F484490
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 880 | 490 | 828 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300035089|Ga0373944_0020571|Ga0373944_0020571_1131_1568 |
| Length | 145 |
| Sequence | MPPSLYCVRNVTVGEDSQMKTCLVVDDSSVIRKIARRILEDMGFRVVEAEDGEQALEFCKRTLPEAVLLDWNMPVMDGYDFLSNLRRLPGGEEPKVVFCTTENNIDHIARAMHGGANEYIMKPFDKDIVTAKFQEVGLIEFGEPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 3 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 4 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 8 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 9 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 10 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 11 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 12 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 13 | 2791355199 | |||
| 14 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 15 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 16 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 17 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 18 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 19 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 20 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 21 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 22 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 23 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 24 | 2904699407 | |||
| 25 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 26 | 2906610324 | |||
| 27 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 28 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 29 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 30 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 31 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 32 | 2922425934 | |||
| 33 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 34 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 35 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 36 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 37 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 38 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 39 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 40 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 41 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 42 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 43 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 44 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 45 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 46 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 48 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 49 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 50 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 56 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 63 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 67 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 87 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 94 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 103 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 104 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 105 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 106 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 107 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 108 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 115 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 116 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 118 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 119 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 120 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 121 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 122 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 123 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 124 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 125 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 126 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 128 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 129 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 130 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 131 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 132 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 135 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 136 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 152 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 164 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 230 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 232 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 233 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 240 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 241 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 242 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 243 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 248 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 249 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 259 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 260 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 261 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 262 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 263 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 270 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 275 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 279 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 282 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 284 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 287 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 288 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 289 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 290 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 291 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 292 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 293 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 299 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 300 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 301 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 302 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 303 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 304 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 307 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 308 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 312 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 313 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 314 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 395 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 396 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 397 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 400 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 401 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 402 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 403 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 404 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 405 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 406 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 407 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 408 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 409 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 410 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 411 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 412 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 413 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 429 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 430 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 432 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 433 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 434 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 439 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 440 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 441 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 445 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 446 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 447 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 448 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 449 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 450 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 451 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 452 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 453 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 454 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 455 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 456 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 457 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 458 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 459 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 460 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 461 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 462 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 463 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 464 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 465 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 466 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 467 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 468 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 470 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 471 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 472 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 473 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 475 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 476 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 478 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 479 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 481 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 482 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 483 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 484 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 485 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 486 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 487 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 488 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 489 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 490 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.41 |
| Metatranscriptomes | 0.11 |
| Isolates | 5.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.86 |
| Nodule | 3.98 |
| Rhizoplane | 3.07 |
| Rhizosphere | 72.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1152838 | 2162886007 | Bacteria | 808 |
| 2 | LJNas_1010822 | 3300000546 | Bacteria | 973 |
| 3 | JGI24750J21931_1031981 | 3300002070 | Bacteria | 775 |
| 4 | JGI24750J21931_1063118 | 3300002070 | Bacteria | 595 |
| 5 | JGI25406J46586_10103102 | 3300003203 | Bacteria | 849 |
| 6 | JGI25165J46597_1006262 | 3300003214 | Bacteria | 2132 |
| 7 | JGI25153J46596_10007332 | 3300003215 | Bacteria | 5444 |
| 8 | JGI25160J50197_1004506 | 3300003354 | Bacteria | 6015 |
| 9 | JGI25160J50197_1013881 | 3300003354 | Bacteria | 2722 |
| 10 | JGI25404J52841_10108630 | 3300003659 | Bacteria | 583 |
| 11 | JGI25404J52841_10128492 | 3300003659 | Bacteria | 535 |
| 12 | Ga0055539_1004325 | 3300003752 | Bacteria | 1895 |
| 13 | Ga0055525_1002098 | 3300003759 | Bacteria | 2330 |
| 14 | Ga0055529_1026258 | 3300003763 | Bacteria | 719 |
| 15 | JGI25405J52794_10051980 | 3300003911 | Bacteria | 879 |
| 16 | JGI25405J52794_10153137 | 3300003911 | Bacteria | 526 |
| 17 | Ga0065165_1038729 | 3300005262 | Bacteria | 1434 |
| 18 | Ga0065165_1051290 | 3300005262 | Bacteria | 1170 |
| 19 | Ga0065715_10959514 | 3300005293 | Bacteria | 557 |
| 20 | Ga0065707_10269492 | 3300005295 | Bacteria | 1075 |
| 21 | Ga0070658_10991817 | 3300005327 | Bacteria | 731 |
| 22 | Ga0070658_11093265 | 3300005327 | Bacteria | 693 |
| 23 | Ga0070676_10120250 | 3300005328 | Bacteria | 1647 |
| 24 | Ga0070683_100516816 | 3300005329 | Bacteria | 1141 |
| 25 | Ga0070690_100383783 | 3300005330 | Bacteria | 1028 |
| 26 | Ga0068869_100581078 | 3300005334 | Bacteria | 944 |
| 27 | Ga0068869_100657034 | 3300005334 | Bacteria | 890 |
| 28 | Ga0070666_10288859 | 3300005335 | Bacteria | 1166 |
| 29 | Ga0070666_11089799 | 3300005335 | Bacteria | 594 |
| 30 | Ga0070680_100234704 | 3300005336 | Bacteria | 1549 |
| 31 | Ga0070682_100489403 | 3300005337 | Bacteria | 951 |
| 32 | Ga0070682_100539656 | 3300005337 | Bacteria | 911 |
| 33 | Ga0068868_100413378 | 3300005338 | Bacteria | 1166 |
| 34 | Ga0068868_100676730 | 3300005338 | Bacteria | 921 |
| 35 | Ga0068868_100745635 | 3300005338 | Bacteria | 879 |
| 36 | Ga0070689_101098717 | 3300005340 | Bacteria | 711 |
| 37 | Ga0070661_100201285 | 3300005344 | Bacteria | 1522 |
| 38 | Ga0070668_100005838 | 3300005347 | Bacteria | 9127 |
| 39 | Ga0070668_100133324 | 3300005347 | Bacteria | 1995 |
| 40 | Ga0070668_100403570 | 3300005347 | Bacteria | 1167 |
| 41 | Ga0070668_100526205 | 3300005347 | Bacteria | 1026 |
| 42 | Ga0070668_100624708 | 3300005347 | Bacteria | 944 |
| 43 | Ga0070669_100244610 | 3300005353 | Bacteria | 1426 |
| 44 | Ga0070669_100714144 | 3300005353 | Bacteria | 847 |
| 45 | Ga0070675_100926861 | 3300005354 | Bacteria | 799 |
| 46 | Ga0070671_100477036 | 3300005355 | Bacteria | 1071 |
| 47 | Ga0070671_100591409 | 3300005355 | Bacteria | 959 |
| 48 | Ga0070674_101084167 | 3300005356 | Bacteria | 707 |
| 49 | Ga0070674_101226721 | 3300005356 | Bacteria | 667 |
| 50 | Ga0070673_101423740 | 3300005364 | Bacteria | 653 |
| 51 | Ga0070659_100261285 | 3300005366 | Bacteria | 1436 |
| 52 | Ga0070703_10318752 | 3300005406 | Bacteria | 654 |
| 53 | Ga0070713_100049420 | 3300005436 | Bacteria | 3469 |
| 54 | Ga0070701_10266289 | 3300005438 | Bacteria | 1041 |
| 55 | Ga0070701_10960624 | 3300005438 | Bacteria | 594 |
| 56 | Ga0070705_100350181 | 3300005440 | Bacteria | 1077 |
| 57 | Ga0070700_100177552 | 3300005441 | Bacteria | 1479 |
| 58 | Ga0070694_100300012 | 3300005444 | Bacteria | 1231 |
| 59 | Ga0070663_100225406 | 3300005455 | Bacteria | 1473 |
| 60 | Ga0070663_100611876 | 3300005455 | Bacteria | 917 |
| 61 | Ga0070678_100046211 | 3300005456 | Bacteria | 3120 |
| 62 | Ga0070678_100265017 | 3300005456 | Bacteria | 1447 |
| 63 | Ga0070678_101217841 | 3300005456 | Bacteria | 698 |
| 64 | Ga0070662_100424429 | 3300005457 | Bacteria | 1100 |
| 65 | Ga0070681_10254456 | 3300005458 | Bacteria | 1668 |
| 66 | Ga0070681_10313362 | 3300005458 | Bacteria | 1478 |
| 67 | Ga0068867_101193113 | 3300005459 | Bacteria | 699 |
| 68 | Ga0070685_10090029 | 3300005466 | Bacteria | 1855 |
| 69 | Ga0070706_100619142 | 3300005467 | Bacteria | 1005 |
| 70 | Ga0070707_101100749 | 3300005468 | Bacteria | 760 |
| 71 | Ga0070698_100194297 | 3300005471 | Bacteria | 1966 |
| 72 | Ga0070698_100217995 | 3300005471 | Bacteria | 1842 |
| 73 | Ga0070699_100871003 | 3300005518 | Bacteria | 825 |
| 74 | Ga0070679_100032725 | 3300005530 | Bacteria | 5145 |
| 75 | Ga0070679_100113377 | 3300005530 | Bacteria | 2696 |
| 76 | Ga0070679_100142891 | 3300005530 | Bacteria | 2372 |
| 77 | Ga0068853_100226396 | 3300005539 | Bacteria | 1709 |
| 78 | Ga0068853_100243890 | 3300005539 | Bacteria | 1647 |
| 79 | Ga0068853_100699799 | 3300005539 | Bacteria | 966 |
| 80 | Ga0068853_101403140 | 3300005539 | Bacteria | 676 |
| 81 | Ga0070672_101381990 | 3300005543 | Bacteria | 630 |
| 82 | Ga0070686_100592194 | 3300005544 | Bacteria | 873 |
| 83 | Ga0070695_100254615 | 3300005545 | Bacteria | 1279 |
| 84 | Ga0070696_100355490 | 3300005546 | Bacteria | 1135 |
| 85 | Ga0070693_100142838 | 3300005547 | Bacteria | 1508 |
| 86 | Ga0070693_100717490 | 3300005547 | Bacteria | 734 |
| 87 | Ga0070665_100044008 | 3300005548 | Bacteria | 4484 |
| 88 | Ga0070665_100129065 | 3300005548 | Bacteria | 2530 |
| 89 | Ga0070665_100172998 | 3300005548 | Bacteria | 2160 |
| 90 | Ga0070665_100196283 | 3300005548 | Bacteria | 2019 |
| 91 | Ga0070665_100455641 | 3300005548 | Bacteria | 1289 |
| 92 | Ga0070665_100581668 | 3300005548 | Bacteria | 1133 |
| 93 | Ga0070665_101218717 | 3300005548 | Unclassified | 763 |
| 94 | Ga0070704_100601501 | 3300005549 | Bacteria | 966 |
| 95 | Ga0068855_100027913 | 3300005563 | Bacteria | 6751 |
| 96 | Ga0068855_100384951 | 3300005563 | Bacteria | 1539 |
| 97 | Ga0068855_100695465 | 3300005563 | Bacteria | 1088 |
| 98 | Ga0068855_101470103 | 3300005563 | Bacteria | 700 |
| 99 | Ga0068854_100030068 | 3300005578 | Bacteria | 3765 |
| 100 | Ga0068854_101211080 | 3300005578 | Bacteria | 677 |
| 101 | Ga0068856_100034134 | 3300005614 | Bacteria | 4984 |
| 102 | Ga0068852_100027518 | 3300005616 | Bacteria | 4634 |
| 103 | Ga0068852_100102155 | 3300005616 | Bacteria | 2590 |
| 104 | Ga0068852_100131914 | 3300005616 | Bacteria | 2302 |
| 105 | Ga0068852_100400756 | 3300005616 | Bacteria | 1350 |
| 106 | Ga0068852_100664039 | 3300005616 | Bacteria | 1051 |
| 107 | Ga0068859_100687116 | 3300005617 | Bacteria | 1114 |
| 108 | Ga0068864_100081294 | 3300005618 | Bacteria | 2840 |
| 109 | Ga0068866_10320746 | 3300005718 | Bacteria | 974 |
| 110 | Ga0068861_100444455 | 3300005719 | Bacteria | 1160 |
| 111 | Ga0068863_100295555 | 3300005841 | Bacteria | 1570 |
| 112 | Ga0068863_100301463 | 3300005841 | Bacteria | 1554 |
| 113 | Ga0068863_100420879 | 3300005841 | Bacteria | 1308 |
| 114 | Ga0068858_100061588 | 3300005842 | Bacteria | 3469 |
| 115 | Ga0068860_100080859 | 3300005843 | Bacteria | 3090 |
| 116 | Ga0068860_100293450 | 3300005843 | Bacteria | 1591 |
| 117 | Ga0068860_101351576 | 3300005843 | Bacteria | 733 |
| 118 | Ga0068862_100216295 | 3300005844 | Bacteria | 1733 |
| 119 | Ga0081455_10004895 | 3300005937 | Bacteria | 14842 |
| 120 | Ga0081455_10023586 | 3300005937 | Bacteria | 5723 |
| 121 | Ga0081455_10044688 | 3300005937 | Bacteria | 3861 |
| 122 | Ga0081540_1004405 | 3300005983 | Bacteria | 10757 |
| 123 | Ga0081540_1008466 | 3300005983 | Bacteria | 7183 |
| 124 | Ga0081540_1015444 | 3300005983 | Bacteria | 4836 |
| 125 | Ga0081540_1273944 | 3300005983 | Bacteria | 583 |
| 126 | Ga0081539_10005931 | 3300005985 | Bacteria | 12064 |
| 127 | Ga0081539_10420486 | 3300005985 | Bacteria | 555 |
| 128 | Ga0070717_10321900 | 3300006028 | Bacteria | 1378 |
| 129 | Ga0070717_10927631 | 3300006028 | Bacteria | 793 |
| 130 | Ga0070717_11291450 | 3300006028 | Bacteria | 664 |
| 131 | Ga0075365_10071356 | 3300006038 | Bacteria | 2338 |
| 132 | Ga0075365_10178722 | 3300006038 | Bacteria | 1483 |
| 133 | Ga0075368_10263162 | 3300006042 | Bacteria | 739 |
| 134 | Ga0075363_100026229 | 3300006048 | Bacteria | 2979 |
| 135 | Ga0075363_100309028 | 3300006048 | Bacteria | 918 |
| 136 | Ga0075363_100477466 | 3300006048 | Bacteria | 739 |
| 137 | Ga0075364_10182993 | 3300006051 | Bacteria | 1418 |
| 138 | Ga0075364_11070387 | 3300006051 | Bacteria | 548 |
| 139 | Ga0075432_10051629 | 3300006058 | Bacteria | 1451 |
| 140 | Ga0075432_10501546 | 3300006058 | Bacteria | 541 |
| 141 | Ga0075362_10141081 | 3300006177 | Bacteria | 1151 |
| 142 | Ga0075362_10408566 | 3300006177 | Bacteria | 685 |
| 143 | Ga0075367_10023304 | 3300006178 | Bacteria | 3482 |
| 144 | Ga0075367_10179821 | 3300006178 | Bacteria | 1318 |
| 145 | Ga0075367_10363027 | 3300006178 | Bacteria | 914 |
| 146 | Ga0075369_10223148 | 3300006186 | Bacteria | 872 |
| 147 | Ga0075369_10247410 | 3300006186 | Bacteria | 828 |
| 148 | Ga0075366_10383429 | 3300006195 | Bacteria | 864 |
| 149 | Ga0075366_10452268 | 3300006195 | Bacteria | 792 |
| 150 | Ga0075366_10722626 | 3300006195 | Bacteria | 619 |
| 151 | Ga0097621_100046159 | 3300006237 | Bacteria | 3523 |
| 152 | Ga0097621_100065762 | 3300006237 | Bacteria | 2985 |
| 153 | Ga0097621_100071933 | 3300006237 | Bacteria | 2859 |
| 154 | Ga0097621_100437270 | 3300006237 | Bacteria | 1177 |
| 155 | Ga0097621_100858331 | 3300006237 | Bacteria | 844 |
| 156 | Ga0075370_10137868 | 3300006353 | Bacteria | 1426 |
| 157 | Ga0075370_10197168 | 3300006353 | Bacteria | 1187 |
| 158 | Ga0075370_10463754 | 3300006353 | Bacteria | 763 |
| 159 | Ga0075370_10552309 | 3300006353 | Bacteria | 696 |
| 160 | Ga0068871_100047551 | 3300006358 | Bacteria | 3460 |
| 161 | Ga0068871_100178181 | 3300006358 | Bacteria | 1825 |
| 162 | Ga0075428_102420772 | 3300006844 | Bacteria | 539 |
| 163 | Ga0075434_100051150 | 3300006871 | Bacteria | 4105 |
| 164 | Ga0075429_100556047 | 3300006880 | Bacteria | 1006 |
| 165 | Ga0075436_100438727 | 3300006914 | Bacteria | 950 |
| 166 | Ga0097620_100687110 | 3300006931 | Bacteria | 1114 |
| 167 | Ga0075435_100252215 | 3300007076 | Bacteria | 1502 |
| 168 | Ga0099795_10023531 | 3300007788 | Bacteria | 2045 |
| 169 | Ga0105250_10058226 | 3300009092 | Bacteria | 1551 |
| 170 | Ga0105240_10077665 | 3300009093 | Bacteria | 4090 |
| 171 | Ga0105240_10095052 | 3300009093 | Bacteria | 3634 |
| 172 | Ga0105240_10171844 | 3300009093 | Bacteria | 2566 |
| 173 | Ga0105240_11015317 | 3300009093 | Bacteria | 886 |
| 174 | Ga0111539_10871624 | 3300009094 | Bacteria | 1047 |
| 175 | Ga0105245_10031932 | 3300009098 | Bacteria | 4661 |
| 176 | Ga0105245_10066139 | 3300009098 | Bacteria | 3271 |
| 177 | Ga0105245_10524074 | 3300009098 | Bacteria | 1204 |
| 178 | Ga0105247_10156695 | 3300009101 | Bacteria | 1505 |
| 179 | Ga0105247_10288705 | 3300009101 | Bacteria | 1134 |
| 180 | Ga0114129_12185399 | 3300009147 | Bacteria | 666 |
| 181 | Ga0105243_10574308 | 3300009148 | Bacteria | 1081 |
| 182 | Ga0105241_10087362 | 3300009174 | Bacteria | 2454 |
| 183 | Ga0105241_10837477 | 3300009174 | Bacteria | 850 |
| 184 | Ga0105242_10626389 | 3300009176 | Bacteria | 1043 |
| 185 | Ga0105242_13118723 | 3300009176 | Bacteria | 514 |
| 186 | Ga0105248_10159915 | 3300009177 | Bacteria | 2541 |
| 187 | Ga0105248_10483422 | 3300009177 | Bacteria | 1396 |
| 188 | Ga0105237_10300641 | 3300009545 | Bacteria | 1608 |
| 189 | Ga0105237_10531219 | 3300009545 | Bacteria | 1183 |
| 190 | Ga0105237_11033735 | 3300009545 | Bacteria | 828 |
| 191 | Ga0105237_11287947 | 3300009545 | Bacteria | 737 |
| 192 | Ga0105237_11304403 | 3300009545 | Bacteria | 732 |
| 193 | Ga0105237_11349387 | 3300009545 | Bacteria | 719 |
| 194 | Ga0105238_10060989 | 3300009551 | Bacteria | 3775 |
| 195 | Ga0105238_10301875 | 3300009551 | Bacteria | 1585 |
| 196 | Ga0105238_10582021 | 3300009551 | Bacteria | 1126 |
| 197 | Ga0099796_10058069 | 3300010159 | Bacteria | 1363 |
| 198 | Ga0099796_10065048 | 3300010159 | Bacteria | 1303 |
| 199 | Ga0099796_10464715 | 3300010159 | Bacteria | 564 |
| 200 | Ga0105239_10056885 | 3300010375 | Bacteria | 4289 |
| 201 | Ga0105239_10356352 | 3300010375 | Bacteria | 1652 |
| 202 | Ga0105239_10534925 | 3300010375 | Bacteria | 1334 |
| 203 | Ga0105239_10886064 | 3300010375 | Bacteria | 1024 |
| 204 | Ga0105239_10938201 | 3300010375 | Bacteria | 994 |
| 205 | Ga0105239_11644743 | 3300010375 | Bacteria | 743 |
| 206 | Ga0105246_10040750 | 3300011119 | Bacteria | 3136 |
| 207 | Ga0105246_11853801 | 3300011119 | Bacteria | 578 |
| 208 | Ga0157314_1004494 | 3300012500 | Bacteria | 1028 |
| 209 | Ga0157370_10057300 | 3300013104 | Bacteria | 3705 |
| 210 | Ga0157370_10363719 | 3300013104 | Bacteria | 1333 |
| 211 | Ga0157370_10525003 | 3300013104 | Bacteria | 1086 |
| 212 | Ga0157374_10116742 | 3300013296 | Bacteria | 2572 |
| 213 | Ga0157378_10041263 | 3300013297 | Bacteria | 4093 |
| 214 | Ga0157378_10498718 | 3300013297 | Bacteria | 1216 |
| 215 | Ga0163162_10590323 | 3300013306 | Bacteria | 1237 |
| 216 | Ga0163162_11322535 | 3300013306 | Bacteria | 819 |
| 217 | Ga0163162_11832449 | 3300013306 | Bacteria | 694 |
| 218 | Ga0157372_11346533 | 3300013307 | Bacteria | 823 |
| 219 | Ga0157372_12269031 | 3300013307 | Bacteria | 623 |
| 220 | Ga0157375_10132487 | 3300013308 | Bacteria | 2613 |
| 221 | Ga0157375_10343143 | 3300013308 | Bacteria | 1659 |
| 222 | Ga0163163_10889207 | 3300014325 | Bacteria | 954 |
| 223 | Ga0163163_12434774 | 3300014325 | Bacteria | 582 |
| 224 | Ga0157380_10216361 | 3300014326 | Bacteria | 1711 |
| 225 | Ga0157377_10135851 | 3300014745 | Bacteria | 1507 |
| 226 | Ga0157379_10702120 | 3300014968 | Bacteria | 949 |
| 227 | Ga0157376_10784459 | 3300014969 | Bacteria | 964 |
| 228 | Ga0213876_10020100 | 3300021384 | Bacteria | 3529 |
| 229 | Ga0209563_100670 | 3300025230 | Bacteria | 10845 |
| 230 | Ga0209677_102054 | 3300025253 | Bacteria | 7958 |
| 231 | Ga0209677_107376 | 3300025253 | Bacteria | 2351 |
| 232 | Ga0209148_1000874 | 3300025254 | Bacteria | 20915 |
| 233 | Ga0209148_1025450 | 3300025254 | Bacteria | 926 |
| 234 | Ga0209233_1013039 | 3300025261 | Bacteria | 2387 |
| 235 | Ga0209233_1025706 | 3300025261 | Bacteria | 1452 |
| 236 | Ga0209455_1001536 | 3300025272 | Bacteria | 10290 |
| 237 | Ga0209455_1003873 | 3300025272 | Bacteria | 5107 |
| 238 | Ga0209455_1026679 | 3300025272 | Bacteria | 1033 |
| 239 | Ga0209130_1007941 | 3300025284 | Bacteria | 3199 |
| 240 | Ga0209130_1049575 | 3300025284 | Bacteria | 770 |
| 241 | Ga0209758_1007103 | 3300025297 | Bacteria | 7753 |
| 242 | Ga0209758_1009747 | 3300025297 | Bacteria | 5898 |
| 243 | Ga0209758_1022815 | 3300025297 | Bacteria | 2853 |
| 244 | Ga0209758_1132869 | 3300025297 | Bacteria | 656 |
| 245 | Ga0209256_1032643 | 3300025299 | Bacteria | 1410 |
| 246 | Ga0207426_1000704 | 3300025302 | Bacteria | 39583 |
| 247 | Ga0207426_1001257 | 3300025302 | Bacteria | 22136 |
| 248 | Ga0207426_1015711 | 3300025302 | Bacteria | 2739 |
| 249 | Ga0207697_10057876 | 3300025315 | Bacteria | 1609 |
| 250 | Ga0207697_10208950 | 3300025315 | Bacteria | 860 |
| 251 | Ga0207696_1049753 | 3300025711 | Bacteria | 1201 |
| 252 | Ga0207653_10121759 | 3300025885 | Bacteria | 940 |
| 253 | Ga0207642_10291773 | 3300025899 | Bacteria | 942 |
| 254 | Ga0207688_10021647 | 3300025901 | Bacteria | 3516 |
| 255 | Ga0207680_10546826 | 3300025903 | Bacteria | 826 |
| 256 | Ga0207647_10018041 | 3300025904 | Bacteria | 4784 |
| 257 | Ga0207645_10048193 | 3300025907 | Bacteria | 2720 |
| 258 | Ga0207645_10368505 | 3300025907 | Bacteria | 963 |
| 259 | Ga0207643_10065231 | 3300025908 | Bacteria | 2085 |
| 260 | Ga0207705_10038153 | 3300025909 | Bacteria | 3439 |
| 261 | Ga0207705_10677885 | 3300025909 | Bacteria | 802 |
| 262 | Ga0207705_11525314 | 3300025909 | Bacteria | 505 |
| 263 | Ga0207684_10109894 | 3300025910 | Bacteria | 2360 |
| 264 | Ga0207684_10205152 | 3300025910 | Bacteria | 1701 |
| 265 | Ga0207654_10031015 | 3300025911 | Bacteria | 2941 |
| 266 | Ga0207654_10083473 | 3300025911 | Bacteria | 1929 |
| 267 | Ga0207654_10510284 | 3300025911 | Bacteria | 850 |
| 268 | Ga0207707_10001534 | 3300025912 | Bacteria | 21320 |
| 269 | Ga0207707_10268715 | 3300025912 | Bacteria | 1478 |
| 270 | Ga0207695_10001156 | 3300025913 | Bacteria | 45753 |
| 271 | Ga0207695_10043787 | 3300025913 | Bacteria | 4766 |
| 272 | Ga0207671_10050733 | 3300025914 | Bacteria | 3072 |
| 273 | Ga0207671_10221960 | 3300025914 | Bacteria | 1481 |
| 274 | Ga0207671_10834669 | 3300025914 | Bacteria | 730 |
| 275 | Ga0207671_10836483 | 3300025914 | Bacteria | 729 |
| 276 | Ga0207663_10757017 | 3300025916 | Bacteria | 772 |
| 277 | Ga0207660_10030604 | 3300025917 | Bacteria | 3701 |
| 278 | Ga0207660_10528026 | 3300025917 | Bacteria | 959 |
| 279 | Ga0207649_10268498 | 3300025920 | Bacteria | 1236 |
| 280 | Ga0207649_10397486 | 3300025920 | Bacteria | 1031 |
| 281 | Ga0207649_10577321 | 3300025920 | Bacteria | 863 |
| 282 | Ga0207652_10222184 | 3300025921 | Bacteria | 1702 |
| 283 | Ga0207652_10580271 | 3300025921 | Bacteria | 1006 |
| 284 | Ga0207681_10126894 | 3300025923 | Bacteria | 1880 |
| 285 | Ga0207681_10677493 | 3300025923 | Bacteria | 856 |
| 286 | Ga0207681_10692043 | 3300025923 | Bacteria | 847 |
| 287 | Ga0207681_11303060 | 3300025923 | Bacteria | 610 |
| 288 | Ga0207694_10181955 | 3300025924 | Bacteria | 1705 |
| 289 | Ga0207694_10725944 | 3300025924 | Bacteria | 838 |
| 290 | Ga0207694_11591969 | 3300025924 | Bacteria | 551 |
| 291 | Ga0207650_10154836 | 3300025925 | Bacteria | 1812 |
| 292 | Ga0207659_11109026 | 3300025926 | Bacteria | 681 |
| 293 | Ga0207687_10020017 | 3300025927 | Bacteria | 4438 |
| 294 | Ga0207687_10273942 | 3300025927 | Bacteria | 1350 |
| 295 | Ga0207644_10470208 | 3300025931 | Bacteria | 1034 |
| 296 | Ga0207706_10270981 | 3300025933 | Bacteria | 1481 |
| 297 | Ga0207709_10247442 | 3300025935 | Bacteria | 1300 |
| 298 | Ga0207670_10680698 | 3300025936 | Bacteria | 850 |
| 299 | Ga0207669_10085987 | 3300025937 | Bacteria | 2032 |
| 300 | Ga0207669_10105585 | 3300025937 | Bacteria | 1874 |
| 301 | Ga0207665_10488229 | 3300025939 | Bacteria | 950 |
| 302 | Ga0207711_10307445 | 3300025941 | Bacteria | 1463 |
| 303 | Ga0207711_10405652 | 3300025941 | Bacteria | 1267 |
| 304 | Ga0207689_10860300 | 3300025942 | Bacteria | 765 |
| 305 | Ga0207689_10883512 | 3300025942 | Bacteria | 754 |
| 306 | Ga0207679_10155774 | 3300025945 | Bacteria | 1865 |
| 307 | Ga0207667_10015856 | 3300025949 | Bacteria | 8539 |
| 308 | Ga0207667_10367000 | 3300025949 | Bacteria | 1468 |
| 309 | Ga0207667_10652598 | 3300025949 | Bacteria | 1058 |
| 310 | Ga0207667_10780641 | 3300025949 | Bacteria | 953 |
| 311 | Ga0207667_10923756 | 3300025949 | Bacteria | 863 |
| 312 | Ga0207667_11382584 | 3300025949 | Bacteria | 678 |
| 313 | Ga0207712_10077095 | 3300025961 | Bacteria | 2415 |
| 314 | Ga0207668_10004107 | 3300025972 | Bacteria | 8550 |
| 315 | Ga0207668_10546712 | 3300025972 | Bacteria | 1002 |
| 316 | Ga0207640_10014499 | 3300025981 | Bacteria | 4540 |
| 317 | Ga0207640_10475476 | 3300025981 | Bacteria | 1035 |
| 318 | Ga0207640_10511237 | 3300025981 | Bacteria | 1002 |
| 319 | Ga0207640_10987197 | 3300025981 | Bacteria | 740 |
| 320 | Ga0207658_10086653 | 3300025986 | Bacteria | 2416 |
| 321 | Ga0207658_10354585 | 3300025986 | Bacteria | 1278 |
| 322 | Ga0207658_10846949 | 3300025986 | Bacteria | 831 |
| 323 | Ga0207677_10038533 | 3300026023 | Bacteria | 3135 |
| 324 | Ga0207677_10108262 | 3300026023 | Bacteria | 2063 |
| 325 | Ga0207677_10753590 | 3300026023 | Bacteria | 868 |
| 326 | Ga0207677_10837926 | 3300026023 | Bacteria | 825 |
| 327 | Ga0207703_10043372 | 3300026035 | Bacteria | 3611 |
| 328 | Ga0207703_10391022 | 3300026035 | Bacteria | 1288 |
| 329 | Ga0207639_10159766 | 3300026041 | Bacteria | 1898 |
| 330 | Ga0207639_10253862 | 3300026041 | Bacteria | 1535 |
| 331 | Ga0207639_10347931 | 3300026041 | Bacteria | 1323 |
| 332 | Ga0207639_10474126 | 3300026041 | Bacteria | 1140 |
| 333 | Ga0207639_11266570 | 3300026041 | Bacteria | 692 |
| 334 | Ga0207678_10076141 | 3300026067 | Bacteria | 2874 |
| 335 | Ga0207678_10084233 | 3300026067 | Bacteria | 2719 |
| 336 | Ga0207708_10384321 | 3300026075 | Bacteria | 1158 |
| 337 | Ga0207702_10371864 | 3300026078 | Bacteria | 1372 |
| 338 | Ga0207702_10508208 | 3300026078 | Bacteria | 1175 |
| 339 | Ga0207702_10852814 | 3300026078 | Bacteria | 902 |
| 340 | Ga0207702_11706555 | 3300026078 | Bacteria | 622 |
| 341 | Ga0207641_10317453 | 3300026088 | Bacteria | 1476 |
| 342 | Ga0207641_10842593 | 3300026088 | Bacteria | 908 |
| 343 | Ga0207641_11248569 | 3300026088 | Bacteria | 743 |
| 344 | Ga0207648_10231352 | 3300026089 | Bacteria | 1644 |
| 345 | Ga0207648_10731481 | 3300026089 | Bacteria | 918 |
| 346 | Ga0207676_10321145 | 3300026095 | Bacteria | 1421 |
| 347 | Ga0207674_10423992 | 3300026116 | Bacteria | 1286 |
| 348 | Ga0207674_11134276 | 3300026116 | Bacteria | 751 |
| 349 | Ga0207675_100923058 | 3300026118 | Bacteria | 890 |
| 350 | Ga0207683_10422865 | 3300026121 | Bacteria | 1227 |
| 351 | Ga0207683_10623410 | 3300026121 | Bacteria | 999 |
| 352 | Ga0207683_10728616 | 3300026121 | Bacteria | 920 |
| 353 | Ga0207698_10101537 | 3300026142 | Bacteria | 2386 |
| 354 | Ga0207698_10219781 | 3300026142 | Bacteria | 1716 |
| 355 | Ga0207698_10662982 | 3300026142 | Bacteria | 1035 |
| 356 | Ga0207698_11139783 | 3300026142 | Bacteria | 793 |
| 357 | Ga0268266_10009167 | 3300028379 | Bacteria | 8734 |
| 358 | Ga0268266_10080191 | 3300028379 | Bacteria | 2843 |
| 359 | Ga0268266_10095681 | 3300028379 | Bacteria | 2608 |
| 360 | Ga0268266_10154742 | 3300028379 | Bacteria | 2070 |
| 361 | Ga0268266_10411948 | 3300028379 | Bacteria | 1280 |
| 362 | Ga0268266_11496613 | 3300028379 | Bacteria | 650 |
| 363 | Ga0268265_10215400 | 3300028380 | Bacteria | 1676 |
| 364 | Ga0268265_12083401 | 3300028380 | Bacteria | 574 |
| 365 | Ga0268264_10284455 | 3300028381 | Bacteria | 1550 |
| 366 | Ga0265337_1003913 | 3300028556 | Bacteria | 6308 |
| 367 | Ga0265326_10006121 | 3300028558 | Bacteria | 3755 |
| 368 | Ga0265319_1015989 | 3300028563 | Bacteria | 2885 |
| 369 | Ga0265319_1041132 | 3300028563 | Bacteria | 1561 |
| 370 | Ga0265334_10011650 | 3300028573 | Bacteria | 3697 |
| 371 | Ga0265318_10011203 | 3300028577 | Bacteria | 3873 |
| 372 | Ga0265318_10065798 | 3300028577 | Bacteria | 1348 |
| 373 | Ga0265323_10000706 | 3300028653 | Bacteria | 18167 |
| 374 | Ga0265322_10014719 | 3300028654 | Bacteria | 2261 |
| 375 | Ga0265336_10000683 | 3300028666 | Bacteria | 18322 |
| 376 | Ga0265338_10001041 | 3300028800 | Bacteria | 46363 |
| 377 | Ga0265324_10002208 | 3300029957 | Bacteria | 10179 |
| 378 | Ga0265760_10072822 | 3300031090 | Bacteria | 1056 |
| 379 | Ga0265330_10169175 | 3300031235 | Bacteria | 927 |
| 380 | Ga0265328_10049487 | 3300031239 | Bacteria | 1543 |
| 381 | Ga0265328_10246206 | 3300031239 | Bacteria | 684 |
| 382 | Ga0265320_10247191 | 3300031240 | Bacteria | 791 |
| 383 | Ga0265325_10167524 | 3300031241 | Bacteria | 1030 |
| 384 | Ga0265340_10008593 | 3300031247 | Bacteria | 5504 |
| 385 | Ga0265331_10149683 | 3300031250 | Bacteria | 1060 |
| 386 | Ga0265331_10259238 | 3300031250 | Bacteria | 780 |
| 387 | Ga0265316_10360480 | 3300031344 | Bacteria | 1051 |
| 388 | Ga0265316_10431075 | 3300031344 | Bacteria | 947 |
| 389 | Ga0307509_10495966 | 3300031507 | Bacteria | 906 |
| 390 | Ga0307509_10728008 | 3300031507 | Bacteria | 658 |
| 391 | Ga0307408_100432049 | 3300031548 | Bacteria | 1138 |
| 392 | Ga0307408_102224574 | 3300031548 | Bacteria | 530 |
| 393 | Ga0307508_10044377 | 3300031616 | Bacteria | 3977 |
| 394 | Ga0307508_10442515 | 3300031616 | Bacteria | 892 |
| 395 | Ga0307508_10818226 | 3300031616 | Bacteria | 550 |
| 396 | Ga0307514_10572985 | 3300031649 | Bacteria | 515 |
| 397 | Ga0265314_10104078 | 3300031711 | Bacteria | 1818 |
| 398 | Ga0265314_10250371 | 3300031711 | Bacteria | 1017 |
| 399 | Ga0265314_10683400 | 3300031711 | Bacteria | 520 |
| 400 | Ga0265342_10073176 | 3300031712 | Bacteria | 1993 |
| 401 | Ga0307516_10073486 | 3300031730 | Bacteria | 3276 |
| 402 | Ga0307413_10092912 | 3300031824 | Bacteria | 1970 |
| 403 | Ga0307410_10139011 | 3300031852 | Bacteria | 1794 |
| 404 | Ga0307410_10563169 | 3300031852 | Bacteria | 946 |
| 405 | Ga0307406_10063979 | 3300031901 | Bacteria | 2385 |
| 406 | Ga0307412_10385066 | 3300031911 | Bacteria | 1137 |
| 407 | Ga0307409_100171799 | 3300031995 | Bacteria | 1908 |
| 408 | Ga0307416_100798826 | 3300032002 | Bacteria | 1039 |
| 409 | Ga0307414_10124646 | 3300032004 | Bacteria | 1988 |
| 410 | Ga0307411_10925951 | 3300032005 | Bacteria | 776 |
| 411 | Ga0307411_10970521 | 3300032005 | Bacteria | 759 |
| 412 | Ga0307411_11537263 | 3300032005 | Bacteria | 612 |
| 413 | Ga0307415_100258391 | 3300032126 | Bacteria | 1419 |
| 414 | Ga0307415_100501288 | 3300032126 | Bacteria | 1061 |
| 415 | Ga0307507_10632107 | 3300033179 | Bacteria | 547 |
| 416 | Ga0307510_10035129 | 3300033180 | Bacteria | 5602 |
| 417 | Ga0307510_10058529 | 3300033180 | Bacteria | 3988 |
| 418 | Ga0373959_0209730 | 3300034820 | Bacteria | 518 |
| 419 | Ga0373928_0217136 | 3300035084 | Bacteria | 558 |
| 420 | Ga0373934_0040090 | 3300035086 | Bacteria | 1847 |
| 421 | Ga0373934_0257226 | 3300035086 | Bacteria | 722 |
| 422 | Ga0373934_0445073 | 3300035086 | Bacteria | 543 |
| 423 | Ga0373944_0007533 | 3300035089 | Bacteria | 2920 |
| 424 | Ga0373944_0020571 | 3300035089 | Bacteria | 1903 |
| 425 | Ga0373932_0064837 | 3300035112 | Bacteria | 1119 |
| 426 | Ga0373936_0008591 | 3300035113 | Bacteria | 3846 |
| 427 | Ga0373936_0009596 | 3300035113 | Bacteria | 3646 |
| 428 | Ga0373936_0066832 | 3300035113 | Bacteria | 1476 |
| 429 | Ga0373939_0276586 | 3300035114 | Bacteria | 662 |
| 430 | Ga0373945_0013000 | 3300035116 | Bacteria | 2773 |
| 431 | Ga0373945_0014997 | 3300035116 | Bacteria | 2602 |
| 432 | Ga0373953_0125662 | 3300035117 | Bacteria | 1091 |
| 433 | Ga0373954_0027517 | 3300035118 | Bacteria | 2610 |
| 434 | Ga0373954_0134840 | 3300035118 | Bacteria | 1203 |
| 435 | Ga0373956_0222439 | 3300035119 | Bacteria | 896 |
| 436 | Ga0373957_0407886 | 3300035120 | Bacteria | 585 |
| 437 | Ga0373943_0206887 | 3300035170 | Bacteria | 1088 |
| 438 | Ga0373943_0406589 | 3300035170 | Bacteria | 786 |
| 439 | Ga0373946_0049993 | 3300035171 | Bacteria | 1745 |
| 440 | Ga0373946_0357119 | 3300035171 | Bacteria | 731 |
| 441 | Ga0373955_0022100 | 3300035172 | Bacteria | 3222 |
| 442 | Ga0373955_0042706 | 3300035172 | Bacteria | 2435 |
| 443 | Ga0373955_0846740 | 3300035172 | Bacteria | 562 |
| 444 | Ga0373924_0001609 | 3300035410 | Bacteria | 7406 |
| 445 | Ga0373924_0008812 | 3300035410 | Bacteria | 3679 |
| 446 | Ga0373931_0170280 | 3300035691 | Bacteria | 1283 |
| 447 | Ga0373935_0027489 | 3300035692 | Bacteria | 3515 |
| 448 | Ga0373935_0039107 | 3300035692 | Bacteria | 2972 |
| 449 | Ga0373935_0156729 | 3300035692 | Bacteria | 1549 |
| 450 | Ga0373927_0003207 | 3300035695 | Bacteria | 11783 |
| 451 | Ga0373927_0209706 | 3300035695 | Bacteria | 1279 |
| 452 | Ga0373933_0007993 | 3300035724 | Bacteria | 5770 |
| 453 | Ga0373933_0108416 | 3300035724 | Bacteria | 1730 |
| 454 | Ga0373933_0870024 | 3300035724 | Bacteria | 593 |
| 455 | Ga0373947_0006026 | 3300035725 | Bacteria | 7068 |
| 456 | Ga0373947_0026448 | 3300035725 | Bacteria | 3391 |
| 457 | Ga0373947_0104432 | 3300035725 | Bacteria | 1784 |
| 458 | Ga0373947_0289945 | 3300035725 | Bacteria | 1090 |
| 459 | Ga0373937_0040577 | 3300036401 | Bacteria | 4242 |
| 460 | Ga0373937_0135256 | 3300036401 | Bacteria | 2304 |
| 461 | Ga0373937_0603662 | 3300036401 | Bacteria | 1042 |
| 462 | Ga0373925_0017296 | 3300037068 | Bacteria | 5224 |
| 463 | Ga0373925_0024092 | 3300037068 | Bacteria | 4442 |
| 464 | Ga0373925_0088330 | 3300037068 | Bacteria | 2367 |
| 465 | Ga0373925_0588595 | 3300037068 | Bacteria | 916 |
| 466 | Ga0395900_0025072 | 3300037418 | Bacteria | 6104 |
| 467 | Ga0395898_0012791 | 3300037466 | Bacteria | 8664 |
| 468 | Ga0436364_0425415 | 3300037853 | Bacteria | 807 |
| 469 | Ga0395901_0132945 | 3300038443 | Bacteria | 2614 |
| 470 | Ga0436365_0238184 | 3300039437 | Bacteria | 808 |
| 471 | Ga0436365_0420080 | 3300039437 | Bacteria | 1626 |
| 472 | Ga0436365_0989203 | 3300039437 | Bacteria | 3792 |
| 473 | Ga0436360_0017356 | 3300039438 | Bacteria | 1056 |
| 474 | Ga0439465_0037505 | 3300041413 | Bacteria | 1559 |
| 475 | Ga0451789_1007321 | 3300041443 | Bacteria | 598 |
| 476 | Ga0451789_1157944 | 3300041443 | Bacteria | 602 |
| 477 | Ga0451791_1090847 | 3300041451 | Bacteria | 1824 |
| 478 | Ga0451793_0399535 | 3300041452 | Bacteria | 852 |
| 479 | Ga0451797_0572757 | 3300041453 | Bacteria | 575 |
| 480 | Ga0451807_0338309 | 3300041486 | Bacteria | 897 |
| 481 | Ga0439431_0022287 | 3300041997 | Bacteria | 1526 |
| 482 | Ga0439432_139395 | 3300042006 | Bacteria | 714 |
| 483 | Ga0439455_0087588 | 3300042012 | Bacteria | 851 |
| 484 | Ga0439459_0006825 | 3300042438 | Bacteria | 1912 |
| 485 | Ga0466969_0090592 | 3300044656 | Bacteria | 1449 |
| 486 | Ga0466972_0462459 | 3300044658 | Bacteria | 596 |
| 487 | Ga0466966_0001471 | 3300044684 | Bacteria | 15165 |
| 488 | Ga0466961_0004761 | 3300044693 | Bacteria | 8540 |
| 489 | Ga0466961_0728820 | 3300044693 | Bacteria | 593 |
| 490 | Ga0466963_0014602 | 3300044694 | Bacteria | 4847 |
| 491 | Ga0466964_0088611 | 3300044706 | Bacteria | 1343 |
| 492 | Ga0466971_0092063 | 3300044719 | Bacteria | 1389 |
| 493 | Ga0466971_0163200 | 3300044719 | Bacteria | 1043 |
| 494 | Ga0466970_0312853 | 3300044765 | Bacteria | 887 |
| 495 | Ga0466970_0433921 | 3300044765 | Bacteria | 752 |
| 496 | Ga0466970_0527773 | 3300044765 | Bacteria | 681 |
| 497 | Ga0466957_0575120 | 3300044842 | Bacteria | 787 |
| 498 | Ga0466959_0005681 | 3300045049 | Bacteria | 8582 |
| 499 | Ga0466959_0234345 | 3300045049 | Bacteria | 1270 |
| 500 | Ga0466959_0355691 | 3300045049 | Bacteria | 998 |
| 501 | Ga0466958_0052462 | 3300045836 | Bacteria | 2472 |
| 502 | Ga0466967_0037023 | 3300045976 | Bacteria | 4171 |
| 503 | Ga0466967_0125936 | 3300045976 | Bacteria | 2373 |
| 504 | Ga0466967_0674125 | 3300045976 | Bacteria | 1023 |
| 505 | Ga0495617_015362 | 3300046452 | Bacteria | 2595 |
| 506 | Ga0495617_202444 | 3300046452 | Bacteria | 620 |
| 507 | Ga0495592_0012750 | 3300046454 | Bacteria | 6390 |
| 508 | Ga0495592_0086197 | 3300046454 | Bacteria | 2262 |
| 509 | Ga0495592_0261592 | 3300046454 | Bacteria | 1139 |
| 510 | Ga0495603_0000182 | 3300046455 | Bacteria | 32426 |
| 511 | Ga0495603_0050821 | 3300046455 | Bacteria | 2464 |
| 512 | Ga0495603_0102705 | 3300046455 | Bacteria | 1669 |
| 513 | Ga0495603_0322682 | 3300046455 | Bacteria | 886 |
| 514 | Ga0495603_0591647 | 3300046455 | Bacteria | 635 |
| 515 | Ga0495603_0688781 | 3300046455 | Bacteria | 584 |
| 516 | Ga0495629_0000314 | 3300046459 | Bacteria | 41394 |
| 517 | Ga0495629_0006021 | 3300046459 | Bacteria | 9020 |
| 518 | Ga0495629_0023701 | 3300046459 | Bacteria | 4371 |
| 519 | Ga0495638_0037355 | 3300046460 | Bacteria | 3089 |
| 520 | Ga0495638_0128217 | 3300046460 | Bacteria | 1493 |
| 521 | Ga0495641_0001508 | 3300046461 | Bacteria | 19835 |
| 522 | Ga0495641_0192463 | 3300046461 | Bacteria | 914 |
| 523 | Ga0495651_0014799 | 3300046462 | Bacteria | 6033 |
| 524 | Ga0495651_0019479 | 3300046462 | Bacteria | 5260 |
| 525 | Ga0495651_0054726 | 3300046462 | Bacteria | 3067 |
| 526 | Ga0495651_0092239 | 3300046462 | Bacteria | 2269 |
| 527 | Ga0495653_0107423 | 3300046463 | Bacteria | 2011 |
| 528 | Ga0495653_0300894 | 3300046463 | Bacteria | 1046 |
| 529 | Ga0495580_0002541 | 3300046472 | Bacteria | 15893 |
| 530 | Ga0495580_0073929 | 3300046472 | Bacteria | 2379 |
| 531 | Ga0495582_0003777 | 3300046473 | Bacteria | 8536 |
| 532 | Ga0495582_0320625 | 3300046473 | Bacteria | 891 |
| 533 | Ga0495639_0006669 | 3300046475 | Bacteria | 4968 |
| 534 | Ga0495639_0036657 | 3300046475 | Bacteria | 2197 |
| 535 | Ga0495639_0287775 | 3300046475 | Bacteria | 818 |
| 536 | Ga0495662_0001470 | 3300046476 | Bacteria | 11662 |
| 537 | Ga0495662_0016856 | 3300046476 | Bacteria | 3536 |
| 538 | Ga0495662_0018098 | 3300046476 | Bacteria | 3408 |
| 539 | Ga0495664_0001204 | 3300046477 | Bacteria | 13527 |
| 540 | Ga0495664_0049429 | 3300046477 | Bacteria | 2496 |
| 541 | Ga0495664_0129739 | 3300046477 | Bacteria | 1526 |
| 542 | Ga0495664_0290553 | 3300046477 | Bacteria | 987 |
| 543 | Ga0495585_0042555 | 3300046492 | Bacteria | 2543 |
| 544 | Ga0495585_0354516 | 3300046492 | Bacteria | 712 |
| 545 | Ga0495594_0000302 | 3300046499 | Bacteria | 24227 |
| 546 | Ga0495594_0210317 | 3300046499 | Bacteria | 1109 |
| 547 | Ga0495594_0229251 | 3300046499 | Bacteria | 1059 |
| 548 | Ga0495607_0525337 | 3300046501 | Bacteria | 522 |
| 549 | Ga0495606_0053703 | 3300046507 | Bacteria | 2613 |
| 550 | Ga0495606_0178813 | 3300046507 | Bacteria | 1225 |
| 551 | Ga0495606_0342167 | 3300046507 | Bacteria | 796 |
| 552 | Ga0495608_0108241 | 3300046511 | Bacteria | 1787 |
| 553 | Ga0495608_0162783 | 3300046511 | Bacteria | 1418 |
| 554 | Ga0495616_0086251 | 3300046513 | Bacteria | 1493 |
| 555 | Ga0495616_0417079 | 3300046513 | Bacteria | 549 |
| 556 | Ga0495618_0008828 | 3300046514 | Bacteria | 6087 |
| 557 | Ga0495618_0043480 | 3300046514 | Bacteria | 2834 |
| 558 | Ga0495620_0123484 | 3300046515 | Bacteria | 1019 |
| 559 | Ga0495628_0014010 | 3300046516 | Bacteria | 6732 |
| 560 | Ga0495628_0061793 | 3300046516 | Bacteria | 2937 |
| 561 | Ga0495628_0169991 | 3300046516 | Bacteria | 1653 |
| 562 | Ga0495628_0310172 | 3300046516 | Bacteria | 1166 |
| 563 | Ga0495630_0002415 | 3300046517 | Bacteria | 12968 |
| 564 | Ga0495630_0137068 | 3300046517 | Bacteria | 1860 |
| 565 | Ga0495631_0029165 | 3300046518 | Bacteria | 2512 |
| 566 | Ga0495632_0030152 | 3300046519 | Bacteria | 2818 |
| 567 | Ga0495637_0139389 | 3300046520 | Bacteria | 921 |
| 568 | Ga0495643_0287868 | 3300046522 | Bacteria | 753 |
| 569 | Ga0495644_0219573 | 3300046523 | Bacteria | 735 |
| 570 | Ga0495648_0006267 | 3300046524 | Bacteria | 9733 |
| 571 | Ga0495663_0024099 | 3300046525 | Bacteria | 1767 |
| 572 | Ga0495663_0033542 | 3300046525 | Bacteria | 1533 |
| 573 | Ga0495652_0006258 | 3300046529 | Bacteria | 11097 |
| 574 | Ga0495652_0755556 | 3300046529 | Bacteria | 650 |
| 575 | Ga0495652_1065366 | 3300046529 | Bacteria | 526 |
| 576 | Ga0495654_0133352 | 3300046530 | Bacteria | 1113 |
| 577 | Ga0495665_0000619 | 3300046531 | Bacteria | 18044 |
| 578 | Ga0495665_0137733 | 3300046531 | Bacteria | 1276 |
| 579 | Ga0495665_0627161 | 3300046531 | Bacteria | 536 |
| 580 | Ga0495640_0000308 | 3300046533 | Bacteria | 33750 |
| 581 | Ga0495640_0014432 | 3300046533 | Bacteria | 5978 |
| 582 | Ga0495640_0032685 | 3300046533 | Bacteria | 3703 |
| 583 | Ga0495586_0026816 | 3300046535 | Bacteria | 3083 |
| 584 | Ga0495587_0030628 | 3300046536 | Bacteria | 3262 |
| 585 | Ga0495598_0009519 | 3300046537 | Bacteria | 2300 |
| 586 | Ga0495609_0069311 | 3300046538 | Bacteria | 1550 |
| 587 | Ga0495609_0147697 | 3300046538 | Bacteria | 1001 |
| 588 | Ga0495621_0501872 | 3300046539 | Bacteria | 523 |
| 589 | Ga0495645_0002277 | 3300046543 | Bacteria | 13061 |
| 590 | Ga0495622_0002921 | 3300046557 | Bacteria | 8156 |
| 591 | Ga0495622_0013329 | 3300046557 | Bacteria | 3814 |
| 592 | Ga0495622_0054035 | 3300046557 | Bacteria | 1863 |
| 593 | Ga0495622_0114264 | 3300046557 | Bacteria | 1235 |
| 594 | Ga0495622_0262568 | 3300046557 | Bacteria | 758 |
| 595 | Ga0495633_0093126 | 3300046558 | Bacteria | 1400 |
| 596 | Ga0495667_0004819 | 3300046559 | Bacteria | 9123 |
| 597 | Ga0495667_0139683 | 3300046559 | Bacteria | 1561 |
| 598 | Ga0495667_0166789 | 3300046559 | Bacteria | 1416 |
| 599 | Ga0495667_0620530 | 3300046559 | Bacteria | 673 |
| 600 | Ga0495656_0066657 | 3300046615 | Bacteria | 1586 |
| 601 | Ga0495668_0023015 | 3300046616 | Bacteria | 3557 |
| 602 | Ga0495668_0112895 | 3300046616 | Bacteria | 1486 |
| 603 | Ga0495668_0404103 | 3300046616 | Bacteria | 751 |
| 604 | Ga0495634_0001483 | 3300046642 | Bacteria | 20763 |
| 605 | Ga0495634_0034146 | 3300046642 | Bacteria | 3492 |
| 606 | Ga0495625_0203704 | 3300046660 | Bacteria | 1304 |
| 607 | Ga0495625_0210822 | 3300046660 | Bacteria | 1277 |
| 608 | Ga0495625_0686204 | 3300046660 | Bacteria | 606 |
| 609 | Ga0495635_0038449 | 3300046663 | Bacteria | 3313 |
| 610 | Ga0495635_0074254 | 3300046663 | Bacteria | 2329 |
| 611 | Ga0495635_0230395 | 3300046663 | Bacteria | 1251 |
| 612 | Ga0495659_0068490 | 3300046664 | Bacteria | 1325 |
| 613 | Ga0495661_0204820 | 3300046665 | Bacteria | 1031 |
| 614 | Ga0495661_0205345 | 3300046665 | Bacteria | 1029 |
| 615 | Ga0495661_0311856 | 3300046665 | Bacteria | 784 |
| 616 | Ga0495588_0119439 | 3300046674 | Bacteria | 1389 |
| 617 | Ga0495588_0182789 | 3300046674 | Bacteria | 1108 |
| 618 | Ga0495657_0015079 | 3300046675 | Bacteria | 5665 |
| 619 | Ga0495657_0095578 | 3300046675 | Bacteria | 1899 |
| 620 | Ga0495599_0327330 | 3300046678 | Bacteria | 921 |
| 621 | Ga0495623_0042017 | 3300046679 | Bacteria | 2914 |
| 622 | Ga0495646_0011359 | 3300046680 | Bacteria | 5655 |
| 623 | Ga0495646_0029121 | 3300046680 | Bacteria | 3453 |
| 624 | Ga0495646_0097496 | 3300046680 | Bacteria | 1689 |
| 625 | Ga0495647_0019286 | 3300046681 | Bacteria | 2437 |
| 626 | Ga0495647_0028193 | 3300046681 | Bacteria | 2069 |
| 627 | Ga0495658_0000936 | 3300046683 | Bacteria | 15569 |
| 628 | Ga0495658_0020828 | 3300046683 | Bacteria | 3448 |
| 629 | Ga0495658_0739339 | 3300046683 | Bacteria | 630 |
| 630 | Ga0495669_0039321 | 3300046684 | Bacteria | 2094 |
| 631 | Ga0495669_0324230 | 3300046684 | Bacteria | 743 |
| 632 | Ga0495669_0566919 | 3300046684 | Bacteria | 552 |
| 633 | Ga0495613_0131395 | 3300046689 | Bacteria | 1793 |
| 634 | Ga0495613_0375342 | 3300046689 | Bacteria | 973 |
| 635 | Ga0495624_0000810 | 3300046690 | Bacteria | 24701 |
| 636 | Ga0495624_0177037 | 3300046690 | Bacteria | 1300 |
| 637 | Ga0495624_0306856 | 3300046690 | Bacteria | 956 |
| 638 | Ga0495624_0510145 | 3300046690 | Bacteria | 719 |
| 639 | Ga0495670_0082982 | 3300046691 | Bacteria | 1634 |
| 640 | Ga0495671_0064047 | 3300046692 | Bacteria | 1810 |
| 641 | Ga0495671_0148277 | 3300046692 | Bacteria | 1142 |
| 642 | Ga0495600_0011127 | 3300046809 | Bacteria | 5602 |
| 643 | Ga0495600_0072440 | 3300046809 | Bacteria | 2250 |
| 644 | Ga0495581_0000683 | 3300047315 | Bacteria | 17799 |
| 645 | Ga0495581_0091563 | 3300047315 | Bacteria | 1764 |
| 646 | Ga0495581_0649851 | 3300047315 | Bacteria | 609 |
| 647 | Ga0495604_0215880 | 3300047317 | Bacteria | 1323 |
| 648 | Ga0495636_0524273 | 3300047318 | Bacteria | 574 |
| 649 | Ga0495674_0012056 | 3300047319 | Bacteria | 8146 |
| 650 | Ga0495674_0146672 | 3300047319 | Bacteria | 1981 |
| 651 | Ga0495674_0677532 | 3300047319 | Bacteria | 811 |
| 652 | Ga0495672_0133343 | 3300047320 | Bacteria | 1304 |
| 653 | Ga0495672_0172127 | 3300047320 | Bacteria | 1103 |
| 654 | Ga0495676_0008153 | 3300047321 | Bacteria | 9610 |
| 655 | Ga0495676_0347411 | 3300047321 | Bacteria | 992 |
| 656 | Ga0495676_0576727 | 3300047321 | Bacteria | 734 |
| 657 | Ga0495680_0010179 | 3300047322 | Bacteria | 8401 |
| 658 | Ga0495680_0166652 | 3300047322 | Bacteria | 1597 |
| 659 | Ga0495680_0721149 | 3300047322 | Bacteria | 657 |
| 660 | Ga0495675_0054237 | 3300047444 | Bacteria | 2544 |
| 661 | Ga0495685_064697 | 3300047447 | Bacteria | 1229 |
| 662 | Ga0495685_209765 | 3300047447 | Bacteria | 623 |
| 663 | Ga0495673_0106682 | 3300047469 | Bacteria | 1125 |
| 664 | Ga0495681_0133666 | 3300047470 | Bacteria | 1054 |
| 665 | Ga0495681_0150884 | 3300047470 | Bacteria | 975 |
| 666 | Ga0495684_0272730 | 3300047471 | Bacteria | 1223 |
| 667 | Ga0495686_0255772 | 3300047472 | Bacteria | 982 |
| 668 | Ga0495686_0268809 | 3300047472 | Bacteria | 952 |
| 669 | Ga0495686_0282218 | 3300047472 | Bacteria | 922 |
| 670 | Ga0495686_0394922 | 3300047472 | Bacteria | 744 |
| 671 | Ga0495593_0000370 | 3300047673 | Bacteria | 24754 |
| 672 | Ga0495593_0062481 | 3300047673 | Bacteria | 1946 |
| 673 | Ga0495593_0468210 | 3300047673 | Bacteria | 631 |
| 674 | Ga0495602_0016617 | 3300048088 | Bacteria | 7397 |
| 675 | Ga0495602_0610482 | 3300048088 | Bacteria | 749 |
| 676 | Ga0496100_0251157 | 3300048903 | Bacteria | 1308 |
| 677 | Ga0496100_0393953 | 3300048903 | Bacteria | 1054 |
| 678 | Ga0496101_0533808 | 3300048904 | Bacteria | 927 |
| 679 | Ga0496101_1325825 | 3300048904 | Bacteria | 562 |
| 680 | Ga0496102_0234656 | 3300048905 | Bacteria | 1729 |
| 681 | Ga0496102_0636406 | 3300048905 | Bacteria | 990 |
| 682 | Ga0496102_1702229 | 3300048905 | Bacteria | 548 |
| 683 | Ga0496105_0063923 | 3300048908 | Bacteria | 3036 |
| 684 | Ga0496106_0724942 | 3300048909 | Bacteria | 791 |
| 685 | Ga0496108_0025132 | 3300048911 | Bacteria | 4907 |
| 686 | Ga0496109_0308781 | 3300048912 | Bacteria | 1492 |
| 687 | Ga0496109_0577146 | 3300048912 | Bacteria | 1060 |
| 688 | Ga0496110_0286131 | 3300048913 | Bacteria | 1501 |
| 689 | Ga0496112_0243501 | 3300048915 | Bacteria | 1750 |
| 690 | Ga0496112_0252013 | 3300048915 | Bacteria | 1716 |
| 691 | Ga0496112_0526207 | 3300048915 | Bacteria | 1117 |
| 692 | Ga0496113_0729959 | 3300048916 | Bacteria | 789 |
| 693 | Ga0496113_1040045 | 3300048916 | Bacteria | 644 |
| 694 | Ga0496115_0381190 | 3300048918 | Bacteria | 1147 |
| 695 | Ga0496115_0553680 | 3300048918 | Bacteria | 919 |
| 696 | Ga0496116_0285990 | 3300048919 | Bacteria | 795 |
| 697 | Ga0496117_0303195 | 3300048920 | Bacteria | 844 |
| 698 | Ga0496118_0011634 | 3300048921 | Bacteria | 8558 |
| 699 | Ga0496118_0126147 | 3300048921 | Bacteria | 1656 |
| 700 | Ga0496118_0261619 | 3300048921 | Bacteria | 976 |
| 701 | Ga0496119_0022207 | 3300048922 | Bacteria | 4553 |
| 702 | Ga0496120_0085482 | 3300048923 | Bacteria | 1698 |
| 703 | Ga0496120_0095207 | 3300048923 | Bacteria | 1583 |
| 704 | Ga0496121_0006350 | 3300048924 | Bacteria | 14731 |
| 705 | Ga0496121_0040352 | 3300048924 | Bacteria | 4097 |
| 706 | Ga0496121_0054773 | 3300048924 | Bacteria | 3329 |
| 707 | Ga0496121_0090891 | 3300048924 | Bacteria | 2385 |
| 708 | Ga0496121_0132894 | 3300048924 | Bacteria | 1859 |
| 709 | Ga0496121_0150187 | 3300048924 | Bacteria | 1715 |
| 710 | Ga0496121_0182598 | 3300048924 | Bacteria | 1512 |
| 711 | Ga0496121_0228676 | 3300048924 | Bacteria | 1304 |
| 712 | Ga0496121_0276276 | 3300048924 | Bacteria | 1152 |
| 713 | Ga0496121_0326255 | 3300048924 | Bacteria | 1031 |
| 714 | Ga0496123_0348889 | 3300048926 | Bacteria | 689 |
| 715 | Ga0496124_0112193 | 3300048927 | Bacteria | 2193 |
| 716 | Ga0496125_0102411 | 3300048928 | Bacteria | 2104 |
| 717 | Ga0496125_0123949 | 3300048928 | Bacteria | 1836 |
| 718 | Ga0496126_0159757 | 3300048929 | Bacteria | 1926 |
| 719 | Ga0496126_0176114 | 3300048929 | Bacteria | 1819 |
| 720 | Ga0496126_0351956 | 3300048929 | Bacteria | 1204 |
| 721 | Ga0496126_0429566 | 3300048929 | Bacteria | 1066 |
| 722 | Ga0496126_0451711 | 3300048929 | Bacteria | 1034 |
| 723 | Ga0496126_0481152 | 3300048929 | Bacteria | 995 |
| 724 | Ga0496126_1338893 | 3300048929 | Bacteria | 520 |
| 725 | Ga0495678_042590 | 3300049459 | Bacteria | 1809 |
| 726 | Ga0495682_0066213 | 3300049460 | Bacteria | 1302 |
| 727 | Ga0495682_0120472 | 3300049460 | Bacteria | 939 |
| 728 | Ga0495682_0248736 | 3300049460 | Bacteria | 629 |
| 729 | Ga0501033_0344084 | 3300049570 | Bacteria | 1045 |
| 730 | Ga0501046_0293391 | 3300049580 | Bacteria | 1189 |
| 731 | Ga0501047_0326464 | 3300049581 | Bacteria | 1373 |
| 732 | Ga0501047_0764241 | 3300049581 | Bacteria | 782 |
| 733 | Ga0501047_0773685 | 3300049581 | Bacteria | 775 |
| 734 | Ga0501067_0071756 | 3300049583 | Bacteria | 1918 |
| 735 | Ga0501070_0451380 | 3300049586 | Bacteria | 1036 |
| 736 | Ga0501073_0023882 | 3300049589 | Bacteria | 4390 |
| 737 | Ga0501075_0350138 | 3300049591 | Bacteria | 1126 |
| 738 | Ga0501076_1004831 | 3300049592 | Bacteria | 687 |
| 739 | Ga0501080_0245707 | 3300049742 | Bacteria | 1632 |
| 740 | Ga0501081_0210315 | 3300049743 | Bacteria | 1413 |
| 741 | Ga0501083_0932328 | 3300049744 | Bacteria | 565 |
| 742 | Ga0501035_0127547 | 3300049822 | Bacteria | 2221 |
| 743 | Ga0501035_0426107 | 3300049822 | Bacteria | 1101 |
| 744 | Ga0501044_0148202 | 3300049823 | Bacteria | 2330 |
| 745 | nmdc:mga03683_636914_c1 | 3300050489 | Bacteria | 524 |
| 746 | nmdc:mga03n38_271140_c1 | 3300050490 | Bacteria | 903 |
| 747 | nmdc:mga03n38_362321_c1 | 3300050490 | Bacteria | 791 |
| 748 | nmdc:mga0yw44_120592_c1 | 3300050492 | Bacteria | 1689 |
| 749 | nmdc:mga0yw44_836915_c1 | 3300050492 | Bacteria | 625 |
| 750 | nmdc:mga0k408_204570_c1 | 3300050493 | Bacteria | 1179 |
| 751 | nmdc:mga0k408_247506_c1 | 3300050493 | Bacteria | 1064 |
| 752 | nmdc:mga0k408_499_c1 | 3300050493 | Bacteria | 21537 |
| 753 | nmdc:mga0k408_696879_c1 | 3300050493 | Bacteria | 595 |
| 754 | nmdc:mga06z11_141014_c1 | 3300050494 | Bacteria | 1363 |
| 755 | nmdc:mga06z11_786384_c1 | 3300050494 | Bacteria | 580 |
| 756 | nmdc:mga06z11_80473_c1 | 3300050494 | Bacteria | 1747 |
| 757 | nmdc:mga07m45_173116_c1 | 3300050496 | Bacteria | 1255 |
| 758 | nmdc:mga07m45_334912_c1 | 3300050496 | Bacteria | 880 |
| 759 | nmdc:mga07m45_350480_c1 | 3300050496 | Bacteria | 858 |
| 760 | nmdc:mga07m45_815436_c1 | 3300050496 | Bacteria | 535 |
| 761 | nmdc:mga0qj67_1420538_c1 | 3300050509 | Bacteria | 535 |
| 762 | nmdc:mga0n895_1215228_c1 | 3300050512 | Bacteria | 727 |
| 763 | nmdc:mga0n895_153988_c1 | 3300050512 | Bacteria | 2329 |
| 764 | nmdc:mga0n895_17055_c1 | 3300050512 | Bacteria | 6685 |
| 765 | nmdc:mga0rr50_43438_c1 | 3300050513 | Bacteria | 3289 |
| 766 | nmdc:mga08x19_161790_c1 | 3300050514 | Bacteria | 1520 |
| 767 | nmdc:mga0sz30_221679_c1 | 3300050516 | Bacteria | 841 |
| 768 | Ga0500610_0128507 | 3300053079 | Bacteria | 1291 |
| 769 | Ga0500635_0402072 | 3300053080 | Bacteria | 542 |
| 770 | Ga0495655_0158853 | 3300053083 | Bacteria | 716 |
| 771 | Ga0495595_0016919 | 3300053084 | Bacteria | 3128 |
| 772 | Ga0495619_0069795 | 3300053085 | Bacteria | 2349 |
| 773 | Ga0495619_0264739 | 3300053085 | Bacteria | 1191 |
| 774 | Ga0495619_0600114 | 3300053085 | Bacteria | 753 |
| 775 | Ga0500578_0229904 | 3300053086 | Bacteria | 1124 |
| 776 | Ga0500644_0167886 | 3300053088 | Bacteria | 891 |
| 777 | Ga0500581_085689 | 3300053089 | Bacteria | 1567 |
| 778 | Ga0500646_0191392 | 3300053090 | Bacteria | 698 |
| 779 | Ga0500647_0038056 | 3300053091 | Bacteria | 2303 |
| 780 | Ga0500647_0147686 | 3300053091 | Bacteria | 1099 |
| 781 | Ga0500583_0539442 | 3300053092 | Bacteria | 543 |
| 782 | Ga0500566_0004243 | 3300053094 | Bacteria | 8554 |
| 783 | Ga0500566_0036998 | 3300053094 | Bacteria | 2829 |
| 784 | Ga0500640_040439 | 3300053095 | Bacteria | 2048 |
| 785 | Ga0500641_0008813 | 3300053096 | Bacteria | 3612 |
| 786 | Ga0500554_038573 | 3300053102 | Bacteria | 1454 |
| 787 | Ga0500572_009466 | 3300053111 | Bacteria | 2303 |
| 788 | Ga0500591_165143 | 3300053115 | Bacteria | 829 |
| 789 | Ga0500594_0211127 | 3300053118 | Bacteria | 640 |
| 790 | Ga0500595_000095 | 3300053119 | Bacteria | 61248 |
| 791 | Ga0500595_009153 | 3300053119 | Bacteria | 4010 |
| 792 | Ga0500595_049846 | 3300053119 | Bacteria | 1302 |
| 793 | Ga0500597_364476 | 3300053120 | Bacteria | 559 |
| 794 | Ga0500608_070689 | 3300053122 | Bacteria | 1659 |
| 795 | Ga0500614_008073 | 3300053123 | Bacteria | 2228 |
| 796 | Ga0500559_0000004 | 3300053136 | Bacteria | 241551 |
| 797 | Ga0500559_0070605 | 3300053136 | Bacteria | 1571 |
| 798 | Ga0500568_0086735 | 3300053139 | Bacteria | 1183 |
| 799 | Ga0500579_154803 | 3300053143 | Bacteria | 987 |
| 800 | Ga0500589_134743 | 3300053147 | Bacteria | 1026 |
| 801 | Ga0500590_144469 | 3300053148 | Bacteria | 1082 |
| 802 | Ga0500590_355162 | 3300053148 | Bacteria | 522 |
| 803 | Ga0500603_005139 | 3300053150 | Bacteria | 2806 |
| 804 | Ga0500603_113390 | 3300053150 | Bacteria | 816 |
| 805 | Ga0500603_181611 | 3300053150 | Bacteria | 662 |
| 806 | Ga0500603_293791 | 3300053150 | Bacteria | 526 |
| 807 | Ga0500619_130069 | 3300053154 | Bacteria | 858 |
| 808 | Ga0500627_0331777 | 3300053158 | Bacteria | 659 |
| 809 | Ga0500630_011616 | 3300053159 | Bacteria | 4335 |
| 810 | Ga0500634_0140940 | 3300053161 | Bacteria | 1142 |
| 811 | Ga0500638_010149 | 3300053162 | Bacteria | 4108 |
| 812 | Ga0500638_084844 | 3300053162 | Bacteria | 1499 |
| 813 | Ga0500638_134433 | 3300053162 | Bacteria | 1118 |
| 814 | Ga0500638_153205 | 3300053162 | Bacteria | 1023 |
| 815 | Ga0500638_319573 | 3300053162 | Bacteria | 590 |
| 816 | Ga0500639_060538 | 3300053163 | Bacteria | 1951 |
| 817 | Ga0500636_0022787 | 3300053177 | Bacteria | 3701 |
| 818 | Ga0500637_0002475 | 3300053178 | Bacteria | 8223 |
| 819 | Ga0500637_0118833 | 3300053178 | Bacteria | 1533 |
| 820 | Ga0500637_0128031 | 3300053178 | Bacteria | 1473 |
| 821 | Ga0500656_025197 | 3300053732 | Bacteria | 762 |
| 822 | Ga0500596_008711 | 3300053735 | Bacteria | 1610 |
| 823 | Ga0500587_042509 | 3300053739 | Bacteria | 655 |
| 824 | Ga0500661_000198 | 3300055283 | Bacteria | 10649 |
| 825 | Ga0500661_011296 | 3300055283 | Bacteria | 1616 |
| 826 | Ga0500661_042330 | 3300055283 | Bacteria | 807 |
| 827 | Ga0501082_1259566 | 3300060353 | Bacteria | 646 |
| 828 | Ga0466962_0047831 | 3300061719 | Bacteria | 2044 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006358 | Ga0068871_100178181 | Ga0068871_1001781812 | 111 |
| 2 | 3300046455 | Ga0495603_0322682 | Ga0495603_0322682_93_446 | 111 |
| 3 | 3300035086 | Ga0373934_0040090 | Ga0373934_0040090_1307_1657 | 116 |
| 4 | 3300035116 | Ga0373945_0013000 | Ga0373945_0013000_29_379 | 116 |
| 5 | 3300048918 | Ga0496115_0381190 | Ga0496115_0381190_561_911 | 116 |
| 6 | 3300049460 | Ga0495682_0248736 | Ga0495682_0248736_62_412 | 116 |
| 7 | 3300050509 | nmdc:mga0qj67_1420538_c1 | nmdc:mga0qj67_1420538_c1_172_522 | 116 |
| 8 | 3300042012 | Ga0439455_0087588 | Ga0439455_0087588_10_363 | 117 |
| 9 | 3300044706 | Ga0466964_0088611 | Ga0466964_0088611_20_373 | 117 |
| 10 | 3300046678 | Ga0495599_0327330 | Ga0495599_0327330_558_911 | 117 |
| 11 | iso_pu_bacteria | 2513237096 | 2513658730 | 117 |
| 12 | iso_pu_bacteria | 2513237101 | 2513693578 | 117 |
| 13 | iso_pu_bacteria | 2513237137 | 2513859934 | 117 |
| 14 | iso_pu_bacteria | 2513237145 | 2513920706 | 117 |
| 15 | iso_pu_bacteria | 2517572143 | 2517895127 | 117 |
| 16 | iso_pu_bacteria | 2524023228 | 2524540473 | 117 |
| 17 | iso_pu_bacteria | 2643221547 | 2643757436 | 117 |
| 18 | iso_pu_bacteria | 2667528175 | 2671123158 | 117 |
| 19 | iso_pu_bacteria | 2721755755 | 2723848465 | 117 |
| 20 | iso_pu_bacteria | 2791355197 | 2793073563 | 117 |
| 21 | iso_pu_bacteria | 2791355199 | 2793080950 | 117 |
| 22 | iso_pu_bacteria | 2874604998 | 2874609194 | 117 |
| 23 | iso_pu_bacteria | 2876808645 | 2876814837 | 117 |
| 24 | iso_pu_bacteria | 2879110137 | 2879119228 | 117 |
| 25 | iso_pu_bacteria | 2885374607 | 2885379755 | 117 |
| 26 | iso_pu_bacteria | 2889033259 | 2889036960 | 117 |
| 27 | iso_pu_bacteria | 2903748898 | 2903752928 | 117 |
| 28 | iso_pu_bacteria | 2904699407 | 2904700041 | 117 |
| 29 | iso_pu_bacteria | 2906610324 | 2906611791 | 117 |
| 30 | iso_pu_bacteria | 2906635258 | 2906636475 | 117 |
| 31 | iso_pu_bacteria | 2906660503 | 2906665617 | 117 |
| 32 | iso_pu_bacteria | 2908739725 | 2908745370 | 117 |
| 33 | iso_pu_bacteria | 2922361189 | 2922363645 | 117 |
| 34 | iso_pu_bacteria | 2922386360 | 2922392783 | 117 |
| 35 | iso_pu_bacteria | 2922425934 | 2922427563 | 117 |
| 36 | iso_pu_bacteria | 2935630451 | 2935637974 | 117 |
| 37 | iso_pu_bacteria | 2941507105 | 2941508426 | 117 |
| 38 | iso_pu_bacteria | 2941515067 | 2941515068 | 117 |
| 39 | iso_pu_bacteria | 2941523033 | 2941530505 | 117 |
| 40 | iso_pu_bacteria | 3005474847 | 3005477224 | 117 |
| 41 | iso_pu_bacteria | 8006933436 | 8006938433 | 117 |
| 42 | iso_pu_bacteria | 8006964411 | 8006972732 | 117 |
| 43 | iso_pu_bacteria | 8006973647 | 8006978505 | 117 |
| 44 | iso_pu_bacteria | 8006984368 | 8006988950 | 117 |
| 45 | iso_pu_bacteria | 8006994254 | 8006999592 | 117 |
| 46 | iso_pu_bacteria | 8019555841 | 8019559902 | 117 |
| 47 | iso_pu_bacteria | 8019565922 | 8019570006 | 117 |
| 48 | 3300003659 | JGI25404J52841_10128492 | JGI25404J52841_101284921 | 118 |
| 49 | 3300046455 | Ga0495603_0688781 | Ga0495603_0688781_11_373 | 120 |
| 50 | 3300005338 | Ga0068868_100676730 | Ga0068868_1006767301 | 121 |
| 51 | 3300005347 | Ga0070668_100005838 | Ga0070668_10000583812 | 121 |
| 52 | 3300005353 | Ga0070669_100714144 | Ga0070669_1007141441 | 121 |
| 53 | 3300005436 | Ga0070713_100049420 | Ga0070713_1000494204 | 121 |
| 54 | 3300005530 | Ga0070679_100142891 | Ga0070679_1001428912 | 121 |
| 55 | 3300005548 | Ga0070665_100455641 | Ga0070665_1004556412 | 121 |
| 56 | 3300005843 | Ga0068860_100080859 | Ga0068860_1000808592 | 121 |
| 57 | 3300006058 | Ga0075432_10051629 | Ga0075432_100516293 | 121 |
| 58 | 3300013104 | Ga0157370_10057300 | Ga0157370_100573003 | 121 |
| 59 | 3300014969 | Ga0157376_10784459 | Ga0157376_107844591 | 121 |
| 60 | 3300025917 | Ga0207660_10528026 | Ga0207660_105280262 | 121 |
| 61 | 3300025921 | Ga0207652_10222184 | Ga0207652_102221842 | 121 |
| 62 | 3300025923 | Ga0207681_10692043 | Ga0207681_106920432 | 121 |
| 63 | 3300025923 | Ga0207681_11303060 | Ga0207681_113030601 | 121 |
| 64 | 3300025925 | Ga0207650_10154836 | Ga0207650_101548363 | 121 |
| 65 | 3300025972 | Ga0207668_10004107 | Ga0207668_100041072 | 121 |
| 66 | 3300026023 | Ga0207677_10753590 | Ga0207677_107535901 | 121 |
| 67 | 3300026078 | Ga0207702_10371864 | Ga0207702_103718642 | 121 |
| 68 | 3300028379 | Ga0268266_10411948 | Ga0268266_104119482 | 121 |
| 69 | 3300028563 | Ga0265319_1041132 | Ga0265319_10411322 | 121 |
| 70 | 3300028577 | Ga0265318_10065798 | Ga0265318_100657982 | 121 |
| 71 | 3300031235 | Ga0265330_10169175 | Ga0265330_101691751 | 121 |
| 72 | 3300031239 | Ga0265328_10246206 | Ga0265328_102462061 | 121 |
| 73 | 3300031240 | Ga0265320_10247191 | Ga0265320_102471911 | 121 |
| 74 | 3300031250 | Ga0265331_10259238 | Ga0265331_102592381 | 121 |
| 75 | 3300031344 | Ga0265316_10431075 | Ga0265316_104310752 | 121 |
| 76 | 3300031649 | Ga0307514_10572985 | Ga0307514_105729851 | 121 |
| 77 | 3300031711 | Ga0265314_10683400 | Ga0265314_106834001 | 121 |
| 78 | 3300035086 | Ga0373934_0257226 | Ga0373934_0257226_99_464 | 121 |
| 79 | 3300035172 | Ga0373955_0846740 | Ga0373955_0846740_70_435 | 121 |
| 80 | 3300035724 | Ga0373933_0108416 | Ga0373933_0108416_585_950 | 121 |
| 81 | 3300036401 | Ga0373937_0603662 | Ga0373937_0603662_625_990 | 121 |
| 82 | 3300037418 | Ga0395900_0025072 | Ga0395900_0025072_3303_3683 | 121 |
| 83 | 3300037466 | Ga0395898_0012791 | Ga0395898_0012791_5859_6239 | 121 |
| 84 | 3300038443 | Ga0395901_0132945 | Ga0395901_0132945_1778_2158 | 121 |
| 85 | 3300039438 | Ga0436360_0017356 | Ga0436360_0017356_609_974 | 121 |
| 86 | 3300041453 | Ga0451797_0572757 | Ga0451797_0572757_57_425 | 121 |
| 87 | 3300042006 | Ga0439432_139395 | Ga0439432_139395_117_482 | 121 |
| 88 | 3300048909 | Ga0496106_0724942 | Ga0496106_0724942_314_679 | 121 |
| 89 | 3300049570 | Ga0501033_0344084 | Ga0501033_0344084_140_505 | 121 |
| 90 | 3300049581 | Ga0501047_0764241 | Ga0501047_0764241_71_436 | 121 |
| 91 | 3300049581 | Ga0501047_0773685 | Ga0501047_0773685_120_485 | 121 |
| 92 | 3300049822 | Ga0501035_0127547 | Ga0501035_0127547_1583_1948 | 121 |
| 93 | 3300049822 | Ga0501035_0426107 | Ga0501035_0426107_705_1070 | 121 |
| 94 | 3300050493 | nmdc:mga0k408_499_c1 | nmdc:mga0k408_499_c1_15533_15898 | 121 |
| 95 | 3300053136 | Ga0500559_0000004 | Ga0500559_0000004_83169_83534 | 121 |
| 96 | 3300053154 | Ga0500619_130069 | Ga0500619_130069_283_648 | 121 |
| 97 | 3300053162 | Ga0500638_319573 | Ga0500638_319573_85_450 | 121 |
| 98 | 3300031090 | Ga0265760_10072822 | Ga0265760_100728222 | 122 |
| 99 | 3300035086 | Ga0373934_0445073 | Ga0373934_0445073_132_500 | 122 |
| 100 | 3300009098 | Ga0105245_10524074 | Ga0105245_105240743 | 124 |
| 101 | 3300011119 | Ga0105246_11853801 | Ga0105246_118538012 | 124 |
| 102 | 3300046507 | Ga0495606_0342167 | Ga0495606_0342167_107_481 | 124 |
| 103 | 3300047447 | Ga0495685_209765 | Ga0495685_209765_236_610 | 124 |
| 104 | 3300048924 | Ga0496121_0228676 | Ga0496121_0228676_11_385 | 124 |
| 105 | 3300048929 | Ga0496126_0176114 | Ga0496126_0176114_383_757 | 124 |
| 106 | 3300003203 | JGI25406J46586_10103102 | JGI25406J46586_101031022 | 125 |
| 107 | 3300003659 | JGI25404J52841_10108630 | JGI25404J52841_101086301 | 125 |
| 108 | 3300003911 | JGI25405J52794_10153137 | JGI25405J52794_101531371 | 125 |
| 109 | 3300005548 | Ga0070665_100172998 | Ga0070665_1001729983 | 125 |
| 110 | 3300005937 | Ga0081455_10023586 | Ga0081455_100235862 | 125 |
| 111 | 3300005983 | Ga0081540_1004405 | Ga0081540_10044052 | 125 |
| 112 | 3300005983 | Ga0081540_1008466 | Ga0081540_10084663 | 125 |
| 113 | 3300005985 | Ga0081539_10005931 | Ga0081539_1000593110 | 125 |
| 114 | 3300005985 | Ga0081539_10420486 | Ga0081539_104204861 | 125 |
| 115 | 3300006871 | Ga0075434_100051150 | Ga0075434_1000511505 | 125 |
| 116 | 3300009176 | Ga0105242_13118723 | Ga0105242_131187231 | 125 |
| 117 | 3300026088 | Ga0207641_11248569 | Ga0207641_112485692 | 125 |
| 118 | 3300028379 | Ga0268266_10154742 | Ga0268266_101547423 | 125 |
| 119 | 3300031239 | Ga0265328_10049487 | Ga0265328_100494873 | 125 |
| 120 | 3300031241 | Ga0265325_10167524 | Ga0265325_101675242 | 125 |
| 121 | 3300031247 | Ga0265340_10008593 | Ga0265340_100085932 | 125 |
| 122 | 3300031250 | Ga0265331_10149683 | Ga0265331_101496832 | 125 |
| 123 | 3300031344 | Ga0265316_10360480 | Ga0265316_103604802 | 125 |
| 124 | 3300031711 | Ga0265314_10250371 | Ga0265314_102503712 | 125 |
| 125 | 3300031712 | Ga0265342_10073176 | Ga0265342_100731763 | 125 |
| 126 | 3300034820 | Ga0373959_0209730 | Ga0373959_0209730_46_423 | 125 |
| 127 | 3300035084 | Ga0373928_0217136 | Ga0373928_0217136_29_406 | 125 |
| 128 | 3300035112 | Ga0373932_0064837 | Ga0373932_0064837_700_1077 | 125 |
| 129 | 3300035691 | Ga0373931_0170280 | Ga0373931_0170280_323_700 | 125 |
| 130 | 3300035725 | Ga0373947_0289945 | Ga0373947_0289945_321_698 | 125 |
| 131 | 3300046460 | Ga0495638_0128217 | Ga0495638_0128217_684_1061 | 125 |
| 132 | 3300046475 | Ga0495639_0287775 | Ga0495639_0287775_363_740 | 125 |
| 133 | 3300046499 | Ga0495594_0210317 | Ga0495594_0210317_527_904 | 125 |
| 134 | 3300046507 | Ga0495606_0178813 | Ga0495606_0178813_705_1082 | 125 |
| 135 | 3300046513 | Ga0495616_0417079 | Ga0495616_0417079_151_528 | 125 |
| 136 | 3300046523 | Ga0495644_0219573 | Ga0495644_0219573_192_569 | 125 |
| 137 | 3300046557 | Ga0495622_0262568 | Ga0495622_0262568_57_434 | 125 |
| 138 | 3300046616 | Ga0495668_0112895 | Ga0495668_0112895_888_1265 | 125 |
| 139 | 3300046660 | Ga0495625_0210822 | Ga0495625_0210822_183_560 | 125 |
| 140 | 3300046681 | Ga0495647_0028193 | Ga0495647_0028193_1085_1462 | 125 |
| 141 | 3300046684 | Ga0495669_0566919 | Ga0495669_0566919_130_507 | 125 |
| 142 | 3300047472 | Ga0495686_0394922 | Ga0495686_0394922_70_447 | 125 |
| 143 | 3300048924 | Ga0496121_0006350 | Ga0496121_0006350_14117_14494 | 125 |
| 144 | 3300049583 | Ga0501067_0071756 | Ga0501067_0071756_556_933 | 125 |
| 145 | 3300049744 | Ga0501083_0932328 | Ga0501083_0932328_25_402 | 125 |
| 146 | 3300050512 | nmdc:mga0n895_1215228_c1 | nmdc:mga0n895_1215228_c1_11_388 | 125 |
| 147 | 3300050512 | nmdc:mga0n895_17055_c1 | nmdc:mga0n895_17055_c1_1768_2145 | 125 |
| 148 | 3300053119 | Ga0500595_049846 | Ga0500595_049846_203_580 | 125 |
| 149 | 3300053139 | Ga0500568_0086735 | Ga0500568_0086735_573_950 | 125 |
| 150 | 3300053158 | Ga0500627_0331777 | Ga0500627_0331777_234_611 | 125 |
| 151 | iso_pu_bacteria | 2513237094 | 2513642392 | 125 |
| 152 | iso_pu_bacteria | 2844315083 | 2844315718 | 125 |
| 153 | iso_pu_bacteria | 2849076700 | 2849083268 | 125 |
| 154 | iso_pu_bacteria | 2888388044 | 2888390447 | 125 |
| 155 | iso_pu_bacteria | 2903727486 | 2903730982 | 125 |
| 156 | iso_pu_bacteria | 2906602504 | 2906608462 | 125 |
| 157 | iso_pu_bacteria | 2932794094 | 2932800052 | 125 |
| 158 | iso_pu_bacteria | 2932801729 | 2932809061 | 125 |
| 159 | iso_pu_bacteria | 2935883170 | 2935888268 | 125 |
| 160 | iso_pu_bacteria | 2941531003 | 2941537938 | 125 |
| 161 | iso_pu_bacteria | 3005594810 | 3005595294 | 125 |
| 162 | iso_pu_bacteria | 3005718088 | 3005718543 | 125 |
| 163 | iso_pu_bacteria | 8019648815 | 8019652141 | 125 |
| 164 | iso_pu_bacteria | 8056689827 | 8056691880 | 125 |
| 165 | iso_pu_bacteria | 8056967851 | 8056975796 | 125 |
| 166 | 3300005578 | Ga0068854_100030068 | Ga0068854_1000300682 | 127 |
| 167 | 3300025949 | Ga0207667_11382584 | Ga0207667_113825842 | 127 |
| 168 | 3300025981 | Ga0207640_10014499 | Ga0207640_100144993 | 127 |
| 169 | 3300035089 | Ga0373944_0020571 | Ga0373944_0020571_1131_1568 | 127 |
| 170 | 3300035113 | Ga0373936_0009596 | Ga0373936_0009596_105_542 | 127 |
| 171 | 3300035118 | Ga0373954_0134840 | Ga0373954_0134840_493_930 | 127 |
| 172 | 3300035170 | Ga0373943_0206887 | Ga0373943_0206887_266_703 | 127 |
| 173 | 3300035172 | Ga0373955_0022100 | Ga0373955_0022100_2575_3012 | 127 |
| 174 | 3300035410 | Ga0373924_0008812 | Ga0373924_0008812_974_1411 | 127 |
| 175 | 3300035692 | Ga0373935_0027489 | Ga0373935_0027489_270_707 | 127 |
| 176 | 3300035695 | Ga0373927_0003207 | Ga0373927_0003207_1893_2330 | 127 |
| 177 | 3300035724 | Ga0373933_0870024 | Ga0373933_0870024_115_552 | 127 |
| 178 | 3300035725 | Ga0373947_0006026 | Ga0373947_0006026_278_715 | 127 |
| 179 | 3300036401 | Ga0373937_0040577 | Ga0373937_0040577_579_1016 | 127 |
| 180 | 3300037068 | Ga0373925_0088330 | Ga0373925_0088330_1644_2081 | 127 |
| 181 | 3300046454 | Ga0495592_0012750 | Ga0495592_0012750_5768_6205 | 127 |
| 182 | 3300046455 | Ga0495603_0000182 | Ga0495603_0000182_31721_32158 | 127 |
| 183 | 3300046459 | Ga0495629_0000314 | Ga0495629_0000314_23676_24113 | 127 |
| 184 | 3300046461 | Ga0495641_0001508 | Ga0495641_0001508_283_720 | 127 |
| 185 | 3300046462 | Ga0495651_0092239 | Ga0495651_0092239_1677_2114 | 127 |
| 186 | 3300046472 | Ga0495580_0002541 | Ga0495580_0002541_6012_6449 | 127 |
| 187 | 3300046473 | Ga0495582_0320625 | Ga0495582_0320625_176_613 | 127 |
| 188 | 3300046475 | Ga0495639_0006669 | Ga0495639_0006669_277_714 | 127 |
| 189 | 3300046476 | Ga0495662_0001470 | Ga0495662_0001470_11172_11609 | 127 |
| 190 | 3300046477 | Ga0495664_0290553 | Ga0495664_0290553_266_703 | 127 |
| 191 | 3300046499 | Ga0495594_0000302 | Ga0495594_0000302_353_790 | 127 |
| 192 | 3300046516 | Ga0495628_0014010 | Ga0495628_0014010_3003_3440 | 127 |
| 193 | 3300046517 | Ga0495630_0002415 | Ga0495630_0002415_9148_9585 | 127 |
| 194 | 3300046529 | Ga0495652_1065366 | Ga0495652_1065366_77_514 | 127 |
| 195 | 3300046531 | Ga0495665_0000619 | Ga0495665_0000619_17455_17838 | 127 |
| 196 | 3300046533 | Ga0495640_0000308 | Ga0495640_0000308_23870_24307 | 127 |
| 197 | 3300046557 | Ga0495622_0002921 | Ga0495622_0002921_295_732 | 127 |
| 198 | 3300046559 | Ga0495667_0004819 | Ga0495667_0004819_3229_3666 | 127 |
| 199 | 3300046642 | Ga0495634_0001483 | Ga0495634_0001483_20060_20497 | 127 |
| 200 | 3300046663 | Ga0495635_0230395 | Ga0495635_0230395_295_732 | 127 |
| 201 | 3300046674 | Ga0495588_0119439 | Ga0495588_0119439_658_1095 | 127 |
| 202 | 3300046680 | Ga0495646_0011359 | Ga0495646_0011359_4657_5094 | 127 |
| 203 | 3300046683 | Ga0495658_0000936 | Ga0495658_0000936_235_672 | 127 |
| 204 | 3300046690 | Ga0495624_0000810 | Ga0495624_0000810_275_712 | 127 |
| 205 | 3300047315 | Ga0495581_0000683 | Ga0495581_0000683_295_732 | 127 |
| 206 | 3300047319 | Ga0495674_0012056 | Ga0495674_0012056_7436_7873 | 127 |
| 207 | 3300047673 | Ga0495593_0000370 | Ga0495593_0000370_155_592 | 127 |
| 208 | 3300053085 | Ga0495619_0600114 | Ga0495619_0600114_167_604 | 127 |
| 209 | 3300005327 | Ga0070658_11093265 | Ga0070658_110932651 | 128 |
| 210 | 3300005336 | Ga0070680_100234704 | Ga0070680_1002347042 | 128 |
| 211 | 3300005458 | Ga0070681_10313362 | Ga0070681_103133622 | 128 |
| 212 | 3300005530 | Ga0070679_100032725 | Ga0070679_1000327252 | 128 |
| 213 | 3300005563 | Ga0068855_100027913 | Ga0068855_1000279136 | 128 |
| 214 | 3300005616 | Ga0068852_100400756 | Ga0068852_1004007562 | 128 |
| 215 | 3300007788 | Ga0099795_10023531 | Ga0099795_100235312 | 128 |
| 216 | 3300009093 | Ga0105240_10077665 | Ga0105240_100776652 | 128 |
| 217 | 3300009545 | Ga0105237_11349387 | Ga0105237_113493872 | 128 |
| 218 | 3300010159 | Ga0099796_10058069 | Ga0099796_100580692 | 128 |
| 219 | 3300010159 | Ga0099796_10065048 | Ga0099796_100650481 | 128 |
| 220 | 3300010159 | Ga0099796_10464715 | Ga0099796_104647152 | 128 |
| 221 | 3300013104 | Ga0157370_10363719 | Ga0157370_103637192 | 128 |
| 222 | 3300013297 | Ga0157378_10041263 | Ga0157378_100412632 | 128 |
| 223 | 3300025909 | Ga0207705_10038153 | Ga0207705_100381532 | 128 |
| 224 | 3300025912 | Ga0207707_10268715 | Ga0207707_102687152 | 128 |
| 225 | 3300025913 | Ga0207695_10043787 | Ga0207695_100437876 | 128 |
| 226 | 3300025917 | Ga0207660_10030604 | Ga0207660_100306043 | 128 |
| 227 | 3300025921 | Ga0207652_10580271 | Ga0207652_105802712 | 128 |
| 228 | 3300025924 | Ga0207694_11591969 | Ga0207694_115919691 | 128 |
| 229 | 3300025949 | Ga0207667_10015856 | Ga0207667_100158566 | 128 |
| 230 | 3300025986 | Ga0207658_10086653 | Ga0207658_100866535 | 128 |
| 231 | 3300026041 | Ga0207639_10474126 | Ga0207639_104741262 | 128 |
| 232 | 3300026078 | Ga0207702_11706555 | Ga0207702_117065551 | 128 |
| 233 | 3300028556 | Ga0265337_1003913 | Ga0265337_10039133 | 128 |
| 234 | 3300028558 | Ga0265326_10006121 | Ga0265326_100061214 | 128 |
| 235 | 3300028563 | Ga0265319_1015989 | Ga0265319_10159893 | 128 |
| 236 | 3300028573 | Ga0265334_10011650 | Ga0265334_100116502 | 128 |
| 237 | 3300028577 | Ga0265318_10011203 | Ga0265318_100112035 | 128 |
| 238 | 3300028653 | Ga0265323_10000706 | Ga0265323_1000070614 | 128 |
| 239 | 3300028654 | Ga0265322_10014719 | Ga0265322_100147192 | 128 |
| 240 | 3300028666 | Ga0265336_10000683 | Ga0265336_100006833 | 128 |
| 241 | 3300028800 | Ga0265338_10001041 | Ga0265338_1000104132 | 128 |
| 242 | 3300029957 | Ga0265324_10002208 | Ga0265324_100022088 | 128 |
| 243 | 3300031507 | Ga0307509_10728008 | Ga0307509_107280081 | 128 |
| 244 | 3300044656 | Ga0466969_0090592 | Ga0466969_0090592_696_1082 | 128 |
| 245 | 3300044684 | Ga0466966_0001471 | Ga0466966_0001471_13963_14349 | 128 |
| 246 | 3300044693 | Ga0466961_0004761 | Ga0466961_0004761_7994_8380 | 128 |
| 247 | 3300045049 | Ga0466959_0005681 | Ga0466959_0005681_8008_8394 | 128 |
| 248 | 3300045836 | Ga0466958_0052462 | Ga0466958_0052462_743_1129 | 128 |
| 249 | 3300046462 | Ga0495651_0019479 | Ga0495651_0019479_1671_2057 | 128 |
| 250 | 3300046477 | Ga0495664_0001204 | Ga0495664_0001204_5506_5892 | 128 |
| 251 | 3300046511 | Ga0495608_0108241 | Ga0495608_0108241_702_1088 | 128 |
| 252 | 3300046516 | Ga0495628_0061793 | Ga0495628_0061793_195_581 | 128 |
| 253 | 3300046517 | Ga0495630_0137068 | Ga0495630_0137068_223_609 | 128 |
| 254 | 3300046529 | Ga0495652_0006258 | Ga0495652_0006258_1961_2347 | 128 |
| 255 | 3300046533 | Ga0495640_0032685 | Ga0495640_0032685_1270_1656 | 128 |
| 256 | 3300046536 | Ga0495587_0030628 | Ga0495587_0030628_1401_1787 | 128 |
| 257 | 3300046543 | Ga0495645_0002277 | Ga0495645_0002277_9812_10198 | 128 |
| 258 | 3300046559 | Ga0495667_0139683 | Ga0495667_0139683_1009_1395 | 128 |
| 259 | 3300046675 | Ga0495657_0015079 | Ga0495657_0015079_5090_5476 | 128 |
| 260 | 3300046679 | Ga0495623_0042017 | Ga0495623_0042017_63_449 | 128 |
| 261 | 3300046689 | Ga0495613_0131395 | Ga0495613_0131395_158_544 | 128 |
| 262 | 3300046809 | Ga0495600_0072440 | Ga0495600_0072440_1425_1811 | 128 |
| 263 | 3300047317 | Ga0495604_0215880 | Ga0495604_0215880_748_1134 | 128 |
| 264 | 3300047319 | Ga0495674_0146672 | Ga0495674_0146672_156_542 | 128 |
| 265 | 3300047322 | Ga0495680_0010179 | Ga0495680_0010179_1803_2189 | 128 |
| 266 | 3300047444 | Ga0495675_0054237 | Ga0495675_0054237_73_459 | 128 |
| 267 | 3300047673 | Ga0495593_0468210 | Ga0495593_0468210_105_491 | 128 |
| 268 | 3300048088 | Ga0495602_0016617 | Ga0495602_0016617_6829_7215 | 128 |
| 269 | 3300048924 | Ga0496121_0276276 | Ga0496121_0276276_376_762 | 128 |
| 270 | 3300048929 | Ga0496126_0451711 | Ga0496126_0451711_38_424 | 128 |
| 271 | 3300049580 | Ga0501046_0293391 | Ga0501046_0293391_631_1017 | 128 |
| 272 | 3300049581 | Ga0501047_0326464 | Ga0501047_0326464_327_713 | 128 |
| 273 | 3300049586 | Ga0501070_0451380 | Ga0501070_0451380_181_567 | 128 |
| 274 | 3300049589 | Ga0501073_0023882 | Ga0501073_0023882_2871_3257 | 128 |
| 275 | 3300049742 | Ga0501080_0245707 | Ga0501080_0245707_135_521 | 128 |
| 276 | 3300049823 | Ga0501044_0148202 | Ga0501044_0148202_1809_2195 | 128 |
| 277 | 3300053084 | Ga0495595_0016919 | Ga0495595_0016919_2028_2414 | 128 |
| 278 | 2162886007 | SwRhRL2b_contig_1152838 | SwRhRL2b_0516.00007090 | 129 |
| 279 | 3300000546 | LJNas_1010822 | LJNas_10108222 | 129 |
| 280 | 3300002070 | JGI24750J21931_1031981 | JGI24750J21931_10319812 | 129 |
| 281 | 3300002070 | JGI24750J21931_1063118 | JGI24750J21931_10631182 | 129 |
| 282 | 3300003214 | JGI25165J46597_1006262 | JGI25165J46597_10062623 | 129 |
| 283 | 3300003215 | JGI25153J46596_10007332 | JGI25153J46596_100073327 | 129 |
| 284 | 3300003354 | JGI25160J50197_1004506 | JGI25160J50197_10045062 | 129 |
| 285 | 3300003354 | JGI25160J50197_1013881 | JGI25160J50197_10138812 | 129 |
| 286 | 3300003752 | Ga0055539_1004325 | Ga0055539_10043253 | 129 |
| 287 | 3300003759 | Ga0055525_1002098 | Ga0055525_10020982 | 129 |
| 288 | 3300003763 | Ga0055529_1026258 | Ga0055529_10262582 | 129 |
| 289 | 3300003911 | JGI25405J52794_10051980 | JGI25405J52794_100519802 | 129 |
| 290 | 3300005262 | Ga0065165_1038729 | Ga0065165_10387292 | 129 |
| 291 | 3300005262 | Ga0065165_1051290 | Ga0065165_10512902 | 129 |
| 292 | 3300005293 | Ga0065715_10959514 | Ga0065715_109595141 | 129 |
| 293 | 3300005295 | Ga0065707_10269492 | Ga0065707_102694922 | 129 |
| 294 | 3300005327 | Ga0070658_10991817 | Ga0070658_109918171 | 129 |
| 295 | 3300005328 | Ga0070676_10120250 | Ga0070676_101202503 | 129 |
| 296 | 3300005329 | Ga0070683_100516816 | Ga0070683_1005168162 | 129 |
| 297 | 3300005330 | Ga0070690_100383783 | Ga0070690_1003837832 | 129 |
| 298 | 3300005334 | Ga0068869_100581078 | Ga0068869_1005810782 | 129 |
| 299 | 3300005334 | Ga0068869_100657034 | Ga0068869_1006570342 | 129 |
| 300 | 3300005335 | Ga0070666_10288859 | Ga0070666_102888592 | 129 |
| 301 | 3300005335 | Ga0070666_11089799 | Ga0070666_110897992 | 129 |
| 302 | 3300005337 | Ga0070682_100489403 | Ga0070682_1004894032 | 129 |
| 303 | 3300005337 | Ga0070682_100539656 | Ga0070682_1005396562 | 129 |
| 304 | 3300005338 | Ga0068868_100413378 | Ga0068868_1004133782 | 129 |
| 305 | 3300005338 | Ga0068868_100745635 | Ga0068868_1007456352 | 129 |
| 306 | 3300005340 | Ga0070689_101098717 | Ga0070689_1010987171 | 129 |
| 307 | 3300005344 | Ga0070661_100201285 | Ga0070661_1002012852 | 129 |
| 308 | 3300005347 | Ga0070668_100133324 | Ga0070668_1001333243 | 129 |
| 309 | 3300005347 | Ga0070668_100403570 | Ga0070668_1004035702 | 129 |
| 310 | 3300005347 | Ga0070668_100526205 | Ga0070668_1005262052 | 129 |
| 311 | 3300005347 | Ga0070668_100624708 | Ga0070668_1006247082 | 129 |
| 312 | 3300005353 | Ga0070669_100244610 | Ga0070669_1002446102 | 129 |
| 313 | 3300005354 | Ga0070675_100926861 | Ga0070675_1009268612 | 129 |
| 314 | 3300005355 | Ga0070671_100477036 | Ga0070671_1004770362 | 129 |
| 315 | 3300005355 | Ga0070671_100591409 | Ga0070671_1005914092 | 129 |
| 316 | 3300005356 | Ga0070674_101084167 | Ga0070674_1010841671 | 129 |
| 317 | 3300005356 | Ga0070674_101226721 | Ga0070674_1012267212 | 129 |
| 318 | 3300005364 | Ga0070673_101423740 | Ga0070673_1014237401 | 129 |
| 319 | 3300005366 | Ga0070659_100261285 | Ga0070659_1002612852 | 129 |
| 320 | 3300005406 | Ga0070703_10318752 | Ga0070703_103187522 | 129 |
| 321 | 3300005438 | Ga0070701_10266289 | Ga0070701_102662892 | 129 |
| 322 | 3300005438 | Ga0070701_10960624 | Ga0070701_109606241 | 129 |
| 323 | 3300005440 | Ga0070705_100350181 | Ga0070705_1003501811 | 129 |
| 324 | 3300005441 | Ga0070700_100177552 | Ga0070700_1001775522 | 129 |
| 325 | 3300005444 | Ga0070694_100300012 | Ga0070694_1003000122 | 129 |
| 326 | 3300005455 | Ga0070663_100225406 | Ga0070663_1002254062 | 129 |
| 327 | 3300005455 | Ga0070663_100611876 | Ga0070663_1006118761 | 129 |
| 328 | 3300005456 | Ga0070678_100046211 | Ga0070678_1000462112 | 129 |
| 329 | 3300005456 | Ga0070678_100265017 | Ga0070678_1002650172 | 129 |
| 330 | 3300005456 | Ga0070678_101217841 | Ga0070678_1012178411 | 129 |
| 331 | 3300005457 | Ga0070662_100424429 | Ga0070662_1004244292 | 129 |
| 332 | 3300005458 | Ga0070681_10254456 | Ga0070681_102544563 | 129 |
| 333 | 3300005459 | Ga0068867_101193113 | Ga0068867_1011931131 | 129 |
| 334 | 3300005466 | Ga0070685_10090029 | Ga0070685_100900292 | 129 |
| 335 | 3300005467 | Ga0070706_100619142 | Ga0070706_1006191422 | 129 |
| 336 | 3300005468 | Ga0070707_101100749 | Ga0070707_1011007492 | 129 |
| 337 | 3300005471 | Ga0070698_100194297 | Ga0070698_1001942974 | 129 |
| 338 | 3300005471 | Ga0070698_100217995 | Ga0070698_1002179953 | 129 |
| 339 | 3300005518 | Ga0070699_100871003 | Ga0070699_1008710032 | 129 |
| 340 | 3300005530 | Ga0070679_100113377 | Ga0070679_1001133775 | 129 |
| 341 | 3300005539 | Ga0068853_100226396 | Ga0068853_1002263962 | 129 |
| 342 | 3300005539 | Ga0068853_100243890 | Ga0068853_1002438902 | 129 |
| 343 | 3300005539 | Ga0068853_100699799 | Ga0068853_1006997992 | 129 |
| 344 | 3300005539 | Ga0068853_101403140 | Ga0068853_1014031402 | 129 |
| 345 | 3300005543 | Ga0070672_101381990 | Ga0070672_1013819902 | 129 |
| 346 | 3300005544 | Ga0070686_100592194 | Ga0070686_1005921942 | 129 |
| 347 | 3300005545 | Ga0070695_100254615 | Ga0070695_1002546152 | 129 |
| 348 | 3300005546 | Ga0070696_100355490 | Ga0070696_1003554902 | 129 |
| 349 | 3300005547 | Ga0070693_100142838 | Ga0070693_1001428382 | 129 |
| 350 | 3300005547 | Ga0070693_100717490 | Ga0070693_1007174902 | 129 |
| 351 | 3300005548 | Ga0070665_100044008 | Ga0070665_1000440082 | 129 |
| 352 | 3300005548 | Ga0070665_100129065 | Ga0070665_1001290655 | 129 |
| 353 | 3300005548 | Ga0070665_100196283 | Ga0070665_1001962833 | 129 |
| 354 | 3300005548 | Ga0070665_100581668 | Ga0070665_1005816682 | 129 |
| 355 | 3300005548 | Ga0070665_101218717 | Ga0070665_1012187171 | 129 |
| 356 | 3300005549 | Ga0070704_100601501 | Ga0070704_1006015012 | 129 |
| 357 | 3300005563 | Ga0068855_100384951 | Ga0068855_1003849512 | 129 |
| 358 | 3300005563 | Ga0068855_100695465 | Ga0068855_1006954652 | 129 |
| 359 | 3300005563 | Ga0068855_101470103 | Ga0068855_1014701031 | 129 |
| 360 | 3300005578 | Ga0068854_101211080 | Ga0068854_1012110802 | 129 |
| 361 | 3300005614 | Ga0068856_100034134 | Ga0068856_1000341346 | 129 |
| 362 | 3300005616 | Ga0068852_100027518 | Ga0068852_1000275182 | 129 |
| 363 | 3300005616 | Ga0068852_100102155 | Ga0068852_1001021553 | 129 |
| 364 | 3300005616 | Ga0068852_100131914 | Ga0068852_1001319143 | 129 |
| 365 | 3300005616 | Ga0068852_100664039 | Ga0068852_1006640392 | 129 |
| 366 | 3300005617 | Ga0068859_100687116 | Ga0068859_1006871162 | 129 |
| 367 | 3300005618 | Ga0068864_100081294 | Ga0068864_1000812945 | 129 |
| 368 | 3300005718 | Ga0068866_10320746 | Ga0068866_103207462 | 129 |
| 369 | 3300005719 | Ga0068861_100444455 | Ga0068861_1004444552 | 129 |
| 370 | 3300005841 | Ga0068863_100295555 | Ga0068863_1002955552 | 129 |
| 371 | 3300005841 | Ga0068863_100301463 | Ga0068863_1003014633 | 129 |
| 372 | 3300005841 | Ga0068863_100420879 | Ga0068863_1004208792 | 129 |
| 373 | 3300005842 | Ga0068858_100061588 | Ga0068858_1000615882 | 129 |
| 374 | 3300005843 | Ga0068860_100293450 | Ga0068860_1002934502 | 129 |
| 375 | 3300005843 | Ga0068860_101351576 | Ga0068860_1013515762 | 129 |
| 376 | 3300005844 | Ga0068862_100216295 | Ga0068862_1002162952 | 129 |
| 377 | 3300005937 | Ga0081455_10004895 | Ga0081455_100048953 | 129 |
| 378 | 3300005937 | Ga0081455_10044688 | Ga0081455_100446883 | 129 |
| 379 | 3300005983 | Ga0081540_1015444 | Ga0081540_10154442 | 129 |
| 380 | 3300005983 | Ga0081540_1273944 | Ga0081540_12739441 | 129 |
| 381 | 3300006028 | Ga0070717_10321900 | Ga0070717_103219002 | 129 |
| 382 | 3300006028 | Ga0070717_10927631 | Ga0070717_109276312 | 129 |
| 383 | 3300006028 | Ga0070717_11291450 | Ga0070717_112914502 | 129 |
| 384 | 3300006038 | Ga0075365_10071356 | Ga0075365_100713563 | 129 |
| 385 | 3300006038 | Ga0075365_10178722 | Ga0075365_101787222 | 129 |
| 386 | 3300006042 | Ga0075368_10263162 | Ga0075368_102631622 | 129 |
| 387 | 3300006048 | Ga0075363_100026229 | Ga0075363_1000262292 | 129 |
| 388 | 3300006048 | Ga0075363_100309028 | Ga0075363_1003090282 | 129 |
| 389 | 3300006048 | Ga0075363_100477466 | Ga0075363_1004774661 | 129 |
| 390 | 3300006051 | Ga0075364_10182993 | Ga0075364_101829932 | 129 |
| 391 | 3300006051 | Ga0075364_11070387 | Ga0075364_110703871 | 129 |
| 392 | 3300006058 | Ga0075432_10501546 | Ga0075432_105015461 | 129 |
| 393 | 3300006177 | Ga0075362_10141081 | Ga0075362_101410812 | 129 |
| 394 | 3300006177 | Ga0075362_10408566 | Ga0075362_104085662 | 129 |
| 395 | 3300006178 | Ga0075367_10023304 | Ga0075367_100233043 | 129 |
| 396 | 3300006178 | Ga0075367_10179821 | Ga0075367_101798212 | 129 |
| 397 | 3300006178 | Ga0075367_10363027 | Ga0075367_103630272 | 129 |
| 398 | 3300006186 | Ga0075369_10223148 | Ga0075369_102231482 | 129 |
| 399 | 3300006186 | Ga0075369_10247410 | Ga0075369_102474102 | 129 |
| 400 | 3300006195 | Ga0075366_10383429 | Ga0075366_103834291 | 129 |
| 401 | 3300006195 | Ga0075366_10452268 | Ga0075366_104522682 | 129 |
| 402 | 3300006195 | Ga0075366_10722626 | Ga0075366_107226262 | 129 |
| 403 | 3300006237 | Ga0097621_100046159 | Ga0097621_1000461592 | 129 |
| 404 | 3300006237 | Ga0097621_100065762 | Ga0097621_1000657623 | 129 |
| 405 | 3300006237 | Ga0097621_100071933 | Ga0097621_1000719332 | 129 |
| 406 | 3300006237 | Ga0097621_100437270 | Ga0097621_1004372702 | 129 |
| 407 | 3300006237 | Ga0097621_100858331 | Ga0097621_1008583312 | 129 |
| 408 | 3300006353 | Ga0075370_10137868 | Ga0075370_101378682 | 129 |
| 409 | 3300006353 | Ga0075370_10197168 | Ga0075370_101971681 | 129 |
| 410 | 3300006353 | Ga0075370_10463754 | Ga0075370_104637541 | 129 |
| 411 | 3300006353 | Ga0075370_10552309 | Ga0075370_105523092 | 129 |
| 412 | 3300006358 | Ga0068871_100047551 | Ga0068871_1000475512 | 129 |
| 413 | 3300006844 | Ga0075428_102420772 | Ga0075428_1024207721 | 129 |
| 414 | 3300006880 | Ga0075429_100556047 | Ga0075429_1005560472 | 129 |
| 415 | 3300006914 | Ga0075436_100438727 | Ga0075436_1004387271 | 129 |
| 416 | 3300006931 | Ga0097620_100687110 | Ga0097620_1006871102 | 129 |
| 417 | 3300007076 | Ga0075435_100252215 | Ga0075435_1002522153 | 129 |
| 418 | 3300009092 | Ga0105250_10058226 | Ga0105250_100582262 | 129 |
| 419 | 3300009093 | Ga0105240_10095052 | Ga0105240_100950526 | 129 |
| 420 | 3300009093 | Ga0105240_10171844 | Ga0105240_101718442 | 129 |
| 421 | 3300009093 | Ga0105240_11015317 | Ga0105240_110153172 | 129 |
| 422 | 3300009094 | Ga0111539_10871624 | Ga0111539_108716242 | 129 |
| 423 | 3300009098 | Ga0105245_10031932 | Ga0105245_100319327 | 129 |
| 424 | 3300009098 | Ga0105245_10066139 | Ga0105245_100661395 | 129 |
| 425 | 3300009101 | Ga0105247_10156695 | Ga0105247_101566952 | 129 |
| 426 | 3300009101 | Ga0105247_10288705 | Ga0105247_102887052 | 129 |
| 427 | 3300009147 | Ga0114129_12185399 | Ga0114129_121853991 | 129 |
| 428 | 3300009148 | Ga0105243_10574308 | Ga0105243_105743082 | 129 |
| 429 | 3300009174 | Ga0105241_10087362 | Ga0105241_100873622 | 129 |
| 430 | 3300009174 | Ga0105241_10837477 | Ga0105241_108374772 | 129 |
| 431 | 3300009176 | Ga0105242_10626389 | Ga0105242_106263891 | 129 |
| 432 | 3300009177 | Ga0105248_10159915 | Ga0105248_101599152 | 129 |
| 433 | 3300009177 | Ga0105248_10483422 | Ga0105248_104834222 | 129 |
| 434 | 3300009545 | Ga0105237_10300641 | Ga0105237_103006413 | 129 |
| 435 | 3300009545 | Ga0105237_10531219 | Ga0105237_105312192 | 129 |
| 436 | 3300009545 | Ga0105237_11033735 | Ga0105237_110337352 | 129 |
| 437 | 3300009545 | Ga0105237_11287947 | Ga0105237_112879472 | 129 |
| 438 | 3300009545 | Ga0105237_11304403 | Ga0105237_113044031 | 129 |
| 439 | 3300009551 | Ga0105238_10060989 | Ga0105238_100609892 | 129 |
| 440 | 3300009551 | Ga0105238_10301875 | Ga0105238_103018753 | 129 |
| 441 | 3300009551 | Ga0105238_10582021 | Ga0105238_105820212 | 129 |
| 442 | 3300010375 | Ga0105239_10056885 | Ga0105239_100568851 | 129 |
| 443 | 3300010375 | Ga0105239_10356352 | Ga0105239_103563522 | 129 |
| 444 | 3300010375 | Ga0105239_10534925 | Ga0105239_105349252 | 129 |
| 445 | 3300010375 | Ga0105239_10886064 | Ga0105239_108860642 | 129 |
| 446 | 3300010375 | Ga0105239_10938201 | Ga0105239_109382012 | 129 |
| 447 | 3300010375 | Ga0105239_11644743 | Ga0105239_116447432 | 129 |
| 448 | 3300011119 | Ga0105246_10040750 | Ga0105246_100407505 | 129 |
| 449 | 3300012500 | Ga0157314_1004494 | Ga0157314_10044941 | 129 |
| 450 | 3300013104 | Ga0157370_10525003 | Ga0157370_105250032 | 129 |
| 451 | 3300013296 | Ga0157374_10116742 | Ga0157374_101167422 | 129 |
| 452 | 3300013297 | Ga0157378_10498718 | Ga0157378_104987182 | 129 |
| 453 | 3300013306 | Ga0163162_10590323 | Ga0163162_105903232 | 129 |
| 454 | 3300013306 | Ga0163162_11322535 | Ga0163162_113225352 | 129 |
| 455 | 3300013306 | Ga0163162_11832449 | Ga0163162_118324492 | 129 |
| 456 | 3300013307 | Ga0157372_11346533 | Ga0157372_113465332 | 129 |
| 457 | 3300013307 | Ga0157372_12269031 | Ga0157372_122690312 | 129 |
| 458 | 3300013308 | Ga0157375_10132487 | Ga0157375_101324875 | 129 |
| 459 | 3300013308 | Ga0157375_10343143 | Ga0157375_103431432 | 129 |
| 460 | 3300014325 | Ga0163163_10889207 | Ga0163163_108892072 | 129 |
| 461 | 3300014325 | Ga0163163_12434774 | Ga0163163_124347742 | 129 |
| 462 | 3300014326 | Ga0157380_10216361 | Ga0157380_102163613 | 129 |
| 463 | 3300014745 | Ga0157377_10135851 | Ga0157377_101358513 | 129 |
| 464 | 3300014968 | Ga0157379_10702120 | Ga0157379_107021202 | 129 |
| 465 | 3300021384 | Ga0213876_10020100 | Ga0213876_100201003 | 129 |
| 466 | 3300025230 | Ga0209563_100670 | Ga0209563_10067011 | 129 |
| 467 | 3300025253 | Ga0209677_102054 | Ga0209677_1020548 | 129 |
| 468 | 3300025253 | Ga0209677_107376 | Ga0209677_1073763 | 129 |
| 469 | 3300025254 | Ga0209148_1000874 | Ga0209148_100087417 | 129 |
| 470 | 3300025254 | Ga0209148_1025450 | Ga0209148_10254502 | 129 |
| 471 | 3300025261 | Ga0209233_1013039 | Ga0209233_10130393 | 129 |
| 472 | 3300025261 | Ga0209233_1025706 | Ga0209233_10257063 | 129 |
| 473 | 3300025272 | Ga0209455_1001536 | Ga0209455_10015369 | 129 |
| 474 | 3300025272 | Ga0209455_1003873 | Ga0209455_10038733 | 129 |
| 475 | 3300025272 | Ga0209455_1026679 | Ga0209455_10266792 | 129 |
| 476 | 3300025284 | Ga0209130_1007941 | Ga0209130_10079412 | 129 |
| 477 | 3300025284 | Ga0209130_1049575 | Ga0209130_10495752 | 129 |
| 478 | 3300025297 | Ga0209758_1007103 | Ga0209758_10071032 | 129 |
| 479 | 3300025297 | Ga0209758_1009747 | Ga0209758_10097477 | 129 |
| 480 | 3300025297 | Ga0209758_1022815 | Ga0209758_10228153 | 129 |
| 481 | 3300025297 | Ga0209758_1132869 | Ga0209758_11328692 | 129 |
| 482 | 3300025299 | Ga0209256_1032643 | Ga0209256_10326432 | 129 |
| 483 | 3300025302 | Ga0207426_1000704 | Ga0207426_10007047 | 129 |
| 484 | 3300025302 | Ga0207426_1001257 | Ga0207426_10012573 | 129 |
| 485 | 3300025302 | Ga0207426_1015711 | Ga0207426_10157112 | 129 |
| 486 | 3300025315 | Ga0207697_10057876 | Ga0207697_100578762 | 129 |
| 487 | 3300025315 | Ga0207697_10208950 | Ga0207697_102089501 | 129 |
| 488 | 3300025711 | Ga0207696_1049753 | Ga0207696_10497532 | 129 |
| 489 | 3300025885 | Ga0207653_10121759 | Ga0207653_101217592 | 129 |
| 490 | 3300025899 | Ga0207642_10291773 | Ga0207642_102917732 | 129 |
| 491 | 3300025901 | Ga0207688_10021647 | Ga0207688_100216476 | 129 |
| 492 | 3300025903 | Ga0207680_10546826 | Ga0207680_105468262 | 129 |
| 493 | 3300025904 | Ga0207647_10018041 | Ga0207647_100180412 | 129 |
| 494 | 3300025907 | Ga0207645_10048193 | Ga0207645_100481932 | 129 |
| 495 | 3300025907 | Ga0207645_10368505 | Ga0207645_103685052 | 129 |
| 496 | 3300025908 | Ga0207643_10065231 | Ga0207643_100652313 | 129 |
| 497 | 3300025909 | Ga0207705_10677885 | Ga0207705_106778852 | 129 |
| 498 | 3300025909 | Ga0207705_11525314 | Ga0207705_115253141 | 129 |
| 499 | 3300025910 | Ga0207684_10109894 | Ga0207684_101098942 | 129 |
| 500 | 3300025910 | Ga0207684_10205152 | Ga0207684_102051523 | 129 |
| 501 | 3300025911 | Ga0207654_10031015 | Ga0207654_100310153 | 129 |
| 502 | 3300025911 | Ga0207654_10083473 | Ga0207654_100834732 | 129 |
| 503 | 3300025911 | Ga0207654_10510284 | Ga0207654_105102841 | 129 |
| 504 | 3300025912 | Ga0207707_10001534 | Ga0207707_100015342 | 129 |
| 505 | 3300025913 | Ga0207695_10001156 | Ga0207695_100011562 | 129 |
| 506 | 3300025914 | Ga0207671_10050733 | Ga0207671_100507332 | 129 |
| 507 | 3300025914 | Ga0207671_10221960 | Ga0207671_102219602 | 129 |
| 508 | 3300025914 | Ga0207671_10834669 | Ga0207671_108346692 | 129 |
| 509 | 3300025914 | Ga0207671_10836483 | Ga0207671_108364831 | 129 |
| 510 | 3300025916 | Ga0207663_10757017 | Ga0207663_107570171 | 129 |
| 511 | 3300025920 | Ga0207649_10268498 | Ga0207649_102684982 | 129 |
| 512 | 3300025920 | Ga0207649_10397486 | Ga0207649_103974862 | 129 |
| 513 | 3300025920 | Ga0207649_10577321 | Ga0207649_105773211 | 129 |
| 514 | 3300025923 | Ga0207681_10126894 | Ga0207681_101268941 | 129 |
| 515 | 3300025923 | Ga0207681_10677493 | Ga0207681_106774932 | 129 |
| 516 | 3300025924 | Ga0207694_10181955 | Ga0207694_101819552 | 129 |
| 517 | 3300025924 | Ga0207694_10725944 | Ga0207694_107259442 | 129 |
| 518 | 3300025926 | Ga0207659_11109026 | Ga0207659_111090262 | 129 |
| 519 | 3300025927 | Ga0207687_10020017 | Ga0207687_100200173 | 129 |
| 520 | 3300025927 | Ga0207687_10273942 | Ga0207687_102739422 | 129 |
| 521 | 3300025931 | Ga0207644_10470208 | Ga0207644_104702082 | 129 |
| 522 | 3300025933 | Ga0207706_10270981 | Ga0207706_102709812 | 129 |
| 523 | 3300025935 | Ga0207709_10247442 | Ga0207709_102474423 | 129 |
| 524 | 3300025936 | Ga0207670_10680698 | Ga0207670_106806982 | 129 |
| 525 | 3300025937 | Ga0207669_10085987 | Ga0207669_100859873 | 129 |
| 526 | 3300025937 | Ga0207669_10105585 | Ga0207669_101055852 | 129 |
| 527 | 3300025939 | Ga0207665_10488229 | Ga0207665_104882291 | 129 |
| 528 | 3300025941 | Ga0207711_10307445 | Ga0207711_103074452 | 129 |
| 529 | 3300025941 | Ga0207711_10405652 | Ga0207711_104056522 | 129 |
| 530 | 3300025942 | Ga0207689_10860300 | Ga0207689_108603002 | 129 |
| 531 | 3300025942 | Ga0207689_10883512 | Ga0207689_108835122 | 129 |
| 532 | 3300025945 | Ga0207679_10155774 | Ga0207679_101557742 | 129 |
| 533 | 3300025949 | Ga0207667_10367000 | Ga0207667_103670002 | 129 |
| 534 | 3300025949 | Ga0207667_10652598 | Ga0207667_106525982 | 129 |
| 535 | 3300025949 | Ga0207667_10780641 | Ga0207667_107806412 | 129 |
| 536 | 3300025949 | Ga0207667_10923756 | Ga0207667_109237562 | 129 |
| 537 | 3300025961 | Ga0207712_10077095 | Ga0207712_100770952 | 129 |
| 538 | 3300025972 | Ga0207668_10546712 | Ga0207668_105467122 | 129 |
| 539 | 3300025981 | Ga0207640_10475476 | Ga0207640_104754762 | 129 |
| 540 | 3300025981 | Ga0207640_10511237 | Ga0207640_105112372 | 129 |
| 541 | 3300025981 | Ga0207640_10987197 | Ga0207640_109871972 | 129 |
| 542 | 3300025986 | Ga0207658_10354585 | Ga0207658_103545852 | 129 |
| 543 | 3300025986 | Ga0207658_10846949 | Ga0207658_108469492 | 129 |
| 544 | 3300026023 | Ga0207677_10038533 | Ga0207677_100385335 | 129 |
| 545 | 3300026023 | Ga0207677_10108262 | Ga0207677_101082622 | 129 |
| 546 | 3300026023 | Ga0207677_10837926 | Ga0207677_108379262 | 129 |
| 547 | 3300026035 | Ga0207703_10043372 | Ga0207703_100433726 | 129 |
| 548 | 3300026035 | Ga0207703_10391022 | Ga0207703_103910223 | 129 |
| 549 | 3300026041 | Ga0207639_10159766 | Ga0207639_101597663 | 129 |
| 550 | 3300026041 | Ga0207639_10253862 | Ga0207639_102538622 | 129 |
| 551 | 3300026041 | Ga0207639_10347931 | Ga0207639_103479312 | 129 |
| 552 | 3300026041 | Ga0207639_11266570 | Ga0207639_112665702 | 129 |
| 553 | 3300026067 | Ga0207678_10076141 | Ga0207678_100761415 | 129 |
| 554 | 3300026067 | Ga0207678_10084233 | Ga0207678_100842335 | 129 |
| 555 | 3300026075 | Ga0207708_10384321 | Ga0207708_103843212 | 129 |
| 556 | 3300026078 | Ga0207702_10508208 | Ga0207702_105082082 | 129 |
| 557 | 3300026078 | Ga0207702_10852814 | Ga0207702_108528142 | 129 |
| 558 | 3300026088 | Ga0207641_10317453 | Ga0207641_103174533 | 129 |
| 559 | 3300026088 | Ga0207641_10842593 | Ga0207641_108425932 | 129 |
| 560 | 3300026089 | Ga0207648_10231352 | Ga0207648_102313523 | 129 |
| 561 | 3300026089 | Ga0207648_10731481 | Ga0207648_107314812 | 129 |
| 562 | 3300026095 | Ga0207676_10321145 | Ga0207676_103211453 | 129 |
| 563 | 3300026116 | Ga0207674_10423992 | Ga0207674_104239921 | 129 |
| 564 | 3300026116 | Ga0207674_11134276 | Ga0207674_111342762 | 129 |
| 565 | 3300026118 | Ga0207675_100923058 | Ga0207675_1009230582 | 129 |
| 566 | 3300026121 | Ga0207683_10422865 | Ga0207683_104228652 | 129 |
| 567 | 3300026121 | Ga0207683_10623410 | Ga0207683_106234102 | 129 |
| 568 | 3300026121 | Ga0207683_10728616 | Ga0207683_107286162 | 129 |
| 569 | 3300026142 | Ga0207698_10101537 | Ga0207698_101015374 | 129 |
| 570 | 3300026142 | Ga0207698_10219781 | Ga0207698_102197812 | 129 |
| 571 | 3300026142 | Ga0207698_10662982 | Ga0207698_106629822 | 129 |
| 572 | 3300026142 | Ga0207698_11139783 | Ga0207698_111397832 | 129 |
| 573 | 3300028379 | Ga0268266_10009167 | Ga0268266_100091673 | 129 |
| 574 | 3300028379 | Ga0268266_10080191 | Ga0268266_100801913 | 129 |
| 575 | 3300028379 | Ga0268266_10095681 | Ga0268266_100956812 | 129 |
| 576 | 3300028379 | Ga0268266_11496613 | Ga0268266_114966132 | 129 |
| 577 | 3300028380 | Ga0268265_10215400 | Ga0268265_102154002 | 129 |
| 578 | 3300028380 | Ga0268265_12083401 | Ga0268265_120834012 | 129 |
| 579 | 3300028381 | Ga0268264_10284455 | Ga0268264_102844552 | 129 |
| 580 | 3300031507 | Ga0307509_10495966 | Ga0307509_104959662 | 129 |
| 581 | 3300031548 | Ga0307408_100432049 | Ga0307408_1004320492 | 129 |
| 582 | 3300031548 | Ga0307408_102224574 | Ga0307408_1022245741 | 129 |
| 583 | 3300031616 | Ga0307508_10044377 | Ga0307508_100443773 | 129 |
| 584 | 3300031616 | Ga0307508_10442515 | Ga0307508_104425152 | 129 |
| 585 | 3300031616 | Ga0307508_10818226 | Ga0307508_108182261 | 129 |
| 586 | 3300031711 | Ga0265314_10104078 | Ga0265314_101040783 | 129 |
| 587 | 3300031730 | Ga0307516_10073486 | Ga0307516_100734864 | 129 |
| 588 | 3300031824 | Ga0307413_10092912 | Ga0307413_100929123 | 129 |
| 589 | 3300031852 | Ga0307410_10139011 | Ga0307410_101390112 | 129 |
| 590 | 3300031852 | Ga0307410_10563169 | Ga0307410_105631692 | 129 |
| 591 | 3300031901 | Ga0307406_10063979 | Ga0307406_100639792 | 129 |
| 592 | 3300031911 | Ga0307412_10385066 | Ga0307412_103850662 | 129 |
| 593 | 3300031995 | Ga0307409_100171799 | Ga0307409_1001717991 | 129 |
| 594 | 3300032002 | Ga0307416_100798826 | Ga0307416_1007988262 | 129 |
| 595 | 3300032004 | Ga0307414_10124646 | Ga0307414_101246463 | 129 |
| 596 | 3300032005 | Ga0307411_10925951 | Ga0307411_109259512 | 129 |
| 597 | 3300032005 | Ga0307411_10970521 | Ga0307411_109705211 | 129 |
| 598 | 3300032005 | Ga0307411_11537263 | Ga0307411_115372631 | 129 |
| 599 | 3300032126 | Ga0307415_100258391 | Ga0307415_1002583912 | 129 |
| 600 | 3300032126 | Ga0307415_100501288 | Ga0307415_1005012882 | 129 |
| 601 | 3300033179 | Ga0307507_10632107 | Ga0307507_106321072 | 129 |
| 602 | 3300033180 | Ga0307510_10035129 | Ga0307510_100351297 | 129 |
| 603 | 3300033180 | Ga0307510_10058529 | Ga0307510_100585291 | 129 |
| 604 | 3300035089 | Ga0373944_0007533 | Ga0373944_0007533_2433_2822 | 129 |
| 605 | 3300035113 | Ga0373936_0008591 | Ga0373936_0008591_1356_1745 | 129 |
| 606 | 3300035113 | Ga0373936_0066832 | Ga0373936_0066832_855_1244 | 129 |
| 607 | 3300035114 | Ga0373939_0276586 | Ga0373939_0276586_66_455 | 129 |
| 608 | 3300035116 | Ga0373945_0014997 | Ga0373945_0014997_785_1174 | 129 |
| 609 | 3300035117 | Ga0373953_0125662 | Ga0373953_0125662_543_932 | 129 |
| 610 | 3300035118 | Ga0373954_0027517 | Ga0373954_0027517_863_1252 | 129 |
| 611 | 3300035119 | Ga0373956_0222439 | Ga0373956_0222439_16_405 | 129 |
| 612 | 3300035120 | Ga0373957_0407886 | Ga0373957_0407886_16_405 | 129 |
| 613 | 3300035170 | Ga0373943_0406589 | Ga0373943_0406589_165_554 | 129 |
| 614 | 3300035171 | Ga0373946_0049993 | Ga0373946_0049993_561_950 | 129 |
| 615 | 3300035171 | Ga0373946_0357119 | Ga0373946_0357119_233_622 | 129 |
| 616 | 3300035172 | Ga0373955_0042706 | Ga0373955_0042706_1814_2203 | 129 |
| 617 | 3300035410 | Ga0373924_0001609 | Ga0373924_0001609_3641_4030 | 129 |
| 618 | 3300035692 | Ga0373935_0039107 | Ga0373935_0039107_1283_1672 | 129 |
| 619 | 3300035692 | Ga0373935_0156729 | Ga0373935_0156729_850_1239 | 129 |
| 620 | 3300035695 | Ga0373927_0209706 | Ga0373927_0209706_233_622 | 129 |
| 621 | 3300035724 | Ga0373933_0007993 | Ga0373933_0007993_972_1361 | 129 |
| 622 | 3300035725 | Ga0373947_0026448 | Ga0373947_0026448_2015_2404 | 129 |
| 623 | 3300035725 | Ga0373947_0104432 | Ga0373947_0104432_817_1206 | 129 |
| 624 | 3300036401 | Ga0373937_0135256 | Ga0373937_0135256_972_1361 | 129 |
| 625 | 3300037068 | Ga0373925_0017296 | Ga0373925_0017296_2888_3277 | 129 |
| 626 | 3300037068 | Ga0373925_0024092 | Ga0373925_0024092_2065_2454 | 129 |
| 627 | 3300037068 | Ga0373925_0588595 | Ga0373925_0588595_356_745 | 129 |
| 628 | 3300037853 | Ga0436364_0425415 | Ga0436364_0425415_349_738 | 129 |
| 629 | 3300039437 | Ga0436365_0238184 | Ga0436365_0238184_248_637 | 129 |
| 630 | 3300039437 | Ga0436365_0420080 | Ga0436365_0420080_1066_1458 | 129 |
| 631 | 3300039437 | Ga0436365_0989203 | Ga0436365_0989203_3278_3670 | 129 |
| 632 | 3300041413 | Ga0439465_0037505 | Ga0439465_0037505_642_1031 | 129 |
| 633 | 3300041443 | Ga0451789_1007321 | Ga0451789_1007321_106_495 | 129 |
| 634 | 3300041443 | Ga0451789_1157944 | Ga0451789_1157944_38_430 | 129 |
| 635 | 3300041451 | Ga0451791_1090847 | Ga0451791_1090847_94_483 | 129 |
| 636 | 3300041452 | Ga0451793_0399535 | Ga0451793_0399535_43_432 | 129 |
| 637 | 3300041486 | Ga0451807_0338309 | Ga0451807_0338309_259_651 | 129 |
| 638 | 3300041997 | Ga0439431_0022287 | Ga0439431_0022287_231_620 | 129 |
| 639 | 3300042438 | Ga0439459_0006825 | Ga0439459_0006825_1090_1482 | 129 |
| 640 | 3300044658 | Ga0466972_0462459 | Ga0466972_0462459_92_481 | 129 |
| 641 | 3300044693 | Ga0466961_0728820 | Ga0466961_0728820_65_454 | 129 |
| 642 | 3300044694 | Ga0466963_0014602 | Ga0466963_0014602_1340_1729 | 129 |
| 643 | 3300044719 | Ga0466971_0092063 | Ga0466971_0092063_188_577 | 129 |
| 644 | 3300044719 | Ga0466971_0163200 | Ga0466971_0163200_509_901 | 129 |
| 645 | 3300044765 | Ga0466970_0312853 | Ga0466970_0312853_24_416 | 129 |
| 646 | 3300044765 | Ga0466970_0433921 | Ga0466970_0433921_91_483 | 129 |
| 647 | 3300044765 | Ga0466970_0527773 | Ga0466970_0527773_35_424 | 129 |
| 648 | 3300044842 | Ga0466957_0575120 | Ga0466957_0575120_267_659 | 129 |
| 649 | 3300045049 | Ga0466959_0234345 | Ga0466959_0234345_773_1165 | 129 |
| 650 | 3300045049 | Ga0466959_0355691 | Ga0466959_0355691_140_532 | 129 |
| 651 | 3300045976 | Ga0466967_0037023 | Ga0466967_0037023_791_1180 | 129 |
| 652 | 3300045976 | Ga0466967_0125936 | Ga0466967_0125936_1537_1929 | 129 |
| 653 | 3300045976 | Ga0466967_0674125 | Ga0466967_0674125_475_867 | 129 |
| 654 | 3300046452 | Ga0495617_015362 | Ga0495617_015362_749_1138 | 129 |
| 655 | 3300046452 | Ga0495617_202444 | Ga0495617_202444_166_555 | 129 |
| 656 | 3300046454 | Ga0495592_0086197 | Ga0495592_0086197_647_1036 | 129 |
| 657 | 3300046454 | Ga0495592_0261592 | Ga0495592_0261592_546_935 | 129 |
| 658 | 3300046455 | Ga0495603_0050821 | Ga0495603_0050821_1045_1434 | 129 |
| 659 | 3300046455 | Ga0495603_0102705 | Ga0495603_0102705_1162_1551 | 129 |
| 660 | 3300046455 | Ga0495603_0591647 | Ga0495603_0591647_79_468 | 129 |
| 661 | 3300046459 | Ga0495629_0006021 | Ga0495629_0006021_1349_1738 | 129 |
| 662 | 3300046459 | Ga0495629_0023701 | Ga0495629_0023701_3483_3872 | 129 |
| 663 | 3300046460 | Ga0495638_0037355 | Ga0495638_0037355_432_821 | 129 |
| 664 | 3300046461 | Ga0495641_0192463 | Ga0495641_0192463_21_410 | 129 |
| 665 | 3300046462 | Ga0495651_0014799 | Ga0495651_0014799_655_1044 | 129 |
| 666 | 3300046462 | Ga0495651_0054726 | Ga0495651_0054726_179_568 | 129 |
| 667 | 3300046463 | Ga0495653_0107423 | Ga0495653_0107423_274_663 | 129 |
| 668 | 3300046463 | Ga0495653_0300894 | Ga0495653_0300894_500_889 | 129 |
| 669 | 3300046472 | Ga0495580_0073929 | Ga0495580_0073929_177_566 | 129 |
| 670 | 3300046473 | Ga0495582_0003777 | Ga0495582_0003777_6626_7015 | 129 |
| 671 | 3300046475 | Ga0495639_0036657 | Ga0495639_0036657_1649_2038 | 129 |
| 672 | 3300046476 | Ga0495662_0016856 | Ga0495662_0016856_1964_2353 | 129 |
| 673 | 3300046476 | Ga0495662_0018098 | Ga0495662_0018098_841_1230 | 129 |
| 674 | 3300046477 | Ga0495664_0049429 | Ga0495664_0049429_2091_2480 | 129 |
| 675 | 3300046477 | Ga0495664_0129739 | Ga0495664_0129739_722_1111 | 129 |
| 676 | 3300046492 | Ga0495585_0042555 | Ga0495585_0042555_1898_2287 | 129 |
| 677 | 3300046492 | Ga0495585_0354516 | Ga0495585_0354516_227_616 | 129 |
| 678 | 3300046499 | Ga0495594_0229251 | Ga0495594_0229251_17_406 | 129 |
| 679 | 3300046501 | Ga0495607_0525337 | Ga0495607_0525337_17_406 | 129 |
| 680 | 3300046507 | Ga0495606_0053703 | Ga0495606_0053703_1718_2107 | 129 |
| 681 | 3300046511 | Ga0495608_0162783 | Ga0495608_0162783_841_1230 | 129 |
| 682 | 3300046513 | Ga0495616_0086251 | Ga0495616_0086251_223_612 | 129 |
| 683 | 3300046514 | Ga0495618_0008828 | Ga0495618_0008828_5537_5926 | 129 |
| 684 | 3300046514 | Ga0495618_0043480 | Ga0495618_0043480_1384_1773 | 129 |
| 685 | 3300046515 | Ga0495620_0123484 | Ga0495620_0123484_479_868 | 129 |
| 686 | 3300046516 | Ga0495628_0169991 | Ga0495628_0169991_241_630 | 129 |
| 687 | 3300046516 | Ga0495628_0310172 | Ga0495628_0310172_295_684 | 129 |
| 688 | 3300046518 | Ga0495631_0029165 | Ga0495631_0029165_1959_2348 | 129 |
| 689 | 3300046519 | Ga0495632_0030152 | Ga0495632_0030152_219_608 | 129 |
| 690 | 3300046520 | Ga0495637_0139389 | Ga0495637_0139389_301_690 | 129 |
| 691 | 3300046522 | Ga0495643_0287868 | Ga0495643_0287868_156_545 | 129 |
| 692 | 3300046524 | Ga0495648_0006267 | Ga0495648_0006267_8862_9251 | 129 |
| 693 | 3300046525 | Ga0495663_0024099 | Ga0495663_0024099_18_407 | 129 |
| 694 | 3300046525 | Ga0495663_0033542 | Ga0495663_0033542_452_841 | 129 |
| 695 | 3300046529 | Ga0495652_0755556 | Ga0495652_0755556_246_635 | 129 |
| 696 | 3300046530 | Ga0495654_0133352 | Ga0495654_0133352_677_1066 | 129 |
| 697 | 3300046531 | Ga0495665_0137733 | Ga0495665_0137733_142_531 | 129 |
| 698 | 3300046531 | Ga0495665_0627161 | Ga0495665_0627161_131_520 | 129 |
| 699 | 3300046533 | Ga0495640_0014432 | Ga0495640_0014432_1099_1488 | 129 |
| 700 | 3300046535 | Ga0495586_0026816 | Ga0495586_0026816_628_1017 | 129 |
| 701 | 3300046537 | Ga0495598_0009519 | Ga0495598_0009519_799_1188 | 129 |
| 702 | 3300046538 | Ga0495609_0069311 | Ga0495609_0069311_681_1070 | 129 |
| 703 | 3300046538 | Ga0495609_0147697 | Ga0495609_0147697_313_702 | 129 |
| 704 | 3300046539 | Ga0495621_0501872 | Ga0495621_0501872_99_488 | 129 |
| 705 | 3300046557 | Ga0495622_0013329 | Ga0495622_0013329_142_531 | 129 |
| 706 | 3300046557 | Ga0495622_0054035 | Ga0495622_0054035_277_666 | 129 |
| 707 | 3300046557 | Ga0495622_0114264 | Ga0495622_0114264_759_1148 | 129 |
| 708 | 3300046558 | Ga0495633_0093126 | Ga0495633_0093126_619_1008 | 129 |
| 709 | 3300046559 | Ga0495667_0166789 | Ga0495667_0166789_17_406 | 129 |
| 710 | 3300046559 | Ga0495667_0620530 | Ga0495667_0620530_126_515 | 129 |
| 711 | 3300046615 | Ga0495656_0066657 | Ga0495656_0066657_1012_1401 | 129 |
| 712 | 3300046616 | Ga0495668_0023015 | Ga0495668_0023015_2874_3263 | 129 |
| 713 | 3300046616 | Ga0495668_0404103 | Ga0495668_0404103_145_534 | 129 |
| 714 | 3300046642 | Ga0495634_0034146 | Ga0495634_0034146_232_621 | 129 |
| 715 | 3300046660 | Ga0495625_0203704 | Ga0495625_0203704_230_619 | 129 |
| 716 | 3300046660 | Ga0495625_0686204 | Ga0495625_0686204_72_461 | 129 |
| 717 | 3300046663 | Ga0495635_0038449 | Ga0495635_0038449_1221_1610 | 129 |
| 718 | 3300046663 | Ga0495635_0074254 | Ga0495635_0074254_1616_2005 | 129 |
| 719 | 3300046664 | Ga0495659_0068490 | Ga0495659_0068490_367_756 | 129 |
| 720 | 3300046665 | Ga0495661_0204820 | Ga0495661_0204820_515_904 | 129 |
| 721 | 3300046665 | Ga0495661_0205345 | Ga0495661_0205345_252_641 | 129 |
| 722 | 3300046665 | Ga0495661_0311856 | Ga0495661_0311856_165_554 | 129 |
| 723 | 3300046674 | Ga0495588_0182789 | Ga0495588_0182789_242_631 | 129 |
| 724 | 3300046675 | Ga0495657_0095578 | Ga0495657_0095578_1342_1731 | 129 |
| 725 | 3300046680 | Ga0495646_0029121 | Ga0495646_0029121_175_564 | 129 |
| 726 | 3300046680 | Ga0495646_0097496 | Ga0495646_0097496_242_631 | 129 |
| 727 | 3300046681 | Ga0495647_0019286 | Ga0495647_0019286_1443_1832 | 129 |
| 728 | 3300046683 | Ga0495658_0020828 | Ga0495658_0020828_3044_3433 | 129 |
| 729 | 3300046683 | Ga0495658_0739339 | Ga0495658_0739339_133_522 | 129 |
| 730 | 3300046684 | Ga0495669_0039321 | Ga0495669_0039321_1583_1972 | 129 |
| 731 | 3300046684 | Ga0495669_0324230 | Ga0495669_0324230_164_553 | 129 |
| 732 | 3300046689 | Ga0495613_0375342 | Ga0495613_0375342_142_531 | 129 |
| 733 | 3300046690 | Ga0495624_0177037 | Ga0495624_0177037_488_877 | 129 |
| 734 | 3300046690 | Ga0495624_0306856 | Ga0495624_0306856_163_552 | 129 |
| 735 | 3300046690 | Ga0495624_0510145 | Ga0495624_0510145_26_415 | 129 |
| 736 | 3300046691 | Ga0495670_0082982 | Ga0495670_0082982_1119_1508 | 129 |
| 737 | 3300046692 | Ga0495671_0064047 | Ga0495671_0064047_428_817 | 129 |
| 738 | 3300046692 | Ga0495671_0148277 | Ga0495671_0148277_296_685 | 129 |
| 739 | 3300046809 | Ga0495600_0011127 | Ga0495600_0011127_398_787 | 129 |
| 740 | 3300047315 | Ga0495581_0091563 | Ga0495581_0091563_31_420 | 129 |
| 741 | 3300047315 | Ga0495581_0649851 | Ga0495581_0649851_16_405 | 129 |
| 742 | 3300047318 | Ga0495636_0524273 | Ga0495636_0524273_128_517 | 129 |
| 743 | 3300047319 | Ga0495674_0677532 | Ga0495674_0677532_320_709 | 129 |
| 744 | 3300047320 | Ga0495672_0133343 | Ga0495672_0133343_149_538 | 129 |
| 745 | 3300047320 | Ga0495672_0172127 | Ga0495672_0172127_517_906 | 129 |
| 746 | 3300047321 | Ga0495676_0008153 | Ga0495676_0008153_6513_6902 | 129 |
| 747 | 3300047321 | Ga0495676_0347411 | Ga0495676_0347411_181_570 | 129 |
| 748 | 3300047321 | Ga0495676_0576727 | Ga0495676_0576727_124_513 | 129 |
| 749 | 3300047322 | Ga0495680_0166652 | Ga0495680_0166652_1125_1514 | 129 |
| 750 | 3300047322 | Ga0495680_0721149 | Ga0495680_0721149_95_484 | 129 |
| 751 | 3300047447 | Ga0495685_064697 | Ga0495685_064697_135_524 | 129 |
| 752 | 3300047469 | Ga0495673_0106682 | Ga0495673_0106682_666_1055 | 129 |
| 753 | 3300047470 | Ga0495681_0133666 | Ga0495681_0133666_220_609 | 129 |
| 754 | 3300047470 | Ga0495681_0150884 | Ga0495681_0150884_348_737 | 129 |
| 755 | 3300047471 | Ga0495684_0272730 | Ga0495684_0272730_693_1082 | 129 |
| 756 | 3300047472 | Ga0495686_0255772 | Ga0495686_0255772_376_765 | 129 |
| 757 | 3300047472 | Ga0495686_0268809 | Ga0495686_0268809_326_715 | 129 |
| 758 | 3300047472 | Ga0495686_0282218 | Ga0495686_0282218_105_494 | 129 |
| 759 | 3300047673 | Ga0495593_0062481 | Ga0495593_0062481_1332_1721 | 129 |
| 760 | 3300048088 | Ga0495602_0610482 | Ga0495602_0610482_184_573 | 129 |
| 761 | 3300048903 | Ga0496100_0251157 | Ga0496100_0251157_290_679 | 129 |
| 762 | 3300048903 | Ga0496100_0393953 | Ga0496100_0393953_92_484 | 129 |
| 763 | 3300048904 | Ga0496101_0533808 | Ga0496101_0533808_202_591 | 129 |
| 764 | 3300048904 | Ga0496101_1325825 | Ga0496101_1325825_45_434 | 129 |
| 765 | 3300048905 | Ga0496102_0234656 | Ga0496102_0234656_729_1118 | 129 |
| 766 | 3300048905 | Ga0496102_0636406 | Ga0496102_0636406_89_478 | 129 |
| 767 | 3300048905 | Ga0496102_1702229 | Ga0496102_1702229_17_406 | 129 |
| 768 | 3300048908 | Ga0496105_0063923 | Ga0496105_0063923_2458_2847 | 129 |
| 769 | 3300048911 | Ga0496108_0025132 | Ga0496108_0025132_2539_2928 | 129 |
| 770 | 3300048912 | Ga0496109_0308781 | Ga0496109_0308781_287_676 | 129 |
| 771 | 3300048912 | Ga0496109_0577146 | Ga0496109_0577146_147_536 | 129 |
| 772 | 3300048913 | Ga0496110_0286131 | Ga0496110_0286131_517_906 | 129 |
| 773 | 3300048915 | Ga0496112_0243501 | Ga0496112_0243501_871_1260 | 129 |
| 774 | 3300048915 | Ga0496112_0252013 | Ga0496112_0252013_1165_1554 | 129 |
| 775 | 3300048915 | Ga0496112_0526207 | Ga0496112_0526207_307_696 | 129 |
| 776 | 3300048916 | Ga0496113_0729959 | Ga0496113_0729959_28_417 | 129 |
| 777 | 3300048916 | Ga0496113_1040045 | Ga0496113_1040045_141_530 | 129 |
| 778 | 3300048918 | Ga0496115_0553680 | Ga0496115_0553680_256_645 | 129 |
| 779 | 3300048919 | Ga0496116_0285990 | Ga0496116_0285990_239_628 | 129 |
| 780 | 3300048920 | Ga0496117_0303195 | Ga0496117_0303195_139_528 | 129 |
| 781 | 3300048921 | Ga0496118_0011634 | Ga0496118_0011634_297_689 | 129 |
| 782 | 3300048921 | Ga0496118_0126147 | Ga0496118_0126147_145_534 | 129 |
| 783 | 3300048921 | Ga0496118_0261619 | Ga0496118_0261619_366_755 | 129 |
| 784 | 3300048922 | Ga0496119_0022207 | Ga0496119_0022207_323_712 | 129 |
| 785 | 3300048923 | Ga0496120_0085482 | Ga0496120_0085482_151_540 | 129 |
| 786 | 3300048923 | Ga0496120_0095207 | Ga0496120_0095207_881_1270 | 129 |
| 787 | 3300048924 | Ga0496121_0040352 | Ga0496121_0040352_163_552 | 129 |
| 788 | 3300048924 | Ga0496121_0054773 | Ga0496121_0054773_1323_1715 | 129 |
| 789 | 3300048924 | Ga0496121_0090891 | Ga0496121_0090891_424_816 | 129 |
| 790 | 3300048924 | Ga0496121_0132894 | Ga0496121_0132894_826_1215 | 129 |
| 791 | 3300048924 | Ga0496121_0150187 | Ga0496121_0150187_1125_1520 | 129 |
| 792 | 3300048924 | Ga0496121_0182598 | Ga0496121_0182598_614_1006 | 129 |
| 793 | 3300048924 | Ga0496121_0326255 | Ga0496121_0326255_513_902 | 129 |
| 794 | 3300048926 | Ga0496123_0348889 | Ga0496123_0348889_157_546 | 129 |
| 795 | 3300048927 | Ga0496124_0112193 | Ga0496124_0112193_1761_2150 | 129 |
| 796 | 3300048928 | Ga0496125_0102411 | Ga0496125_0102411_1537_1926 | 129 |
| 797 | 3300048928 | Ga0496125_0123949 | Ga0496125_0123949_602_994 | 129 |
| 798 | 3300048929 | Ga0496126_0159757 | Ga0496126_0159757_336_731 | 129 |
| 799 | 3300048929 | Ga0496126_0351956 | Ga0496126_0351956_291_680 | 129 |
| 800 | 3300048929 | Ga0496126_0429566 | Ga0496126_0429566_317_709 | 129 |
| 801 | 3300048929 | Ga0496126_0481152 | Ga0496126_0481152_385_774 | 129 |
| 802 | 3300048929 | Ga0496126_1338893 | Ga0496126_1338893_70_459 | 129 |
| 803 | 3300049459 | Ga0495678_042590 | Ga0495678_042590_145_534 | 129 |
| 804 | 3300049460 | Ga0495682_0066213 | Ga0495682_0066213_742_1131 | 129 |
| 805 | 3300049460 | Ga0495682_0120472 | Ga0495682_0120472_360_749 | 129 |
| 806 | 3300049591 | Ga0501075_0350138 | Ga0501075_0350138_499_891 | 129 |
| 807 | 3300049592 | Ga0501076_1004831 | Ga0501076_1004831_196_588 | 129 |
| 808 | 3300049743 | Ga0501081_0210315 | Ga0501081_0210315_535_927 | 129 |
| 809 | 3300050489 | nmdc:mga03683_636914_c1 | nmdc:mga03683_636914_c1_94_486 | 129 |
| 810 | 3300050490 | nmdc:mga03n38_271140_c1 | nmdc:mga03n38_271140_c1_424_813 | 129 |
| 811 | 3300050490 | nmdc:mga03n38_362321_c1 | nmdc:mga03n38_362321_c1_174_563 | 129 |
| 812 | 3300050492 | nmdc:mga0yw44_120592_c1 | nmdc:mga0yw44_120592_c1_838_1227 | 129 |
| 813 | 3300050492 | nmdc:mga0yw44_836915_c1 | nmdc:mga0yw44_836915_c1_40_429 | 129 |
| 814 | 3300050493 | nmdc:mga0k408_204570_c1 | nmdc:mga0k408_204570_c1_260_649 | 129 |
| 815 | 3300050493 | nmdc:mga0k408_247506_c1 | nmdc:mga0k408_247506_c1_182_571 | 129 |
| 816 | 3300050493 | nmdc:mga0k408_696879_c1 | nmdc:mga0k408_696879_c1_57_449 | 129 |
| 817 | 3300050494 | nmdc:mga06z11_141014_c1 | nmdc:mga06z11_141014_c1_680_1069 | 129 |
| 818 | 3300050494 | nmdc:mga06z11_786384_c1 | nmdc:mga06z11_786384_c1_113_505 | 129 |
| 819 | 3300050494 | nmdc:mga06z11_80473_c1 | nmdc:mga06z11_80473_c1_1224_1613 | 129 |
| 820 | 3300050496 | nmdc:mga07m45_173116_c1 | nmdc:mga07m45_173116_c1_248_637 | 129 |
| 821 | 3300050496 | nmdc:mga07m45_334912_c1 | nmdc:mga07m45_334912_c1_44_433 | 129 |
| 822 | 3300050496 | nmdc:mga07m45_350480_c1 | nmdc:mga07m45_350480_c1_321_710 | 129 |
| 823 | 3300050496 | nmdc:mga07m45_815436_c1 | nmdc:mga07m45_815436_c1_119_508 | 129 |
| 824 | 3300050512 | nmdc:mga0n895_153988_c1 | nmdc:mga0n895_153988_c1_165_554 | 129 |
| 825 | 3300050513 | nmdc:mga0rr50_43438_c1 | nmdc:mga0rr50_43438_c1_2411_2800 | 129 |
| 826 | 3300050514 | nmdc:mga08x19_161790_c1 | nmdc:mga08x19_161790_c1_821_1210 | 129 |
| 827 | 3300050516 | nmdc:mga0sz30_221679_c1 | nmdc:mga0sz30_221679_c1_242_631 | 129 |
| 828 | 3300053079 | Ga0500610_0128507 | Ga0500610_0128507_339_728 | 129 |
| 829 | 3300053080 | Ga0500635_0402072 | Ga0500635_0402072_39_428 | 129 |
| 830 | 3300053083 | Ga0495655_0158853 | Ga0495655_0158853_130_519 | 129 |
| 831 | 3300053085 | Ga0495619_0069795 | Ga0495619_0069795_411_800 | 129 |
| 832 | 3300053085 | Ga0495619_0264739 | Ga0495619_0264739_317_706 | 129 |
| 833 | 3300053086 | Ga0500578_0229904 | Ga0500578_0229904_128_517 | 129 |
| 834 | 3300053088 | Ga0500644_0167886 | Ga0500644_0167886_260_649 | 129 |
| 835 | 3300053089 | Ga0500581_085689 | Ga0500581_085689_890_1279 | 129 |
| 836 | 3300053090 | Ga0500646_0191392 | Ga0500646_0191392_67_456 | 129 |
| 837 | 3300053091 | Ga0500647_0038056 | Ga0500647_0038056_1781_2170 | 129 |
| 838 | 3300053091 | Ga0500647_0147686 | Ga0500647_0147686_401_790 | 129 |
| 839 | 3300053092 | Ga0500583_0539442 | Ga0500583_0539442_129_518 | 129 |
| 840 | 3300053094 | Ga0500566_0004243 | Ga0500566_0004243_7506_7895 | 129 |
| 841 | 3300053094 | Ga0500566_0036998 | Ga0500566_0036998_2359_2748 | 129 |
| 842 | 3300053095 | Ga0500640_040439 | Ga0500640_040439_398_787 | 129 |
| 843 | 3300053096 | Ga0500641_0008813 | Ga0500641_0008813_3044_3433 | 129 |
| 844 | 3300053102 | Ga0500554_038573 | Ga0500554_038573_1055_1444 | 129 |
| 845 | 3300053111 | Ga0500572_009466 | Ga0500572_009466_421_810 | 129 |
| 846 | 3300053115 | Ga0500591_165143 | Ga0500591_165143_238_627 | 129 |
| 847 | 3300053118 | Ga0500594_0211127 | Ga0500594_0211127_160_549 | 129 |
| 848 | 3300053119 | Ga0500595_000095 | Ga0500595_000095_60751_61140 | 129 |
| 849 | 3300053119 | Ga0500595_009153 | Ga0500595_009153_3169_3558 | 129 |
| 850 | 3300053120 | Ga0500597_364476 | Ga0500597_364476_156_545 | 129 |
| 851 | 3300053122 | Ga0500608_070689 | Ga0500608_070689_758_1147 | 129 |
| 852 | 3300053123 | Ga0500614_008073 | Ga0500614_008073_1721_2110 | 129 |
| 853 | 3300053136 | Ga0500559_0070605 | Ga0500559_0070605_338_727 | 129 |
| 854 | 3300053143 | Ga0500579_154803 | Ga0500579_154803_156_545 | 129 |
| 855 | 3300053147 | Ga0500589_134743 | Ga0500589_134743_132_521 | 129 |
| 856 | 3300053148 | Ga0500590_144469 | Ga0500590_144469_581_970 | 129 |
| 857 | 3300053148 | Ga0500590_355162 | Ga0500590_355162_116_505 | 129 |
| 858 | 3300053150 | Ga0500603_005139 | Ga0500603_005139_670_1059 | 129 |
| 859 | 3300053150 | Ga0500603_113390 | Ga0500603_113390_169_561 | 129 |
| 860 | 3300053150 | Ga0500603_181611 | Ga0500603_181611_226_615 | 129 |
| 861 | 3300053150 | Ga0500603_293791 | Ga0500603_293791_24_413 | 129 |
| 862 | 3300053159 | Ga0500630_011616 | Ga0500630_011616_2457_2846 | 129 |
| 863 | 3300053161 | Ga0500634_0140940 | Ga0500634_0140940_520_909 | 129 |
| 864 | 3300053162 | Ga0500638_010149 | Ga0500638_010149_1049_1438 | 129 |
| 865 | 3300053162 | Ga0500638_084844 | Ga0500638_084844_1012_1401 | 129 |
| 866 | 3300053162 | Ga0500638_134433 | Ga0500638_134433_383_772 | 129 |
| 867 | 3300053162 | Ga0500638_153205 | Ga0500638_153205_126_515 | 129 |
| 868 | 3300053163 | Ga0500639_060538 | Ga0500639_060538_1315_1704 | 129 |
| 869 | 3300053177 | Ga0500636_0022787 | Ga0500636_0022787_835_1227 | 129 |
| 870 | 3300053178 | Ga0500637_0002475 | Ga0500637_0002475_169_558 | 129 |
| 871 | 3300053178 | Ga0500637_0118833 | Ga0500637_0118833_172_561 | 129 |
| 872 | 3300053178 | Ga0500637_0128031 | Ga0500637_0128031_146_535 | 129 |
| 873 | 3300053732 | Ga0500656_025197 | Ga0500656_025197_238_627 | 129 |
| 874 | 3300053735 | Ga0500596_008711 | Ga0500596_008711_204_593 | 129 |
| 875 | 3300053739 | Ga0500587_042509 | Ga0500587_042509_11_400 | 129 |
| 876 | 3300055283 | Ga0500661_000198 | Ga0500661_000198_175_564 | 129 |
| 877 | 3300055283 | Ga0500661_011296 | Ga0500661_011296_143_532 | 129 |
| 878 | 3300055283 | Ga0500661_042330 | Ga0500661_042330_144_533 | 129 |
| 879 | 3300060353 | Ga0501082_1259566 | Ga0501082_1259566_226_618 | 129 |
| 880 | 3300061719 | Ga0466962_0047831 | Ga0466962_0047831_1637_2029 | 129 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hnq-assembly1.cif.gz_A | crystal structure of the mutant q97a of vibrio cholerae chey3 | 0.9607 | 2 | 118 |
| 4lx8-assembly1.cif.gz_A | crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae | 0.9601 | 2 | 118 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9575 | 2 | 118 |
| 1ab6-assembly2.cif.gz_B | structure of chey mutant f14n, v86t | 0.9574 | 1 | 118 |
| 3to5-assembly1.cif.gz_A | high resolution structure of chey3 from vibrio cholerae | 0.9572 | 2 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9613 | 2 | 82 | 3.40.50.2300 |
| af_P0DMC5_826_949_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9576 | 3 | 117 | 3.40.50.2300 |
| 4ja2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9563 | 1 | 118 | 3.40.50.2300 |
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9546 | 1 | 117 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.954 | 1 | 80 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I4V297-F1-model_v4 | Response regulator | 0.9994 | 1 | 121 |
GO:0000160
|
| AF-A0A1R4GLZ8-F1-model_v4 | Chemotaxis regulator-transmits chemoreceptor signals to flagelllar motor components CheY | 0.9955 | 2 | 122 |
GO:0000160
|
| AF-A0A3C0FW44-F1-model_v4 | Response regulator | 0.9943 | 1 | 121 |
GO:0000160
|
| AF-A0A5B8S863-F1-model_v4 | Response regulator | 0.9942 | 1 | 121 |
GO:0000160
|
| AF-A0A837C750-F1-model_v4 | Putative chemotaxis response regulator | 0.9936 | 1 | 124 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar