
462 3300048912 Ga0496109_1083213 Ga0496109_1083213_37_618 188
463 3300048913 Ga0496110_0006110 Ga0496110_0006110_2133_2720 188
464 3300048914 Ga0496111_0003203 Ga0496111_0003203_4766_5353 188
465 3300048915 Ga0496112_0020496 Ga0496112_0020496_1276_1863 188
466 3300048915 Ga0496112_0308903 Ga0496112_0308903_911_1498 188
467 3300048916 Ga0496113_0011380 Ga0496113_0011380_4832_5419 188
468 3300048916 Ga0496113_0016379 Ga0496113_0016379_775_1362 188
469 3300048917 Ga0496114_0211590 Ga0496114_0211590_942_1550 188
470 3300048918 Ga0496115_0105287 Ga0496115_0105287_1516_2097 188
471 3300005290 Ga0065712_10483230 Ga0065712_104832301 189
472 3300005328 Ga0070676_10076395 Ga0070676_100763952 189
473 3300005328 Ga0070676_10126199 Ga0070676_101261992 189
474 3300005329 Ga0070683_100323707 Ga0070683_1003237071 189
475 3300005331 Ga0070670_100026430 Ga0070670_1000264304 189
476 3300005334 Ga0068869_100039523 Ga0068869_1000395235 189
477 3300005334 Ga0068869_100158040 Ga0068869_1001580402 189
478 3300005335 Ga0070666_10016386 Ga0070666_100163863 189
479 3300005335 Ga0070666_10107282 Ga0070666_101072822 189
480 3300005337 Ga0070682_100011560 Ga0070682_1000115606 189
481 3300005337 Ga0070682_100015105 Ga0070682_1000151055 189
482 3300005337 Ga0070682_100072844 Ga0070682_1000728442 189
483 3300005338 Ga0068868_100019189 Ga0068868_1000191893 189
484 3300005338 Ga0068868_100114985 Ga0068868_1001149852 189
485 3300005339 Ga0070660_100336016 Ga0070660_1003360162 189
486 3300005340 Ga0070689_100029734 Ga0070689_1000297344 189
487 3300005343 Ga0070687_100006230 Ga0070687_1000062303 189
488 3300005344 Ga0070661_100103487 Ga0070661_1001034872 189
489 3300005344 Ga0070661_101242938 Ga0070661_1012429381 189
490 3300005354 Ga0070675_100124241 Ga0070675_1001242412 189
491 3300005354 Ga0070675_100485032 Ga0070675_1004850321 189
492 3300005355 Ga0070671_100010441 Ga0070671_1000104416 189
493 3300005355 Ga0070671_100021219 Ga0070671_1000212192 189
494 3300005355 Ga0070671_100163771 Ga0070671_1001637712 189
495 3300005356 Ga0070674_100034449 Ga0070674_1000344494 189
496 3300005356 Ga0070674_100093096 Ga0070674_1000930961 189
497 3300005364 Ga0070673_100052687 Ga0070673_1000526872 189
498 3300005364 Ga0070673_100082620 Ga0070673_1000826202 189
499 3300005364 Ga0070673_100607081 Ga0070673_1006070812 189
500 3300005365 Ga0070688_100009043 Ga0070688_1000090433 189
501 3300005366 Ga0070659_100260774 Ga0070659_1002607742 189
502 3300005366 Ga0070659_100308486 Ga0070659_1003084862 189
503 3300005367 Ga0070667_100048749 Ga0070667_1000487494 189
504 3300005367 Ga0070667_100151466 Ga0070667_1001514663 189
505 3300005434 Ga0070709_10015799 Ga0070709_100157993 189
506 3300005434 Ga0070709_10226386 Ga0070709_102263862 189
507 3300005434 Ga0070709_10452902 Ga0070709_104529022 189
508 3300005435 Ga0070714_100031975 Ga0070714_1000319754 189
509 3300005435 Ga0070714_100289260 Ga0070714_1002892601 189
510 3300005436 Ga0070713_100000039 Ga0070713_10000003913 189
511 3300005436 Ga0070713_100005026 Ga0070713_1000050264 189
512 3300005436 Ga0070713_100030937 Ga0070713_1000309373 189
513 3300005436 Ga0070713_100153211 Ga0070713_1001532112 189
514 3300005437 Ga0070710_10001919 Ga0070710_100019196 189
515 3300005439 Ga0070711_100250160 Ga0070711_1002501602 189
516 3300005439 Ga0070711_100429923 Ga0070711_1004299231 189
517 3300005439 Ga0070711_100537556 Ga0070711_1005375562 189
518 3300005440 Ga0070705_100145847 Ga0070705_1001458472 189
519 3300005455 Ga0070663_100020275 Ga0070663_1000202756 189
520 3300005455 Ga0070663_100371418 Ga0070663_1003714181 189
521 3300005455 Ga0070663_100980063 Ga0070663_1009800631 189
522 3300005456 Ga0070678_100000728 Ga0070678_10000072811 189
523 3300005456 Ga0070678_100070575 Ga0070678_1000705753 189
524 3300005456 Ga0070678_100237585 Ga0070678_1002375852 189
525 3300005458 Ga0070681_10009517 Ga0070681_100095174 189
526 3300005458 Ga0070681_10061084 Ga0070681_100610842 189
527 3300005459 Ga0068867_100026711 Ga0068867_1000267114 189
528 3300005459 Ga0068867_100357024 Ga0068867_1003570242 189
529 3300005466 Ga0070685_10027399 Ga0070685_100273992 189
530 3300005530 Ga0070679_100088967 Ga0070679_1000889673 189
531 3300005530 Ga0070679_100207694 Ga0070679_1002076942 189
532 3300005535 Ga0070684_100085454 Ga0070684_1000854542 189
533 3300005535 Ga0070684_100305443 Ga0070684_1003054432 189
534 3300005536 Ga0070697_100658826 Ga0070697_1006588261 189
535 3300005539 Ga0068853_100052274 Ga0068853_1000522743 189
536 3300005539 Ga0068853_100269607 Ga0068853_1002696072 189
537 3300005543 Ga0070672_100001043 Ga0070672_1000010437 189
538 3300005543 Ga0070672_100228011 Ga0070672_1002280112 189
539 3300005543 Ga0070672_100437397 Ga0070672_1004373972 189
540 3300005544 Ga0070686_100005547 Ga0070686_1000055475 189
541 3300005545 Ga0070695_100298841 Ga0070695_1002988412 189
542 3300005546 Ga0070696_100082166 Ga0070696_1000821663 189
543 3300005546 Ga0070696_100677242 Ga0070696_1006772421 189
544 3300005547 Ga0070693_100006850 Ga0070693_1000068504 189
545 3300005547 Ga0070693_100139528 Ga0070693_1001395282 189
546 3300005548 Ga0070665_100002989 Ga0070665_10000298910 189
547 3300005548 Ga0070665_100512216 Ga0070665_1005122162 189
548 3300005549 Ga0070704_100363471 Ga0070704_1003634711 189
549 3300005549 Ga0070704_100532462 Ga0070704_1005324621 189
550 3300005563 Ga0068855_100455754 Ga0068855_1004557542 189
551 3300005564 Ga0070664_100189837 Ga0070664_1001898372 189
552 3300005564 Ga0070664_100723375 Ga0070664_1007233752 189
553 3300005578 Ga0068854_100273307 Ga0068854_1002733072 189
554 3300005614 Ga0068856_100150900 Ga0068856_1001509003 189
555 3300005614 Ga0068856_100305419 Ga0068856_1003054192 189
556 3300005615 Ga0070702_100012876 Ga0070702_1000128763 189
557 3300005618 Ga0068864_100021942 Ga0068864_1000219425 189
558 3300005718 Ga0068866_10045919 Ga0068866_100459192 189
559 3300005841 Ga0068863_100190757 Ga0068863_1001907572 189
560 3300005842 Ga0068858_100056529 Ga0068858_1000565295 189
561 3300005842 Ga0068858_100402662 Ga0068858_1004026622 189
562 3300005842 Ga0068858_100819590 Ga0068858_1008195901 189
563 3300005843 Ga0068860_100106733 Ga0068860_1001067332 189
564 3300006028 Ga0070717_10005760 Ga0070717_100057605 189
565 3300006028 Ga0070717_10388727 Ga0070717_103887272 189
566 3300006028 Ga0070717_10697980 Ga0070717_106979802 189
567 3300006163 Ga0070715_10022051 Ga0070715_100220512 189
568 3300006173 Ga0070716_100002302 Ga0070716_1000023026 189
569 3300006175 Ga0070712_100009890 Ga0070712_1000098905 189
570 3300006175 Ga0070712_100013119 Ga0070712_1000131195 189
571 3300006175 Ga0070712_100043893 Ga0070712_1000438932 189
572 3300006175 Ga0070712_100067602 Ga0070712_1000676022 189
573 3300006175 Ga0070712_100170328 Ga0070712_1001703282 189
574 3300006175 Ga0070712_100318807 Ga0070712_1003188072 189
575 3300006237 Ga0097621_100010225 Ga0097621_1000102252 189
576 3300006237 Ga0097621_100113837 Ga0097621_1001138372 189
577 3300006237 Ga0097621_100194548 Ga0097621_1001945482 189
578 3300006237 Ga0097621_100586033 Ga0097621_1005860332 189
579 3300006358 Ga0068871_100003994 Ga0068871_1000039943 189
580 3300006358 Ga0068871_100041628 Ga0068871_1000416282 189
581 3300006358 Ga0068871_100317186 Ga0068871_1003171861 189
582 3300006358 Ga0068871_100319267 Ga0068871_1003192673 189
583 3300006871 Ga0075434_100081494 Ga0075434_1000814942 189
584 3300006871 Ga0075434_100736699 Ga0075434_1007366992 189
585 3300006881 Ga0068865_100094688 Ga0068865_1000946882 189
586 3300006881 Ga0068865_100564237 Ga0068865_1005642372 189
587 3300006914 Ga0075436_100181462 Ga0075436_1001814622 189
588 3300009092 Ga0105250_10024795 Ga0105250_100247953 189
589 3300009098 Ga0105245_10029333 Ga0105245_100293332 189
590 3300009098 Ga0105245_10127957 Ga0105245_101279572 189
591 3300009098 Ga0105245_10363129 Ga0105245_103631292 189
592 3300009101 Ga0105247_10029031 Ga0105247_100290313 189
593 3300009101 Ga0105247_10173383 Ga0105247_101733832 189
594 3300009101 Ga0105247_10197289 Ga0105247_101972892 189
595 3300009148 Ga0105243_10023934 Ga0105243_100239345 189
596 3300009148 Ga0105243_10026026 Ga0105243_100260263 189
597 3300009174 Ga0105241_10014601 Ga0105241_100146012 189
598 3300009174 Ga0105241_10018681 Ga0105241_100186812 189
599 3300009174 Ga0105241_10166234 Ga0105241_101662342 189
600 3300009176 Ga0105242_10010141 Ga0105242_100101415 189
601 3300009176 Ga0105242_10014350 Ga0105242_100143502 189
602 3300009176 Ga0105242_11102524 Ga0105242_111025241 189
603 3300009177 Ga0105248_10043581 Ga0105248_100435814 189
604 3300009177 Ga0105248_10097657 Ga0105248_100976572 189
605 3300009177 Ga0105248_10265100 Ga0105248_102651002 189
606 3300009177 Ga0105248_10295765 Ga0105248_102957652 189
607 3300009545 Ga0105237_10054170 Ga0105237_100541704 189
608 3300009545 Ga0105237_10111632 Ga0105237_101116322 189
609 3300009545 Ga0105237_10138192 Ga0105237_101381924 189
610 3300009551 Ga0105238_10082146 Ga0105238_100821462 189
611 3300009551 Ga0105238_10288779 Ga0105238_102887792 189
612 3300009553 Ga0105249_10178494 Ga0105249_101784942 189
613 3300009553 Ga0105249_10379928 Ga0105249_103799282 189
614 3300010375 Ga0105239_10062965 Ga0105239_100629652 189
615 3300010375 Ga0105239_10200568 Ga0105239_102005682 189
616 3300010375 Ga0105239_10379095 Ga0105239_103790952 189
617 3300011119 Ga0105246_10173807 Ga0105246_101738072 189
618 3300012478 Ga0157328_1000881 Ga0157328_10008812 189
619 3300012507 Ga0157342_1006406 Ga0157342_10064062 189
620 3300013100 Ga0157373_10115335 Ga0157373_101153352 189
621 3300013104 Ga0157370_10540463 Ga0157370_105404632 189
622 3300013296 Ga0157374_10008845 Ga0157374_100088454 189
623 3300013296 Ga0157374_10128543 Ga0157374_101285432 189
624 3300013296 Ga0157374_10309945 Ga0157374_103099452 189
625 3300013297 Ga0157378_10029323 Ga0157378_100293232 189
626 3300013297 Ga0157378_10161621 Ga0157378_101616212 189
627 3300013297 Ga0157378_10381392 Ga0157378_103813922 189
628 3300013308 Ga0157375_10079270 Ga0157375_100792702 189
629 3300013308 Ga0157375_10269533 Ga0157375_102695332 189
630 3300013308 Ga0157375_10299424 Ga0157375_102994242 189
631 3300014325 Ga0163163_10347580 Ga0163163_103475802 189
632 3300014325 Ga0163163_10542852 Ga0163163_105428522 189
633 3300014326 Ga0157380_10334421 Ga0157380_103344212 189
634 3300014745 Ga0157377_10105301 Ga0157377_101053013 189
635 3300014968 Ga0157379_10025689 Ga0157379_100256894 189
636 3300014968 Ga0157379_10346149 Ga0157379_103461492 189
637 3300014968 Ga0157379_10351343 Ga0157379_103513432 189
638 3300014969 Ga0157376_10153633 Ga0157376_101536332 189
639 3300014969 Ga0157376_10177971 Ga0157376_101779712 189
640 3300014969 Ga0157376_10202990 Ga0157376_102029902 189
641 3300017792 Ga0163161_10069944 Ga0163161_100699442 189
642 3300021377 Ga0213874_10084189 Ga0213874_100841892 189
643 3300025898 Ga0207692_10001674 Ga0207692_100016745 189
644 3300025898 Ga0207692_10014567 Ga0207692_100145672 189
645 3300025899 Ga0207642_10411742 Ga0207642_104117422 189
646 3300025900 Ga0207710_10001666 Ga0207710_100016668 189
647 3300025900 Ga0207710_10458589 Ga0207710_104585891 189
648 3300025903 Ga0207680_10020003 Ga0207680_100200032 189
649 3300025903 Ga0207680_10092028 Ga0207680_100920283 189
650 3300025905 Ga0207685_10000852 Ga0207685_100008527 189
651 3300025906 Ga0207699_10006404 Ga0207699_100064044 189
652 3300025906 Ga0207699_10369612 Ga0207699_103696121 189
653 3300025907 Ga0207645_10052631 Ga0207645_100526312 189
654 3300025907 Ga0207645_10191258 Ga0207645_101912582 189
655 3300025911 Ga0207654_10002446 Ga0207654_100024468 189
656 3300025911 Ga0207654_10236912 Ga0207654_102369122 189
657 3300025912 Ga0207707_10010605 Ga0207707_100106052 189
658 3300025914 Ga0207671_10039867 Ga0207671_100398672 189
659 3300025915 Ga0207693_10002257 Ga0207693_1000225712 189
660 3300025915 Ga0207693_10007885 Ga0207693_100078853 189
661 3300025915 Ga0207693_10034136 Ga0207693_100341361 189
662 3300025915 Ga0207693_10059404 Ga0207693_100594042 189
663 3300025915 Ga0207693_10062001 Ga0207693_100620013 189
664 3300025915 Ga0207693_10092385 Ga0207693_100923852 189
665 3300025916 Ga0207663_10004484 Ga0207663_100044846 189
666 3300025916 Ga0207663_10049960 Ga0207663_100499603 189
667 3300025916 Ga0207663_10272334 Ga0207663_102723342 189
668 3300025916 Ga0207663_10546715 Ga0207663_105467152 189
669 3300025919 Ga0207657_10058704 Ga0207657_100587042 189
670 3300025919 Ga0207657_10103652 Ga0207657_101036523 189
671 3300025920 Ga0207649_10077536 Ga0207649_100775362 189
672 3300025922 Ga0207646_10303334 Ga0207646_103033342 189
673 3300025924 Ga0207694_10269481 Ga0207694_102694812 189
674 3300025925 Ga0207650_10032631 Ga0207650_100326315 189
675 3300025926 Ga0207659_10558219 Ga0207659_105582192 189
676 3300025927 Ga0207687_10017501 Ga0207687_100175013 189
677 3300025927 Ga0207687_10071298 Ga0207687_100712982 189
678 3300025928 Ga0207700_10000082 Ga0207700_1000008233 189
679 3300025928 Ga0207700_10006593 Ga0207700_100065931 189
680 3300025928 Ga0207700_10071967 Ga0207700_100719673 189
681 3300025928 Ga0207700_10380501 Ga0207700_103805012 189
682 3300025928 Ga0207700_10449311 Ga0207700_104493112 189
683 3300025929 Ga0207664_10007607 Ga0207664_100076075 189
684 3300025929 Ga0207664_10175216 Ga0207664_101752162 189
685 3300025931 Ga0207644_10005948 Ga0207644_100059485 189
686 3300025931 Ga0207644_10199204 Ga0207644_101992042 189
687 3300025931 Ga0207644_10510639 Ga0207644_105106392 189
688 3300025932 Ga0207690_10027669 Ga0207690_100276693 189
689 3300025933 Ga0207706_10007456 Ga0207706_100074562 189
690 3300025934 Ga0207686_10039576 Ga0207686_100395762 189
691 3300025935 Ga0207709_10022885 Ga0207709_100228852 189
692 3300025936 Ga0207670_10059938 Ga0207670_100599382 189
693 3300025937 Ga0207669_10158660 Ga0207669_101586601 189
694 3300025937 Ga0207669_10640651 Ga0207669_106406512 189
695 3300025938 Ga0207704_10068626 Ga0207704_100686262 189
696 3300025939 Ga0207665_10004818 Ga0207665_100048186 189
697 3300025940 Ga0207691_10039440 Ga0207691_100394403 189
698 3300025940 Ga0207691_10355046 Ga0207691_103550462 189
699 3300025941 Ga0207711_10009116 Ga0207711_100091165 189
700 3300025941 Ga0207711_10076825 Ga0207711_100768252 189
701 3300025941 Ga0207711_11076564 Ga0207711_110765642 189
702 3300025942 Ga0207689_10050225 Ga0207689_100502255 189
703 3300025942 Ga0207689_10128129 Ga0207689_101281292 189
704 3300025944 Ga0207661_10689277 Ga0207661_106892772 189
705 3300025945 Ga0207679_10678892 Ga0207679_106788922 189
706 3300025949 Ga0207667_10634872 Ga0207667_106348722 189
707 3300025960 Ga0207651_10090793 Ga0207651_100907932 189
708 3300025960 Ga0207651_10761422 Ga0207651_107614221 189
709 3300025961 Ga0207712_10157687 Ga0207712_101576872 189
710 3300025961 Ga0207712_10486734 Ga0207712_104867341 189
711 3300025981 Ga0207640_10786704 Ga0207640_107867042 189
712 3300025986 Ga0207658_10137294 Ga0207658_101372942 189
713 3300025986 Ga0207658_10274986 Ga0207658_102749862 189
714 3300026023 Ga0207677_10039478 Ga0207677_100394785 189
715 3300026035 Ga0207703_10011838 Ga0207703_100118385 189
716 3300026041 Ga0207639_10087372 Ga0207639_100873722 189
717 3300026067 Ga0207678_10128643 Ga0207678_101286432 189
718 3300026067 Ga0207678_10144614 Ga0207678_101446142 189
719 3300026075 Ga0207708_10230239 Ga0207708_102302392 189
720 3300026078 Ga0207702_10436872 Ga0207702_104368722 189
721 3300026078 Ga0207702_10473895 Ga0207702_104738952 189
722 3300026088 Ga0207641_10138937 Ga0207641_101389372 189
723 3300026095 Ga0207676_10019980 Ga0207676_100199803 189
724 3300026095 Ga0207676_10820288 Ga0207676_108202882 189
725 3300026116 Ga0207674_10070740 Ga0207674_100707402 189
726 3300026121 Ga0207683_10000480 Ga0207683_1000048022 189
727 3300026121 Ga0207683_10062449 Ga0207683_100624492 189
728 3300026121 Ga0207683_10270802 Ga0207683_102708022 189
729 3300028379 Ga0268266_10005275 Ga0268266_100052754 189
730 3300028379 Ga0268266_10028221 Ga0268266_100282211 189
731 3300031507 Ga0307509_10130561 Ga0307509_101305613 189
732 3300031595 Ga0265313_10015163 Ga0265313_100151633 189
733 3300034957 Ga0373938_0063768 Ga0373938_0063768_31_600 189
734 3300035083 Ga0373926_0053387 Ga0373926_0053387_787_1371 189
735 3300035086 Ga0373934_0014177 Ga0373934_0014177_1158_1742 189
736 3300035089 Ga0373944_0003706 Ga0373944_0003706_1236_1805 189
737 3300035089 Ga0373944_0022547 Ga0373944_0022547_746_1330 189
738 3300035090 Ga0373949_0053951 Ga0373949_0053951_292_861 189
739 3300035111 Ga0373923_0004472 Ga0373923_0004472_2894_3478 189
740 3300035113 Ga0373936_0088302 Ga0373936_0088302_195_779 189
741 3300035114 Ga0373939_0157285 Ga0373939_0157285_208_792 189
742 3300035115 Ga0373941_0044152 Ga0373941_0044152_400_969 189
743 3300035116 Ga0373945_0014083 Ga0373945_0014083_339_908 189
744 3300035117 Ga0373953_0005116 Ga0373953_0005116_2679_3263 189
745 3300035118 Ga0373954_0005514 Ga0373954_0005514_2940_3524 189
746 3300035120 Ga0373957_0001985 Ga0373957_0001985_773_1357 189
747 3300035121 Ga0373960_0011455 Ga0373960_0011455_207_776 189
748 3300035170 Ga0373943_0016010 Ga0373943_0016010_575_1144 189
749 3300035170 Ga0373943_0016358 Ga0373943_0016358_2292_2876 189
750 3300035171 Ga0373946_0010307 Ga0373946_0010307_1835_2404 189
751 3300035241 Ga0373961_0041732 Ga0373961_0041732_75_644 189
752 3300035410 Ga0373924_0061551 Ga0373924_0061551_341_925 189
753 3300035691 Ga0373931_0045589 Ga0373931_0045589_1690_2274 189
754 3300035691 Ga0373931_0060654 Ga0373931_0060654_1398_1967 189
755 3300035692 Ga0373935_0001749 Ga0373935_0001749_2191_2760 189
756 3300035692 Ga0373935_0050340 Ga0373935_0050340_822_1406 189
757 3300035695 Ga0373927_0049597 Ga0373927_0049597_1507_2091 189
758 3300035695 Ga0373927_0114758 Ga0373927_0114758_998_1567 189
759 3300035724 Ga0373933_0009136 Ga0373933_0009136_3171_3755 189
760 3300035724 Ga0373933_0055799 Ga0373933_0055799_354_938 189
761 3300035725 Ga0373947_0001187 Ga0373947_0001187_11998_12567 189
762 3300035725 Ga0373947_0088994 Ga0373947_0088994_1124_1708 189
763 3300036401 Ga0373937_0027974 Ga0373937_0027974_1746_2330 189
764 3300037068 Ga0373925_0004244 Ga0373925_0004244_2232_2801 189
765 3300037068 Ga0373925_0280237 Ga0373925_0280237_406_990 189
766 3300037068 Ga0373925_0720753 Ga0373925_0720753_32_625 189
767 3300039450 Ga0436363_1542522 Ga0436363_1542522_502_1095 189
768 3300041512 Ga0451853_0763982 Ga0451853_0763982_137_721 189
769 3300046454 Ga0495592_0010242 Ga0495592_0010242_4596_5180 189
770 3300046455 Ga0495603_0019912 Ga0495603_0019912_1854_2438 189
771 3300046455 Ga0495603_0061344 Ga0495603_0061344_1133_1702 189
772 3300046459 Ga0495629_0000968 Ga0495629_0000968_14935_15504 189
773 3300046459 Ga0495629_0170466 Ga0495629_0170466_261_845 189
774 3300046459 Ga0495629_0194292 Ga0495629_0194292_52_636 189
775 3300046459 Ga0495629_0237156 Ga0495629_0237156_444_1028 189
776 3300046461 Ga0495641_0017865 Ga0495641_0017865_1545_2129 189
777 3300046462 Ga0495651_0002173 Ga0495651_0002173_9482_10066 189
778 3300046472 Ga0495580_0169764 Ga0495580_0169764_525_1109 189
779 3300046473 Ga0495582_0002401 Ga0495582_0002401_9172_9741 189
780 3300046473 Ga0495582_0125756 Ga0495582_0125756_290_874 189
781 3300046475 Ga0495639_0010527 Ga0495639_0010527_2236_2820 189
782 3300046476 Ga0495662_0033198 Ga0495662_0033198_682_1266 189
783 3300046477 Ga0495664_0048328 Ga0495664_0048328_177_761 189
784 3300046477 Ga0495664_0050516 Ga0495664_0050516_183_767 189
785 3300046491 Ga0495584_0116793 Ga0495584_0116793_425_1009 189
786 3300046511 Ga0495608_0009348 Ga0495608_0009348_3105_3689 189
787 3300046514 Ga0495618_0137727 Ga0495618_0137727_407_991 189
788 3300046514 Ga0495618_0172602 Ga0495618_0172602_401_985 189
789 3300046516 Ga0495628_0019118 Ga0495628_0019118_4596_5180 189
790 3300046517 Ga0495630_0103761 Ga0495630_0103761_198_782 189
791 3300046526 Ga0495666_0069639 Ga0495666_0069639_566_1150 189
792 3300046529 Ga0495652_0040582 Ga0495652_0040582_1756_2340 189
793 3300046529 Ga0495652_0204387 Ga0495652_0204387_171_755 189
794 3300046531 Ga0495665_0047177 Ga0495665_0047177_669_1253 189
795 3300046533 Ga0495640_0029383 Ga0495640_0029383_271_855 189
796 3300046533 Ga0495640_0039156 Ga0495640_0039156_140_724 189
797 3300046535 Ga0495586_0058031 Ga0495586_0058031_489_1073 189
798 3300046535 Ga0495586_0059730 Ga0495586_0059730_49_633 189
799 3300046536 Ga0495587_0008084 Ga0495587_0008084_3170_3754 189
800 3300046539 Ga0495621_0102654 Ga0495621_0102654_297_881 189
801 3300046543 Ga0495645_0015451 Ga0495645_0015451_2712_3296 189
802 3300046557 Ga0495622_0112543 Ga0495622_0112543_326_895 189
803 3300046559 Ga0495667_0000293 Ga0495667_0000293_2771_3355 189
804 3300046642 Ga0495634_0041569 Ga0495634_0041569_1463_2047 189
805 3300046642 Ga0495634_0116882 Ga0495634_0116882_158_742 189
806 3300046663 Ga0495635_0067993 Ga0495635_0067993_1501_2085 189
807 3300046663 Ga0495635_0248520 Ga0495635_0248520_573_1157 189
808 3300046674 Ga0495588_0023331 Ga0495588_0023331_1940_2524 189
809 3300046675 Ga0495657_0009103 Ga0495657_0009103_4322_4906 189
810 3300046678 Ga0495599_0006529 Ga0495599_0006529_6094_6678 189
811 3300046679 Ga0495623_0000668 Ga0495623_0000668_14781_15365 189
812 3300046680 Ga0495646_0022084 Ga0495646_0022084_1175_1759 189
813 3300046681 Ga0495647_0061937 Ga0495647_0061937_527_1096 189
814 3300046683 Ga0495658_0016691 Ga0495658_0016691_326_895 189
815 3300046683 Ga0495658_0018823 Ga0495658_0018823_846_1430 189
816 3300046689 Ga0495613_0129516 Ga0495613_0129516_526_1110 189
817 3300046690 Ga0495624_0059043 Ga0495624_0059043_1320_1904 189
818 3300046690 Ga0495624_0115959 Ga0495624_0115959_891_1475 189
819 3300046809 Ga0495600_0004765 Ga0495600_0004765_4875_5459 189
820 3300047315 Ga0495581_0056406 Ga0495581_0056406_931_1515 189
821 3300047315 Ga0495581_0159070 Ga0495581_0159070_603_1172 189
822 3300047317 Ga0495604_0005199 Ga0495604_0005199_5372_5956 189
823 3300047319 Ga0495674_0009612 Ga0495674_0009612_8425_9009 189
824 3300047319 Ga0495674_0311394 Ga0495674_0311394_353_937 189
825 3300047321 Ga0495676_0038286 Ga0495676_0038286_1069_1653 189
826 3300047322 Ga0495680_0003160 Ga0495680_0003160_401_985 189
827 3300047322 Ga0495680_0072609 Ga0495680_0072609_1626_2195 189
828 3300047322 Ga0495680_0273544 Ga0495680_0273544_277_861 189
829 3300047444 Ga0495675_0002509 Ga0495675_0002509_1903_2487 189
830 3300047471 Ga0495684_0037697 Ga0495684_0037697_2724_3308 189
831 3300047471 Ga0495684_0240931 Ga0495684_0240931_273_857 189
832 3300047471 Ga0495684_0258369 Ga0495684_0258369_50_619 189
833 3300047673 Ga0495593_0063278 Ga0495593_0063278_492_1076 189
834 3300048088 Ga0495602_0020889 Ga0495602_0020889_3292_3876 189
835 3300048903 Ga0496100_0355975 Ga0496100_0355975_108_692 189
836 3300048904 Ga0496101_0001812 Ga0496101_0001812_529_1113 189
837 3300048905 Ga0496102_0217808 Ga0496102_0217808_452_1021 189
838 3300048905 Ga0496102_0604557 Ga0496102_0604557_266_835 189
839 3300048906 Ga0496103_0332495 Ga0496103_0332495_77_661 189
840 3300048907 Ga0496104_0059292 Ga0496104_0059292_2548_3117 189
841 3300048907 Ga0496104_0061938 Ga0496104_0061938_896_1480 189
842 3300048907 Ga0496104_0065245 Ga0496104_0065245_1807_2376 189
843 3300048907 Ga0496104_0092744 Ga0496104_0092744_186_755 189
844 3300048907 Ga0496104_0607820 Ga0496104_0607820_413_982 189
845 3300048907 Ga0496104_0914367 Ga0496104_0914367_169_753 189
846 3300048908 Ga0496105_0020983 Ga0496105_0020983_4218_4787 189
847 3300048909 Ga0496106_0006214 Ga0496106_0006214_3072_3641 189
848 3300048909 Ga0496106_0125465 Ga0496106_0125465_1189_1773 189
849 3300048910 Ga0496107_0018485 Ga0496107_0018485_2871_3455 189
850 3300048910 Ga0496107_0029092 Ga0496107_0029092_3289_3858 189
851 3300048910 Ga0496107_0289079 Ga0496107_0289079_561_1145 189
852 3300048911 Ga0496108_0127310 Ga0496108_0127310_394_963 189
853 3300048912 Ga0496109_0067238 Ga0496109_0067238_165_752 189
854 3300048912 Ga0496109_0087812 Ga0496109_0087812_1807_2376 189
855 3300048913 Ga0496110_0161538 Ga0496110_0161538_217_801 189
856 3300048913 Ga0496110_0237197 Ga0496110_0237197_372_941 189
857 3300048914 Ga0496111_0008722 Ga0496111_0008722_4353_4922 189
858 3300048915 Ga0496112_0048980 Ga0496112_0048980_500_1069 189
859 3300048915 Ga0496112_0143502 Ga0496112_0143502_1290_1859 189
860 3300048915 Ga0496112_1068710 Ga0496112_1068710_81_665 189
861 3300048916 Ga0496113_0081844 Ga0496113_0081844_498_1067 189
862 3300048916 Ga0496113_0216394 Ga0496113_0216394_672_1256 189
863 3300048917 Ga0496114_0015488 Ga0496114_0015488_2462_3031 189
864 3300048917 Ga0496114_0356194 Ga0496114_0356194_331_915 189
865 3300048918 Ga0496115_0007409 Ga0496115_0007409_6773_7357 189
866 3300048918 Ga0496115_0042324 Ga0496115_0042324_2671_3240 189
867 3300048918 Ga0496115_0259452 Ga0496115_0259452_477_1061 189
868 3300048918 Ga0496115_0579949 Ga0496115_0579949_275_859 189
869 3300050512 nmdc:mga0n895_1498942_c1 nmdc:mga0n895_1498942_c1_58_627 189
870 3300050512 nmdc:mga0n895_340581_c1 nmdc:mga0n895_340581_c1_130_699 189
871 3300050514 nmdc:mga08x19_143908_c1 nmdc:mga08x19_143908_c1_260_829 189
872 3300053077 Ga0495601_0001091 Ga0495601_0001091_14061_14645 189
873 3300053077 Ga0495601_0259441 Ga0495601_0259441_192_776 189
874 3300053078 Ga0495612_0008078 Ga0495612_0008078_170_754 189
875 3300053078 Ga0495612_0073496 Ga0495612_0073496_359_943 189
876 3300053084 Ga0495595_0001076 Ga0495595_0001076_1974_2558 189
877 3300053085 Ga0495619_0000324 Ga0495619_0000324_22996_23565 189
878 3300053085 Ga0495619_0007062 Ga0495619_0007062_3703_4287 189
879 3300053085 Ga0495619_0132260 Ga0495619_0132260_870_1454 189
880 3300053136 Ga0500559_0138601 Ga0500559_0138601_540_1124 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

75

204

0.97

PF19609

DUF6114

Family of unknown function (DUF6114)

15

88

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8053 16 168
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.796 16 168
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.79 17 168
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.6412 17 168
8u4v-assembly1.cif.gz_A cryo-em structure of human claudin-4 complex with clostridium perfringens enterotoxin c-terminal domain, sfab cop-1, and nanobody 0.4955 54 162
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8586 39 166 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.835 39 166 1.20.120.550
af_I1JXM9_128_228_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6431 59 177 1.20.1280.290
af_I1JXM9_128_228_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6048 59 177 1.20.1280.290
af_O13657_599_717_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.6042 63 163 1.20.58.340
ID Description Score Start End GO Terms
AF-A0A536V873-F1-model_v4 TRAP transporter small permease protein 0.933 1 173 GO:0005886
GO:0015740
GO:0022857
AF-A0A2V7ADU2-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.928 4 173 GO:0005886
GO:0015740
GO:0022857
AF-A0A847PBP4-F1-model_v4 TRAP transporter small permease 0.9266 18 167 GO:0005886
GO:0015740
GO:0022857
AF-A0A537NAW7-F1-model_v4 TRAP transporter small permease protein 0.9254 1 175 GO:0005886
GO:0015740
GO:0022857
AF-V8QV81-F1-model_v4 TRAP transporter small permease protein 0.9238 23 167 GO:0005886
GO:0015740
GO:0022857

Feature Viewer

pLDDT pTM Quality
76.54 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map