F484490

General Info

Members Datasets Scaffolds Average Seq Length
880 490 828 128

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0020571|Ga0373944_0020571_1131_1568
Length 145
Sequence MPPSLYCVRNVTVGEDSQMKTCLVVDDSSVIRKIARRILEDMGFRVVEAEDGEQALEFCKRTLPEAVLLDWNMPVMDGYDFLSNLRRLPGGEEPKVVFCTTENNIDHIARAMHGGANEYIMKPFDKDIVTAKFQEVGLIEFGEPA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
9 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
10 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
11 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
12 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
13 2791355199
14 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
15 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
16 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
17 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
18 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
19 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
20 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
21 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
22 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
23 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
24 2904699407
25 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
26 2906610324
27 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
28 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
29 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
30 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
31 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
32 2922425934
33 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
34 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
35 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
36 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
37 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
38 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
39 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
40 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
41 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
42 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
43 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
44 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
45 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
46 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
50 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
52 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
53 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
54 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
65 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
66 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
67 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
79 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
80 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
81 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
88 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
89 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
90 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
91 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
92 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
95 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
96 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
97 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
98 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
103 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
104 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
107 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
117 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
118 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
119 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
122 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
123 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
124 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
125 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
136 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
164 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
228 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
229 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
230 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
231 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
232 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
233 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
234 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
235 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
236 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
237 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
239 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
240 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
241 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
242 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
243 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
248 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
249 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
250 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
251 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
259 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
260 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
261 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
264 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
265 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
266 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
267 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
268 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
270 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
271 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
272 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
273 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
274 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
275 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
276 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
277 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
278 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
283 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
289 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
290 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
291 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
292 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
293 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
294 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
295 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
296 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
297 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
298 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
299 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
300 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
301 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
302 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
303 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
304 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
307 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
308 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
315 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
316 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
317 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
318 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
319 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
320 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
321 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
324 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
325 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
326 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
327 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
328 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
329 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
330 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
333 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
334 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
337 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
338 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
339 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
340 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
341 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
342 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
343 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
344 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
345 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
346 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
347 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
348 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
349 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
350 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
351 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
352 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
353 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
354 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
355 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
356 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
357 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
358 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
359 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
362 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
363 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
364 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
365 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
366 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
367 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
368 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
369 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
370 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
371 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
372 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
373 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
374 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
375 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
376 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
377 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
378 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
379 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
380 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
381 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
382 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
383 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
384 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
385 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
386 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
387 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
388 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
389 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
390 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
391 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
392 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
393 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
394 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
395 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
396 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
397 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
398 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
399 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
400 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
401 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
402 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
403 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
404 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
405 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
406 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
407 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
408 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
409 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
410 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
411 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
412 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
413 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
414 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
415 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
419 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
420 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
421 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
422 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
423 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
424 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
425 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
426 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
428 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
429 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
432 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
433 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
434 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
435 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
436 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
437 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
438 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
439 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
440 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
441 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
442 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
443 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
444 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
445 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
446 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
447 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
448 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
449 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
450 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
451 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
452 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
453 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
454 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
455 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
456 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
457 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
458 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
459 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
460 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
461 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
462 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
463 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
464 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
465 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
466 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
467 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
468 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
469 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
470 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
471 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
472 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
473 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
474 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
475 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
476 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
477 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
478 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
479 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
480 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
481 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
482 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
483 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
484 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
485 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
486 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
487 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
488 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
489 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
490 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.41
Metatranscriptomes 0.11
Isolates 5.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.86
Nodule 3.98
Rhizoplane 3.07
Rhizosphere 72.27
Stem 0
Stem Tuber 0
Unclassified 6.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1152838 2162886007 Bacteria 808
2 LJNas_1010822 3300000546 Bacteria 973
3 JGI24750J21931_1031981 3300002070 Bacteria 775
4 JGI24750J21931_1063118 3300002070 Bacteria 595
5 JGI25406J46586_10103102 3300003203 Bacteria 849
6 JGI25165J46597_1006262 3300003214 Bacteria 2132
7 JGI25153J46596_10007332 3300003215 Bacteria 5444
8 JGI25160J50197_1004506 3300003354 Bacteria 6015
9 JGI25160J50197_1013881 3300003354 Bacteria 2722
10 JGI25404J52841_10108630 3300003659 Bacteria 583
11 JGI25404J52841_10128492 3300003659 Bacteria 535
12 Ga0055539_1004325 3300003752 Bacteria 1895
13 Ga0055525_1002098 3300003759 Bacteria 2330
14 Ga0055529_1026258 3300003763 Bacteria 719
15 JGI25405J52794_10051980 3300003911 Bacteria 879
16 JGI25405J52794_10153137 3300003911 Bacteria 526
17 Ga0065165_1038729 3300005262 Bacteria 1434
18 Ga0065165_1051290 3300005262 Bacteria 1170
19 Ga0065715_10959514 3300005293 Bacteria 557
20 Ga0065707_10269492 3300005295 Bacteria 1075
21 Ga0070658_10991817 3300005327 Bacteria 731
22 Ga0070658_11093265 3300005327 Bacteria 693
23 Ga0070676_10120250 3300005328 Bacteria 1647
24 Ga0070683_100516816 3300005329 Bacteria 1141
25 Ga0070690_100383783 3300005330 Bacteria 1028
26 Ga0068869_100581078 3300005334 Bacteria 944
27 Ga0068869_100657034 3300005334 Bacteria 890
28 Ga0070666_10288859 3300005335 Bacteria 1166
29 Ga0070666_11089799 3300005335 Bacteria 594
30 Ga0070680_100234704 3300005336 Bacteria 1549
31 Ga0070682_100489403 3300005337 Bacteria 951
32 Ga0070682_100539656 3300005337 Bacteria 911
33 Ga0068868_100413378 3300005338 Bacteria 1166
34 Ga0068868_100676730 3300005338 Bacteria 921
35 Ga0068868_100745635 3300005338 Bacteria 879
36 Ga0070689_101098717 3300005340 Bacteria 711
37 Ga0070661_100201285 3300005344 Bacteria 1522
38 Ga0070668_100005838 3300005347 Bacteria 9127
39 Ga0070668_100133324 3300005347 Bacteria 1995
40 Ga0070668_100403570 3300005347 Bacteria 1167
41 Ga0070668_100526205 3300005347 Bacteria 1026
42 Ga0070668_100624708 3300005347 Bacteria 944
43 Ga0070669_100244610 3300005353 Bacteria 1426
44 Ga0070669_100714144 3300005353 Bacteria 847
45 Ga0070675_100926861 3300005354 Bacteria 799
46 Ga0070671_100477036 3300005355 Bacteria 1071
47 Ga0070671_100591409 3300005355 Bacteria 959
48 Ga0070674_101084167 3300005356 Bacteria 707
49 Ga0070674_101226721 3300005356 Bacteria 667
50 Ga0070673_101423740 3300005364 Bacteria 653
51 Ga0070659_100261285 3300005366 Bacteria 1436
52 Ga0070703_10318752 3300005406 Bacteria 654
53 Ga0070713_100049420 3300005436 Bacteria 3469
54 Ga0070701_10266289 3300005438 Bacteria 1041
55 Ga0070701_10960624 3300005438 Bacteria 594
56 Ga0070705_100350181 3300005440 Bacteria 1077
57 Ga0070700_100177552 3300005441 Bacteria 1479
58 Ga0070694_100300012 3300005444 Bacteria 1231
59 Ga0070663_100225406 3300005455 Bacteria 1473
60 Ga0070663_100611876 3300005455 Bacteria 917
61 Ga0070678_100046211 3300005456 Bacteria 3120
62 Ga0070678_100265017 3300005456 Bacteria 1447
63 Ga0070678_101217841 3300005456 Bacteria 698
64 Ga0070662_100424429 3300005457 Bacteria 1100
65 Ga0070681_10254456 3300005458 Bacteria 1668
66 Ga0070681_10313362 3300005458 Bacteria 1478
67 Ga0068867_101193113 3300005459 Bacteria 699
68 Ga0070685_10090029 3300005466 Bacteria 1855
69 Ga0070706_100619142 3300005467 Bacteria 1005
70 Ga0070707_101100749 3300005468 Bacteria 760
71 Ga0070698_100194297 3300005471 Bacteria 1966
72 Ga0070698_100217995 3300005471 Bacteria 1842
73 Ga0070699_100871003 3300005518 Bacteria 825
74 Ga0070679_100032725 3300005530 Bacteria 5145
75 Ga0070679_100113377 3300005530 Bacteria 2696
76 Ga0070679_100142891 3300005530 Bacteria 2372
77 Ga0068853_100226396 3300005539 Bacteria 1709
78 Ga0068853_100243890 3300005539 Bacteria 1647
79 Ga0068853_100699799 3300005539 Bacteria 966
80 Ga0068853_101403140 3300005539 Bacteria 676
81 Ga0070672_101381990 3300005543 Bacteria 630
82 Ga0070686_100592194 3300005544 Bacteria 873
83 Ga0070695_100254615 3300005545 Bacteria 1279
84 Ga0070696_100355490 3300005546 Bacteria 1135
85 Ga0070693_100142838 3300005547 Bacteria 1508
86 Ga0070693_100717490 3300005547 Bacteria 734
87 Ga0070665_100044008 3300005548 Bacteria 4484
88 Ga0070665_100129065 3300005548 Bacteria 2530
89 Ga0070665_100172998 3300005548 Bacteria 2160
90 Ga0070665_100196283 3300005548 Bacteria 2019
91 Ga0070665_100455641 3300005548 Bacteria 1289
92 Ga0070665_100581668 3300005548 Bacteria 1133
93 Ga0070665_101218717 3300005548 Unclassified 763
94 Ga0070704_100601501 3300005549 Bacteria 966
95 Ga0068855_100027913 3300005563 Bacteria 6751
96 Ga0068855_100384951 3300005563 Bacteria 1539
97 Ga0068855_100695465 3300005563 Bacteria 1088
98 Ga0068855_101470103 3300005563 Bacteria 700
99 Ga0068854_100030068 3300005578 Bacteria 3765
100 Ga0068854_101211080 3300005578 Bacteria 677
101 Ga0068856_100034134 3300005614 Bacteria 4984
102 Ga0068852_100027518 3300005616 Bacteria 4634
103 Ga0068852_100102155 3300005616 Bacteria 2590
104 Ga0068852_100131914 3300005616 Bacteria 2302
105 Ga0068852_100400756 3300005616 Bacteria 1350
106 Ga0068852_100664039 3300005616 Bacteria 1051
107 Ga0068859_100687116 3300005617 Bacteria 1114
108 Ga0068864_100081294 3300005618 Bacteria 2840
109 Ga0068866_10320746 3300005718 Bacteria 974
110 Ga0068861_100444455 3300005719 Bacteria 1160
111 Ga0068863_100295555 3300005841 Bacteria 1570
112 Ga0068863_100301463 3300005841 Bacteria 1554
113 Ga0068863_100420879 3300005841 Bacteria 1308
114 Ga0068858_100061588 3300005842 Bacteria 3469
115 Ga0068860_100080859 3300005843 Bacteria 3090
116 Ga0068860_100293450 3300005843 Bacteria 1591
117 Ga0068860_101351576 3300005843 Bacteria 733
118 Ga0068862_100216295 3300005844 Bacteria 1733
119 Ga0081455_10004895 3300005937 Bacteria 14842
120 Ga0081455_10023586 3300005937 Bacteria 5723
121 Ga0081455_10044688 3300005937 Bacteria 3861
122 Ga0081540_1004405 3300005983 Bacteria 10757
123 Ga0081540_1008466 3300005983 Bacteria 7183
124 Ga0081540_1015444 3300005983 Bacteria 4836
125 Ga0081540_1273944 3300005983 Bacteria 583
126 Ga0081539_10005931 3300005985 Bacteria 12064
127 Ga0081539_10420486 3300005985 Bacteria 555
128 Ga0070717_10321900 3300006028 Bacteria 1378
129 Ga0070717_10927631 3300006028 Bacteria 793
130 Ga0070717_11291450 3300006028 Bacteria 664
131 Ga0075365_10071356 3300006038 Bacteria 2338
132 Ga0075365_10178722 3300006038 Bacteria 1483
133 Ga0075368_10263162 3300006042 Bacteria 739
134 Ga0075363_100026229 3300006048 Bacteria 2979
135 Ga0075363_100309028 3300006048 Bacteria 918
136 Ga0075363_100477466 3300006048 Bacteria 739
137 Ga0075364_10182993 3300006051 Bacteria 1418
138 Ga0075364_11070387 3300006051 Bacteria 548
139 Ga0075432_10051629 3300006058 Bacteria 1451
140 Ga0075432_10501546 3300006058 Bacteria 541
141 Ga0075362_10141081 3300006177 Bacteria 1151
142 Ga0075362_10408566 3300006177 Bacteria 685
143 Ga0075367_10023304 3300006178 Bacteria 3482
144 Ga0075367_10179821 3300006178 Bacteria 1318
145 Ga0075367_10363027 3300006178 Bacteria 914
146 Ga0075369_10223148 3300006186 Bacteria 872
147 Ga0075369_10247410 3300006186 Bacteria 828
148 Ga0075366_10383429 3300006195 Bacteria 864
149 Ga0075366_10452268 3300006195 Bacteria 792
150 Ga0075366_10722626 3300006195 Bacteria 619
151 Ga0097621_100046159 3300006237 Bacteria 3523
152 Ga0097621_100065762 3300006237 Bacteria 2985
153 Ga0097621_100071933 3300006237 Bacteria 2859
154 Ga0097621_100437270 3300006237 Bacteria 1177
155 Ga0097621_100858331 3300006237 Bacteria 844
156 Ga0075370_10137868 3300006353 Bacteria 1426
157 Ga0075370_10197168 3300006353 Bacteria 1187
158 Ga0075370_10463754 3300006353 Bacteria 763
159 Ga0075370_10552309 3300006353 Bacteria 696
160 Ga0068871_100047551 3300006358 Bacteria 3460
161 Ga0068871_100178181 3300006358 Bacteria 1825
162 Ga0075428_102420772 3300006844 Bacteria 539
163 Ga0075434_100051150 3300006871 Bacteria 4105
164 Ga0075429_100556047 3300006880 Bacteria 1006
165 Ga0075436_100438727 3300006914 Bacteria 950
166 Ga0097620_100687110 3300006931 Bacteria 1114
167 Ga0075435_100252215 3300007076 Bacteria 1502
168 Ga0099795_10023531 3300007788 Bacteria 2045
169 Ga0105250_10058226 3300009092 Bacteria 1551
170 Ga0105240_10077665 3300009093 Bacteria 4090
171 Ga0105240_10095052 3300009093 Bacteria 3634
172 Ga0105240_10171844 3300009093 Bacteria 2566
173 Ga0105240_11015317 3300009093 Bacteria 886
174 Ga0111539_10871624 3300009094 Bacteria 1047
175 Ga0105245_10031932 3300009098 Bacteria 4661
176 Ga0105245_10066139 3300009098 Bacteria 3271
177 Ga0105245_10524074 3300009098 Bacteria 1204
178 Ga0105247_10156695 3300009101 Bacteria 1505
179 Ga0105247_10288705 3300009101 Bacteria 1134
180 Ga0114129_12185399 3300009147 Bacteria 666
181 Ga0105243_10574308 3300009148 Bacteria 1081
182 Ga0105241_10087362 3300009174 Bacteria 2454
183 Ga0105241_10837477 3300009174 Bacteria 850
184 Ga0105242_10626389 3300009176 Bacteria 1043
185 Ga0105242_13118723 3300009176 Bacteria 514
186 Ga0105248_10159915 3300009177 Bacteria 2541
187 Ga0105248_10483422 3300009177 Bacteria 1396
188 Ga0105237_10300641 3300009545 Bacteria 1608
189 Ga0105237_10531219 3300009545 Bacteria 1183
190 Ga0105237_11033735 3300009545 Bacteria 828
191 Ga0105237_11287947 3300009545 Bacteria 737
192 Ga0105237_11304403 3300009545 Bacteria 732
193 Ga0105237_11349387 3300009545 Bacteria 719
194 Ga0105238_10060989 3300009551 Bacteria 3775
195 Ga0105238_10301875 3300009551 Bacteria 1585
196 Ga0105238_10582021 3300009551 Bacteria 1126
197 Ga0099796_10058069 3300010159 Bacteria 1363
198 Ga0099796_10065048 3300010159 Bacteria 1303
199 Ga0099796_10464715 3300010159 Bacteria 564
200 Ga0105239_10056885 3300010375 Bacteria 4289
201 Ga0105239_10356352 3300010375 Bacteria 1652
202 Ga0105239_10534925 3300010375 Bacteria 1334
203 Ga0105239_10886064 3300010375 Bacteria 1024
204 Ga0105239_10938201 3300010375 Bacteria 994
205 Ga0105239_11644743 3300010375 Bacteria 743
206 Ga0105246_10040750 3300011119 Bacteria 3136
207 Ga0105246_11853801 3300011119 Bacteria 578
208 Ga0157314_1004494 3300012500 Bacteria 1028
209 Ga0157370_10057300 3300013104 Bacteria 3705
210 Ga0157370_10363719 3300013104 Bacteria 1333
211 Ga0157370_10525003 3300013104 Bacteria 1086
212 Ga0157374_10116742 3300013296 Bacteria 2572
213 Ga0157378_10041263 3300013297 Bacteria 4093
214 Ga0157378_10498718 3300013297 Bacteria 1216
215 Ga0163162_10590323 3300013306 Bacteria 1237
216 Ga0163162_11322535 3300013306 Bacteria 819
217 Ga0163162_11832449 3300013306 Bacteria 694
218 Ga0157372_11346533 3300013307 Bacteria 823
219 Ga0157372_12269031 3300013307 Bacteria 623
220 Ga0157375_10132487 3300013308 Bacteria 2613
221 Ga0157375_10343143 3300013308 Bacteria 1659
222 Ga0163163_10889207 3300014325 Bacteria 954
223 Ga0163163_12434774 3300014325 Bacteria 582
224 Ga0157380_10216361 3300014326 Bacteria 1711
225 Ga0157377_10135851 3300014745 Bacteria 1507
226 Ga0157379_10702120 3300014968 Bacteria 949
227 Ga0157376_10784459 3300014969 Bacteria 964
228 Ga0213876_10020100 3300021384 Bacteria 3529
229 Ga0209563_100670 3300025230 Bacteria 10845
230 Ga0209677_102054 3300025253 Bacteria 7958
231 Ga0209677_107376 3300025253 Bacteria 2351
232 Ga0209148_1000874 3300025254 Bacteria 20915
233 Ga0209148_1025450 3300025254 Bacteria 926
234 Ga0209233_1013039 3300025261 Bacteria 2387
235 Ga0209233_1025706 3300025261 Bacteria 1452
236 Ga0209455_1001536 3300025272 Bacteria 10290
237 Ga0209455_1003873 3300025272 Bacteria 5107
238 Ga0209455_1026679 3300025272 Bacteria 1033
239 Ga0209130_1007941 3300025284 Bacteria 3199
240 Ga0209130_1049575 3300025284 Bacteria 770
241 Ga0209758_1007103 3300025297 Bacteria 7753
242 Ga0209758_1009747 3300025297 Bacteria 5898
243 Ga0209758_1022815 3300025297 Bacteria 2853
244 Ga0209758_1132869 3300025297 Bacteria 656
245 Ga0209256_1032643 3300025299 Bacteria 1410
246 Ga0207426_1000704 3300025302 Bacteria 39583
247 Ga0207426_1001257 3300025302 Bacteria 22136
248 Ga0207426_1015711 3300025302 Bacteria 2739
249 Ga0207697_10057876 3300025315 Bacteria 1609
250 Ga0207697_10208950 3300025315 Bacteria 860
251 Ga0207696_1049753 3300025711 Bacteria 1201
252 Ga0207653_10121759 3300025885 Bacteria 940
253 Ga0207642_10291773 3300025899 Bacteria 942
254 Ga0207688_10021647 3300025901 Bacteria 3516
255 Ga0207680_10546826 3300025903 Bacteria 826
256 Ga0207647_10018041 3300025904 Bacteria 4784
257 Ga0207645_10048193 3300025907 Bacteria 2720
258 Ga0207645_10368505 3300025907 Bacteria 963
259 Ga0207643_10065231 3300025908 Bacteria 2085
260 Ga0207705_10038153 3300025909 Bacteria 3439
261 Ga0207705_10677885 3300025909 Bacteria 802
262 Ga0207705_11525314 3300025909 Bacteria 505
263 Ga0207684_10109894 3300025910 Bacteria 2360
264 Ga0207684_10205152 3300025910 Bacteria 1701
265 Ga0207654_10031015 3300025911 Bacteria 2941
266 Ga0207654_10083473 3300025911 Bacteria 1929
267 Ga0207654_10510284 3300025911 Bacteria 850
268 Ga0207707_10001534 3300025912 Bacteria 21320
269 Ga0207707_10268715 3300025912 Bacteria 1478
270 Ga0207695_10001156 3300025913 Bacteria 45753
271 Ga0207695_10043787 3300025913 Bacteria 4766
272 Ga0207671_10050733 3300025914 Bacteria 3072
273 Ga0207671_10221960 3300025914 Bacteria 1481
274 Ga0207671_10834669 3300025914 Bacteria 730
275 Ga0207671_10836483 3300025914 Bacteria 729
276 Ga0207663_10757017 3300025916 Bacteria 772
277 Ga0207660_10030604 3300025917 Bacteria 3701
278 Ga0207660_10528026 3300025917 Bacteria 959
279 Ga0207649_10268498 3300025920 Bacteria 1236
280 Ga0207649_10397486 3300025920 Bacteria 1031
281 Ga0207649_10577321 3300025920 Bacteria 863
282 Ga0207652_10222184 3300025921 Bacteria 1702
283 Ga0207652_10580271 3300025921 Bacteria 1006
284 Ga0207681_10126894 3300025923 Bacteria 1880
285 Ga0207681_10677493 3300025923 Bacteria 856
286 Ga0207681_10692043 3300025923 Bacteria 847
287 Ga0207681_11303060 3300025923 Bacteria 610
288 Ga0207694_10181955 3300025924 Bacteria 1705
289 Ga0207694_10725944 3300025924 Bacteria 838
290 Ga0207694_11591969 3300025924 Bacteria 551
291 Ga0207650_10154836 3300025925 Bacteria 1812
292 Ga0207659_11109026 3300025926 Bacteria 681
293 Ga0207687_10020017 3300025927 Bacteria 4438
294 Ga0207687_10273942 3300025927 Bacteria 1350
295 Ga0207644_10470208 3300025931 Bacteria 1034
296 Ga0207706_10270981 3300025933 Bacteria 1481
297 Ga0207709_10247442 3300025935 Bacteria 1300
298 Ga0207670_10680698 3300025936 Bacteria 850
299 Ga0207669_10085987 3300025937 Bacteria 2032
300 Ga0207669_10105585 3300025937 Bacteria 1874
301 Ga0207665_10488229 3300025939 Bacteria 950
302 Ga0207711_10307445 3300025941 Bacteria 1463
303 Ga0207711_10405652 3300025941 Bacteria 1267
304 Ga0207689_10860300 3300025942 Bacteria 765
305 Ga0207689_10883512 3300025942 Bacteria 754
306 Ga0207679_10155774 3300025945 Bacteria 1865
307 Ga0207667_10015856 3300025949 Bacteria 8539
308 Ga0207667_10367000 3300025949 Bacteria 1468
309 Ga0207667_10652598 3300025949 Bacteria 1058
310 Ga0207667_10780641 3300025949 Bacteria 953
311 Ga0207667_10923756 3300025949 Bacteria 863
312 Ga0207667_11382584 3300025949 Bacteria 678
313 Ga0207712_10077095 3300025961 Bacteria 2415
314 Ga0207668_10004107 3300025972 Bacteria 8550
315 Ga0207668_10546712 3300025972 Bacteria 1002
316 Ga0207640_10014499 3300025981 Bacteria 4540
317 Ga0207640_10475476 3300025981 Bacteria 1035
318 Ga0207640_10511237 3300025981 Bacteria 1002
319 Ga0207640_10987197 3300025981 Bacteria 740
320 Ga0207658_10086653 3300025986 Bacteria 2416
321 Ga0207658_10354585 3300025986 Bacteria 1278
322 Ga0207658_10846949 3300025986 Bacteria 831
323 Ga0207677_10038533 3300026023 Bacteria 3135
324 Ga0207677_10108262 3300026023 Bacteria 2063
325 Ga0207677_10753590 3300026023 Bacteria 868
326 Ga0207677_10837926 3300026023 Bacteria 825
327 Ga0207703_10043372 3300026035 Bacteria 3611
328 Ga0207703_10391022 3300026035 Bacteria 1288
329 Ga0207639_10159766 3300026041 Bacteria 1898
330 Ga0207639_10253862 3300026041 Bacteria 1535
331 Ga0207639_10347931 3300026041 Bacteria 1323
332 Ga0207639_10474126 3300026041 Bacteria 1140
333 Ga0207639_11266570 3300026041 Bacteria 692
334 Ga0207678_10076141 3300026067 Bacteria 2874
335 Ga0207678_10084233 3300026067 Bacteria 2719
336 Ga0207708_10384321 3300026075 Bacteria 1158
337 Ga0207702_10371864 3300026078 Bacteria 1372
338 Ga0207702_10508208 3300026078 Bacteria 1175
339 Ga0207702_10852814 3300026078 Bacteria 902
340 Ga0207702_11706555 3300026078 Bacteria 622
341 Ga0207641_10317453 3300026088 Bacteria 1476
342 Ga0207641_10842593 3300026088 Bacteria 908
343 Ga0207641_11248569 3300026088 Bacteria 743
344 Ga0207648_10231352 3300026089 Bacteria 1644
345 Ga0207648_10731481 3300026089 Bacteria 918
346 Ga0207676_10321145 3300026095 Bacteria 1421
347 Ga0207674_10423992 3300026116 Bacteria 1286
348 Ga0207674_11134276 3300026116 Bacteria 751
349 Ga0207675_100923058 3300026118 Bacteria 890
350 Ga0207683_10422865 3300026121 Bacteria 1227
351 Ga0207683_10623410 3300026121 Bacteria 999
352 Ga0207683_10728616 3300026121 Bacteria 920
353 Ga0207698_10101537 3300026142 Bacteria 2386
354 Ga0207698_10219781 3300026142 Bacteria 1716
355 Ga0207698_10662982 3300026142 Bacteria 1035
356 Ga0207698_11139783 3300026142 Bacteria 793
357 Ga0268266_10009167 3300028379 Bacteria 8734
358 Ga0268266_10080191 3300028379 Bacteria 2843
359 Ga0268266_10095681 3300028379 Bacteria 2608
360 Ga0268266_10154742 3300028379 Bacteria 2070
361 Ga0268266_10411948 3300028379 Bacteria 1280
362 Ga0268266_11496613 3300028379 Bacteria 650
363 Ga0268265_10215400 3300028380 Bacteria 1676
364 Ga0268265_12083401 3300028380 Bacteria 574
365 Ga0268264_10284455 3300028381 Bacteria 1550
366 Ga0265337_1003913 3300028556 Bacteria 6308
367 Ga0265326_10006121 3300028558 Bacteria 3755
368 Ga0265319_1015989 3300028563 Bacteria 2885
369 Ga0265319_1041132 3300028563 Bacteria 1561
370 Ga0265334_10011650 3300028573 Bacteria 3697
371 Ga0265318_10011203 3300028577 Bacteria 3873
372 Ga0265318_10065798 3300028577 Bacteria 1348
373 Ga0265323_10000706 3300028653 Bacteria 18167
374 Ga0265322_10014719 3300028654 Bacteria 2261
375 Ga0265336_10000683 3300028666 Bacteria 18322
376 Ga0265338_10001041 3300028800 Bacteria 46363
377 Ga0265324_10002208 3300029957 Bacteria 10179
378 Ga0265760_10072822 3300031090 Bacteria 1056
379 Ga0265330_10169175 3300031235 Bacteria 927
380 Ga0265328_10049487 3300031239 Bacteria 1543
381 Ga0265328_10246206 3300031239 Bacteria 684
382 Ga0265320_10247191 3300031240 Bacteria 791
383 Ga0265325_10167524 3300031241 Bacteria 1030
384 Ga0265340_10008593 3300031247 Bacteria 5504
385 Ga0265331_10149683 3300031250 Bacteria 1060
386 Ga0265331_10259238 3300031250 Bacteria 780
387 Ga0265316_10360480 3300031344 Bacteria 1051
388 Ga0265316_10431075 3300031344 Bacteria 947
389 Ga0307509_10495966 3300031507 Bacteria 906
390 Ga0307509_10728008 3300031507 Bacteria 658
391 Ga0307408_100432049 3300031548 Bacteria 1138
392 Ga0307408_102224574 3300031548 Bacteria 530
393 Ga0307508_10044377 3300031616 Bacteria 3977
394 Ga0307508_10442515 3300031616 Bacteria 892
395 Ga0307508_10818226 3300031616 Bacteria 550
396 Ga0307514_10572985 3300031649 Bacteria 515
397 Ga0265314_10104078 3300031711 Bacteria 1818
398 Ga0265314_10250371 3300031711 Bacteria 1017
399 Ga0265314_10683400 3300031711 Bacteria 520
400 Ga0265342_10073176 3300031712 Bacteria 1993
401 Ga0307516_10073486 3300031730 Bacteria 3276
402 Ga0307413_10092912 3300031824 Bacteria 1970
403 Ga0307410_10139011 3300031852 Bacteria 1794
404 Ga0307410_10563169 3300031852 Bacteria 946
405 Ga0307406_10063979 3300031901 Bacteria 2385
406 Ga0307412_10385066 3300031911 Bacteria 1137
407 Ga0307409_100171799 3300031995 Bacteria 1908
408 Ga0307416_100798826 3300032002 Bacteria 1039
409 Ga0307414_10124646 3300032004 Bacteria 1988
410 Ga0307411_10925951 3300032005 Bacteria 776
411 Ga0307411_10970521 3300032005 Bacteria 759
412 Ga0307411_11537263 3300032005 Bacteria 612
413 Ga0307415_100258391 3300032126 Bacteria 1419
414 Ga0307415_100501288 3300032126 Bacteria 1061
415 Ga0307507_10632107 3300033179 Bacteria 547
416 Ga0307510_10035129 3300033180 Bacteria 5602
417 Ga0307510_10058529 3300033180 Bacteria 3988
418 Ga0373959_0209730 3300034820 Bacteria 518
419 Ga0373928_0217136 3300035084 Bacteria 558
420 Ga0373934_0040090 3300035086 Bacteria 1847
421 Ga0373934_0257226 3300035086 Bacteria 722
422 Ga0373934_0445073 3300035086 Bacteria 543
423 Ga0373944_0007533 3300035089 Bacteria 2920
424 Ga0373944_0020571 3300035089 Bacteria 1903
425 Ga0373932_0064837 3300035112 Bacteria 1119
426 Ga0373936_0008591 3300035113 Bacteria 3846
427 Ga0373936_0009596 3300035113 Bacteria 3646
428 Ga0373936_0066832 3300035113 Bacteria 1476
429 Ga0373939_0276586 3300035114 Bacteria 662
430 Ga0373945_0013000 3300035116 Bacteria 2773
431 Ga0373945_0014997 3300035116 Bacteria 2602
432 Ga0373953_0125662 3300035117 Bacteria 1091
433 Ga0373954_0027517 3300035118 Bacteria 2610
434 Ga0373954_0134840 3300035118 Bacteria 1203
435 Ga0373956_0222439 3300035119 Bacteria 896
436 Ga0373957_0407886 3300035120 Bacteria 585
437 Ga0373943_0206887 3300035170 Bacteria 1088
438 Ga0373943_0406589 3300035170 Bacteria 786
439 Ga0373946_0049993 3300035171 Bacteria 1745
440 Ga0373946_0357119 3300035171 Bacteria 731
441 Ga0373955_0022100 3300035172 Bacteria 3222
442 Ga0373955_0042706 3300035172 Bacteria 2435
443 Ga0373955_0846740 3300035172 Bacteria 562
444 Ga0373924_0001609 3300035410 Bacteria 7406
445 Ga0373924_0008812 3300035410 Bacteria 3679
446 Ga0373931_0170280 3300035691 Bacteria 1283
447 Ga0373935_0027489 3300035692 Bacteria 3515
448 Ga0373935_0039107 3300035692 Bacteria 2972
449 Ga0373935_0156729 3300035692 Bacteria 1549
450 Ga0373927_0003207 3300035695 Bacteria 11783
451 Ga0373927_0209706 3300035695 Bacteria 1279
452 Ga0373933_0007993 3300035724 Bacteria 5770
453 Ga0373933_0108416 3300035724 Bacteria 1730
454 Ga0373933_0870024 3300035724 Bacteria 593
455 Ga0373947_0006026 3300035725 Bacteria 7068
456 Ga0373947_0026448 3300035725 Bacteria 3391
457 Ga0373947_0104432 3300035725 Bacteria 1784
458 Ga0373947_0289945 3300035725 Bacteria 1090
459 Ga0373937_0040577 3300036401 Bacteria 4242
460 Ga0373937_0135256 3300036401 Bacteria 2304
461 Ga0373937_0603662 3300036401 Bacteria 1042
462 Ga0373925_0017296 3300037068 Bacteria 5224
463 Ga0373925_0024092 3300037068 Bacteria 4442
464 Ga0373925_0088330 3300037068 Bacteria 2367
465 Ga0373925_0588595 3300037068 Bacteria 916
466 Ga0395900_0025072 3300037418 Bacteria 6104
467 Ga0395898_0012791 3300037466 Bacteria 8664
468 Ga0436364_0425415 3300037853 Bacteria 807
469 Ga0395901_0132945 3300038443 Bacteria 2614
470 Ga0436365_0238184 3300039437 Bacteria 808
471 Ga0436365_0420080 3300039437 Bacteria 1626
472 Ga0436365_0989203 3300039437 Bacteria 3792
473 Ga0436360_0017356 3300039438 Bacteria 1056
474 Ga0439465_0037505 3300041413 Bacteria 1559
475 Ga0451789_1007321 3300041443 Bacteria 598
476 Ga0451789_1157944 3300041443 Bacteria 602
477 Ga0451791_1090847 3300041451 Bacteria 1824
478 Ga0451793_0399535 3300041452 Bacteria 852
479 Ga0451797_0572757 3300041453 Bacteria 575
480 Ga0451807_0338309 3300041486 Bacteria 897
481 Ga0439431_0022287 3300041997 Bacteria 1526
482 Ga0439432_139395 3300042006 Bacteria 714
483 Ga0439455_0087588 3300042012 Bacteria 851
484 Ga0439459_0006825 3300042438 Bacteria 1912
485 Ga0466969_0090592 3300044656 Bacteria 1449
486 Ga0466972_0462459 3300044658 Bacteria 596
487 Ga0466966_0001471 3300044684 Bacteria 15165
488 Ga0466961_0004761 3300044693 Bacteria 8540
489 Ga0466961_0728820 3300044693 Bacteria 593
490 Ga0466963_0014602 3300044694 Bacteria 4847
491 Ga0466964_0088611 3300044706 Bacteria 1343
492 Ga0466971_0092063 3300044719 Bacteria 1389
493 Ga0466971_0163200 3300044719 Bacteria 1043
494 Ga0466970_0312853 3300044765 Bacteria 887
495 Ga0466970_0433921 3300044765 Bacteria 752
496 Ga0466970_0527773 3300044765 Bacteria 681
497 Ga0466957_0575120 3300044842 Bacteria 787
498 Ga0466959_0005681 3300045049 Bacteria 8582
499 Ga0466959_0234345 3300045049 Bacteria 1270
500 Ga0466959_0355691 3300045049 Bacteria 998
501 Ga0466958_0052462 3300045836 Bacteria 2472
502 Ga0466967_0037023 3300045976 Bacteria 4171
503 Ga0466967_0125936 3300045976 Bacteria 2373
504 Ga0466967_0674125 3300045976 Bacteria 1023
505 Ga0495617_015362 3300046452 Bacteria 2595
506 Ga0495617_202444 3300046452 Bacteria 620
507 Ga0495592_0012750 3300046454 Bacteria 6390
508 Ga0495592_0086197 3300046454 Bacteria 2262
509 Ga0495592_0261592 3300046454 Bacteria 1139
510 Ga0495603_0000182 3300046455 Bacteria 32426
511 Ga0495603_0050821 3300046455 Bacteria 2464
512 Ga0495603_0102705 3300046455 Bacteria 1669
513 Ga0495603_0322682 3300046455 Bacteria 886
514 Ga0495603_0591647 3300046455 Bacteria 635
515 Ga0495603_0688781 3300046455 Bacteria 584
516 Ga0495629_0000314 3300046459 Bacteria 41394
517 Ga0495629_0006021 3300046459 Bacteria 9020
518 Ga0495629_0023701 3300046459 Bacteria 4371
519 Ga0495638_0037355 3300046460 Bacteria 3089
520 Ga0495638_0128217 3300046460 Bacteria 1493
521 Ga0495641_0001508 3300046461 Bacteria 19835
522 Ga0495641_0192463 3300046461 Bacteria 914
523 Ga0495651_0014799 3300046462 Bacteria 6033
524 Ga0495651_0019479 3300046462 Bacteria 5260
525 Ga0495651_0054726 3300046462 Bacteria 3067
526 Ga0495651_0092239 3300046462 Bacteria 2269
527 Ga0495653_0107423 3300046463 Bacteria 2011
528 Ga0495653_0300894 3300046463 Bacteria 1046
529 Ga0495580_0002541 3300046472 Bacteria 15893
530 Ga0495580_0073929 3300046472 Bacteria 2379
531 Ga0495582_0003777 3300046473 Bacteria 8536
532 Ga0495582_0320625 3300046473 Bacteria 891
533 Ga0495639_0006669 3300046475 Bacteria 4968
534 Ga0495639_0036657 3300046475 Bacteria 2197
535 Ga0495639_0287775 3300046475 Bacteria 818
536 Ga0495662_0001470 3300046476 Bacteria 11662
537 Ga0495662_0016856 3300046476 Bacteria 3536
538 Ga0495662_0018098 3300046476 Bacteria 3408
539 Ga0495664_0001204 3300046477 Bacteria 13527
540 Ga0495664_0049429 3300046477 Bacteria 2496
541 Ga0495664_0129739 3300046477 Bacteria 1526
542 Ga0495664_0290553 3300046477 Bacteria 987
543 Ga0495585_0042555 3300046492 Bacteria 2543
544 Ga0495585_0354516 3300046492 Bacteria 712
545 Ga0495594_0000302 3300046499 Bacteria 24227
546 Ga0495594_0210317 3300046499 Bacteria 1109
547 Ga0495594_0229251 3300046499 Bacteria 1059
548 Ga0495607_0525337 3300046501 Bacteria 522
549 Ga0495606_0053703 3300046507 Bacteria 2613
550 Ga0495606_0178813 3300046507 Bacteria 1225
551 Ga0495606_0342167 3300046507 Bacteria 796
552 Ga0495608_0108241 3300046511 Bacteria 1787
553 Ga0495608_0162783 3300046511 Bacteria 1418
554 Ga0495616_0086251 3300046513 Bacteria 1493
555 Ga0495616_0417079 3300046513 Bacteria 549
556 Ga0495618_0008828 3300046514 Bacteria 6087
557 Ga0495618_0043480 3300046514 Bacteria 2834
558 Ga0495620_0123484 3300046515 Bacteria 1019
559 Ga0495628_0014010 3300046516 Bacteria 6732
560 Ga0495628_0061793 3300046516 Bacteria 2937
561 Ga0495628_0169991 3300046516 Bacteria 1653
562 Ga0495628_0310172 3300046516 Bacteria 1166
563 Ga0495630_0002415 3300046517 Bacteria 12968
564 Ga0495630_0137068 3300046517 Bacteria 1860
565 Ga0495631_0029165 3300046518 Bacteria 2512
566 Ga0495632_0030152 3300046519 Bacteria 2818
567 Ga0495637_0139389 3300046520 Bacteria 921
568 Ga0495643_0287868 3300046522 Bacteria 753
569 Ga0495644_0219573 3300046523 Bacteria 735
570 Ga0495648_0006267 3300046524 Bacteria 9733
571 Ga0495663_0024099 3300046525 Bacteria 1767
572 Ga0495663_0033542 3300046525 Bacteria 1533
573 Ga0495652_0006258 3300046529 Bacteria 11097
574 Ga0495652_0755556 3300046529 Bacteria 650
575 Ga0495652_1065366 3300046529 Bacteria 526
576 Ga0495654_0133352 3300046530 Bacteria 1113
577 Ga0495665_0000619 3300046531 Bacteria 18044
578 Ga0495665_0137733 3300046531 Bacteria 1276
579 Ga0495665_0627161 3300046531 Bacteria 536
580 Ga0495640_0000308 3300046533 Bacteria 33750
581 Ga0495640_0014432 3300046533 Bacteria 5978
582 Ga0495640_0032685 3300046533 Bacteria 3703
583 Ga0495586_0026816 3300046535 Bacteria 3083
584 Ga0495587_0030628 3300046536 Bacteria 3262
585 Ga0495598_0009519 3300046537 Bacteria 2300
586 Ga0495609_0069311 3300046538 Bacteria 1550
587 Ga0495609_0147697 3300046538 Bacteria 1001
588 Ga0495621_0501872 3300046539 Bacteria 523
589 Ga0495645_0002277 3300046543 Bacteria 13061
590 Ga0495622_0002921 3300046557 Bacteria 8156
591 Ga0495622_0013329 3300046557 Bacteria 3814
592 Ga0495622_0054035 3300046557 Bacteria 1863
593 Ga0495622_0114264 3300046557 Bacteria 1235
594 Ga0495622_0262568 3300046557 Bacteria 758
595 Ga0495633_0093126 3300046558 Bacteria 1400
596 Ga0495667_0004819 3300046559 Bacteria 9123
597 Ga0495667_0139683 3300046559 Bacteria 1561
598 Ga0495667_0166789 3300046559 Bacteria 1416
599 Ga0495667_0620530 3300046559 Bacteria 673
600 Ga0495656_0066657 3300046615 Bacteria 1586
601 Ga0495668_0023015 3300046616 Bacteria 3557
602 Ga0495668_0112895 3300046616 Bacteria 1486
603 Ga0495668_0404103 3300046616 Bacteria 751
604 Ga0495634_0001483 3300046642 Bacteria 20763
605 Ga0495634_0034146 3300046642 Bacteria 3492
606 Ga0495625_0203704 3300046660 Bacteria 1304
607 Ga0495625_0210822 3300046660 Bacteria 1277
608 Ga0495625_0686204 3300046660 Bacteria 606
609 Ga0495635_0038449 3300046663 Bacteria 3313
610 Ga0495635_0074254 3300046663 Bacteria 2329
611 Ga0495635_0230395 3300046663 Bacteria 1251
612 Ga0495659_0068490 3300046664 Bacteria 1325
613 Ga0495661_0204820 3300046665 Bacteria 1031
614 Ga0495661_0205345 3300046665 Bacteria 1029
615 Ga0495661_0311856 3300046665 Bacteria 784
616 Ga0495588_0119439 3300046674 Bacteria 1389
617 Ga0495588_0182789 3300046674 Bacteria 1108
618 Ga0495657_0015079 3300046675 Bacteria 5665
619 Ga0495657_0095578 3300046675 Bacteria 1899
620 Ga0495599_0327330 3300046678 Bacteria 921
621 Ga0495623_0042017 3300046679 Bacteria 2914
622 Ga0495646_0011359 3300046680 Bacteria 5655
623 Ga0495646_0029121 3300046680 Bacteria 3453
624 Ga0495646_0097496 3300046680 Bacteria 1689
625 Ga0495647_0019286 3300046681 Bacteria 2437
626 Ga0495647_0028193 3300046681 Bacteria 2069
627 Ga0495658_0000936 3300046683 Bacteria 15569
628 Ga0495658_0020828 3300046683 Bacteria 3448
629 Ga0495658_0739339 3300046683 Bacteria 630
630 Ga0495669_0039321 3300046684 Bacteria 2094
631 Ga0495669_0324230 3300046684 Bacteria 743
632 Ga0495669_0566919 3300046684 Bacteria 552
633 Ga0495613_0131395 3300046689 Bacteria 1793
634 Ga0495613_0375342 3300046689 Bacteria 973
635 Ga0495624_0000810 3300046690 Bacteria 24701
636 Ga0495624_0177037 3300046690 Bacteria 1300
637 Ga0495624_0306856 3300046690 Bacteria 956
638 Ga0495624_0510145 3300046690 Bacteria 719
639 Ga0495670_0082982 3300046691 Bacteria 1634
640 Ga0495671_0064047 3300046692 Bacteria 1810
641 Ga0495671_0148277 3300046692 Bacteria 1142
642 Ga0495600_0011127 3300046809 Bacteria 5602
643 Ga0495600_0072440 3300046809 Bacteria 2250
644 Ga0495581_0000683 3300047315 Bacteria 17799
645 Ga0495581_0091563 3300047315 Bacteria 1764
646 Ga0495581_0649851 3300047315 Bacteria 609
647 Ga0495604_0215880 3300047317 Bacteria 1323
648 Ga0495636_0524273 3300047318 Bacteria 574
649 Ga0495674_0012056 3300047319 Bacteria 8146
650 Ga0495674_0146672 3300047319 Bacteria 1981
651 Ga0495674_0677532 3300047319 Bacteria 811
652 Ga0495672_0133343 3300047320 Bacteria 1304
653 Ga0495672_0172127 3300047320 Bacteria 1103
654 Ga0495676_0008153 3300047321 Bacteria 9610
655 Ga0495676_0347411 3300047321 Bacteria 992
656 Ga0495676_0576727 3300047321 Bacteria 734
657 Ga0495680_0010179 3300047322 Bacteria 8401
658 Ga0495680_0166652 3300047322 Bacteria 1597
659 Ga0495680_0721149 3300047322 Bacteria 657
660 Ga0495675_0054237 3300047444 Bacteria 2544
661 Ga0495685_064697 3300047447 Bacteria 1229
662 Ga0495685_209765 3300047447 Bacteria 623
663 Ga0495673_0106682 3300047469 Bacteria 1125
664 Ga0495681_0133666 3300047470 Bacteria 1054
665 Ga0495681_0150884 3300047470 Bacteria 975
666 Ga0495684_0272730 3300047471 Bacteria 1223
667 Ga0495686_0255772 3300047472 Bacteria 982
668 Ga0495686_0268809 3300047472 Bacteria 952
669 Ga0495686_0282218 3300047472 Bacteria 922
670 Ga0495686_0394922 3300047472 Bacteria 744
671 Ga0495593_0000370 3300047673 Bacteria 24754
672 Ga0495593_0062481 3300047673 Bacteria 1946
673 Ga0495593_0468210 3300047673 Bacteria 631
674 Ga0495602_0016617 3300048088 Bacteria 7397
675 Ga0495602_0610482 3300048088 Bacteria 749
676 Ga0496100_0251157 3300048903 Bacteria 1308
677 Ga0496100_0393953 3300048903 Bacteria 1054
678 Ga0496101_0533808 3300048904 Bacteria 927
679 Ga0496101_1325825 3300048904 Bacteria 562
680 Ga0496102_0234656 3300048905 Bacteria 1729
681 Ga0496102_0636406 3300048905 Bacteria 990
682 Ga0496102_1702229 3300048905 Bacteria 548
683 Ga0496105_0063923 3300048908 Bacteria 3036
684 Ga0496106_0724942 3300048909 Bacteria 791
685 Ga0496108_0025132 3300048911 Bacteria 4907
686 Ga0496109_0308781 3300048912 Bacteria 1492
687 Ga0496109_0577146 3300048912 Bacteria 1060
688 Ga0496110_0286131 3300048913 Bacteria 1501
689 Ga0496112_0243501 3300048915 Bacteria 1750
690 Ga0496112_0252013 3300048915 Bacteria 1716
691 Ga0496112_0526207 3300048915 Bacteria 1117
692 Ga0496113_0729959 3300048916 Bacteria 789
693 Ga0496113_1040045 3300048916 Bacteria 644
694 Ga0496115_0381190 3300048918 Bacteria 1147
695 Ga0496115_0553680 3300048918 Bacteria 919
696 Ga0496116_0285990 3300048919 Bacteria 795
697 Ga0496117_0303195 3300048920 Bacteria 844
698 Ga0496118_0011634 3300048921 Bacteria 8558
699 Ga0496118_0126147 3300048921 Bacteria 1656
700 Ga0496118_0261619 3300048921 Bacteria 976
701 Ga0496119_0022207 3300048922 Bacteria 4553
702 Ga0496120_0085482 3300048923 Bacteria 1698
703 Ga0496120_0095207 3300048923 Bacteria 1583
704 Ga0496121_0006350 3300048924 Bacteria 14731
705 Ga0496121_0040352 3300048924 Bacteria 4097
706 Ga0496121_0054773 3300048924 Bacteria 3329
707 Ga0496121_0090891 3300048924 Bacteria 2385
708 Ga0496121_0132894 3300048924 Bacteria 1859
709 Ga0496121_0150187 3300048924 Bacteria 1715
710 Ga0496121_0182598 3300048924 Bacteria 1512
711 Ga0496121_0228676 3300048924 Bacteria 1304
712 Ga0496121_0276276 3300048924 Bacteria 1152
713 Ga0496121_0326255 3300048924 Bacteria 1031
714 Ga0496123_0348889 3300048926 Bacteria 689
715 Ga0496124_0112193 3300048927 Bacteria 2193
716 Ga0496125_0102411 3300048928 Bacteria 2104
717 Ga0496125_0123949 3300048928 Bacteria 1836
718 Ga0496126_0159757 3300048929 Bacteria 1926
719 Ga0496126_0176114 3300048929 Bacteria 1819
720 Ga0496126_0351956 3300048929 Bacteria 1204
721 Ga0496126_0429566 3300048929 Bacteria 1066
722 Ga0496126_0451711 3300048929 Bacteria 1034
723 Ga0496126_0481152 3300048929 Bacteria 995
724 Ga0496126_1338893 3300048929 Bacteria 520
725 Ga0495678_042590 3300049459 Bacteria 1809
726 Ga0495682_0066213 3300049460 Bacteria 1302
727 Ga0495682_0120472 3300049460 Bacteria 939
728 Ga0495682_0248736 3300049460 Bacteria 629
729 Ga0501033_0344084 3300049570 Bacteria 1045
730 Ga0501046_0293391 3300049580 Bacteria 1189
731 Ga0501047_0326464 3300049581 Bacteria 1373
732 Ga0501047_0764241 3300049581 Bacteria 782
733 Ga0501047_0773685 3300049581 Bacteria 775
734 Ga0501067_0071756 3300049583 Bacteria 1918
735 Ga0501070_0451380 3300049586 Bacteria 1036
736 Ga0501073_0023882 3300049589 Bacteria 4390
737 Ga0501075_0350138 3300049591 Bacteria 1126
738 Ga0501076_1004831 3300049592 Bacteria 687
739 Ga0501080_0245707 3300049742 Bacteria 1632
740 Ga0501081_0210315 3300049743 Bacteria 1413
741 Ga0501083_0932328 3300049744 Bacteria 565
742 Ga0501035_0127547 3300049822 Bacteria 2221
743 Ga0501035_0426107 3300049822 Bacteria 1101
744 Ga0501044_0148202 3300049823 Bacteria 2330
745 nmdc:mga03683_636914_c1 3300050489 Bacteria 524
746 nmdc:mga03n38_271140_c1 3300050490 Bacteria 903
747 nmdc:mga03n38_362321_c1 3300050490 Bacteria 791
748 nmdc:mga0yw44_120592_c1 3300050492 Bacteria 1689
749 nmdc:mga0yw44_836915_c1 3300050492 Bacteria 625
750 nmdc:mga0k408_204570_c1 3300050493 Bacteria 1179
751 nmdc:mga0k408_247506_c1 3300050493 Bacteria 1064
752 nmdc:mga0k408_499_c1 3300050493 Bacteria 21537
753 nmdc:mga0k408_696879_c1 3300050493 Bacteria 595
754 nmdc:mga06z11_141014_c1 3300050494 Bacteria 1363
755 nmdc:mga06z11_786384_c1 3300050494 Bacteria 580
756 nmdc:mga06z11_80473_c1 3300050494 Bacteria 1747
757 nmdc:mga07m45_173116_c1 3300050496 Bacteria 1255
758 nmdc:mga07m45_334912_c1 3300050496 Bacteria 880
759 nmdc:mga07m45_350480_c1 3300050496 Bacteria 858
760 nmdc:mga07m45_815436_c1 3300050496 Bacteria 535
761 nmdc:mga0qj67_1420538_c1 3300050509 Bacteria 535
762 nmdc:mga0n895_1215228_c1 3300050512 Bacteria 727
763 nmdc:mga0n895_153988_c1 3300050512 Bacteria 2329
764 nmdc:mga0n895_17055_c1 3300050512 Bacteria 6685
765 nmdc:mga0rr50_43438_c1 3300050513 Bacteria 3289
766 nmdc:mga08x19_161790_c1 3300050514 Bacteria 1520
767 nmdc:mga0sz30_221679_c1 3300050516 Bacteria 841
768 Ga0500610_0128507 3300053079 Bacteria 1291
769 Ga0500635_0402072 3300053080 Bacteria 542
770 Ga0495655_0158853 3300053083 Bacteria 716
771 Ga0495595_0016919 3300053084 Bacteria 3128
772 Ga0495619_0069795 3300053085 Bacteria 2349
773 Ga0495619_0264739 3300053085 Bacteria 1191
774 Ga0495619_0600114 3300053085 Bacteria 753
775 Ga0500578_0229904 3300053086 Bacteria 1124
776 Ga0500644_0167886 3300053088 Bacteria 891
777 Ga0500581_085689 3300053089 Bacteria 1567
778 Ga0500646_0191392 3300053090 Bacteria 698
779 Ga0500647_0038056 3300053091 Bacteria 2303
780 Ga0500647_0147686 3300053091 Bacteria 1099
781 Ga0500583_0539442 3300053092 Bacteria 543
782 Ga0500566_0004243 3300053094 Bacteria 8554
783 Ga0500566_0036998 3300053094 Bacteria 2829
784 Ga0500640_040439 3300053095 Bacteria 2048
785 Ga0500641_0008813 3300053096 Bacteria 3612
786 Ga0500554_038573 3300053102 Bacteria 1454
787 Ga0500572_009466 3300053111 Bacteria 2303
788 Ga0500591_165143 3300053115 Bacteria 829
789 Ga0500594_0211127 3300053118 Bacteria 640
790 Ga0500595_000095 3300053119 Bacteria 61248
791 Ga0500595_009153 3300053119 Bacteria 4010
792 Ga0500595_049846 3300053119 Bacteria 1302
793 Ga0500597_364476 3300053120 Bacteria 559
794 Ga0500608_070689 3300053122 Bacteria 1659
795 Ga0500614_008073 3300053123 Bacteria 2228
796 Ga0500559_0000004 3300053136 Bacteria 241551
797 Ga0500559_0070605 3300053136 Bacteria 1571
798 Ga0500568_0086735 3300053139 Bacteria 1183
799 Ga0500579_154803 3300053143 Bacteria 987
800 Ga0500589_134743 3300053147 Bacteria 1026
801 Ga0500590_144469 3300053148 Bacteria 1082
802 Ga0500590_355162 3300053148 Bacteria 522
803 Ga0500603_005139 3300053150 Bacteria 2806
804 Ga0500603_113390 3300053150 Bacteria 816
805 Ga0500603_181611 3300053150 Bacteria 662
806 Ga0500603_293791 3300053150 Bacteria 526
807 Ga0500619_130069 3300053154 Bacteria 858
808 Ga0500627_0331777 3300053158 Bacteria 659
809 Ga0500630_011616 3300053159 Bacteria 4335
810 Ga0500634_0140940 3300053161 Bacteria 1142
811 Ga0500638_010149 3300053162 Bacteria 4108
812 Ga0500638_084844 3300053162 Bacteria 1499
813 Ga0500638_134433 3300053162 Bacteria 1118
814 Ga0500638_153205 3300053162 Bacteria 1023
815 Ga0500638_319573 3300053162 Bacteria 590
816 Ga0500639_060538 3300053163 Bacteria 1951
817 Ga0500636_0022787 3300053177 Bacteria 3701
818 Ga0500637_0002475 3300053178 Bacteria 8223
819 Ga0500637_0118833 3300053178 Bacteria 1533
820 Ga0500637_0128031 3300053178 Bacteria 1473
821 Ga0500656_025197 3300053732 Bacteria 762
822 Ga0500596_008711 3300053735 Bacteria 1610
823 Ga0500587_042509 3300053739 Bacteria 655
824 Ga0500661_000198 3300055283 Bacteria 10649
825 Ga0500661_011296 3300055283 Bacteria 1616
826 Ga0500661_042330 3300055283 Bacteria 807
827 Ga0501082_1259566 3300060353 Bacteria 646
828 Ga0466962_0047831 3300061719 Bacteria 2044

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006358 Ga0068871_100178181 Ga0068871_1001781812 111
2 3300046455 Ga0495603_0322682 Ga0495603_0322682_93_446 111
3 3300035086 Ga0373934_0040090 Ga0373934_0040090_1307_1657 116
4 3300035116 Ga0373945_0013000 Ga0373945_0013000_29_379 116
5 3300048918 Ga0496115_0381190 Ga0496115_0381190_561_911 116
6 3300049460 Ga0495682_0248736 Ga0495682_0248736_62_412 116
7 3300050509 nmdc:mga0qj67_1420538_c1 nmdc:mga0qj67_1420538_c1_172_522 116
8 3300042012 Ga0439455_0087588 Ga0439455_0087588_10_363 117
9 3300044706 Ga0466964_0088611 Ga0466964_0088611_20_373 117
10 3300046678 Ga0495599_0327330 Ga0495599_0327330_558_911 117
11 iso_pu_bacteria 2513237096 2513658730 117
12 iso_pu_bacteria 2513237101 2513693578 117
13 iso_pu_bacteria 2513237137 2513859934 117
14 iso_pu_bacteria 2513237145 2513920706 117
15 iso_pu_bacteria 2517572143 2517895127 117
16 iso_pu_bacteria 2524023228 2524540473 117
17 iso_pu_bacteria 2643221547 2643757436 117
18 iso_pu_bacteria 2667528175 2671123158 117
19 iso_pu_bacteria 2721755755 2723848465 117
20 iso_pu_bacteria 2791355197 2793073563 117
21 iso_pu_bacteria 2791355199 2793080950 117
22 iso_pu_bacteria 2874604998 2874609194 117
23 iso_pu_bacteria 2876808645 2876814837 117
24 iso_pu_bacteria 2879110137 2879119228 117
25 iso_pu_bacteria 2885374607 2885379755 117
26 iso_pu_bacteria 2889033259 2889036960 117
27 iso_pu_bacteria 2903748898 2903752928 117
28 iso_pu_bacteria 2904699407 2904700041 117
29 iso_pu_bacteria 2906610324 2906611791 117
30 iso_pu_bacteria 2906635258 2906636475 117
31 iso_pu_bacteria 2906660503 2906665617 117
32 iso_pu_bacteria 2908739725 2908745370 117
33 iso_pu_bacteria 2922361189 2922363645 117
34 iso_pu_bacteria 2922386360 2922392783 117
35 iso_pu_bacteria 2922425934 2922427563 117
36 iso_pu_bacteria 2935630451 2935637974 117
37 iso_pu_bacteria 2941507105 2941508426 117
38 iso_pu_bacteria 2941515067 2941515068 117
39 iso_pu_bacteria 2941523033 2941530505 117
40 iso_pu_bacteria 3005474847 3005477224 117
41 iso_pu_bacteria 8006933436 8006938433 117
42 iso_pu_bacteria 8006964411 8006972732 117
43 iso_pu_bacteria 8006973647 8006978505 117
44 iso_pu_bacteria 8006984368 8006988950 117
45 iso_pu_bacteria 8006994254 8006999592 117
46 iso_pu_bacteria 8019555841 8019559902 117
47 iso_pu_bacteria 8019565922 8019570006 117
48 3300003659 JGI25404J52841_10128492 JGI25404J52841_101284921 118
49 3300046455 Ga0495603_0688781 Ga0495603_0688781_11_373 120
50 3300005338 Ga0068868_100676730 Ga0068868_1006767301 121
51 3300005347 Ga0070668_100005838 Ga0070668_10000583812 121
52 3300005353 Ga0070669_100714144 Ga0070669_1007141441 121
53 3300005436 Ga0070713_100049420 Ga0070713_1000494204 121
54 3300005530 Ga0070679_100142891 Ga0070679_1001428912 121
55 3300005548 Ga0070665_100455641 Ga0070665_1004556412 121
56 3300005843 Ga0068860_100080859 Ga0068860_1000808592 121
57 3300006058 Ga0075432_10051629 Ga0075432_100516293 121
58 3300013104 Ga0157370_10057300 Ga0157370_100573003 121
59 3300014969 Ga0157376_10784459 Ga0157376_107844591 121
60 3300025917 Ga0207660_10528026 Ga0207660_105280262 121
61 3300025921 Ga0207652_10222184 Ga0207652_102221842 121
62 3300025923 Ga0207681_10692043 Ga0207681_106920432 121
63 3300025923 Ga0207681_11303060 Ga0207681_113030601 121
64 3300025925 Ga0207650_10154836 Ga0207650_101548363 121
65 3300025972 Ga0207668_10004107 Ga0207668_100041072 121
66 3300026023 Ga0207677_10753590 Ga0207677_107535901 121
67 3300026078 Ga0207702_10371864 Ga0207702_103718642 121
68 3300028379 Ga0268266_10411948 Ga0268266_104119482 121
69 3300028563 Ga0265319_1041132 Ga0265319_10411322 121
70 3300028577 Ga0265318_10065798 Ga0265318_100657982 121
71 3300031235 Ga0265330_10169175 Ga0265330_101691751 121
72 3300031239 Ga0265328_10246206 Ga0265328_102462061 121
73 3300031240 Ga0265320_10247191 Ga0265320_102471911 121
74 3300031250 Ga0265331_10259238 Ga0265331_102592381 121
75 3300031344 Ga0265316_10431075 Ga0265316_104310752 121
76 3300031649 Ga0307514_10572985 Ga0307514_105729851 121
77 3300031711 Ga0265314_10683400 Ga0265314_106834001 121
78 3300035086 Ga0373934_0257226 Ga0373934_0257226_99_464 121
79 3300035172 Ga0373955_0846740 Ga0373955_0846740_70_435 121
80 3300035724 Ga0373933_0108416 Ga0373933_0108416_585_950 121
81 3300036401 Ga0373937_0603662 Ga0373937_0603662_625_990 121
82 3300037418 Ga0395900_0025072 Ga0395900_0025072_3303_3683 121
83 3300037466 Ga0395898_0012791 Ga0395898_0012791_5859_6239 121
84 3300038443 Ga0395901_0132945 Ga0395901_0132945_1778_2158 121
85 3300039438 Ga0436360_0017356 Ga0436360_0017356_609_974 121
86 3300041453 Ga0451797_0572757 Ga0451797_0572757_57_425 121
87 3300042006 Ga0439432_139395 Ga0439432_139395_117_482 121
88 3300048909 Ga0496106_0724942 Ga0496106_0724942_314_679 121
89 3300049570 Ga0501033_0344084 Ga0501033_0344084_140_505 121
90 3300049581 Ga0501047_0764241 Ga0501047_0764241_71_436 121
91 3300049581 Ga0501047_0773685 Ga0501047_0773685_120_485 121
92 3300049822 Ga0501035_0127547 Ga0501035_0127547_1583_1948 121
93 3300049822 Ga0501035_0426107 Ga0501035_0426107_705_1070 121
94 3300050493 nmdc:mga0k408_499_c1 nmdc:mga0k408_499_c1_15533_15898 121
95 3300053136 Ga0500559_0000004 Ga0500559_0000004_83169_83534 121
96 3300053154 Ga0500619_130069 Ga0500619_130069_283_648 121
97 3300053162 Ga0500638_319573 Ga0500638_319573_85_450 121
98 3300031090 Ga0265760_10072822 Ga0265760_100728222 122
99 3300035086 Ga0373934_0445073 Ga0373934_0445073_132_500 122
100 3300009098 Ga0105245_10524074 Ga0105245_105240743 124
101 3300011119 Ga0105246_11853801 Ga0105246_118538012 124
102 3300046507 Ga0495606_0342167 Ga0495606_0342167_107_481 124
103 3300047447 Ga0495685_209765 Ga0495685_209765_236_610 124
104 3300048924 Ga0496121_0228676 Ga0496121_0228676_11_385 124
105 3300048929 Ga0496126_0176114 Ga0496126_0176114_383_757 124
106 3300003203 JGI25406J46586_10103102 JGI25406J46586_101031022 125
107 3300003659 JGI25404J52841_10108630 JGI25404J52841_101086301 125
108 3300003911 JGI25405J52794_10153137 JGI25405J52794_101531371 125
109 3300005548 Ga0070665_100172998 Ga0070665_1001729983 125
110 3300005937 Ga0081455_10023586 Ga0081455_100235862 125
111 3300005983 Ga0081540_1004405 Ga0081540_10044052 125
112 3300005983 Ga0081540_1008466 Ga0081540_10084663 125
113 3300005985 Ga0081539_10005931 Ga0081539_1000593110 125
114 3300005985 Ga0081539_10420486 Ga0081539_104204861 125
115 3300006871 Ga0075434_100051150 Ga0075434_1000511505 125
116 3300009176 Ga0105242_13118723 Ga0105242_131187231 125
117 3300026088 Ga0207641_11248569 Ga0207641_112485692 125
118 3300028379 Ga0268266_10154742 Ga0268266_101547423 125
119 3300031239 Ga0265328_10049487 Ga0265328_100494873 125
120 3300031241 Ga0265325_10167524 Ga0265325_101675242 125
121 3300031247 Ga0265340_10008593 Ga0265340_100085932 125
122 3300031250 Ga0265331_10149683 Ga0265331_101496832 125
123 3300031344 Ga0265316_10360480 Ga0265316_103604802 125
124 3300031711 Ga0265314_10250371 Ga0265314_102503712 125
125 3300031712 Ga0265342_10073176 Ga0265342_100731763 125
126 3300034820 Ga0373959_0209730 Ga0373959_0209730_46_423 125
127 3300035084 Ga0373928_0217136 Ga0373928_0217136_29_406 125
128 3300035112 Ga0373932_0064837 Ga0373932_0064837_700_1077 125
129 3300035691 Ga0373931_0170280 Ga0373931_0170280_323_700 125
130 3300035725 Ga0373947_0289945 Ga0373947_0289945_321_698 125
131 3300046460 Ga0495638_0128217 Ga0495638_0128217_684_1061 125
132 3300046475 Ga0495639_0287775 Ga0495639_0287775_363_740 125
133 3300046499 Ga0495594_0210317 Ga0495594_0210317_527_904 125
134 3300046507 Ga0495606_0178813 Ga0495606_0178813_705_1082 125
135 3300046513 Ga0495616_0417079 Ga0495616_0417079_151_528 125
136 3300046523 Ga0495644_0219573 Ga0495644_0219573_192_569 125
137 3300046557 Ga0495622_0262568 Ga0495622_0262568_57_434 125
138 3300046616 Ga0495668_0112895 Ga0495668_0112895_888_1265 125
139 3300046660 Ga0495625_0210822 Ga0495625_0210822_183_560 125
140 3300046681 Ga0495647_0028193 Ga0495647_0028193_1085_1462 125
141 3300046684 Ga0495669_0566919 Ga0495669_0566919_130_507 125
142 3300047472 Ga0495686_0394922 Ga0495686_0394922_70_447 125
143 3300048924 Ga0496121_0006350 Ga0496121_0006350_14117_14494 125
144 3300049583 Ga0501067_0071756 Ga0501067_0071756_556_933 125
145 3300049744 Ga0501083_0932328 Ga0501083_0932328_25_402 125
146 3300050512 nmdc:mga0n895_1215228_c1 nmdc:mga0n895_1215228_c1_11_388 125
147 3300050512 nmdc:mga0n895_17055_c1 nmdc:mga0n895_17055_c1_1768_2145 125
148 3300053119 Ga0500595_049846 Ga0500595_049846_203_580 125
149 3300053139 Ga0500568_0086735 Ga0500568_0086735_573_950 125
150 3300053158 Ga0500627_0331777 Ga0500627_0331777_234_611 125
151 iso_pu_bacteria 2513237094 2513642392 125
152 iso_pu_bacteria 2844315083 2844315718 125
153 iso_pu_bacteria 2849076700 2849083268 125
154 iso_pu_bacteria 2888388044 2888390447 125
155 iso_pu_bacteria 2903727486 2903730982 125
156 iso_pu_bacteria 2906602504 2906608462 125
157 iso_pu_bacteria 2932794094 2932800052 125
158 iso_pu_bacteria 2932801729 2932809061 125
159 iso_pu_bacteria 2935883170 2935888268 125
160 iso_pu_bacteria 2941531003 2941537938 125
161 iso_pu_bacteria 3005594810 3005595294 125
162 iso_pu_bacteria 3005718088 3005718543 125
163 iso_pu_bacteria 8019648815 8019652141 125
164 iso_pu_bacteria 8056689827 8056691880 125
165 iso_pu_bacteria 8056967851 8056975796 125
166 3300005578 Ga0068854_100030068 Ga0068854_1000300682 127
167 3300025949 Ga0207667_11382584 Ga0207667_113825842 127
168 3300025981 Ga0207640_10014499 Ga0207640_100144993 127
169 3300035089 Ga0373944_0020571 Ga0373944_0020571_1131_1568 127
170 3300035113 Ga0373936_0009596 Ga0373936_0009596_105_542 127
171 3300035118 Ga0373954_0134840 Ga0373954_0134840_493_930 127
172 3300035170 Ga0373943_0206887 Ga0373943_0206887_266_703 127
173 3300035172 Ga0373955_0022100 Ga0373955_0022100_2575_3012 127
174 3300035410 Ga0373924_0008812 Ga0373924_0008812_974_1411 127
175 3300035692 Ga0373935_0027489 Ga0373935_0027489_270_707 127
176 3300035695 Ga0373927_0003207 Ga0373927_0003207_1893_2330 127
177 3300035724 Ga0373933_0870024 Ga0373933_0870024_115_552 127
178 3300035725 Ga0373947_0006026 Ga0373947_0006026_278_715 127
179 3300036401 Ga0373937_0040577 Ga0373937_0040577_579_1016 127
180 3300037068 Ga0373925_0088330 Ga0373925_0088330_1644_2081 127
181 3300046454 Ga0495592_0012750 Ga0495592_0012750_5768_6205 127
182 3300046455 Ga0495603_0000182 Ga0495603_0000182_31721_32158 127
183 3300046459 Ga0495629_0000314 Ga0495629_0000314_23676_24113 127
184 3300046461 Ga0495641_0001508 Ga0495641_0001508_283_720 127
185 3300046462 Ga0495651_0092239 Ga0495651_0092239_1677_2114 127
186 3300046472 Ga0495580_0002541 Ga0495580_0002541_6012_6449 127
187 3300046473 Ga0495582_0320625 Ga0495582_0320625_176_613 127
188 3300046475 Ga0495639_0006669 Ga0495639_0006669_277_714 127
189 3300046476 Ga0495662_0001470 Ga0495662_0001470_11172_11609 127
190 3300046477 Ga0495664_0290553 Ga0495664_0290553_266_703 127
191 3300046499 Ga0495594_0000302 Ga0495594_0000302_353_790 127
192 3300046516 Ga0495628_0014010 Ga0495628_0014010_3003_3440 127
193 3300046517 Ga0495630_0002415 Ga0495630_0002415_9148_9585 127
194 3300046529 Ga0495652_1065366 Ga0495652_1065366_77_514 127
195 3300046531 Ga0495665_0000619 Ga0495665_0000619_17455_17838 127
196 3300046533 Ga0495640_0000308 Ga0495640_0000308_23870_24307 127
197 3300046557 Ga0495622_0002921 Ga0495622_0002921_295_732 127
198 3300046559 Ga0495667_0004819 Ga0495667_0004819_3229_3666 127
199 3300046642 Ga0495634_0001483 Ga0495634_0001483_20060_20497 127
200 3300046663 Ga0495635_0230395 Ga0495635_0230395_295_732 127
201 3300046674 Ga0495588_0119439 Ga0495588_0119439_658_1095 127
202 3300046680 Ga0495646_0011359 Ga0495646_0011359_4657_5094 127
203 3300046683 Ga0495658_0000936 Ga0495658_0000936_235_672 127
204 3300046690 Ga0495624_0000810 Ga0495624_0000810_275_712 127
205 3300047315 Ga0495581_0000683 Ga0495581_0000683_295_732 127
206 3300047319 Ga0495674_0012056 Ga0495674_0012056_7436_7873 127
207 3300047673 Ga0495593_0000370 Ga0495593_0000370_155_592 127
208 3300053085 Ga0495619_0600114 Ga0495619_0600114_167_604 127
209 3300005327 Ga0070658_11093265 Ga0070658_110932651 128
210 3300005336 Ga0070680_100234704 Ga0070680_1002347042 128
211 3300005458 Ga0070681_10313362 Ga0070681_103133622 128
212 3300005530 Ga0070679_100032725 Ga0070679_1000327252 128
213 3300005563 Ga0068855_100027913 Ga0068855_1000279136 128
214 3300005616 Ga0068852_100400756 Ga0068852_1004007562 128
215 3300007788 Ga0099795_10023531 Ga0099795_100235312 128
216 3300009093 Ga0105240_10077665 Ga0105240_100776652 128
217 3300009545 Ga0105237_11349387 Ga0105237_113493872 128
218 3300010159 Ga0099796_10058069 Ga0099796_100580692 128
219 3300010159 Ga0099796_10065048 Ga0099796_100650481 128
220 3300010159 Ga0099796_10464715 Ga0099796_104647152 128
221 3300013104 Ga0157370_10363719 Ga0157370_103637192 128
222 3300013297 Ga0157378_10041263 Ga0157378_100412632 128
223 3300025909 Ga0207705_10038153 Ga0207705_100381532 128
224 3300025912 Ga0207707_10268715 Ga0207707_102687152 128
225 3300025913 Ga0207695_10043787 Ga0207695_100437876 128
226 3300025917 Ga0207660_10030604 Ga0207660_100306043 128
227 3300025921 Ga0207652_10580271 Ga0207652_105802712 128
228 3300025924 Ga0207694_11591969 Ga0207694_115919691 128
229 3300025949 Ga0207667_10015856 Ga0207667_100158566 128
230 3300025986 Ga0207658_10086653 Ga0207658_100866535 128
231 3300026041 Ga0207639_10474126 Ga0207639_104741262 128
232 3300026078 Ga0207702_11706555 Ga0207702_117065551 128
233 3300028556 Ga0265337_1003913 Ga0265337_10039133 128
234 3300028558 Ga0265326_10006121 Ga0265326_100061214 128
235 3300028563 Ga0265319_1015989 Ga0265319_10159893 128
236 3300028573 Ga0265334_10011650 Ga0265334_100116502 128
237 3300028577 Ga0265318_10011203 Ga0265318_100112035 128
238 3300028653 Ga0265323_10000706 Ga0265323_1000070614 128
239 3300028654 Ga0265322_10014719 Ga0265322_100147192 128
240 3300028666 Ga0265336_10000683 Ga0265336_100006833 128
241 3300028800 Ga0265338_10001041 Ga0265338_1000104132 128
242 3300029957 Ga0265324_10002208 Ga0265324_100022088 128
243 3300031507 Ga0307509_10728008 Ga0307509_107280081 128
244 3300044656 Ga0466969_0090592 Ga0466969_0090592_696_1082 128
245 3300044684 Ga0466966_0001471 Ga0466966_0001471_13963_14349 128
246 3300044693 Ga0466961_0004761 Ga0466961_0004761_7994_8380 128
247 3300045049 Ga0466959_0005681 Ga0466959_0005681_8008_8394 128
248 3300045836 Ga0466958_0052462 Ga0466958_0052462_743_1129 128
249 3300046462 Ga0495651_0019479 Ga0495651_0019479_1671_2057 128
250 3300046477 Ga0495664_0001204 Ga0495664_0001204_5506_5892 128
251 3300046511 Ga0495608_0108241 Ga0495608_0108241_702_1088 128
252 3300046516 Ga0495628_0061793 Ga0495628_0061793_195_581 128
253 3300046517 Ga0495630_0137068 Ga0495630_0137068_223_609 128
254 3300046529 Ga0495652_0006258 Ga0495652_0006258_1961_2347 128
255 3300046533 Ga0495640_0032685 Ga0495640_0032685_1270_1656 128
256 3300046536 Ga0495587_0030628 Ga0495587_0030628_1401_1787 128
257 3300046543 Ga0495645_0002277 Ga0495645_0002277_9812_10198 128
258 3300046559 Ga0495667_0139683 Ga0495667_0139683_1009_1395 128
259 3300046675 Ga0495657_0015079 Ga0495657_0015079_5090_5476 128
260 3300046679 Ga0495623_0042017 Ga0495623_0042017_63_449 128
261 3300046689 Ga0495613_0131395 Ga0495613_0131395_158_544 128
262 3300046809 Ga0495600_0072440 Ga0495600_0072440_1425_1811 128
263 3300047317 Ga0495604_0215880 Ga0495604_0215880_748_1134 128
264 3300047319 Ga0495674_0146672 Ga0495674_0146672_156_542 128
265 3300047322 Ga0495680_0010179 Ga0495680_0010179_1803_2189 128
266 3300047444 Ga0495675_0054237 Ga0495675_0054237_73_459 128
267 3300047673 Ga0495593_0468210 Ga0495593_0468210_105_491 128
268 3300048088 Ga0495602_0016617 Ga0495602_0016617_6829_7215 128
269 3300048924 Ga0496121_0276276 Ga0496121_0276276_376_762 128
270 3300048929 Ga0496126_0451711 Ga0496126_0451711_38_424 128
271 3300049580 Ga0501046_0293391 Ga0501046_0293391_631_1017 128
272 3300049581 Ga0501047_0326464 Ga0501047_0326464_327_713 128
273 3300049586 Ga0501070_0451380 Ga0501070_0451380_181_567 128
274 3300049589 Ga0501073_0023882 Ga0501073_0023882_2871_3257 128
275 3300049742 Ga0501080_0245707 Ga0501080_0245707_135_521 128
276 3300049823 Ga0501044_0148202 Ga0501044_0148202_1809_2195 128
277 3300053084 Ga0495595_0016919 Ga0495595_0016919_2028_2414 128
278 2162886007 SwRhRL2b_contig_1152838 SwRhRL2b_0516.00007090 129
279 3300000546 LJNas_1010822 LJNas_10108222 129
280 3300002070 JGI24750J21931_1031981 JGI24750J21931_10319812 129
281 3300002070 JGI24750J21931_1063118 JGI24750J21931_10631182 129
282 3300003214 JGI25165J46597_1006262 JGI25165J46597_10062623 129
283 3300003215 JGI25153J46596_10007332 JGI25153J46596_100073327 129
284 3300003354 JGI25160J50197_1004506 JGI25160J50197_10045062 129
285 3300003354 JGI25160J50197_1013881 JGI25160J50197_10138812 129
286 3300003752 Ga0055539_1004325 Ga0055539_10043253 129
287 3300003759 Ga0055525_1002098 Ga0055525_10020982 129
288 3300003763 Ga0055529_1026258 Ga0055529_10262582 129
289 3300003911 JGI25405J52794_10051980 JGI25405J52794_100519802 129
290 3300005262 Ga0065165_1038729 Ga0065165_10387292 129
291 3300005262 Ga0065165_1051290 Ga0065165_10512902 129
292 3300005293 Ga0065715_10959514 Ga0065715_109595141 129
293 3300005295 Ga0065707_10269492 Ga0065707_102694922 129
294 3300005327 Ga0070658_10991817 Ga0070658_109918171 129
295 3300005328 Ga0070676_10120250 Ga0070676_101202503 129
296 3300005329 Ga0070683_100516816 Ga0070683_1005168162 129
297 3300005330 Ga0070690_100383783 Ga0070690_1003837832 129
298 3300005334 Ga0068869_100581078 Ga0068869_1005810782 129
299 3300005334 Ga0068869_100657034 Ga0068869_1006570342 129
300 3300005335 Ga0070666_10288859 Ga0070666_102888592 129
301 3300005335 Ga0070666_11089799 Ga0070666_110897992 129
302 3300005337 Ga0070682_100489403 Ga0070682_1004894032 129
303 3300005337 Ga0070682_100539656 Ga0070682_1005396562 129
304 3300005338 Ga0068868_100413378 Ga0068868_1004133782 129
305 3300005338 Ga0068868_100745635 Ga0068868_1007456352 129
306 3300005340 Ga0070689_101098717 Ga0070689_1010987171 129
307 3300005344 Ga0070661_100201285 Ga0070661_1002012852 129
308 3300005347 Ga0070668_100133324 Ga0070668_1001333243 129
309 3300005347 Ga0070668_100403570 Ga0070668_1004035702 129
310 3300005347 Ga0070668_100526205 Ga0070668_1005262052 129
311 3300005347 Ga0070668_100624708 Ga0070668_1006247082 129
312 3300005353 Ga0070669_100244610 Ga0070669_1002446102 129
313 3300005354 Ga0070675_100926861 Ga0070675_1009268612 129
314 3300005355 Ga0070671_100477036 Ga0070671_1004770362 129
315 3300005355 Ga0070671_100591409 Ga0070671_1005914092 129
316 3300005356 Ga0070674_101084167 Ga0070674_1010841671 129
317 3300005356 Ga0070674_101226721 Ga0070674_1012267212 129
318 3300005364 Ga0070673_101423740 Ga0070673_1014237401 129
319 3300005366 Ga0070659_100261285 Ga0070659_1002612852 129
320 3300005406 Ga0070703_10318752 Ga0070703_103187522 129
321 3300005438 Ga0070701_10266289 Ga0070701_102662892 129
322 3300005438 Ga0070701_10960624 Ga0070701_109606241 129
323 3300005440 Ga0070705_100350181 Ga0070705_1003501811 129
324 3300005441 Ga0070700_100177552 Ga0070700_1001775522 129
325 3300005444 Ga0070694_100300012 Ga0070694_1003000122 129
326 3300005455 Ga0070663_100225406 Ga0070663_1002254062 129
327 3300005455 Ga0070663_100611876 Ga0070663_1006118761 129
328 3300005456 Ga0070678_100046211 Ga0070678_1000462112 129
329 3300005456 Ga0070678_100265017 Ga0070678_1002650172 129
330 3300005456 Ga0070678_101217841 Ga0070678_1012178411 129
331 3300005457 Ga0070662_100424429 Ga0070662_1004244292 129
332 3300005458 Ga0070681_10254456 Ga0070681_102544563 129
333 3300005459 Ga0068867_101193113 Ga0068867_1011931131 129
334 3300005466 Ga0070685_10090029 Ga0070685_100900292 129
335 3300005467 Ga0070706_100619142 Ga0070706_1006191422 129
336 3300005468 Ga0070707_101100749 Ga0070707_1011007492 129
337 3300005471 Ga0070698_100194297 Ga0070698_1001942974 129
338 3300005471 Ga0070698_100217995 Ga0070698_1002179953 129
339 3300005518 Ga0070699_100871003 Ga0070699_1008710032 129
340 3300005530 Ga0070679_100113377 Ga0070679_1001133775 129
341 3300005539 Ga0068853_100226396 Ga0068853_1002263962 129
342 3300005539 Ga0068853_100243890 Ga0068853_1002438902 129
343 3300005539 Ga0068853_100699799 Ga0068853_1006997992 129
344 3300005539 Ga0068853_101403140 Ga0068853_1014031402 129
345 3300005543 Ga0070672_101381990 Ga0070672_1013819902 129
346 3300005544 Ga0070686_100592194 Ga0070686_1005921942 129
347 3300005545 Ga0070695_100254615 Ga0070695_1002546152 129
348 3300005546 Ga0070696_100355490 Ga0070696_1003554902 129
349 3300005547 Ga0070693_100142838 Ga0070693_1001428382 129
350 3300005547 Ga0070693_100717490 Ga0070693_1007174902 129
351 3300005548 Ga0070665_100044008 Ga0070665_1000440082 129
352 3300005548 Ga0070665_100129065 Ga0070665_1001290655 129
353 3300005548 Ga0070665_100196283 Ga0070665_1001962833 129
354 3300005548 Ga0070665_100581668 Ga0070665_1005816682 129
355 3300005548 Ga0070665_101218717 Ga0070665_1012187171 129
356 3300005549 Ga0070704_100601501 Ga0070704_1006015012 129
357 3300005563 Ga0068855_100384951 Ga0068855_1003849512 129
358 3300005563 Ga0068855_100695465 Ga0068855_1006954652 129
359 3300005563 Ga0068855_101470103 Ga0068855_1014701031 129
360 3300005578 Ga0068854_101211080 Ga0068854_1012110802 129
361 3300005614 Ga0068856_100034134 Ga0068856_1000341346 129
362 3300005616 Ga0068852_100027518 Ga0068852_1000275182 129
363 3300005616 Ga0068852_100102155 Ga0068852_1001021553 129
364 3300005616 Ga0068852_100131914 Ga0068852_1001319143 129
365 3300005616 Ga0068852_100664039 Ga0068852_1006640392 129
366 3300005617 Ga0068859_100687116 Ga0068859_1006871162 129
367 3300005618 Ga0068864_100081294 Ga0068864_1000812945 129
368 3300005718 Ga0068866_10320746 Ga0068866_103207462 129
369 3300005719 Ga0068861_100444455 Ga0068861_1004444552 129
370 3300005841 Ga0068863_100295555 Ga0068863_1002955552 129
371 3300005841 Ga0068863_100301463 Ga0068863_1003014633 129
372 3300005841 Ga0068863_100420879 Ga0068863_1004208792 129
373 3300005842 Ga0068858_100061588 Ga0068858_1000615882 129
374 3300005843 Ga0068860_100293450 Ga0068860_1002934502 129
375 3300005843 Ga0068860_101351576 Ga0068860_1013515762 129
376 3300005844 Ga0068862_100216295 Ga0068862_1002162952 129
377 3300005937 Ga0081455_10004895 Ga0081455_100048953 129
378 3300005937 Ga0081455_10044688 Ga0081455_100446883 129
379 3300005983 Ga0081540_1015444 Ga0081540_10154442 129
380 3300005983 Ga0081540_1273944 Ga0081540_12739441 129
381 3300006028 Ga0070717_10321900 Ga0070717_103219002 129
382 3300006028 Ga0070717_10927631 Ga0070717_109276312 129
383 3300006028 Ga0070717_11291450 Ga0070717_112914502 129
384 3300006038 Ga0075365_10071356 Ga0075365_100713563 129
385 3300006038 Ga0075365_10178722 Ga0075365_101787222 129
386 3300006042 Ga0075368_10263162 Ga0075368_102631622 129
387 3300006048 Ga0075363_100026229 Ga0075363_1000262292 129
388 3300006048 Ga0075363_100309028 Ga0075363_1003090282 129
389 3300006048 Ga0075363_100477466 Ga0075363_1004774661 129
390 3300006051 Ga0075364_10182993 Ga0075364_101829932 129
391 3300006051 Ga0075364_11070387 Ga0075364_110703871 129
392 3300006058 Ga0075432_10501546 Ga0075432_105015461 129
393 3300006177 Ga0075362_10141081 Ga0075362_101410812 129
394 3300006177 Ga0075362_10408566 Ga0075362_104085662 129
395 3300006178 Ga0075367_10023304 Ga0075367_100233043 129
396 3300006178 Ga0075367_10179821 Ga0075367_101798212 129
397 3300006178 Ga0075367_10363027 Ga0075367_103630272 129
398 3300006186 Ga0075369_10223148 Ga0075369_102231482 129
399 3300006186 Ga0075369_10247410 Ga0075369_102474102 129
400 3300006195 Ga0075366_10383429 Ga0075366_103834291 129
401 3300006195 Ga0075366_10452268 Ga0075366_104522682 129
402 3300006195 Ga0075366_10722626 Ga0075366_107226262 129
403 3300006237 Ga0097621_100046159 Ga0097621_1000461592 129
404 3300006237 Ga0097621_100065762 Ga0097621_1000657623 129
405 3300006237 Ga0097621_100071933 Ga0097621_1000719332 129
406 3300006237 Ga0097621_100437270 Ga0097621_1004372702 129
407 3300006237 Ga0097621_100858331 Ga0097621_1008583312 129
408 3300006353 Ga0075370_10137868 Ga0075370_101378682 129
409 3300006353 Ga0075370_10197168 Ga0075370_101971681 129
410 3300006353 Ga0075370_10463754 Ga0075370_104637541 129
411 3300006353 Ga0075370_10552309 Ga0075370_105523092 129
412 3300006358 Ga0068871_100047551 Ga0068871_1000475512 129
413 3300006844 Ga0075428_102420772 Ga0075428_1024207721 129
414 3300006880 Ga0075429_100556047 Ga0075429_1005560472 129
415 3300006914 Ga0075436_100438727 Ga0075436_1004387271 129
416 3300006931 Ga0097620_100687110 Ga0097620_1006871102 129
417 3300007076 Ga0075435_100252215 Ga0075435_1002522153 129
418 3300009092 Ga0105250_10058226 Ga0105250_100582262 129
419 3300009093 Ga0105240_10095052 Ga0105240_100950526 129
420 3300009093 Ga0105240_10171844 Ga0105240_101718442 129
421 3300009093 Ga0105240_11015317 Ga0105240_110153172 129
422 3300009094 Ga0111539_10871624 Ga0111539_108716242 129
423 3300009098 Ga0105245_10031932 Ga0105245_100319327 129
424 3300009098 Ga0105245_10066139 Ga0105245_100661395 129
425 3300009101 Ga0105247_10156695 Ga0105247_101566952 129
426 3300009101 Ga0105247_10288705 Ga0105247_102887052 129
427 3300009147 Ga0114129_12185399 Ga0114129_121853991 129
428 3300009148 Ga0105243_10574308 Ga0105243_105743082 129
429 3300009174 Ga0105241_10087362 Ga0105241_100873622 129
430 3300009174 Ga0105241_10837477 Ga0105241_108374772 129
431 3300009176 Ga0105242_10626389 Ga0105242_106263891 129
432 3300009177 Ga0105248_10159915 Ga0105248_101599152 129
433 3300009177 Ga0105248_10483422 Ga0105248_104834222 129
434 3300009545 Ga0105237_10300641 Ga0105237_103006413 129
435 3300009545 Ga0105237_10531219 Ga0105237_105312192 129
436 3300009545 Ga0105237_11033735 Ga0105237_110337352 129
437 3300009545 Ga0105237_11287947 Ga0105237_112879472 129
438 3300009545 Ga0105237_11304403 Ga0105237_113044031 129
439 3300009551 Ga0105238_10060989 Ga0105238_100609892 129
440 3300009551 Ga0105238_10301875 Ga0105238_103018753 129
441 3300009551 Ga0105238_10582021 Ga0105238_105820212 129
442 3300010375 Ga0105239_10056885 Ga0105239_100568851 129
443 3300010375 Ga0105239_10356352 Ga0105239_103563522 129
444 3300010375 Ga0105239_10534925 Ga0105239_105349252 129
445 3300010375 Ga0105239_10886064 Ga0105239_108860642 129
446 3300010375 Ga0105239_10938201 Ga0105239_109382012 129
447 3300010375 Ga0105239_11644743 Ga0105239_116447432 129
448 3300011119 Ga0105246_10040750 Ga0105246_100407505 129
449 3300012500 Ga0157314_1004494 Ga0157314_10044941 129
450 3300013104 Ga0157370_10525003 Ga0157370_105250032 129
451 3300013296 Ga0157374_10116742 Ga0157374_101167422 129
452 3300013297 Ga0157378_10498718 Ga0157378_104987182 129
453 3300013306 Ga0163162_10590323 Ga0163162_105903232 129
454 3300013306 Ga0163162_11322535 Ga0163162_113225352 129
455 3300013306 Ga0163162_11832449 Ga0163162_118324492 129
456 3300013307 Ga0157372_11346533 Ga0157372_113465332 129
457 3300013307 Ga0157372_12269031 Ga0157372_122690312 129
458 3300013308 Ga0157375_10132487 Ga0157375_101324875 129
459 3300013308 Ga0157375_10343143 Ga0157375_103431432 129
460 3300014325 Ga0163163_10889207 Ga0163163_108892072 129
461 3300014325 Ga0163163_12434774 Ga0163163_124347742 129
462 3300014326 Ga0157380_10216361 Ga0157380_102163613 129
463 3300014745 Ga0157377_10135851 Ga0157377_101358513 129
464 3300014968 Ga0157379_10702120 Ga0157379_107021202 129
465 3300021384 Ga0213876_10020100 Ga0213876_100201003 129
466 3300025230 Ga0209563_100670 Ga0209563_10067011 129
467 3300025253 Ga0209677_102054 Ga0209677_1020548 129
468 3300025253 Ga0209677_107376 Ga0209677_1073763 129
469 3300025254 Ga0209148_1000874 Ga0209148_100087417 129
470 3300025254 Ga0209148_1025450 Ga0209148_10254502 129
471 3300025261 Ga0209233_1013039 Ga0209233_10130393 129
472 3300025261 Ga0209233_1025706 Ga0209233_10257063 129
473 3300025272 Ga0209455_1001536 Ga0209455_10015369 129
474 3300025272 Ga0209455_1003873 Ga0209455_10038733 129
475 3300025272 Ga0209455_1026679 Ga0209455_10266792 129
476 3300025284 Ga0209130_1007941 Ga0209130_10079412 129
477 3300025284 Ga0209130_1049575 Ga0209130_10495752 129
478 3300025297 Ga0209758_1007103 Ga0209758_10071032 129
479 3300025297 Ga0209758_1009747 Ga0209758_10097477 129
480 3300025297 Ga0209758_1022815 Ga0209758_10228153 129
481 3300025297 Ga0209758_1132869 Ga0209758_11328692 129
482 3300025299 Ga0209256_1032643 Ga0209256_10326432 129
483 3300025302 Ga0207426_1000704 Ga0207426_10007047 129
484 3300025302 Ga0207426_1001257 Ga0207426_10012573 129
485 3300025302 Ga0207426_1015711 Ga0207426_10157112 129
486 3300025315 Ga0207697_10057876 Ga0207697_100578762 129
487 3300025315 Ga0207697_10208950 Ga0207697_102089501 129
488 3300025711 Ga0207696_1049753 Ga0207696_10497532 129
489 3300025885 Ga0207653_10121759 Ga0207653_101217592 129
490 3300025899 Ga0207642_10291773 Ga0207642_102917732 129
491 3300025901 Ga0207688_10021647 Ga0207688_100216476 129
492 3300025903 Ga0207680_10546826 Ga0207680_105468262 129
493 3300025904 Ga0207647_10018041 Ga0207647_100180412 129
494 3300025907 Ga0207645_10048193 Ga0207645_100481932 129
495 3300025907 Ga0207645_10368505 Ga0207645_103685052 129
496 3300025908 Ga0207643_10065231 Ga0207643_100652313 129
497 3300025909 Ga0207705_10677885 Ga0207705_106778852 129
498 3300025909 Ga0207705_11525314 Ga0207705_115253141 129
499 3300025910 Ga0207684_10109894 Ga0207684_101098942 129
500 3300025910 Ga0207684_10205152 Ga0207684_102051523 129
501 3300025911 Ga0207654_10031015 Ga0207654_100310153 129
502 3300025911 Ga0207654_10083473 Ga0207654_100834732 129
503 3300025911 Ga0207654_10510284 Ga0207654_105102841 129
504 3300025912 Ga0207707_10001534 Ga0207707_100015342 129
505 3300025913 Ga0207695_10001156 Ga0207695_100011562 129
506 3300025914 Ga0207671_10050733 Ga0207671_100507332 129
507 3300025914 Ga0207671_10221960 Ga0207671_102219602 129
508 3300025914 Ga0207671_10834669 Ga0207671_108346692 129
509 3300025914 Ga0207671_10836483 Ga0207671_108364831 129
510 3300025916 Ga0207663_10757017 Ga0207663_107570171 129
511 3300025920 Ga0207649_10268498 Ga0207649_102684982 129
512 3300025920 Ga0207649_10397486 Ga0207649_103974862 129
513 3300025920 Ga0207649_10577321 Ga0207649_105773211 129
514 3300025923 Ga0207681_10126894 Ga0207681_101268941 129
515 3300025923 Ga0207681_10677493 Ga0207681_106774932 129
516 3300025924 Ga0207694_10181955 Ga0207694_101819552 129
517 3300025924 Ga0207694_10725944 Ga0207694_107259442 129
518 3300025926 Ga0207659_11109026 Ga0207659_111090262 129
519 3300025927 Ga0207687_10020017 Ga0207687_100200173 129
520 3300025927 Ga0207687_10273942 Ga0207687_102739422 129
521 3300025931 Ga0207644_10470208 Ga0207644_104702082 129
522 3300025933 Ga0207706_10270981 Ga0207706_102709812 129
523 3300025935 Ga0207709_10247442 Ga0207709_102474423 129
524 3300025936 Ga0207670_10680698 Ga0207670_106806982 129
525 3300025937 Ga0207669_10085987 Ga0207669_100859873 129
526 3300025937 Ga0207669_10105585 Ga0207669_101055852 129
527 3300025939 Ga0207665_10488229 Ga0207665_104882291 129
528 3300025941 Ga0207711_10307445 Ga0207711_103074452 129
529 3300025941 Ga0207711_10405652 Ga0207711_104056522 129
530 3300025942 Ga0207689_10860300 Ga0207689_108603002 129
531 3300025942 Ga0207689_10883512 Ga0207689_108835122 129
532 3300025945 Ga0207679_10155774 Ga0207679_101557742 129
533 3300025949 Ga0207667_10367000 Ga0207667_103670002 129
534 3300025949 Ga0207667_10652598 Ga0207667_106525982 129
535 3300025949 Ga0207667_10780641 Ga0207667_107806412 129
536 3300025949 Ga0207667_10923756 Ga0207667_109237562 129
537 3300025961 Ga0207712_10077095 Ga0207712_100770952 129
538 3300025972 Ga0207668_10546712 Ga0207668_105467122 129
539 3300025981 Ga0207640_10475476 Ga0207640_104754762 129
540 3300025981 Ga0207640_10511237 Ga0207640_105112372 129
541 3300025981 Ga0207640_10987197 Ga0207640_109871972 129
542 3300025986 Ga0207658_10354585 Ga0207658_103545852 129
543 3300025986 Ga0207658_10846949 Ga0207658_108469492 129
544 3300026023 Ga0207677_10038533 Ga0207677_100385335 129
545 3300026023 Ga0207677_10108262 Ga0207677_101082622 129
546 3300026023 Ga0207677_10837926 Ga0207677_108379262 129
547 3300026035 Ga0207703_10043372 Ga0207703_100433726 129
548 3300026035 Ga0207703_10391022 Ga0207703_103910223 129
549 3300026041 Ga0207639_10159766 Ga0207639_101597663 129
550 3300026041 Ga0207639_10253862 Ga0207639_102538622 129
551 3300026041 Ga0207639_10347931 Ga0207639_103479312 129
552 3300026041 Ga0207639_11266570 Ga0207639_112665702 129
553 3300026067 Ga0207678_10076141 Ga0207678_100761415 129
554 3300026067 Ga0207678_10084233 Ga0207678_100842335 129
555 3300026075 Ga0207708_10384321 Ga0207708_103843212 129
556 3300026078 Ga0207702_10508208 Ga0207702_105082082 129
557 3300026078 Ga0207702_10852814 Ga0207702_108528142 129
558 3300026088 Ga0207641_10317453 Ga0207641_103174533 129
559 3300026088 Ga0207641_10842593 Ga0207641_108425932 129
560 3300026089 Ga0207648_10231352 Ga0207648_102313523 129
561 3300026089 Ga0207648_10731481 Ga0207648_107314812 129
562 3300026095 Ga0207676_10321145 Ga0207676_103211453 129
563 3300026116 Ga0207674_10423992 Ga0207674_104239921 129
564 3300026116 Ga0207674_11134276 Ga0207674_111342762 129
565 3300026118 Ga0207675_100923058 Ga0207675_1009230582 129
566 3300026121 Ga0207683_10422865 Ga0207683_104228652 129
567 3300026121 Ga0207683_10623410 Ga0207683_106234102 129
568 3300026121 Ga0207683_10728616 Ga0207683_107286162 129
569 3300026142 Ga0207698_10101537 Ga0207698_101015374 129
570 3300026142 Ga0207698_10219781 Ga0207698_102197812 129
571 3300026142 Ga0207698_10662982 Ga0207698_106629822 129
572 3300026142 Ga0207698_11139783 Ga0207698_111397832 129
573 3300028379 Ga0268266_10009167 Ga0268266_100091673 129
574 3300028379 Ga0268266_10080191 Ga0268266_100801913 129
575 3300028379 Ga0268266_10095681 Ga0268266_100956812 129
576 3300028379 Ga0268266_11496613 Ga0268266_114966132 129
577 3300028380 Ga0268265_10215400 Ga0268265_102154002 129
578 3300028380 Ga0268265_12083401 Ga0268265_120834012 129
579 3300028381 Ga0268264_10284455 Ga0268264_102844552 129
580 3300031507 Ga0307509_10495966 Ga0307509_104959662 129
581 3300031548 Ga0307408_100432049 Ga0307408_1004320492 129
582 3300031548 Ga0307408_102224574 Ga0307408_1022245741 129
583 3300031616 Ga0307508_10044377 Ga0307508_100443773 129
584 3300031616 Ga0307508_10442515 Ga0307508_104425152 129
585 3300031616 Ga0307508_10818226 Ga0307508_108182261 129
586 3300031711 Ga0265314_10104078 Ga0265314_101040783 129
587 3300031730 Ga0307516_10073486 Ga0307516_100734864 129
588 3300031824 Ga0307413_10092912 Ga0307413_100929123 129
589 3300031852 Ga0307410_10139011 Ga0307410_101390112 129
590 3300031852 Ga0307410_10563169 Ga0307410_105631692 129
591 3300031901 Ga0307406_10063979 Ga0307406_100639792 129
592 3300031911 Ga0307412_10385066 Ga0307412_103850662 129
593 3300031995 Ga0307409_100171799 Ga0307409_1001717991 129
594 3300032002 Ga0307416_100798826 Ga0307416_1007988262 129
595 3300032004 Ga0307414_10124646 Ga0307414_101246463 129
596 3300032005 Ga0307411_10925951 Ga0307411_109259512 129
597 3300032005 Ga0307411_10970521 Ga0307411_109705211 129
598 3300032005 Ga0307411_11537263 Ga0307411_115372631 129
599 3300032126 Ga0307415_100258391 Ga0307415_1002583912 129
600 3300032126 Ga0307415_100501288 Ga0307415_1005012882 129
601 3300033179 Ga0307507_10632107 Ga0307507_106321072 129
602 3300033180 Ga0307510_10035129 Ga0307510_100351297 129
603 3300033180 Ga0307510_10058529 Ga0307510_100585291 129
604 3300035089 Ga0373944_0007533 Ga0373944_0007533_2433_2822 129
605 3300035113 Ga0373936_0008591 Ga0373936_0008591_1356_1745 129
606 3300035113 Ga0373936_0066832 Ga0373936_0066832_855_1244 129
607 3300035114 Ga0373939_0276586 Ga0373939_0276586_66_455 129
608 3300035116 Ga0373945_0014997 Ga0373945_0014997_785_1174 129
609 3300035117 Ga0373953_0125662 Ga0373953_0125662_543_932 129
610 3300035118 Ga0373954_0027517 Ga0373954_0027517_863_1252 129
611 3300035119 Ga0373956_0222439 Ga0373956_0222439_16_405 129
612 3300035120 Ga0373957_0407886 Ga0373957_0407886_16_405 129
613 3300035170 Ga0373943_0406589 Ga0373943_0406589_165_554 129
614 3300035171 Ga0373946_0049993 Ga0373946_0049993_561_950 129
615 3300035171 Ga0373946_0357119 Ga0373946_0357119_233_622 129
616 3300035172 Ga0373955_0042706 Ga0373955_0042706_1814_2203 129
617 3300035410 Ga0373924_0001609 Ga0373924_0001609_3641_4030 129
618 3300035692 Ga0373935_0039107 Ga0373935_0039107_1283_1672 129
619 3300035692 Ga0373935_0156729 Ga0373935_0156729_850_1239 129
620 3300035695 Ga0373927_0209706 Ga0373927_0209706_233_622 129
621 3300035724 Ga0373933_0007993 Ga0373933_0007993_972_1361 129
622 3300035725 Ga0373947_0026448 Ga0373947_0026448_2015_2404 129
623 3300035725 Ga0373947_0104432 Ga0373947_0104432_817_1206 129
624 3300036401 Ga0373937_0135256 Ga0373937_0135256_972_1361 129
625 3300037068 Ga0373925_0017296 Ga0373925_0017296_2888_3277 129
626 3300037068 Ga0373925_0024092 Ga0373925_0024092_2065_2454 129
627 3300037068 Ga0373925_0588595 Ga0373925_0588595_356_745 129
628 3300037853 Ga0436364_0425415 Ga0436364_0425415_349_738 129
629 3300039437 Ga0436365_0238184 Ga0436365_0238184_248_637 129
630 3300039437 Ga0436365_0420080 Ga0436365_0420080_1066_1458 129
631 3300039437 Ga0436365_0989203 Ga0436365_0989203_3278_3670 129
632 3300041413 Ga0439465_0037505 Ga0439465_0037505_642_1031 129
633 3300041443 Ga0451789_1007321 Ga0451789_1007321_106_495 129
634 3300041443 Ga0451789_1157944 Ga0451789_1157944_38_430 129
635 3300041451 Ga0451791_1090847 Ga0451791_1090847_94_483 129
636 3300041452 Ga0451793_0399535 Ga0451793_0399535_43_432 129
637 3300041486 Ga0451807_0338309 Ga0451807_0338309_259_651 129
638 3300041997 Ga0439431_0022287 Ga0439431_0022287_231_620 129
639 3300042438 Ga0439459_0006825 Ga0439459_0006825_1090_1482 129
640 3300044658 Ga0466972_0462459 Ga0466972_0462459_92_481 129
641 3300044693 Ga0466961_0728820 Ga0466961_0728820_65_454 129
642 3300044694 Ga0466963_0014602 Ga0466963_0014602_1340_1729 129
643 3300044719 Ga0466971_0092063 Ga0466971_0092063_188_577 129
644 3300044719 Ga0466971_0163200 Ga0466971_0163200_509_901 129
645 3300044765 Ga0466970_0312853 Ga0466970_0312853_24_416 129
646 3300044765 Ga0466970_0433921 Ga0466970_0433921_91_483 129
647 3300044765 Ga0466970_0527773 Ga0466970_0527773_35_424 129
648 3300044842 Ga0466957_0575120 Ga0466957_0575120_267_659 129
649 3300045049 Ga0466959_0234345 Ga0466959_0234345_773_1165 129
650 3300045049 Ga0466959_0355691 Ga0466959_0355691_140_532 129
651 3300045976 Ga0466967_0037023 Ga0466967_0037023_791_1180 129
652 3300045976 Ga0466967_0125936 Ga0466967_0125936_1537_1929 129
653 3300045976 Ga0466967_0674125 Ga0466967_0674125_475_867 129
654 3300046452 Ga0495617_015362 Ga0495617_015362_749_1138 129
655 3300046452 Ga0495617_202444 Ga0495617_202444_166_555 129
656 3300046454 Ga0495592_0086197 Ga0495592_0086197_647_1036 129
657 3300046454 Ga0495592_0261592 Ga0495592_0261592_546_935 129
658 3300046455 Ga0495603_0050821 Ga0495603_0050821_1045_1434 129
659 3300046455 Ga0495603_0102705 Ga0495603_0102705_1162_1551 129
660 3300046455 Ga0495603_0591647 Ga0495603_0591647_79_468 129
661 3300046459 Ga0495629_0006021 Ga0495629_0006021_1349_1738 129
662 3300046459 Ga0495629_0023701 Ga0495629_0023701_3483_3872 129
663 3300046460 Ga0495638_0037355 Ga0495638_0037355_432_821 129
664 3300046461 Ga0495641_0192463 Ga0495641_0192463_21_410 129
665 3300046462 Ga0495651_0014799 Ga0495651_0014799_655_1044 129
666 3300046462 Ga0495651_0054726 Ga0495651_0054726_179_568 129
667 3300046463 Ga0495653_0107423 Ga0495653_0107423_274_663 129
668 3300046463 Ga0495653_0300894 Ga0495653_0300894_500_889 129
669 3300046472 Ga0495580_0073929 Ga0495580_0073929_177_566 129
670 3300046473 Ga0495582_0003777 Ga0495582_0003777_6626_7015 129
671 3300046475 Ga0495639_0036657 Ga0495639_0036657_1649_2038 129
672 3300046476 Ga0495662_0016856 Ga0495662_0016856_1964_2353 129
673 3300046476 Ga0495662_0018098 Ga0495662_0018098_841_1230 129
674 3300046477 Ga0495664_0049429 Ga0495664_0049429_2091_2480 129
675 3300046477 Ga0495664_0129739 Ga0495664_0129739_722_1111 129
676 3300046492 Ga0495585_0042555 Ga0495585_0042555_1898_2287 129
677 3300046492 Ga0495585_0354516 Ga0495585_0354516_227_616 129
678 3300046499 Ga0495594_0229251 Ga0495594_0229251_17_406 129
679 3300046501 Ga0495607_0525337 Ga0495607_0525337_17_406 129
680 3300046507 Ga0495606_0053703 Ga0495606_0053703_1718_2107 129
681 3300046511 Ga0495608_0162783 Ga0495608_0162783_841_1230 129
682 3300046513 Ga0495616_0086251 Ga0495616_0086251_223_612 129
683 3300046514 Ga0495618_0008828 Ga0495618_0008828_5537_5926 129
684 3300046514 Ga0495618_0043480 Ga0495618_0043480_1384_1773 129
685 3300046515 Ga0495620_0123484 Ga0495620_0123484_479_868 129
686 3300046516 Ga0495628_0169991 Ga0495628_0169991_241_630 129
687 3300046516 Ga0495628_0310172 Ga0495628_0310172_295_684 129
688 3300046518 Ga0495631_0029165 Ga0495631_0029165_1959_2348 129
689 3300046519 Ga0495632_0030152 Ga0495632_0030152_219_608 129
690 3300046520 Ga0495637_0139389 Ga0495637_0139389_301_690 129
691 3300046522 Ga0495643_0287868 Ga0495643_0287868_156_545 129
692 3300046524 Ga0495648_0006267 Ga0495648_0006267_8862_9251 129
693 3300046525 Ga0495663_0024099 Ga0495663_0024099_18_407 129
694 3300046525 Ga0495663_0033542 Ga0495663_0033542_452_841 129
695 3300046529 Ga0495652_0755556 Ga0495652_0755556_246_635 129
696 3300046530 Ga0495654_0133352 Ga0495654_0133352_677_1066 129
697 3300046531 Ga0495665_0137733 Ga0495665_0137733_142_531 129
698 3300046531 Ga0495665_0627161 Ga0495665_0627161_131_520 129
699 3300046533 Ga0495640_0014432 Ga0495640_0014432_1099_1488 129
700 3300046535 Ga0495586_0026816 Ga0495586_0026816_628_1017 129
701 3300046537 Ga0495598_0009519 Ga0495598_0009519_799_1188 129
702 3300046538 Ga0495609_0069311 Ga0495609_0069311_681_1070 129
703 3300046538 Ga0495609_0147697 Ga0495609_0147697_313_702 129
704 3300046539 Ga0495621_0501872 Ga0495621_0501872_99_488 129
705 3300046557 Ga0495622_0013329 Ga0495622_0013329_142_531 129
706 3300046557 Ga0495622_0054035 Ga0495622_0054035_277_666 129
707 3300046557 Ga0495622_0114264 Ga0495622_0114264_759_1148 129
708 3300046558 Ga0495633_0093126 Ga0495633_0093126_619_1008 129
709 3300046559 Ga0495667_0166789 Ga0495667_0166789_17_406 129
710 3300046559 Ga0495667_0620530 Ga0495667_0620530_126_515 129
711 3300046615 Ga0495656_0066657 Ga0495656_0066657_1012_1401 129
712 3300046616 Ga0495668_0023015 Ga0495668_0023015_2874_3263 129
713 3300046616 Ga0495668_0404103 Ga0495668_0404103_145_534 129
714 3300046642 Ga0495634_0034146 Ga0495634_0034146_232_621 129
715 3300046660 Ga0495625_0203704 Ga0495625_0203704_230_619 129
716 3300046660 Ga0495625_0686204 Ga0495625_0686204_72_461 129
717 3300046663 Ga0495635_0038449 Ga0495635_0038449_1221_1610 129
718 3300046663 Ga0495635_0074254 Ga0495635_0074254_1616_2005 129
719 3300046664 Ga0495659_0068490 Ga0495659_0068490_367_756 129
720 3300046665 Ga0495661_0204820 Ga0495661_0204820_515_904 129
721 3300046665 Ga0495661_0205345 Ga0495661_0205345_252_641 129
722 3300046665 Ga0495661_0311856 Ga0495661_0311856_165_554 129
723 3300046674 Ga0495588_0182789 Ga0495588_0182789_242_631 129
724 3300046675 Ga0495657_0095578 Ga0495657_0095578_1342_1731 129
725 3300046680 Ga0495646_0029121 Ga0495646_0029121_175_564 129
726 3300046680 Ga0495646_0097496 Ga0495646_0097496_242_631 129
727 3300046681 Ga0495647_0019286 Ga0495647_0019286_1443_1832 129
728 3300046683 Ga0495658_0020828 Ga0495658_0020828_3044_3433 129
729 3300046683 Ga0495658_0739339 Ga0495658_0739339_133_522 129
730 3300046684 Ga0495669_0039321 Ga0495669_0039321_1583_1972 129
731 3300046684 Ga0495669_0324230 Ga0495669_0324230_164_553 129
732 3300046689 Ga0495613_0375342 Ga0495613_0375342_142_531 129
733 3300046690 Ga0495624_0177037 Ga0495624_0177037_488_877 129
734 3300046690 Ga0495624_0306856 Ga0495624_0306856_163_552 129
735 3300046690 Ga0495624_0510145 Ga0495624_0510145_26_415 129
736 3300046691 Ga0495670_0082982 Ga0495670_0082982_1119_1508 129
737 3300046692 Ga0495671_0064047 Ga0495671_0064047_428_817 129
738 3300046692 Ga0495671_0148277 Ga0495671_0148277_296_685 129
739 3300046809 Ga0495600_0011127 Ga0495600_0011127_398_787 129
740 3300047315 Ga0495581_0091563 Ga0495581_0091563_31_420 129
741 3300047315 Ga0495581_0649851 Ga0495581_0649851_16_405 129
742 3300047318 Ga0495636_0524273 Ga0495636_0524273_128_517 129
743 3300047319 Ga0495674_0677532 Ga0495674_0677532_320_709 129
744 3300047320 Ga0495672_0133343 Ga0495672_0133343_149_538 129
745 3300047320 Ga0495672_0172127 Ga0495672_0172127_517_906 129
746 3300047321 Ga0495676_0008153 Ga0495676_0008153_6513_6902 129
747 3300047321 Ga0495676_0347411 Ga0495676_0347411_181_570 129
748 3300047321 Ga0495676_0576727 Ga0495676_0576727_124_513 129
749 3300047322 Ga0495680_0166652 Ga0495680_0166652_1125_1514 129
750 3300047322 Ga0495680_0721149 Ga0495680_0721149_95_484 129
751 3300047447 Ga0495685_064697 Ga0495685_064697_135_524 129
752 3300047469 Ga0495673_0106682 Ga0495673_0106682_666_1055 129
753 3300047470 Ga0495681_0133666 Ga0495681_0133666_220_609 129
754 3300047470 Ga0495681_0150884 Ga0495681_0150884_348_737 129
755 3300047471 Ga0495684_0272730 Ga0495684_0272730_693_1082 129
756 3300047472 Ga0495686_0255772 Ga0495686_0255772_376_765 129
757 3300047472 Ga0495686_0268809 Ga0495686_0268809_326_715 129
758 3300047472 Ga0495686_0282218 Ga0495686_0282218_105_494 129
759 3300047673 Ga0495593_0062481 Ga0495593_0062481_1332_1721 129
760 3300048088 Ga0495602_0610482 Ga0495602_0610482_184_573 129
761 3300048903 Ga0496100_0251157 Ga0496100_0251157_290_679 129
762 3300048903 Ga0496100_0393953 Ga0496100_0393953_92_484 129
763 3300048904 Ga0496101_0533808 Ga0496101_0533808_202_591 129
764 3300048904 Ga0496101_1325825 Ga0496101_1325825_45_434 129
765 3300048905 Ga0496102_0234656 Ga0496102_0234656_729_1118 129
766 3300048905 Ga0496102_0636406 Ga0496102_0636406_89_478 129
767 3300048905 Ga0496102_1702229 Ga0496102_1702229_17_406 129
768 3300048908 Ga0496105_0063923 Ga0496105_0063923_2458_2847 129
769 3300048911 Ga0496108_0025132 Ga0496108_0025132_2539_2928 129
770 3300048912 Ga0496109_0308781 Ga0496109_0308781_287_676 129
771 3300048912 Ga0496109_0577146 Ga0496109_0577146_147_536 129
772 3300048913 Ga0496110_0286131 Ga0496110_0286131_517_906 129
773 3300048915 Ga0496112_0243501 Ga0496112_0243501_871_1260 129
774 3300048915 Ga0496112_0252013 Ga0496112_0252013_1165_1554 129
775 3300048915 Ga0496112_0526207 Ga0496112_0526207_307_696 129
776 3300048916 Ga0496113_0729959 Ga0496113_0729959_28_417 129
777 3300048916 Ga0496113_1040045 Ga0496113_1040045_141_530 129
778 3300048918 Ga0496115_0553680 Ga0496115_0553680_256_645 129
779 3300048919 Ga0496116_0285990 Ga0496116_0285990_239_628 129
780 3300048920 Ga0496117_0303195 Ga0496117_0303195_139_528 129
781 3300048921 Ga0496118_0011634 Ga0496118_0011634_297_689 129
782 3300048921 Ga0496118_0126147 Ga0496118_0126147_145_534 129
783 3300048921 Ga0496118_0261619 Ga0496118_0261619_366_755 129
784 3300048922 Ga0496119_0022207 Ga0496119_0022207_323_712 129
785 3300048923 Ga0496120_0085482 Ga0496120_0085482_151_540 129
786 3300048923 Ga0496120_0095207 Ga0496120_0095207_881_1270 129
787 3300048924 Ga0496121_0040352 Ga0496121_0040352_163_552 129
788 3300048924 Ga0496121_0054773 Ga0496121_0054773_1323_1715 129
789 3300048924 Ga0496121_0090891 Ga0496121_0090891_424_816 129
790 3300048924 Ga0496121_0132894 Ga0496121_0132894_826_1215 129
791 3300048924 Ga0496121_0150187 Ga0496121_0150187_1125_1520 129
792 3300048924 Ga0496121_0182598 Ga0496121_0182598_614_1006 129
793 3300048924 Ga0496121_0326255 Ga0496121_0326255_513_902 129
794 3300048926 Ga0496123_0348889 Ga0496123_0348889_157_546 129
795 3300048927 Ga0496124_0112193 Ga0496124_0112193_1761_2150 129
796 3300048928 Ga0496125_0102411 Ga0496125_0102411_1537_1926 129
797 3300048928 Ga0496125_0123949 Ga0496125_0123949_602_994 129
798 3300048929 Ga0496126_0159757 Ga0496126_0159757_336_731 129
799 3300048929 Ga0496126_0351956 Ga0496126_0351956_291_680 129
800 3300048929 Ga0496126_0429566 Ga0496126_0429566_317_709 129
801 3300048929 Ga0496126_0481152 Ga0496126_0481152_385_774 129
802 3300048929 Ga0496126_1338893 Ga0496126_1338893_70_459 129
803 3300049459 Ga0495678_042590 Ga0495678_042590_145_534 129
804 3300049460 Ga0495682_0066213 Ga0495682_0066213_742_1131 129
805 3300049460 Ga0495682_0120472 Ga0495682_0120472_360_749 129
806 3300049591 Ga0501075_0350138 Ga0501075_0350138_499_891 129
807 3300049592 Ga0501076_1004831 Ga0501076_1004831_196_588 129
808 3300049743 Ga0501081_0210315 Ga0501081_0210315_535_927 129
809 3300050489 nmdc:mga03683_636914_c1 nmdc:mga03683_636914_c1_94_486 129
810 3300050490 nmdc:mga03n38_271140_c1 nmdc:mga03n38_271140_c1_424_813 129
811 3300050490 nmdc:mga03n38_362321_c1 nmdc:mga03n38_362321_c1_174_563 129
812 3300050492 nmdc:mga0yw44_120592_c1 nmdc:mga0yw44_120592_c1_838_1227 129
813 3300050492 nmdc:mga0yw44_836915_c1 nmdc:mga0yw44_836915_c1_40_429 129
814 3300050493 nmdc:mga0k408_204570_c1 nmdc:mga0k408_204570_c1_260_649 129
815 3300050493 nmdc:mga0k408_247506_c1 nmdc:mga0k408_247506_c1_182_571 129
816 3300050493 nmdc:mga0k408_696879_c1 nmdc:mga0k408_696879_c1_57_449 129
817 3300050494 nmdc:mga06z11_141014_c1 nmdc:mga06z11_141014_c1_680_1069 129
818 3300050494 nmdc:mga06z11_786384_c1 nmdc:mga06z11_786384_c1_113_505 129
819 3300050494 nmdc:mga06z11_80473_c1 nmdc:mga06z11_80473_c1_1224_1613 129
820 3300050496 nmdc:mga07m45_173116_c1 nmdc:mga07m45_173116_c1_248_637 129
821 3300050496 nmdc:mga07m45_334912_c1 nmdc:mga07m45_334912_c1_44_433 129
822 3300050496 nmdc:mga07m45_350480_c1 nmdc:mga07m45_350480_c1_321_710 129
823 3300050496 nmdc:mga07m45_815436_c1 nmdc:mga07m45_815436_c1_119_508 129
824 3300050512 nmdc:mga0n895_153988_c1 nmdc:mga0n895_153988_c1_165_554 129
825 3300050513 nmdc:mga0rr50_43438_c1 nmdc:mga0rr50_43438_c1_2411_2800 129
826 3300050514 nmdc:mga08x19_161790_c1 nmdc:mga08x19_161790_c1_821_1210 129
827 3300050516 nmdc:mga0sz30_221679_c1 nmdc:mga0sz30_221679_c1_242_631 129
828 3300053079 Ga0500610_0128507 Ga0500610_0128507_339_728 129
829 3300053080 Ga0500635_0402072 Ga0500635_0402072_39_428 129
830 3300053083 Ga0495655_0158853 Ga0495655_0158853_130_519 129
831 3300053085 Ga0495619_0069795 Ga0495619_0069795_411_800 129
832 3300053085 Ga0495619_0264739 Ga0495619_0264739_317_706 129
833 3300053086 Ga0500578_0229904 Ga0500578_0229904_128_517 129
834 3300053088 Ga0500644_0167886 Ga0500644_0167886_260_649 129
835 3300053089 Ga0500581_085689 Ga0500581_085689_890_1279 129
836 3300053090 Ga0500646_0191392 Ga0500646_0191392_67_456 129
837 3300053091 Ga0500647_0038056 Ga0500647_0038056_1781_2170 129
838 3300053091 Ga0500647_0147686 Ga0500647_0147686_401_790 129
839 3300053092 Ga0500583_0539442 Ga0500583_0539442_129_518 129
840 3300053094 Ga0500566_0004243 Ga0500566_0004243_7506_7895 129
841 3300053094 Ga0500566_0036998 Ga0500566_0036998_2359_2748 129
842 3300053095 Ga0500640_040439 Ga0500640_040439_398_787 129
843 3300053096 Ga0500641_0008813 Ga0500641_0008813_3044_3433 129
844 3300053102 Ga0500554_038573 Ga0500554_038573_1055_1444 129
845 3300053111 Ga0500572_009466 Ga0500572_009466_421_810 129
846 3300053115 Ga0500591_165143 Ga0500591_165143_238_627 129
847 3300053118 Ga0500594_0211127 Ga0500594_0211127_160_549 129
848 3300053119 Ga0500595_000095 Ga0500595_000095_60751_61140 129
849 3300053119 Ga0500595_009153 Ga0500595_009153_3169_3558 129
850 3300053120 Ga0500597_364476 Ga0500597_364476_156_545 129
851 3300053122 Ga0500608_070689 Ga0500608_070689_758_1147 129
852 3300053123 Ga0500614_008073 Ga0500614_008073_1721_2110 129
853 3300053136 Ga0500559_0070605 Ga0500559_0070605_338_727 129
854 3300053143 Ga0500579_154803 Ga0500579_154803_156_545 129
855 3300053147 Ga0500589_134743 Ga0500589_134743_132_521 129
856 3300053148 Ga0500590_144469 Ga0500590_144469_581_970 129
857 3300053148 Ga0500590_355162 Ga0500590_355162_116_505 129
858 3300053150 Ga0500603_005139 Ga0500603_005139_670_1059 129
859 3300053150 Ga0500603_113390 Ga0500603_113390_169_561 129
860 3300053150 Ga0500603_181611 Ga0500603_181611_226_615 129
861 3300053150 Ga0500603_293791 Ga0500603_293791_24_413 129
862 3300053159 Ga0500630_011616 Ga0500630_011616_2457_2846 129
863 3300053161 Ga0500634_0140940 Ga0500634_0140940_520_909 129
864 3300053162 Ga0500638_010149 Ga0500638_010149_1049_1438 129
865 3300053162 Ga0500638_084844 Ga0500638_084844_1012_1401 129
866 3300053162 Ga0500638_134433 Ga0500638_134433_383_772 129
867 3300053162 Ga0500638_153205 Ga0500638_153205_126_515 129
868 3300053163 Ga0500639_060538 Ga0500639_060538_1315_1704 129
869 3300053177 Ga0500636_0022787 Ga0500636_0022787_835_1227 129
870 3300053178 Ga0500637_0002475 Ga0500637_0002475_169_558 129
871 3300053178 Ga0500637_0118833 Ga0500637_0118833_172_561 129
872 3300053178 Ga0500637_0128031 Ga0500637_0128031_146_535 129
873 3300053732 Ga0500656_025197 Ga0500656_025197_238_627 129
874 3300053735 Ga0500596_008711 Ga0500596_008711_204_593 129
875 3300053739 Ga0500587_042509 Ga0500587_042509_11_400 129
876 3300055283 Ga0500661_000198 Ga0500661_000198_175_564 129
877 3300055283 Ga0500661_011296 Ga0500661_011296_143_532 129
878 3300055283 Ga0500661_042330 Ga0500661_042330_144_533 129
879 3300060353 Ga0501082_1259566 Ga0501082_1259566_226_618 129
880 3300061719 Ga0466962_0047831 Ga0466962_0047831_1637_2029 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

22

134

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hnq-assembly1.cif.gz_A crystal structure of the mutant q97a of vibrio cholerae chey3 0.9607 2 118
4lx8-assembly1.cif.gz_A crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae 0.9601 2 118
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9575 2 118
1ab6-assembly2.cif.gz_B structure of chey mutant f14n, v86t 0.9574 1 118
3to5-assembly1.cif.gz_A high resolution structure of chey3 from vibrio cholerae 0.9572 2 118
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9613 2 82 3.40.50.2300
af_P0DMC5_826_949_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9576 3 117 3.40.50.2300
4ja2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9563 1 118 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9546 1 117 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.954 1 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6I4V297-F1-model_v4 Response regulator 0.9994 1 121 GO:0000160
AF-A0A1R4GLZ8-F1-model_v4 Chemotaxis regulator-transmits chemoreceptor signals to flagelllar motor components CheY 0.9955 2 122 GO:0000160
AF-A0A3C0FW44-F1-model_v4 Response regulator 0.9943 1 121 GO:0000160
AF-A0A5B8S863-F1-model_v4 Response regulator 0.9942 1 121 GO:0000160
AF-A0A837C750-F1-model_v4 Putative chemotaxis response regulator 0.9936 1 124 GO:0000160

Feature Viewer

pLDDT pTM Quality
92.51 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map