F484522

General Info

Members Datasets Scaffolds Average Seq Length
881 546 1762 223

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10143380|Ga0105240_101433803
Length 257
Sequence LYGPGSAAHHFVLRCARDTKSKTRERKMKSVVVRNIKRADNNAVATMAALGVSTVHEALGRSGLMKTYMRPIWAGAQIAGPAVTVLAQPGDNWMIHVAVEQCQKGDVLVVGCTTDNTDGMFGELLATSLTARGVKGLIIDAGCRDVKALHDMGFPVWSRAVSAKGTVKATPGAVNVPVVCAGVNVEPGDVIVADDDGVVVVPRKLAIETAQKAQKRHDDEDGKRKQLAAGVLGLDMYKMREPLAKAGLVYVDNPEDV

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
159 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
160 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
161 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
322 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
337 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
338 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
339 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
340 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
341 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
342 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
343 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
344 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
345 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
346 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
347 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
348 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
349 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
350 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
351 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
352 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
353 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
354 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
355 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
356 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
357 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
358 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
359 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
360 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
361 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
362 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
363 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
364 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
365 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
366 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
367 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
368 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
369 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
370 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
371 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
372 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
373 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
374 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
375 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
376 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
377 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
378 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
379 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
380 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
381 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
382 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
383 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
384 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
385 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
386 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
387 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
388 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
389 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
390 2791355199
391 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
392 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
393 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
394 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
395 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
396 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
397 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
398 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
399 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
400 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
401 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
402 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
403 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
404 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
405 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
406 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
407 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
408 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
409 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
410 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
411 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
412 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
413 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
414 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
415 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
416 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
417 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
418 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
419 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
420 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
421 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
422 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
423 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
424 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
425 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
426 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
427 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
428 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
429 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
430 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
431 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
432 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
433 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
434 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
435 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
436 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
437 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
438 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
439 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
440 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
441 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
442 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
443 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
444 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
445 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
446 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
447 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
448 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
449 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
450 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
451 2922368715
452 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
453 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
454 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
455 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
456 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
457 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
458 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
459 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
460 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
461 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
462 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
463 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
464 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
465 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
466 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
467 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
468 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
469 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
470 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
471 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
472 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
473 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
474 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
475 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
476 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
477 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
478 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
479 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
480 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
481 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
482 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
483 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
484 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
485 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
486 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
487 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
488 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
489 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
490 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
491 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
492 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
493 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
494 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
495 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
496 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
497 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
498 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
499 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
500 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
501 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
502 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
503 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
504 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
505 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
506 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
507 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
508 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
509 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
510 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
511 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
512 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
513 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
514 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
515 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
516 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
517 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
518 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
519 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
520 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
521 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
522 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
523 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
524 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
525 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
526 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
527 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
528 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
529 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
530 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
531 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
532 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
533 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
534 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
535 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
536 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
537 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
538 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
539 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
540 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
541 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
542 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
543 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
544 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
545 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
546 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.98
Metatranscriptomes 0.23
Isolates 19.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.99
Nodule 15.32
Rhizoplane 7.26
Rhizosphere 58.12
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10143380 3300009093 Bacteria 2854
2 RicEn_C1063 2010549000 Bacteria 2363
3 JGI24739J22299_10071180 3300001989 Bacteria 1082
4 JGI25153J46596_10000394 3300003215 Bacteria 29469
5 JGI25153J46596_10003431 3300003215 Bacteria 8876
6 JGI25160J50197_1012586 3300003354 Bacteria 2928
7 Ga0055542_1011589 3300003762 Bacteria 1559
8 Ga0055531_10007393 3300003794 Bacteria 6010
9 Ga0055543_1002885 3300004625 Bacteria 5407
10 Ga0065165_1001731 3300005262 Bacteria 21826
11 Ga0065165_1002125 3300005262 Bacteria 18029
12 Ga0065712_10016912 3300005290 Bacteria 1759
13 Ga0070658_10004762 3300005327 Bacteria 11041
14 Ga0070658_10051844 3300005327 Bacteria 3325
15 Ga0070683_100477334 3300005329 Bacteria 1191
16 Ga0070683_100575298 3300005329 Bacteria 1077
17 Ga0068869_100509780 3300005334 Bacteria 1005
18 Ga0070680_100017453 3300005336 Bacteria 5660
19 Ga0070680_100107577 3300005336 Bacteria 2319
20 Ga0070682_100104282 3300005337 Bacteria 1878
21 Ga0068868_100103125 3300005338 Bacteria 2310
22 Ga0070660_100001944 3300005339 Bacteria 14250
23 Ga0070660_100069539 3300005339 Bacteria 2746
24 Ga0070661_100125958 3300005344 Bacteria 1922
25 Ga0070668_100323705 3300005347 Bacteria 1298
26 Ga0070675_100356650 3300005354 Bacteria 1298
27 Ga0070671_100001629 3300005355 Bacteria 16929
28 Ga0070673_100177979 3300005364 Bacteria 1819
29 Ga0070709_10014203 3300005434 Bacteria 4500
30 Ga0070709_10048689 3300005434 Bacteria 2646
31 Ga0070709_10077995 3300005434 Bacteria 2155
32 Ga0070709_10078036 3300005434 Bacteria 2154
33 Ga0070714_100041624 3300005435 Bacteria 3878
34 Ga0070714_100091008 3300005435 Bacteria 2672
35 Ga0070713_100012732 3300005436 Bacteria 6181
36 Ga0070713_100192501 3300005436 Bacteria 1838
37 Ga0070713_100195344 3300005436 Bacteria 1825
38 Ga0070713_100464464 3300005436 Bacteria 1190
39 Ga0070710_10002441 3300005437 Bacteria 8802
40 Ga0070710_10046159 3300005437 Bacteria 2425
41 Ga0070710_10159238 3300005437 Bacteria 1399
42 Ga0070711_100002925 3300005439 Bacteria 9841
43 Ga0070711_100005838 3300005439 Bacteria 7390
44 Ga0070711_100017055 3300005439 Bacteria 4619
45 Ga0070711_100020886 3300005439 Bacteria 4227
46 Ga0070711_100040240 3300005439 Bacteria 3151
47 Ga0070711_100179879 3300005439 Bacteria 1619
48 Ga0070711_100913954 3300005439 Bacteria 749
49 Ga0070663_100055656 3300005455 Bacteria 2832
50 Ga0070663_100226708 3300005455 Bacteria 1469
51 Ga0070663_100249004 3300005455 Bacteria 1406
52 Ga0070678_100011904 3300005456 Bacteria 5384
53 Ga0070678_100043206 3300005456 Bacteria 3209
54 Ga0070681_10004544 3300005458 Bacteria 13233
55 Ga0070681_10103453 3300005458 Bacteria 2792
56 Ga0070681_10219115 3300005458 Bacteria 1818
57 Ga0070681_10622008 3300005458 Bacteria 994
58 Ga0070706_100204227 3300005467 Bacteria 1846
59 Ga0070707_100739084 3300005468 Bacteria 947
60 Ga0070698_100079119 3300005471 Bacteria 3285
61 Ga0070699_100098367 3300005518 Bacteria 2564
62 Ga0070679_100006626 3300005530 Bacteria 10798
63 Ga0070679_100038870 3300005530 Bacteria 4731
64 Ga0070679_100395127 3300005530 Bacteria 1329
65 Ga0070679_100463679 3300005530 Bacteria 1211
66 Ga0070679_100539670 3300005530 Bacteria 1110
67 Ga0070684_100063932 3300005535 Bacteria 3227
68 Ga0070684_100393456 3300005535 Bacteria 1277
69 Ga0068853_100127758 3300005539 Bacteria 2272
70 Ga0068853_100486966 3300005539 Bacteria 1163
71 Ga0070672_100275735 3300005543 Bacteria 1421
72 Ga0070695_100149314 3300005545 Bacteria 1629
73 Ga0070696_100238502 3300005546 Bacteria 1370
74 Ga0070693_100128664 3300005547 Bacteria 1580
75 Ga0070665_101137226 3300005548 Bacteria 792
76 Ga0068855_100073110 3300005563 Bacteria 3984
77 Ga0068855_100837078 3300005563 Bacteria 976
78 Ga0068855_100858428 3300005563 Bacteria 961
79 Ga0070664_100024089 3300005564 Bacteria 5032
80 Ga0070664_100043917 3300005564 Bacteria 3773
81 Ga0068857_100139884 3300005577 Bacteria 2188
82 Ga0068854_100460406 3300005578 Bacteria 1064
83 Ga0068856_100000020 3300005614 Bacteria 146775
84 Ga0068856_100135286 3300005614 Bacteria 2470
85 Ga0068856_100168939 3300005614 Bacteria 2199
86 Ga0070702_100551212 3300005615 Bacteria 856
87 Ga0068852_100116503 3300005616 Bacteria 2438
88 Ga0068852_100420229 3300005616 Bacteria 1319
89 Ga0068852_100567177 3300005616 Bacteria 1137
90 Ga0068859_100171388 3300005617 Bacteria 2251
91 Ga0068864_100025488 3300005618 Bacteria 4981
92 Ga0068866_10026261 3300005718 Bacteria 2748
93 Ga0068861_100891841 3300005719 Bacteria 841
94 Ga0068870_10485385 3300005840 Bacteria 821
95 Ga0068863_100045728 3300005841 Bacteria 4154
96 Ga0068858_100008078 3300005842 Bacteria 10133
97 Ga0068860_100327827 3300005843 Bacteria 1503
98 Ga0068862_100268560 3300005844 Bacteria 1559
99 Ga0068862_100301425 3300005844 Bacteria 1474
100 Ga0081455_10017926 3300005937 Bacteria 6766
101 Ga0081455_10063868 3300005937 Bacteria 3087
102 Ga0081455_10105008 3300005937 Bacteria 2259
103 Ga0081538_10034813 3300005981 Bacteria 3321
104 Ga0081540_1002690 3300005983 Bacteria 14454
105 Ga0081540_1003654 3300005983 Bacteria 12058
106 Ga0081540_1017195 3300005983 Bacteria 4485
107 Ga0070717_10022005 3300006028 Bacteria 5031
108 Ga0070717_10064475 3300006028 Bacteria 3043
109 Ga0070717_10178883 3300006028 Bacteria 1848
110 Ga0075365_10054530 3300006038 Bacteria 2651
111 Ga0075365_10232908 3300006038 Bacteria 1293
112 Ga0075363_100063020 3300006048 Bacteria 2000
113 Ga0075364_10208643 3300006051 Bacteria 1325
114 Ga0070715_10000961 3300006163 Bacteria 8038
115 Ga0070716_100002442 3300006173 Bacteria 8562
116 Ga0070712_100015939 3300006175 Bacteria 4847
117 Ga0070712_100034659 3300006175 Bacteria 3422
118 Ga0070712_100043566 3300006175 Bacteria 3090
119 Ga0070712_100068339 3300006175 Bacteria 2531
120 Ga0070712_100070488 3300006175 Bacteria 2498
121 Ga0070712_100492850 3300006175 Bacteria 1026
122 Ga0075362_10022802 3300006177 Bacteria 2641
123 Ga0075367_10000988 3300006178 Bacteria 11650
124 Ga0075369_10008785 3300006186 Bacteria 3903
125 Ga0075366_10155752 3300006195 Bacteria 1384
126 Ga0075366_10411529 3300006195 Bacteria 832
127 Ga0075366_10483803 3300006195 Bacteria 765
128 Ga0097621_100019101 3300006237 Bacteria 5255
129 Ga0097621_100030570 3300006237 Bacteria 4265
130 Ga0097621_100567523 3300006237 Bacteria 1034
131 Ga0075370_10060519 3300006353 Bacteria 2157
132 Ga0068871_100010894 3300006358 Bacteria 6656
133 Ga0068871_100166449 3300006358 Bacteria 1887
134 Ga0075428_100079146 3300006844 Bacteria 3587
135 Ga0075434_100490088 3300006871 Bacteria 1250
136 Ga0068865_100381974 3300006881 Bacteria 1149
137 Ga0097620_100171379 3300006931 Bacteria 2251
138 Ga0099824_1012798 3300006942 Bacteria 8977
139 Ga0099794_10283726 3300007265 Bacteria 856
140 Ga0105240_10008282 3300009093 Bacteria 14882
141 Ga0105240_10238154 3300009093 Bacteria 2111
142 Ga0105240_10273675 3300009093 Bacteria 1943
143 Ga0105240_11362552 3300009093 Bacteria 747
144 Ga0105245_10006619 3300009098 Bacteria 10177
145 Ga0105245_10007619 3300009098 Bacteria 9480
146 Ga0105245_10161198 3300009098 Bacteria 2128
147 Ga0105245_10365153 3300009098 Bacteria 1434
148 Ga0105247_10346942 3300009101 Bacteria 1043
149 Ga0114129_10111337 3300009147 Bacteria 3777
150 Ga0114129_10749936 3300009147 Bacteria 1250
151 Ga0105241_10053828 3300009174 Bacteria 3079
152 Ga0105241_10062670 3300009174 Bacteria 2867
153 Ga0105241_10072568 3300009174 Bacteria 2676
154 Ga0105241_10122821 3300009174 Bacteria 2093
155 Ga0105242_10018122 3300009176 Bacteria 5500
156 Ga0105242_10077188 3300009176 Bacteria 2779
157 Ga0105242_10418766 3300009176 Bacteria 1255
158 Ga0105242_10480797 3300009176 Bacteria 1177
159 Ga0105248_10015680 3300009177 Bacteria 8351
160 Ga0105248_10027920 3300009177 Bacteria 6284
161 Ga0105248_10164724 3300009177 Bacteria 2499
162 Ga0105248_10440910 3300009177 Bacteria 1467
163 Ga0105237_10006673 3300009545 Bacteria 12756
164 Ga0105237_10016711 3300009545 Bacteria 7618
165 Ga0105237_10026248 3300009545 Bacteria 5953
166 Ga0105237_11001220 3300009545 Bacteria 842
167 Ga0105238_10005356 3300009551 Bacteria 12677
168 Ga0105238_10157681 3300009551 Bacteria 2245
169 Ga0105238_10246610 3300009551 Bacteria 1764
170 Ga0105238_10288491 3300009551 Bacteria 1623
171 Ga0105238_10889307 3300009551 Bacteria 909
172 Ga0099796_10009831 3300010159 Bacteria 2605
173 Ga0105239_10502132 3300010375 Bacteria 1379
174 Ga0105246_10462649 3300011119 Bacteria 1069
175 Ga0105246_10597859 3300011119 Bacteria 953
176 Ga0105246_10716096 3300011119 Bacteria 879
177 Ga0157371_10013955 3300013102 Bacteria 6084
178 Ga0157370_10110323 3300013104 Bacteria 2572
179 Ga0157370_10161675 3300013104 Bacteria 2083
180 Ga0157369_10035175 3300013105 Bacteria 5494
181 Ga0157369_10104822 3300013105 Bacteria 3011
182 Ga0157369_10225065 3300013105 Bacteria 1963
183 Ga0157369_10457316 3300013105 Bacteria 1322
184 Ga0157369_10587395 3300013105 Bacteria 1150
185 Ga0157374_10012098 3300013296 Bacteria 7494
186 Ga0157378_10037040 3300013297 Bacteria 4319
187 Ga0163162_10019668 3300013306 Bacteria 6628
188 Ga0157372_10965973 3300013307 Bacteria 987
189 Ga0157375_10015754 3300013308 Bacteria 6774
190 Ga0157375_10031030 3300013308 Bacteria 5045
191 Ga0157375_10034118 3300013308 Bacteria 4844
192 Ga0163163_10047665 3300014325 Bacteria 4212
193 Ga0163163_10490357 3300014325 Bacteria 1290
194 Ga0157379_10005550 3300014968 Bacteria 10838
195 Ga0157379_10015374 3300014968 Bacteria 6715
196 Ga0157379_10090305 3300014968 Bacteria 2748
197 Ga0157376_10073840 3300014969 Bacteria 2905
198 Ga0206356_11553529 3300020070 Bacteria 1534
199 Ga0206353_11806622 3300020082 Bacteria 1611
200 Ga0213872_10034960 3300021361 Bacteria 2299
201 Ga0213876_10057753 3300021384 Bacteria 2049
202 Ga0213875_10056323 3300021388 Bacteria 1842
203 Ga0209148_1000500 3300025254 Bacteria 39994
204 Ga0209564_1019909 3300025295 Bacteria 2484
205 Ga0209758_1000024 3300025297 Bacteria 591966
206 Ga0209758_1001533 3300025297 Bacteria 26615
207 Ga0209758_1004785 3300025297 Bacteria 10950
208 Ga0209758_1007070 3300025297 Bacteria 7780
209 Ga0207426_1000510 3300025302 Bacteria 56675
210 Ga0209257_1001149 3300025304 Bacteria 33675
211 Ga0207656_10045648 3300025321 Bacteria 1876
212 Ga0207692_10008992 3300025898 Bacteria 4157
213 Ga0207692_10094891 3300025898 Bacteria 1625
214 Ga0207688_10059355 3300025901 Bacteria 2154
215 Ga0207680_10219026 3300025903 Bacteria 1304
216 Ga0207685_10016843 3300025905 Bacteria 2348
217 Ga0207699_10002766 3300025906 Bacteria 8287
218 Ga0207699_10034074 3300025906 Bacteria 2884
219 Ga0207699_10040124 3300025906 Bacteria 2696
220 Ga0207699_10297819 3300025906 Bacteria 1125
221 Ga0207699_10354584 3300025906 Bacteria 1036
222 Ga0207705_10463919 3300025909 Bacteria 983
223 Ga0207707_10000950 3300025912 Bacteria 27902
224 Ga0207707_10004626 3300025912 Bacteria 12087
225 Ga0207707_10052762 3300025912 Bacteria 3539
226 Ga0207707_10232394 3300025912 Bacteria 1604
227 Ga0207707_10474556 3300025912 Bacteria 1069
228 Ga0207695_10000008 3300025913 Bacteria 1058268
229 Ga0207695_10084653 3300025913 Bacteria 3201
230 Ga0207695_10161968 3300025913 Bacteria 2168
231 Ga0207671_10003142 3300025914 Bacteria 16765
232 Ga0207693_10000068 3300025915 Bacteria 91004
233 Ga0207693_10010099 3300025915 Bacteria 7669
234 Ga0207693_10012278 3300025915 Bacteria 6922
235 Ga0207693_10013028 3300025915 Bacteria 6710
236 Ga0207693_10059172 3300025915 Bacteria 3001
237 Ga0207693_10208751 3300025915 Bacteria 1535
238 Ga0207663_10000098 3300025916 Bacteria 41171
239 Ga0207663_10035907 3300025916 Bacteria 2978
240 Ga0207663_10053162 3300025916 Bacteria 2529
241 Ga0207660_10002564 3300025917 Bacteria 11938
242 Ga0207660_10027186 3300025917 Bacteria 3902
243 Ga0207660_10218329 3300025917 Bacteria 1495
244 Ga0207657_10000658 3300025919 Bacteria 36762
245 Ga0207657_10155771 3300025919 Bacteria 1858
246 Ga0207649_10029765 3300025920 Bacteria 3228
247 Ga0207652_10003470 3300025921 Bacteria 12999
248 Ga0207652_10079037 3300025921 Bacteria 2873
249 Ga0207652_10088350 3300025921 Bacteria 2719
250 Ga0207652_10264824 3300025921 Bacteria 1550
251 Ga0207652_10283302 3300025921 Bacteria 1495
252 Ga0207652_10355623 3300025921 Bacteria 1322
253 Ga0207652_10651436 3300025921 Bacteria 942
254 Ga0207646_10210051 3300025922 Bacteria 1758
255 Ga0207646_10599160 3300025922 Bacteria 989
256 Ga0207694_10089008 3300025924 Bacteria 2434
257 Ga0207694_10145180 3300025924 Bacteria 1910
258 Ga0207694_10190212 3300025924 Bacteria 1667
259 Ga0207687_10116864 3300025927 Bacteria 1989
260 Ga0207687_10123341 3300025927 Bacteria 1941
261 Ga0207687_10331011 3300025927 Bacteria 1235
262 Ga0207700_10015748 3300025928 Bacteria 5000
263 Ga0207700_10091132 3300025928 Bacteria 2407
264 Ga0207700_10197106 3300025928 Bacteria 1695
265 Ga0207700_10303626 3300025928 Bacteria 1379
266 Ga0207700_10411601 3300025928 Bacteria 1186
267 Ga0207700_10455503 3300025928 Bacteria 1128
268 Ga0207664_10042775 3300025929 Bacteria 3539
269 Ga0207664_10043417 3300025929 Bacteria 3516
270 Ga0207664_10162299 3300025929 Bacteria 1907
271 Ga0207690_10107114 3300025932 Bacteria 2007
272 Ga0207706_10403102 3300025933 Bacteria 1186
273 Ga0207709_10443739 3300025935 Bacteria 1001
274 Ga0207704_10296267 3300025938 Bacteria 1237
275 Ga0207665_10000355 3300025939 Bacteria 31763
276 Ga0207665_10432670 3300025939 Bacteria 1007
277 Ga0207711_10174186 3300025941 Bacteria 1954
278 Ga0207711_10233979 3300025941 Bacteria 1683
279 Ga0207711_10317721 3300025941 Bacteria 1438
280 Ga0207689_10021146 3300025942 Bacteria 5470
281 Ga0207661_10001747 3300025944 Bacteria 14871
282 Ga0207661_10051941 3300025944 Bacteria 3273
283 Ga0207661_10262245 3300025944 Bacteria 1539
284 Ga0207661_10649613 3300025944 Bacteria 969
285 Ga0207679_10036381 3300025945 Bacteria 3492
286 Ga0207667_10215773 3300025949 Bacteria 1966
287 Ga0207667_10296284 3300025949 Bacteria 1652
288 Ga0207667_10682469 3300025949 Bacteria 1030
289 Ga0207651_10370470 3300025960 Bacteria 1211
290 Ga0207640_10139666 3300025981 Bacteria 1764
291 Ga0207677_10020108 3300026023 Bacteria 4047
292 Ga0207677_10372683 3300026023 Bacteria 1202
293 Ga0207677_10727925 3300026023 Bacteria 882
294 Ga0207703_10323706 3300026035 Bacteria 1412
295 Ga0207639_10043047 3300026041 Bacteria 3387
296 Ga0207639_10122518 3300026041 Bacteria 2138
297 Ga0207639_10149674 3300026041 Bacteria 1954
298 Ga0207639_10486835 3300026041 Bacteria 1125
299 Ga0207678_10035639 3300026067 Bacteria 4332
300 Ga0207678_10043159 3300026067 Bacteria 3903
301 Ga0207678_10111029 3300026067 Bacteria 2339
302 Ga0207678_10111451 3300026067 Bacteria 2334
303 Ga0207702_10000126 3300026078 Bacteria 90550
304 Ga0207641_10083530 3300026088 Bacteria 2778
305 Ga0207641_10866328 3300026088 Bacteria 896
306 Ga0207676_10190935 3300026095 Unclassified 1802
307 Ga0207674_10129603 3300026116 Bacteria 2486
308 Ga0207674_10261908 3300026116 Bacteria 1676
309 Ga0207675_100438424 3300026118 Bacteria 1293
310 Ga0207675_100495090 3300026118 Bacteria 1216
311 Ga0207675_100802265 3300026118 Bacteria 955
312 Ga0207683_10001340 3300026121 Bacteria 22231
313 Ga0207683_10028473 3300026121 Bacteria 4830
314 Ga0207683_10358569 3300026121 Bacteria 1339
315 Ga0207698_10336335 3300026142 Bacteria 1420
316 Ga0209389_1000185 3300027296 Bacteria 47184
317 Ga0209589_1000036 3300027357 Bacteria 131278
318 Ga0209489_100006 3300027361 Bacteria 475698
319 Ga0209700_100005 3300027363 Bacteria 573969
320 Ga0268266_10002394 3300028379 Bacteria 20226
321 Ga0268266_10483755 3300028379 Bacteria 1180
322 Ga0268266_10925741 3300028379 Bacteria 843
323 Ga0268264_10027494 3300028381 Bacteria 4648
324 Ga0307517_10000008 3300028786 Bacteria 243202
325 Ga0307517_10228925 3300028786 Bacteria 1119
326 Ga0307515_10045960 3300028794 Bacteria 6689
327 Ga0265330_10045567 3300031235 Bacteria 1934
328 Ga0265330_10088362 3300031235 Bacteria 1332
329 Ga0265325_10000044 3300031241 Bacteria 89107
330 Ga0265325_10011538 3300031241 Bacteria 5074
331 Ga0265325_10045607 3300031241 Bacteria 2277
332 Ga0265339_10019022 3300031249 Bacteria 4038
333 Ga0265339_10057328 3300031249 Bacteria 2107
334 Ga0265339_10141434 3300031249 Bacteria 1224
335 Ga0265339_10180991 3300031249 Bacteria 1050
336 Ga0265339_10207939 3300031249 Bacteria 963
337 Ga0265316_10042156 3300031344 Bacteria 3649
338 Ga0307513_10029676 3300031456 Bacteria 6228
339 Ga0307513_10418380 3300031456 Bacteria 1071
340 Ga0307509_10180532 3300031507 Bacteria 1976
341 Ga0307408_100449154 3300031548 Bacteria 1118
342 Ga0265313_10009939 3300031595 Bacteria 6106
343 Ga0307508_10229059 3300031616 Bacteria 1457
344 Ga0265314_10008091 3300031711 Bacteria 9048
345 Ga0265314_10050093 3300031711 Bacteria 2919
346 Ga0307516_10077115 3300031730 Bacteria 3182
347 Ga0307406_10332610 3300031901 Bacteria 1180
348 Ga0307406_10517961 3300031901 Bacteria 970
349 Ga0307409_100577749 3300031995 Bacteria 1107
350 Ga0307416_100271276 3300032002 Bacteria 1666
351 Ga0307415_100069687 3300032126 Bacteria 2467
352 Ga0316583_10000267 3300032133 Bacteria 14347
353 Ga0307510_10001061 3300033180 Bacteria 29217
354 Ga0307510_10018144 3300033180 Bacteria 8285
355 Ga0307510_10125011 3300033180 Bacteria 2264
356 Ga0373926_0042232 3300035083 Bacteria 1630
357 Ga0373923_0135165 3300035111 Bacteria 1111
358 Ga0373939_0000811 3300035114 Bacteria 7714
359 Ga0373953_0005595 3300035117 Bacteria 4090
360 Ga0373953_0048107 3300035117 Bacteria 1717
361 Ga0373954_0013096 3300035118 Bacteria 3693
362 Ga0373956_0015090 3300035119 Bacteria 3231
363 Ga0373956_0089214 3300035119 Bacteria 1421
364 Ga0373957_0022135 3300035120 Bacteria 2262
365 Ga0373943_0028143 3300035170 Bacteria 2647
366 Ga0373955_0009673 3300035172 Bacteria 4526
367 Ga0373955_0015065 3300035172 Bacteria 3777
368 Ga0373955_0108075 3300035172 Bacteria 1606
369 Ga0316574_0209557 3300035398 Bacteria 1251
370 Ga0373924_0021198 3300035410 Bacteria 2534
371 Ga0373935_0044130 3300035692 Bacteria 2808
372 Ga0373927_0016784 3300035695 Bacteria 4829
373 Ga0373927_0027467 3300035695 Bacteria 3715
374 Ga0373933_0000199 3300035724 Bacteria 39593
375 Ga0373933_0012562 3300035724 Bacteria 4680
376 Ga0373947_0047946 3300035725 Bacteria 2562
377 Ga0373937_0003498 3300036401 Bacteria 13203
378 Ga0373925_0000767 3300037068 Bacteria 29498
379 Ga0373925_0157538 3300037068 Bacteria 1787
380 Ga0373925_0263518 3300037068 Bacteria 1385
381 Ga0373925_0265765 3300037068 Bacteria 1379
382 Ga0373925_0442365 3300037068 Bacteria 1064
383 Ga0395900_0044295 3300037418 Bacteria 4585
384 Ga0395900_0288678 3300037418 Bacteria 1630
385 Ga0395900_0291201 3300037418 Bacteria 1621
386 Ga0395898_0010583 3300037466 Bacteria 9632
387 Ga0395898_0185548 3300037466 Bacteria 1987
388 Ga0395898_0436159 3300037466 Bacteria 1248
389 Ga0395905_0040677 3300037471 Bacteria 4361
390 Ga0395905_0136213 3300037471 Bacteria 2310
391 Ga0436364_0397486 3300037853 Bacteria 1508
392 Ga0436364_1535696 3300037853 Bacteria 2655
393 Ga0395901_0011779 3300038443 Bacteria 8868
394 Ga0395901_0123610 3300038443 Bacteria 2719
395 Ga0395901_0182755 3300038443 Bacteria 2199
396 Ga0436365_0042699 3300039437 Bacteria 1950
397 Ga0436360_1256664 3300039438 Bacteria 1900
398 Ga0436361_0532883 3300039447 Bacteria 1128
399 Ga0436361_0833650 3300039447 Bacteria 10674
400 Ga0436363_0842295 3300039450 Bacteria 928
401 Ga0439441_022090 3300042001 Bacteria 1180
402 Ga0466963_0038369 3300044694 Bacteria 3131
403 Ga0466963_0132734 3300044694 Bacteria 1721
404 Ga0466963_0169940 3300044694 Bacteria 1519
405 Ga0466964_0092261 3300044706 Bacteria 1320
406 Ga0466971_0248365 3300044719 Bacteria 847
407 Ga0466957_0005921 3300044842 Bacteria 6888
408 Ga0466957_0067739 3300044842 Bacteria 2203
409 Ga0466959_0030990 3300045049 Bacteria 3959
410 Ga0451576_1082748 3300045051 Bacteria 839
411 Ga0466958_0055054 3300045836 Bacteria 2413
412 Ga0466958_0131752 3300045836 Bacteria 1570
413 Ga0466967_0066574 3300045976 Bacteria 3210
414 Ga0466967_0863177 3300045976 Bacteria 899
415 Ga0495617_137550 3300046452 Bacteria 781
416 Ga0495592_0003279 3300046454 Bacteria 11596
417 Ga0495603_0004410 3300046455 Bacteria 8389
418 Ga0495603_0006388 3300046455 Bacteria 7051
419 Ga0495603_0044718 3300046455 Bacteria 2642
420 Ga0495603_0083749 3300046455 Bacteria 1868
421 Ga0495629_0192979 3300046459 Bacteria 1409
422 Ga0495641_0022963 3300046461 Bacteria 3110
423 Ga0495641_0130608 3300046461 Bacteria 1121
424 Ga0495651_0055037 3300046462 Bacteria 3057
425 Ga0495651_0064165 3300046462 Bacteria 2807
426 Ga0495653_0141442 3300046463 Bacteria 1692
427 Ga0495580_0001449 3300046472 Bacteria 20800
428 Ga0495580_0113921 3300046472 Bacteria 1878
429 Ga0495580_0133464 3300046472 Bacteria 1721
430 Ga0495582_0120766 3300046473 Bacteria 1476
431 Ga0495605_0139756 3300046474 Bacteria 1087
432 Ga0495639_0044746 3300046475 Bacteria 2001
433 Ga0495662_0133154 3300046476 Bacteria 1222
434 Ga0495664_0006747 3300046477 Bacteria 6348
435 Ga0495664_0019399 3300046477 Bacteria 3909
436 Ga0495664_0045522 3300046477 Bacteria 2602
437 Ga0495585_0053425 3300046492 Bacteria 2236
438 Ga0495594_0066599 3300046499 Bacteria 1998
439 Ga0495594_0217607 3300046499 Bacteria 1089
440 Ga0495606_0001179 3300046507 Bacteria 36884
441 Ga0495606_0025719 3300046507 Bacteria 4209
442 Ga0495608_0042556 3300046511 Bacteria 3037
443 Ga0495608_0121182 3300046511 Bacteria 1677
444 Ga0495618_0005389 3300046514 Bacteria 7805
445 Ga0495628_0015673 3300046516 Bacteria 6328
446 Ga0495628_0041443 3300046516 Bacteria 3675
447 Ga0495628_0274934 3300046516 Bacteria 1252
448 Ga0495628_0410575 3300046516 Bacteria 988
449 Ga0495630_0256501 3300046517 Bacteria 1336
450 Ga0495630_0402568 3300046517 Bacteria 1049
451 Ga0495632_0062420 3300046519 Bacteria 1806
452 Ga0495637_0113053 3300046520 Bacteria 1051
453 Ga0495666_0042687 3300046526 Bacteria 2192
454 Ga0495666_0051380 3300046526 Bacteria 1980
455 Ga0495652_0002979 3300046529 Bacteria 17017
456 Ga0495652_0083205 3300046529 Bacteria 2635
457 Ga0495665_0038334 3300046531 Bacteria 2555
458 Ga0495640_0011617 3300046533 Bacteria 6764
459 Ga0495640_0027667 3300046533 Bacteria 4087
460 Ga0495640_0103913 3300046533 Bacteria 1862
461 Ga0495640_0187589 3300046533 Bacteria 1315
462 Ga0495587_0011641 3300046536 Bacteria 5569
463 Ga0495598_0004011 3300046537 Bacteria 3162
464 Ga0495645_0001025 3300046543 Bacteria 19015
465 Ga0495645_0001772 3300046543 Bacteria 14693
466 Ga0495622_0041218 3300046557 Bacteria 2147
467 Ga0495622_0068255 3300046557 Bacteria 1642
468 Ga0495667_0001273 3300046559 Bacteria 16514
469 Ga0495667_0033238 3300046559 Bacteria 3452
470 Ga0495667_0069109 3300046559 Bacteria 2306
471 Ga0495656_0131030 3300046615 Bacteria 1193
472 Ga0495668_0261772 3300046616 Bacteria 947
473 Ga0495634_0053454 3300046642 Bacteria 2705
474 Ga0495625_0190042 3300046660 Bacteria 1361
475 Ga0495635_0114378 3300046663 Bacteria 1842
476 Ga0495659_0019059 3300046664 Bacteria 2293
477 Ga0495588_0006176 3300046674 Bacteria 5381
478 Ga0495588_0009960 3300046674 Bacteria 4406
479 Ga0495657_0067361 3300046675 Bacteria 2350
480 Ga0495599_0007196 3300046678 Bacteria 6741
481 Ga0495623_0013803 3300046679 Bacteria 5237
482 Ga0495623_0069959 3300046679 Bacteria 2186
483 Ga0495646_0067005 3300046680 Bacteria 2123
484 Ga0495647_0029905 3300046681 Bacteria 2017
485 Ga0495647_0059378 3300046681 Bacteria 1506
486 Ga0495658_0171470 3300046683 Bacteria 1343
487 Ga0495658_0303068 3300046683 Bacteria 1011
488 Ga0495624_0020197 3300046690 Bacteria 4436
489 Ga0495624_0137708 3300046690 Bacteria 1496
490 Ga0495670_0303218 3300046691 Bacteria 856
491 Ga0495600_0003839 3300046809 Bacteria 8910
492 Ga0495600_0049859 3300046809 Bacteria 2731
493 Ga0495604_0002660 3300047317 Bacteria 14340
494 Ga0495604_0010726 3300047317 Bacteria 7272
495 Ga0495674_0013103 3300047319 Bacteria 7798
496 Ga0495674_0014178 3300047319 Bacteria 7466
497 Ga0495674_0048940 3300047319 Bacteria 3738
498 Ga0495674_0072773 3300047319 Bacteria 2964
499 Ga0495674_0128534 3300047319 Bacteria 2136
500 Ga0495672_0039595 3300047320 Bacteria 2865
501 Ga0495676_0072253 3300047321 Bacteria 2650
502 Ga0495676_0084983 3300047321 Bacteria 2385
503 Ga0495676_0161515 3300047321 Bacteria 1585
504 Ga0495680_0009088 3300047322 Bacteria 8971
505 Ga0495680_0044688 3300047322 Bacteria 3502
506 Ga0495680_0284136 3300047322 Bacteria 1165
507 Ga0495683_0246945 3300047323 Bacteria 785
508 Ga0495675_0000984 3300047444 Bacteria 17289
509 Ga0495675_0198151 3300047444 Bacteria 1223
510 Ga0495681_0132100 3300047470 Bacteria 1062
511 Ga0495684_0051684 3300047471 Bacteria 3136
512 Ga0495684_0103345 3300047471 Bacteria 2154
513 Ga0495686_0076873 3300047472 Bacteria 2045
514 Ga0495593_0064886 3300047673 Bacteria 1905
515 Ga0495602_0000726 3300048088 Bacteria 31111
516 Ga0495614_0050196 3300048089 Bacteria 1787
517 Ga0495626_0150224 3300048091 Bacteria 983
518 Ga0496100_0006817 3300048903 Bacteria 6260
519 Ga0496100_0087309 3300048903 Bacteria 2120
520 Ga0496101_0000213 3300048904 Bacteria 43662
521 Ga0496101_0020482 3300048904 Bacteria 4529
522 Ga0496101_0237976 3300048904 Bacteria 1416
523 Ga0496101_0257105 3300048904 Bacteria 1361
524 Ga0496101_0275356 3300048904 Bacteria 1314
525 Ga0496102_0030253 3300048905 Bacteria 4845
526 Ga0496102_0107202 3300048905 Bacteria 2601
527 Ga0496102_0157581 3300048905 Bacteria 2135
528 Ga0496102_0179875 3300048905 Bacteria 1992
529 Ga0496103_0000323 3300048906 Bacteria 43761
530 Ga0496103_0045764 3300048906 Bacteria 2700
531 Ga0496103_0226854 3300048906 Bacteria 1201
532 Ga0496103_0294408 3300048906 Bacteria 1044
533 Ga0496104_0000580 3300048907 Bacteria 31194
534 Ga0496104_0002456 3300048907 Bacteria 15968
535 Ga0496104_0069164 3300048907 Bacteria 3355
536 Ga0496104_0109269 3300048907 Bacteria 2650
537 Ga0496104_0118307 3300048907 Bacteria 2543
538 Ga0496104_0205595 3300048907 Bacteria 1881
539 Ga0496104_0916199 3300048907 Bacteria 781
540 Ga0496105_0000402 3300048908 Bacteria 28437
541 Ga0496105_0005338 3300048908 Bacteria 9737
542 Ga0496105_0006042 3300048908 Bacteria 9260
543 Ga0496105_0019704 3300048908 Bacteria 5442
544 Ga0496105_0034625 3300048908 Bacteria 4154
545 Ga0496106_0002551 3300048909 Bacteria 13535
546 Ga0496106_0019968 3300048909 Bacteria 4969
547 Ga0496106_0673926 3300048909 Bacteria 825
548 Ga0496107_0005110 3300048910 Bacteria 8949
549 Ga0496107_0007348 3300048910 Bacteria 7597
550 Ga0496107_0011880 3300048910 Bacteria 6083
551 Ga0496108_0007691 3300048911 Bacteria 8729
552 Ga0496108_0018148 3300048911 Bacteria 5758
553 Ga0496108_0018223 3300048911 Bacteria 5748
554 Ga0496108_0099899 3300048911 Bacteria 2474
555 Ga0496109_0010098 3300048912 Bacteria 8054
556 Ga0496109_0030334 3300048912 Bacteria 4847
557 Ga0496109_0188433 3300048912 Bacteria 1938
558 Ga0496109_0480397 3300048912 Bacteria 1173
559 Ga0496110_0023813 3300048913 Bacteria 5211
560 Ga0496110_0067437 3300048913 Bacteria 3166
561 Ga0496110_0232617 3300048913 Bacteria 1676
562 Ga0496110_0634889 3300048913 Bacteria 967
563 Ga0496111_0000449 3300048914 Bacteria 20923
564 Ga0496111_0014244 3300048914 Bacteria 5427
565 Ga0496112_0034239 3300048915 Bacteria 4941
566 Ga0496112_0075363 3300048915 Bacteria 3336
567 Ga0496113_0000528 3300048916 Bacteria 18859
568 Ga0496113_0036976 3300048916 Bacteria 3580
569 Ga0496113_0288256 3300048916 Bacteria 1313
570 Ga0496113_0344749 3300048916 Bacteria 1195
571 Ga0496114_0057383 3300048917 Bacteria 3250
572 Ga0496114_0094109 3300048917 Bacteria 2548
573 Ga0496114_0170210 3300048917 Bacteria 1898
574 Ga0496114_0261912 3300048917 Bacteria 1522
575 Ga0496114_0387221 3300048917 Bacteria 1238
576 Ga0496115_0006273 3300048918 Bacteria 8697
577 Ga0496115_0027561 3300048918 Bacteria 4445
578 Ga0496115_0095967 3300048918 Bacteria 2427
579 Ga0496115_0165195 3300048918 Bacteria 1831
580 Ga0496115_0261882 3300048918 Bacteria 1422
581 Ga0496115_0354614 3300048918 Bacteria 1196
582 Ga0496116_0000691 3300048919 Bacteria 43800
583 Ga0496116_0017742 3300048919 Bacteria 5514
584 Ga0496117_0000018 3300048920 Bacteria 479613
585 Ga0496117_0040858 3300048920 Bacteria 3406
586 Ga0496118_0000013 3300048921 Bacteria 574008
587 Ga0496118_0041838 3300048921 Bacteria 3622
588 Ga0496118_0347342 3300048921 Bacteria 792
589 Ga0496119_0035537 3300048922 Bacteria 3263
590 Ga0496121_0014546 3300048924 Bacteria 8342
591 Ga0496121_0224248 3300048924 Bacteria 1321
592 Ga0496121_0313416 3300048924 Bacteria 1059
593 Ga0496124_0150774 3300048927 Bacteria 1824
594 Ga0496125_0203754 3300048928 Bacteria 1292
595 Ga0496126_0000902 3300048929 Bacteria 51705
596 Ga0496126_0001122 3300048929 Bacteria 44809
597 Ga0496126_0015735 3300048929 Bacteria 7601
598 Ga0496126_0048493 3300048929 Bacteria 3881
599 Ga0496126_0097147 3300048929 Bacteria 2582
600 Ga0496126_0129917 3300048929 Bacteria 2177
601 Ga0496126_0482171 3300048929 Bacteria 993
602 Ga0501031_0035285 3300049568 Bacteria 3262
603 Ga0501032_0140627 3300049569 Bacteria 1589
604 Ga0501032_0190204 3300049569 Bacteria 1342
605 Ga0501033_0076639 3300049570 Bacteria 2454
606 Ga0501034_0190459 3300049571 Bacteria 2013
607 Ga0501034_0423571 3300049571 Bacteria 1252
608 Ga0501036_0116806 3300049572 Bacteria 2253
609 Ga0501037_0369219 3300049573 Bacteria 987
610 Ga0501038_0037203 3300049574 Bacteria 4268
611 Ga0501039_0184272 3300049575 Bacteria 1642
612 Ga0501039_0209369 3300049575 Bacteria 1533
613 Ga0501043_0154376 3300049579 Bacteria 1796
614 Ga0501043_0416932 3300049579 Bacteria 1013
615 Ga0501046_0615463 3300049580 Bacteria 770
616 Ga0501047_0098128 3300049581 Bacteria 2808
617 Ga0501047_0314286 3300049581 Bacteria 1407
618 Ga0501048_0365352 3300049582 Bacteria 1030
619 Ga0501067_0298735 3300049583 Bacteria 896
620 Ga0501070_0005092 3300049586 Bacteria 11201
621 Ga0501070_0101042 3300049586 Bacteria 2385
622 Ga0501073_0057668 3300049589 Bacteria 2714
623 Ga0501073_0084887 3300049589 Bacteria 2203
624 Ga0501074_0008292 3300049590 Bacteria 7535
625 Ga0501074_0012164 3300049590 Bacteria 6256
626 Ga0501079_0256190 3300049741 Bacteria 1368
627 Ga0501044_0080499 3300049823 Bacteria 3299
628 Ga0501044_0093205 3300049823 Bacteria 3037
629 Ga0501044_0132475 3300049823 Bacteria 2486
630 nmdc:mga03683_247809_c1 3300050489 Bacteria 827
631 nmdc:mga03n38_20431_c1 3300050490 Bacteria 2649
632 nmdc:mga03n38_26265_c1 3300050490 Bacteria 2403
633 nmdc:mga00v17_179291_c1 3300050491 Bacteria 1367
634 nmdc:mga00v17_278130_c1 3300050491 Bacteria 1086
635 nmdc:mga0yw44_215299_c1 3300050492 Bacteria 1272
636 nmdc:mga0yw44_79637_c1 3300050492 Bacteria 2050
637 nmdc:mga0k408_162592_c1 3300050493 Bacteria 1330
638 nmdc:mga0k408_215548_c1 3300050493 Bacteria 1146
639 nmdc:mga06z11_59313_c1 3300050494 Bacteria 1989
640 nmdc:mga07m45_13999_c1 3300050496 Bacteria 4265
641 nmdc:mga07m45_343835_c1 3300050496 Bacteria 867
642 nmdc:mga05p37_141849_c1 3300050507 Bacteria 2943
643 nmdc:mga08y16_307608_c1 3300050511 Bacteria 1632
644 nmdc:mga0sz30_191847_c1 3300050516 Bacteria 907
645 nmdc:mga0sz30_238604_c1 3300050516 Bacteria 809
646 Ga0495601_0000232 3300053077 Bacteria 29854
647 Ga0495601_0004312 3300053077 Bacteria 8215
648 Ga0495601_0014166 3300053077 Bacteria 4804
649 Ga0495601_0330339 3300053077 Bacteria 992
650 Ga0495612_0000608 3300053078 Bacteria 14397
651 Ga0495612_0008328 3300053078 Bacteria 4208
652 Ga0495612_0064474 3300053078 Bacteria 1520
653 Ga0500635_0008149 3300053080 Bacteria 2866
654 Ga0500635_0067466 3300053080 Bacteria 1262
655 Ga0500635_0116019 3300053080 Bacteria 998
656 Ga0495595_0000240 3300053084 Bacteria 21669
657 Ga0495595_0000284 3300053084 Bacteria 19932
658 Ga0495619_0000145 3300053085 Bacteria 52248
659 Ga0495619_0001165 3300053085 Bacteria 17262
660 Ga0495619_0001565 3300053085 Bacteria 15043
661 Ga0495619_0028070 3300053085 Bacteria 3629
662 Ga0500578_0023708 3300053086 Bacteria 3939
663 Ga0500578_0148732 3300053086 Bacteria 1460
664 Ga0500644_0119011 3300053088 Bacteria 1027
665 Ga0500647_0039154 3300053091 Bacteria 2272
666 Ga0500583_0036800 3300053092 Bacteria 2194
667 Ga0500566_0000006 3300053094 Bacteria 153632
668 Ga0500640_000036 3300053095 Bacteria 20472
669 Ga0500641_0131994 3300053096 Bacteria 1078
670 Ga0500554_009687 3300053102 Bacteria 2317
671 Ga0500555_004027 3300053103 Bacteria 4175
672 Ga0500557_000052 3300053105 Bacteria 50636
673 Ga0500562_020239 3300053108 Bacteria 1727
674 Ga0500572_005599 3300053111 Bacteria 2852
675 Ga0500572_036126 3300053111 Bacteria 1409
676 Ga0500593_012965 3300053117 Bacteria 3548
677 Ga0500607_040291 3300053121 Bacteria 2532
678 Ga0500608_021487 3300053122 Bacteria 2983
679 Ga0500608_078010 3300053122 Bacteria 1567
680 Ga0500614_000846 3300053123 Bacteria 7731
681 Ga0500642_0000468 3300053130 Bacteria 12589
682 Ga0500642_0104047 3300053130 Bacteria 1322
683 Ga0500655_022213 3300053133 Bacteria 1193
684 Ga0500658_0051537 3300053134 Bacteria 1683
685 Ga0500658_0089405 3300053134 Bacteria 1329
686 Ga0500559_0023353 3300053136 Bacteria 2625
687 Ga0500559_0029799 3300053136 Bacteria 2338
688 Ga0500585_156795 3300053144 Bacteria 790
689 Ga0500590_057832 3300053148 Bacteria 1955
690 Ga0500603_000195 3300053150 Bacteria 15888
691 Ga0500603_002409 3300053150 Bacteria 4106
692 Ga0500604_0109479 3300053151 Bacteria 917
693 Ga0500619_038193 3300053154 Bacteria 1503
694 Ga0500620_001550 3300053155 Bacteria 4302
695 Ga0500630_001646 3300053159 Bacteria 10694
696 Ga0500638_026391 3300053162 Bacteria 2783
697 Ga0500639_000170 3300053163 Bacteria 31566
698 Ga0500639_051091 3300053163 Bacteria 2152
699 Ga0500636_0001217 3300053177 Bacteria 13893
700 Ga0500637_0012756 3300053178 Bacteria 4387
701 Ga0500637_0038627 3300053178 Bacteria 2691
702 Ga0500625_038855 3300053729 Bacteria 2245
703 Ga0500645_074604 3300053730 Bacteria 972
704 Ga0500601_003622 3300053737 Bacteria 1677
705 Ga0466962_0044607 3300061719 Bacteria 2121
706 2507508247 2507262055 Bacteria 8048963
707 2508542316 2508501009 Bacteria 7784016
708 2508691924 2508501042 Bacteria 8719808
709 2511397496 2511231028 Bacteria 8046582
710 2513622376 2513237092 Bacteria 8341956
711 2513640553 2513237094 Bacteria 8789602
712 2513645466 2513237095 Bacteria 8976980
713 2513692891 2513237101 Bacteria 7952346
714 2513702501 2513237102 Bacteria 7703324
715 2513718416 2513237104 Bacteria 10034502
716 2513873113 2513237139 Bacteria 8737671
717 2514016546 2513237161 Bacteria 8871253
718 2517102651 2517093001 Bacteria 9002274
719 2524437713 2524023205 Bacteria 8918781
720 2528848685 2528768022 Bacteria 10457665
721 2617347021 2617270735 Bacteria 9163226
722 2723846524 2721755755 Bacteria 8322773
723 2745081181 2744054633 Bacteria 8678936
724 2793062620 2791355196 Bacteria 7323613
725 2793079923
726 2805914988 2802429603 Bacteria 8777136
727 2818239693 2816332527 Bacteria 8933356
728 2824602375 2824600985 Bacteria 8488197
729 2824610531 2824609381 Bacteria 8672835
730 2824618090 2824617872 Bacteria 8814715
731 2824626758 2824626560 Bacteria 8813858
732 2824636607 2824635225 Bacteria 8785348
733 2824645141 2824644064 Bacteria 8743947
734 2824654344 2824653114 Bacteria 8493680
735 2824661572 2824661429 Bacteria 9877870
736 2824672014 2824671348 Bacteria 8369588
737 2824679841 2824679649 Bacteria 8248951
738 2824688613 2824687955 Bacteria 8360029
739 2824705277 2824704595 Bacteria 9667483
740 2824715698 2824714736 Bacteria 8717648
741 2824725181 2824723954 Bacteria 8758240
742 2824754349 2824753945 Bacteria 9787441
743 2824767848 2824763712 Bacteria 9792355
744 2824775274 2824773399 Bacteria 8360218
745 2838123376 2838122688 Bacteria 8803140
746 2841946669 2841941048 Bacteria 8688029
747 2841954097 2841949485 Bacteria 8680857
748 2841964042 2841957949 Bacteria 8652217
749 2841969475 2841966195 Bacteria 8673214
750 2841983800 2841983080 Bacteria 8395090
751 2842040158 2842038055 Bacteria 8002051
752 2842046897 2842045827 Bacteria 8006841
753 2844319388 2844315083 Bacteria 8138177
754 2847936558 2847930680 Bacteria 9342022
755 2857515892 2857509624 Bacteria 7472071
756 2874598383 2874590934 Bacteria 8299676
757 2874605540 2874604998 Bacteria 7834745
758 2874619398 2874612657 Bacteria 8252029
759 2874626384 2874620515 Bacteria 8290088
760 2874632248 2874628541 Bacteria 8630250
761 2874652562 2874645413 Bacteria 8214782
762 2876764935 2876761206 Bacteria 10111113
763 2876778139 2876771140 Bacteria 8287509
764 2876825992 2876818435 Bacteria 8274608
765 2879081933 2879074833 Bacteria 8279565
766 2879089537 2879083081 Bacteria 8587928
767 2879108325 2879099564 Bacteria 10442239
768 2879115854 2879110137 Bacteria 8907982
769 2879135055 2879127579 Bacteria 8294491
770 2879149740 2879142872 Bacteria 8267021
771 2881368488 2881364244 Bacteria 7710352
772 2881672554 2881665667 Bacteria 8175609
773 2885369239 2885366525 Bacteria 8326213
774 2885413338 2885409591 Bacteria 9235467
775 2888384456 2888378607 Bacteria 9652610
776 2888393452 2888388044 Bacteria 7304136
777 2888424906 2888419890 Bacteria 7857137
778 2889039413 2889033259 Bacteria 9099371
779 2903734329 2903727486 Bacteria 8281579
780 2904671723 2904666416 Bacteria 8226587
781 2904715072 2904711408 Bacteria 9771557
782 2906605574 2906602504 Bacteria 8295279
783 2906633653 2906626472 Bacteria 8826946
784 2906646555 2906643746 Bacteria 8722424
785 2922365728 2922361189 Bacteria 7436256
786 2922374866
787 2922400450 2922393267 Bacteria 8285685
788 2929621912 2929615660 Bacteria 9193770
789 2929629781 2929624759 Bacteria 9339455
790 2932788780 2932784394 Bacteria 9704911
791 2932798021 2932794094 Bacteria 7915132
792 2932807137 2932801729 Bacteria 7987968
793 2932812754 2932809354 Bacteria 9135765
794 2932819154 2932818245 Bacteria 9955613
795 2932830446 2932828146 Bacteria 9745859
796 2933583812 2933577622 Bacteria 9116884
797 2935609271 2935608549 Bacteria 8203142
798 2935616740 2935616580 Bacteria 9032984
799 2935641930 2935638405 Bacteria 10015038
800 2935659120 2935656913 Bacteria 8965014
801 2935673061 2935665750 Bacteria 9571747
802 2935675866 2935675223 Bacteria 9928132
803 2935685863 2935684952 Bacteria 9590419
804 2935697891 2935694250 Bacteria 9291695
805 2935705703 2935703347 Bacteria 10242284
806 2935714415 2935713505 Bacteria 9608509
807 2935725034 2935722832 Bacteria 9608746
808 2935732607 2935732158 Bacteria 9706831
809 2935741986 2935741537 Bacteria 9707219
810 2935751828 2935750917 Bacteria 9590372
811 2935765085 2935760218 Bacteria 9817913
812 2935771702 2935769743 Bacteria 7878163
813 2935778883 2935777560 Bacteria 8077691
814 2935791196 2935785616 Bacteria 7962367
815 2935795475 2935793552 Bacteria 8012592
816 2935802681 2935801545 Bacteria 9301974
817 2935813489 2935810662 Bacteria 9401221
818 2935822431 2935819856 Bacteria 8261050
819 2935830097 2935827899 Bacteria 10038562
820 2935838015 2935837841 Bacteria 9454360
821 2935848013 2935847175 Bacteria 8228321
822 2935855364 2935855204 Bacteria 9035059
823 2935867392 2935864058 Bacteria 9784707
824 2935875789 2935873716 Bacteria 9632195
825 2935908764 2935908558 Bacteria 8568796
826 2935917909 2935916978 Bacteria 9113783
827 2935926662 2935926038 Bacteria 8601059
828 2935935112 2935934488 Bacteria 8602579
829 2935943562 2935942939 Bacteria 8599779
830 2935952000 2935951376 Bacteria 8602333
831 2935960768 2935959822 Bacteria 7869783
832 2935968125 2935967501 Bacteria 8603075
833 2935978740 2935975950 Bacteria 8347125
834 2935987389 2935984226 Bacteria 8302647
835 2935996452 2935992306 Bacteria 9802711
836 2936003733 2936002035 Bacteria 9362176
837 2936013535 2936011229 Bacteria 8801034
838 2936022338 2936019824 Bacteria 8804134
839 2936030784 2936028420 Bacteria 8965941
840 2936042438 2936037263 Bacteria 9446081
841 2936048597 2936046547 Bacteria 8903709
842 2936058811 2936055302 Bacteria 8785755
843 2940557369 2940556831 Bacteria 9590747
844 2941533160 2941531003 Bacteria 7653939
845 2941539319 2941538514 Bacteria 9402094
846 3005484636 3005483717 Bacteria 7877331
847 3005510649 3005506211 Bacteria 6943378
848 3005587713 3005587118 Bacteria 7794411
849 3005599584 3005594810 Bacteria 8716512
850 3005715242 3005710791 Bacteria 7622528
851 3005722626 3005718088 Bacteria 8283608
852 8006972441 8006964411 Bacteria 8966052
853 8006987900 8006984368 Bacteria 9651211
854 8016521846 8016511872 Bacteria 9921665
855 8016529257 8016522445 Bacteria 8156687
856 8016534471 8016530956 Bacteria 8155261
857 8016547691 8016539877 Bacteria 8155419
858 8016554446 8016548790 Bacteria 8155074
859 8016562819 8016557553 Bacteria 8154380
860 8016572810 8016566248 Bacteria 8158151
861 8016576969 8016575299 Bacteria 8154085
862 8016593237 8016583857 Bacteria 10421953
863 8016600594 8016595262 Bacteria 8149947
864 8016626190 8016622563 Bacteria 7999408
865 8016639971 8016630954 Bacteria 9217207
866 8017063807 8017057580 Bacteria 10023680
867 8019534231 8019530166 Bacteria 8155624
868 8019545228 8019538911 Bacteria 7872763
869 8019553287 8019547302 Bacteria 7996444
870 8019583155 8019576017 Bacteria 10049540
871 8019590958 8019586578 Bacteria 10212056
872 8019600389 8019597564 Bacteria 10041141
873 8019628548 8019619141 Bacteria 9218857
874 8019634089 8019629233 Bacteria 8687553
875 8019645640 8019638758 Bacteria 9062356
876 8019658901 8019648815 Bacteria 10014479
877 8019661967 8019659431 Bacteria 8577854
878 8019671492 8019668869 Bacteria 8791617
879 8019684615 8019678201 Bacteria 8863603
880 8019690433 8019687851 Bacteria 8712826
881 8055745922 8055742211 Bacteria 9226248
882 Ga0105240_10143380
883 RicEn_C1063
884 JGI24739J22299_10071180
885 JGI25153J46596_10000394
886 JGI25153J46596_10003431
887 JGI25160J50197_1012586
888 Ga0055542_1011589
889 Ga0055531_10007393
890 Ga0055543_1002885
891 Ga0065165_1001731
892 Ga0065165_1002125
893 Ga0065712_10016912
894 Ga0070658_10004762
895 Ga0070658_10051844
896 Ga0070683_100477334
897 Ga0070683_100575298
898 Ga0068869_100509780
899 Ga0070680_100017453
900 Ga0070680_100107577
901 Ga0070682_100104282
902 Ga0068868_100103125
903 Ga0070660_100001944
904 Ga0070660_100069539
905 Ga0070661_100125958
906 Ga0070668_100323705
907 Ga0070675_100356650
908 Ga0070671_100001629
909 Ga0070673_100177979
910 Ga0070709_10014203
911 Ga0070709_10048689
912 Ga0070709_10077995
913 Ga0070709_10078036
914 Ga0070714_100041624
915 Ga0070714_100091008
916 Ga0070713_100012732
917 Ga0070713_100192501
918 Ga0070713_100195344
919 Ga0070713_100464464
920 Ga0070710_10002441
921 Ga0070710_10046159
922 Ga0070710_10159238
923 Ga0070711_100002925
924 Ga0070711_100005838
925 Ga0070711_100017055
926 Ga0070711_100020886
927 Ga0070711_100040240
928 Ga0070711_100179879
929 Ga0070711_100913954
930 Ga0070663_100055656
931 Ga0070663_100226708
932 Ga0070663_100249004
933 Ga0070678_100011904
934 Ga0070678_100043206
935 Ga0070681_10004544
936 Ga0070681_10103453
937 Ga0070681_10219115
938 Ga0070681_10622008
939 Ga0070706_100204227
940 Ga0070707_100739084
941 Ga0070698_100079119
942 Ga0070699_100098367
943 Ga0070679_100006626
944 Ga0070679_100038870
945 Ga0070679_100395127
946 Ga0070679_100463679
947 Ga0070679_100539670
948 Ga0070684_100063932
949 Ga0070684_100393456
950 Ga0068853_100127758
951 Ga0068853_100486966
952 Ga0070672_100275735
953 Ga0070695_100149314
954 Ga0070696_100238502
955 Ga0070693_100128664
956 Ga0070665_101137226
957 Ga0068855_100073110
958 Ga0068855_100837078
959 Ga0068855_100858428
960 Ga0070664_100024089
961 Ga0070664_100043917
962 Ga0068857_100139884
963 Ga0068854_100460406
964 Ga0068856_100000020
965 Ga0068856_100135286
966 Ga0068856_100168939
967 Ga0070702_100551212
968 Ga0068852_100116503
969 Ga0068852_100420229
970 Ga0068852_100567177
971 Ga0068859_100171388
972 Ga0068864_100025488
973 Ga0068866_10026261
974 Ga0068861_100891841
975 Ga0068870_10485385
976 Ga0068863_100045728
977 Ga0068858_100008078
978 Ga0068860_100327827
979 Ga0068862_100268560
980 Ga0068862_100301425
981 Ga0081455_10017926
982 Ga0081455_10063868
983 Ga0081455_10105008
984 Ga0081538_10034813
985 Ga0081540_1002690
986 Ga0081540_1003654
987 Ga0081540_1017195
988 Ga0070717_10022005
989 Ga0070717_10064475
990 Ga0070717_10178883
991 Ga0075365_10054530
992 Ga0075365_10232908
993 Ga0075363_100063020
994 Ga0075364_10208643
995 Ga0070715_10000961
996 Ga0070716_100002442
997 Ga0070712_100015939
998 Ga0070712_100034659
999 Ga0070712_100043566
1000 Ga0070712_100068339
1001 Ga0070712_100070488
1002 Ga0070712_100492850
1003 Ga0075362_10022802
1004 Ga0075367_10000988
1005 Ga0075369_10008785
1006 Ga0075366_10155752
1007 Ga0075366_10411529
1008 Ga0075366_10483803
1009 Ga0097621_100019101
1010 Ga0097621_100030570
1011 Ga0097621_100567523
1012 Ga0075370_10060519
1013 Ga0068871_100010894
1014 Ga0068871_100166449
1015 Ga0075428_100079146
1016 Ga0075434_100490088
1017 Ga0068865_100381974
1018 Ga0097620_100171379
1019 Ga0099824_1012798
1020 Ga0099794_10283726
1021 Ga0105240_10008282
1022 Ga0105240_10238154
1023 Ga0105240_10273675
1024 Ga0105240_11362552
1025 Ga0105245_10006619
1026 Ga0105245_10007619
1027 Ga0105245_10161198
1028 Ga0105245_10365153
1029 Ga0105247_10346942
1030 Ga0114129_10111337
1031 Ga0114129_10749936
1032 Ga0105241_10053828
1033 Ga0105241_10062670
1034 Ga0105241_10072568
1035 Ga0105241_10122821
1036 Ga0105242_10018122
1037 Ga0105242_10077188
1038 Ga0105242_10418766
1039 Ga0105242_10480797
1040 Ga0105248_10015680
1041 Ga0105248_10027920
1042 Ga0105248_10164724
1043 Ga0105248_10440910
1044 Ga0105237_10006673
1045 Ga0105237_10016711
1046 Ga0105237_10026248
1047 Ga0105237_11001220
1048 Ga0105238_10005356
1049 Ga0105238_10157681
1050 Ga0105238_10246610
1051 Ga0105238_10288491
1052 Ga0105238_10889307
1053 Ga0099796_10009831
1054 Ga0105239_10502132
1055 Ga0105246_10462649
1056 Ga0105246_10597859
1057 Ga0105246_10716096
1058 Ga0157371_10013955
1059 Ga0157370_10110323
1060 Ga0157370_10161675
1061 Ga0157369_10035175
1062 Ga0157369_10104822
1063 Ga0157369_10225065
1064 Ga0157369_10457316
1065 Ga0157369_10587395
1066 Ga0157374_10012098
1067 Ga0157378_10037040
1068 Ga0163162_10019668
1069 Ga0157372_10965973
1070 Ga0157375_10015754
1071 Ga0157375_10031030
1072 Ga0157375_10034118
1073 Ga0163163_10047665
1074 Ga0163163_10490357
1075 Ga0157379_10005550
1076 Ga0157379_10015374
1077 Ga0157379_10090305
1078 Ga0157376_10073840
1079 Ga0206356_11553529
1080 Ga0206353_11806622
1081 Ga0213872_10034960
1082 Ga0213876_10057753
1083 Ga0213875_10056323
1084 Ga0209148_1000500
1085 Ga0209564_1019909
1086 Ga0209758_1000024
1087 Ga0209758_1001533
1088 Ga0209758_1004785
1089 Ga0209758_1007070
1090 Ga0207426_1000510
1091 Ga0209257_1001149
1092 Ga0207656_10045648
1093 Ga0207692_10008992
1094 Ga0207692_10094891
1095 Ga0207688_10059355
1096 Ga0207680_10219026
1097 Ga0207685_10016843
1098 Ga0207699_10002766
1099 Ga0207699_10034074
1100 Ga0207699_10040124
1101 Ga0207699_10297819
1102 Ga0207699_10354584
1103 Ga0207705_10463919
1104 Ga0207707_10000950
1105 Ga0207707_10004626
1106 Ga0207707_10052762
1107 Ga0207707_10232394
1108 Ga0207707_10474556
1109 Ga0207695_10000008
1110 Ga0207695_10084653
1111 Ga0207695_10161968
1112 Ga0207671_10003142
1113 Ga0207693_10000068
1114 Ga0207693_10010099
1115 Ga0207693_10012278
1116 Ga0207693_10013028
1117 Ga0207693_10059172
1118 Ga0207693_10208751
1119 Ga0207663_10000098
1120 Ga0207663_10035907
1121 Ga0207663_10053162
1122 Ga0207660_10002564
1123 Ga0207660_10027186
1124 Ga0207660_10218329
1125 Ga0207657_10000658
1126 Ga0207657_10155771
1127 Ga0207649_10029765
1128 Ga0207652_10003470
1129 Ga0207652_10079037
1130 Ga0207652_10088350
1131 Ga0207652_10264824
1132 Ga0207652_10283302
1133 Ga0207652_10355623
1134 Ga0207652_10651436
1135 Ga0207646_10210051
1136 Ga0207646_10599160
1137 Ga0207694_10089008
1138 Ga0207694_10145180
1139 Ga0207694_10190212
1140 Ga0207687_10116864
1141 Ga0207687_10123341
1142 Ga0207687_10331011
1143 Ga0207700_10015748
1144 Ga0207700_10091132
1145 Ga0207700_10197106
1146 Ga0207700_10303626
1147 Ga0207700_10411601
1148 Ga0207700_10455503
1149 Ga0207664_10042775
1150 Ga0207664_10043417
1151 Ga0207664_10162299
1152 Ga0207690_10107114
1153 Ga0207706_10403102
1154 Ga0207709_10443739
1155 Ga0207704_10296267
1156 Ga0207665_10000355
1157 Ga0207665_10432670
1158 Ga0207711_10174186
1159 Ga0207711_10233979
1160 Ga0207711_10317721
1161 Ga0207689_10021146
1162 Ga0207661_10001747
1163 Ga0207661_10051941
1164 Ga0207661_10262245
1165 Ga0207661_10649613
1166 Ga0207679_10036381
1167 Ga0207667_10215773
1168 Ga0207667_10296284
1169 Ga0207667_10682469
1170 Ga0207651_10370470
1171 Ga0207640_10139666
1172 Ga0207677_10020108
1173 Ga0207677_10372683
1174 Ga0207677_10727925
1175 Ga0207703_10323706
1176 Ga0207639_10043047
1177 Ga0207639_10122518
1178 Ga0207639_10149674
1179 Ga0207639_10486835
1180 Ga0207678_10035639
1181 Ga0207678_10043159
1182 Ga0207678_10111029
1183 Ga0207678_10111451
1184 Ga0207702_10000126
1185 Ga0207641_10083530
1186 Ga0207641_10866328
1187 Ga0207676_10190935
1188 Ga0207674_10129603
1189 Ga0207674_10261908
1190 Ga0207675_100438424
1191 Ga0207675_100495090
1192 Ga0207675_100802265
1193 Ga0207683_10001340
1194 Ga0207683_10028473
1195 Ga0207683_10358569
1196 Ga0207698_10336335
1197 Ga0209389_1000185
1198 Ga0209589_1000036
1199 Ga0209489_100006
1200 Ga0209700_100005
1201 Ga0268266_10002394
1202 Ga0268266_10483755
1203 Ga0268266_10925741
1204 Ga0268264_10027494
1205 Ga0307517_10000008
1206 Ga0307517_10228925
1207 Ga0307515_10045960
1208 Ga0265330_10045567
1209 Ga0265330_10088362
1210 Ga0265325_10000044
1211 Ga0265325_10011538
1212 Ga0265325_10045607
1213 Ga0265339_10019022
1214 Ga0265339_10057328
1215 Ga0265339_10141434
1216 Ga0265339_10180991
1217 Ga0265339_10207939
1218 Ga0265316_10042156
1219 Ga0307513_10029676
1220 Ga0307513_10418380
1221 Ga0307509_10180532
1222 Ga0307408_100449154
1223 Ga0265313_10009939
1224 Ga0307508_10229059
1225 Ga0265314_10008091
1226 Ga0265314_10050093
1227 Ga0307516_10077115
1228 Ga0307406_10332610
1229 Ga0307406_10517961
1230 Ga0307409_100577749
1231 Ga0307416_100271276
1232 Ga0307415_100069687
1233 Ga0316583_10000267
1234 Ga0307510_10001061
1235 Ga0307510_10018144
1236 Ga0307510_10125011
1237 Ga0373926_0042232
1238 Ga0373923_0135165
1239 Ga0373939_0000811
1240 Ga0373953_0005595
1241 Ga0373953_0048107
1242 Ga0373954_0013096
1243 Ga0373956_0015090
1244 Ga0373956_0089214
1245 Ga0373957_0022135
1246 Ga0373943_0028143
1247 Ga0373955_0009673
1248 Ga0373955_0015065
1249 Ga0373955_0108075
1250 Ga0316574_0209557
1251 Ga0373924_0021198
1252 Ga0373935_0044130
1253 Ga0373927_0016784
1254 Ga0373927_0027467
1255 Ga0373933_0000199
1256 Ga0373933_0012562
1257 Ga0373947_0047946
1258 Ga0373937_0003498
1259 Ga0373925_0000767
1260 Ga0373925_0157538
1261 Ga0373925_0263518
1262 Ga0373925_0265765
1263 Ga0373925_0442365
1264 Ga0395900_0044295
1265 Ga0395900_0288678
1266 Ga0395900_0291201
1267 Ga0395898_0010583
1268 Ga0395898_0185548
1269 Ga0395898_0436159
1270 Ga0395905_0040677
1271 Ga0395905_0136213
1272 Ga0436364_0397486
1273 Ga0436364_1535696
1274 Ga0395901_0011779
1275 Ga0395901_0123610
1276 Ga0395901_0182755
1277 Ga0436365_0042699
1278 Ga0436360_1256664
1279 Ga0436361_0532883
1280 Ga0436361_0833650
1281 Ga0436363_0842295
1282 Ga0439441_022090
1283 Ga0466963_0038369
1284 Ga0466963_0132734
1285 Ga0466963_0169940
1286 Ga0466964_0092261
1287 Ga0466971_0248365
1288 Ga0466957_0005921
1289 Ga0466957_0067739
1290 Ga0466959_0030990
1291 Ga0451576_1082748
1292 Ga0466958_0055054
1293 Ga0466958_0131752
1294 Ga0466967_0066574
1295 Ga0466967_0863177
1296 Ga0495617_137550
1297 Ga0495592_0003279
1298 Ga0495603_0004410
1299 Ga0495603_0006388
1300 Ga0495603_0044718
1301 Ga0495603_0083749
1302 Ga0495629_0192979
1303 Ga0495641_0022963
1304 Ga0495641_0130608
1305 Ga0495651_0055037
1306 Ga0495651_0064165
1307 Ga0495653_0141442
1308 Ga0495580_0001449
1309 Ga0495580_0113921
1310 Ga0495580_0133464
1311 Ga0495582_0120766
1312 Ga0495605_0139756
1313 Ga0495639_0044746
1314 Ga0495662_0133154
1315 Ga0495664_0006747
1316 Ga0495664_0019399
1317 Ga0495664_0045522
1318 Ga0495585_0053425
1319 Ga0495594_0066599
1320 Ga0495594_0217607
1321 Ga0495606_0001179
1322 Ga0495606_0025719
1323 Ga0495608_0042556
1324 Ga0495608_0121182
1325 Ga0495618_0005389
1326 Ga0495628_0015673
1327 Ga0495628_0041443
1328 Ga0495628_0274934
1329 Ga0495628_0410575
1330 Ga0495630_0256501
1331 Ga0495630_0402568
1332 Ga0495632_0062420
1333 Ga0495637_0113053
1334 Ga0495666_0042687
1335 Ga0495666_0051380
1336 Ga0495652_0002979
1337 Ga0495652_0083205
1338 Ga0495665_0038334
1339 Ga0495640_0011617
1340 Ga0495640_0027667
1341 Ga0495640_0103913
1342 Ga0495640_0187589
1343 Ga0495587_0011641
1344 Ga0495598_0004011
1345 Ga0495645_0001025
1346 Ga0495645_0001772
1347 Ga0495622_0041218
1348 Ga0495622_0068255
1349 Ga0495667_0001273
1350 Ga0495667_0033238
1351 Ga0495667_0069109
1352 Ga0495656_0131030
1353 Ga0495668_0261772
1354 Ga0495634_0053454
1355 Ga0495625_0190042
1356 Ga0495635_0114378
1357 Ga0495659_0019059
1358 Ga0495588_0006176
1359 Ga0495588_0009960
1360 Ga0495657_0067361
1361 Ga0495599_0007196
1362 Ga0495623_0013803
1363 Ga0495623_0069959
1364 Ga0495646_0067005
1365 Ga0495647_0029905
1366 Ga0495647_0059378
1367 Ga0495658_0171470
1368 Ga0495658_0303068
1369 Ga0495624_0020197
1370 Ga0495624_0137708
1371 Ga0495670_0303218
1372 Ga0495600_0003839
1373 Ga0495600_0049859
1374 Ga0495604_0002660
1375 Ga0495604_0010726
1376 Ga0495674_0013103
1377 Ga0495674_0014178
1378 Ga0495674_0048940
1379 Ga0495674_0072773
1380 Ga0495674_0128534
1381 Ga0495672_0039595
1382 Ga0495676_0072253
1383 Ga0495676_0084983
1384 Ga0495676_0161515
1385 Ga0495680_0009088
1386 Ga0495680_0044688
1387 Ga0495680_0284136
1388 Ga0495683_0246945
1389 Ga0495675_0000984
1390 Ga0495675_0198151
1391 Ga0495681_0132100
1392 Ga0495684_0051684
1393 Ga0495684_0103345
1394 Ga0495686_0076873
1395 Ga0495593_0064886
1396 Ga0495602_0000726
1397 Ga0495614_0050196
1398 Ga0495626_0150224
1399 Ga0496100_0006817
1400 Ga0496100_0087309
1401 Ga0496101_0000213
1402 Ga0496101_0020482
1403 Ga0496101_0237976
1404 Ga0496101_0257105
1405 Ga0496101_0275356
1406 Ga0496102_0030253
1407 Ga0496102_0107202
1408 Ga0496102_0157581
1409 Ga0496102_0179875
1410 Ga0496103_0000323
1411 Ga0496103_0045764
1412 Ga0496103_0226854
1413 Ga0496103_0294408
1414 Ga0496104_0000580
1415 Ga0496104_0002456
1416 Ga0496104_0069164
1417 Ga0496104_0109269
1418 Ga0496104_0118307
1419 Ga0496104_0205595
1420 Ga0496104_0916199
1421 Ga0496105_0000402
1422 Ga0496105_0005338
1423 Ga0496105_0006042
1424 Ga0496105_0019704
1425 Ga0496105_0034625
1426 Ga0496106_0002551
1427 Ga0496106_0019968
1428 Ga0496106_0673926
1429 Ga0496107_0005110
1430 Ga0496107_0007348
1431 Ga0496107_0011880
1432 Ga0496108_0007691
1433 Ga0496108_0018148
1434 Ga0496108_0018223
1435 Ga0496108_0099899
1436 Ga0496109_0010098
1437 Ga0496109_0030334
1438 Ga0496109_0188433
1439 Ga0496109_0480397
1440 Ga0496110_0023813
1441 Ga0496110_0067437
1442 Ga0496110_0232617
1443 Ga0496110_0634889
1444 Ga0496111_0000449
1445 Ga0496111_0014244
1446 Ga0496112_0034239
1447 Ga0496112_0075363
1448 Ga0496113_0000528
1449 Ga0496113_0036976
1450 Ga0496113_0288256
1451 Ga0496113_0344749
1452 Ga0496114_0057383
1453 Ga0496114_0094109
1454 Ga0496114_0170210
1455 Ga0496114_0261912
1456 Ga0496114_0387221
1457 Ga0496115_0006273
1458 Ga0496115_0027561
1459 Ga0496115_0095967
1460 Ga0496115_0165195
1461 Ga0496115_0261882
1462 Ga0496115_0354614
1463 Ga0496116_0000691
1464 Ga0496116_0017742
1465 Ga0496117_0000018
1466 Ga0496117_0040858
1467 Ga0496118_0000013
1468 Ga0496118_0041838
1469 Ga0496118_0347342
1470 Ga0496119_0035537
1471 Ga0496121_0014546
1472 Ga0496121_0224248
1473 Ga0496121_0313416
1474 Ga0496124_0150774
1475 Ga0496125_0203754
1476 Ga0496126_0000902
1477 Ga0496126_0001122
1478 Ga0496126_0015735
1479 Ga0496126_0048493
1480 Ga0496126_0097147
1481 Ga0496126_0129917
1482 Ga0496126_0482171
1483 Ga0501031_0035285
1484 Ga0501032_0140627
1485 Ga0501032_0190204
1486 Ga0501033_0076639
1487 Ga0501034_0190459
1488 Ga0501034_0423571
1489 Ga0501036_0116806
1490 Ga0501037_0369219
1491 Ga0501038_0037203
1492 Ga0501039_0184272
1493 Ga0501039_0209369
1494 Ga0501043_0154376
1495 Ga0501043_0416932
1496 Ga0501046_0615463
1497 Ga0501047_0098128
1498 Ga0501047_0314286
1499 Ga0501048_0365352
1500 Ga0501067_0298735
1501 Ga0501070_0005092
1502 Ga0501070_0101042
1503 Ga0501073_0057668
1504 Ga0501073_0084887
1505 Ga0501074_0008292
1506 Ga0501074_0012164
1507 Ga0501079_0256190
1508 Ga0501044_0080499
1509 Ga0501044_0093205
1510 Ga0501044_0132475
1511 nmdc:mga03683_247809_c1
1512 nmdc:mga03n38_20431_c1
1513 nmdc:mga03n38_26265_c1
1514 nmdc:mga00v17_179291_c1
1515 nmdc:mga00v17_278130_c1
1516 nmdc:mga0yw44_215299_c1
1517 nmdc:mga0yw44_79637_c1
1518 nmdc:mga0k408_162592_c1
1519 nmdc:mga0k408_215548_c1
1520 nmdc:mga06z11_59313_c1
1521 nmdc:mga07m45_13999_c1
1522 nmdc:mga07m45_343835_c1
1523 nmdc:mga05p37_141849_c1
1524 nmdc:mga08y16_307608_c1
1525 nmdc:mga0sz30_191847_c1
1526 nmdc:mga0sz30_238604_c1
1527 Ga0495601_0000232
1528 Ga0495601_0004312
1529 Ga0495601_0014166
1530 Ga0495601_0330339
1531 Ga0495612_0000608
1532 Ga0495612_0008328
1533 Ga0495612_0064474
1534 Ga0500635_0008149
1535 Ga0500635_0067466
1536 Ga0500635_0116019
1537 Ga0495595_0000240
1538 Ga0495595_0000284
1539 Ga0495619_0000145
1540 Ga0495619_0001165
1541 Ga0495619_0001565
1542 Ga0495619_0028070
1543 Ga0500578_0023708
1544 Ga0500578_0148732
1545 Ga0500644_0119011
1546 Ga0500647_0039154
1547 Ga0500583_0036800
1548 Ga0500566_0000006
1549 Ga0500640_000036
1550 Ga0500641_0131994
1551 Ga0500554_009687
1552 Ga0500555_004027
1553 Ga0500557_000052
1554 Ga0500562_020239
1555 Ga0500572_005599
1556 Ga0500572_036126
1557 Ga0500593_012965
1558 Ga0500607_040291
1559 Ga0500608_021487
1560 Ga0500608_078010
1561 Ga0500614_000846
1562 Ga0500642_0000468
1563 Ga0500642_0104047
1564 Ga0500655_022213
1565 Ga0500658_0051537
1566 Ga0500658_0089405
1567 Ga0500559_0023353
1568 Ga0500559_0029799
1569 Ga0500585_156795
1570 Ga0500590_057832
1571 Ga0500603_000195
1572 Ga0500603_002409
1573 Ga0500604_0109479
1574 Ga0500619_038193
1575 Ga0500620_001550
1576 Ga0500630_001646
1577 Ga0500638_026391
1578 Ga0500639_000170
1579 Ga0500639_051091
1580 Ga0500636_0001217
1581 Ga0500637_0012756
1582 Ga0500637_0038627
1583 Ga0500625_038855
1584 Ga0500645_074604
1585 Ga0500601_003622
1586 Ga0466962_0044607
1587 2507508247
1588 2508542316
1589 2508691924
1590 2511397496
1591 2513622376
1592 2513640553
1593 2513645466
1594 2513692891
1595 2513702501
1596 2513718416
1597 2513873113
1598 2514016546
1599 2517102651
1600 2524437713
1601 2528848685
1602 2617347021
1603 2723846524
1604 2745081181
1605 2793062620
1606 2793079923
1607 2805914988
1608 2818239693
1609 2824602375
1610 2824610531
1611 2824618090
1612 2824626758
1613 2824636607
1614 2824645141
1615 2824654344
1616 2824661572
1617 2824672014
1618 2824679841
1619 2824688613
1620 2824705277
1621 2824715698
1622 2824725181
1623 2824754349
1624 2824767848
1625 2824775274
1626 2838123376
1627 2841946669
1628 2841954097
1629 2841964042
1630 2841969475
1631 2841983800
1632 2842040158
1633 2842046897
1634 2844319388
1635 2847936558
1636 2857515892
1637 2874598383
1638 2874605540
1639 2874619398
1640 2874626384
1641 2874632248
1642 2874652562
1643 2876764935
1644 2876778139
1645 2876825992
1646 2879081933
1647 2879089537
1648 2879108325
1649 2879115854
1650 2879135055
1651 2879149740
1652 2881368488
1653 2881672554
1654 2885369239
1655 2885413338
1656 2888384456
1657 2888393452
1658 2888424906
1659 2889039413
1660 2903734329
1661 2904671723
1662 2904715072
1663 2906605574
1664 2906633653
1665 2906646555
1666 2922365728
1667 2922374866
1668 2922400450
1669 2929621912
1670 2929629781
1671 2932788780
1672 2932798021
1673 2932807137
1674 2932812754
1675 2932819154
1676 2932830446
1677 2933583812
1678 2935609271
1679 2935616740
1680 2935641930
1681 2935659120
1682 2935673061
1683 2935675866
1684 2935685863
1685 2935697891
1686 2935705703
1687 2935714415
1688 2935725034
1689 2935732607
1690 2935741986
1691 2935751828
1692 2935765085
1693 2935771702
1694 2935778883
1695 2935791196
1696 2935795475
1697 2935802681
1698 2935813489
1699 2935822431
1700 2935830097
1701 2935838015
1702 2935848013
1703 2935855364
1704 2935867392
1705 2935875789
1706 2935908764
1707 2935917909
1708 2935926662
1709 2935935112
1710 2935943562
1711 2935952000
1712 2935960768
1713 2935968125
1714 2935978740
1715 2935987389
1716 2935996452
1717 2936003733
1718 2936013535
1719 2936022338
1720 2936030784
1721 2936042438
1722 2936048597
1723 2936058811
1724 2940557369
1725 2941533160
1726 2941539319
1727 3005484636
1728 3005510649
1729 3005587713
1730 3005599584
1731 3005715242
1732 3005722626
1733 8006972441
1734 8006987900
1735 8016521846
1736 8016529257
1737 8016534471
1738 8016547691
1739 8016554446
1740 8016562819
1741 8016572810
1742 8016576969
1743 8016593237
1744 8016600594
1745 8016626190
1746 8016639971
1747 8017063807
1748 8019534231
1749 8019545228
1750 8019553287
1751 8019583155
1752 8019590958
1753 8019600389
1754 8019628548
1755 8019634089
1756 8019645640
1757 8019658901
1758 8019661967
1759 8019671492
1760 8019684615
1761 8019690433
1762 8055745922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

52

200

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcn-assembly1.cif.gz_A crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426 0.9092 34 160
1j3l-assembly1.cif.gz_A structure of the rna-processing inhibitor rraa from thermus thermophilis 0.895 35 160
3c8o-assembly1.cif.gz_B the crystal structure of rraa from pao1 0.8917 20 160
1vi4-assembly1.cif.gz_A crystal structure of regulator of ribonuclease activity a protein 1 0.8907 34 160
1nxj-assembly1.cif.gz_A structure of rv3853 from mycobacterium tuberculosis 0.887 32 160
ID Description Score Start End Superfamily
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9757 21 160 3.50.30.40
2pcnA00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9092 34 160 3.50.30.40
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8943 21 160 3.50.30.40
af_P0A8R0_1_161_3.50.30.40 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8919 20 160 3.50.30.40
1j3lD00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8903 34 160 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A2M8V5U8-F1-model_v4 deleted 0.9818 37 135
AF-A0A7X5SB67-F1-model_v4 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase (EC 4.1.3.17) 0.9774 2 160 GO:0046872
GO:0047443
AF-A0A7W1K333-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (RraA-like protein) 0.9766 2 131 GO:0046872
AF-A0A2V8LMN1-F1-model_v4 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase 0.9764 1 160 GO:0046872
AF-A0A7W9G7T8-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (RraA-like protein) 0.9736 1 160 GO:0046872
GO:0047443

Map