F484547
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 882 | 403 | 1764 | 398 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_100004175|Ga0068854_1000041755 |
| Length | 438 |
| Sequence | MRSEYLFTSESVSEGHPDKVLFLSKDPEARVACETLTTTQRVVLAGEIRCKGVYENGAWAPGALDEIEATVRGVVRRIGYEQDGFHWQNLEFSNYLHGQSAHIAQGVDETGNKDEGAGDQGIMFGFACDETPDLMPATLDYSHKILERLAADRKSGAAPFLEPDAKSQVTLHYKDGKPVEATAIVVSTQHKPGWDQGEKEAELHAYVKAAVGELLPAGFVTANTVWHINPTGSFEIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYVTRYLAKNIVAAGLARRCTIQLAYAIGVARPLSLYVDSHGTGTVDDAVLEAAIAKVAEERLGGLTPKGIRLGLGLNRPIYSTTAAYGHFGRKAEGDLFPWERTDLVEALKAACSGKGEAGRASGQATPMPSPSCGQRSSLGRAGSRNSAGIRPNSRAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 163 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 164 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 165 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 196 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 199 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 263 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 264 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 265 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 270 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 271 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 278 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 280 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 281 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 282 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 283 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 285 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 286 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 287 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 288 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 292 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 304 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 305 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 306 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 308 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 310 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 311 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 312 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 313 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 315 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 316 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 317 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 318 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 320 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 321 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 323 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 325 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 328 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 329 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 332 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 333 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 334 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 335 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 337 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 338 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 340 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 341 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 342 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 343 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 344 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 345 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 346 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 347 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 348 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 349 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 350 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 351 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 352 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 353 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 354 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 355 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 356 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 357 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 358 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 359 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 360 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 361 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 362 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 363 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 364 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 365 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 366 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 367 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 368 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 369 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 370 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 371 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 372 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 373 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 374 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 375 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 376 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 377 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 378 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 379 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 380 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 381 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 382 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 383 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 384 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 385 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 386 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 387 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 388 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 389 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 390 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 391 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 392 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 393 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 394 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 395 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 396 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 397 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 398 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 399 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 400 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 401 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 402 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 403 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.18 |
| Metatranscriptomes | 0.34 |
| Isolates | 7.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.57 |
| Bulb | 0 |
| Endosphere | 13.27 |
| Nodule | 0.11 |
| Rhizoplane | 4.65 |
| Rhizosphere | 70.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068854_100004175 | 3300005578 | Bacteria | 9088 |
| 2 | SwRhRL2b_contig_1291094 | 2162886007 | Bacteria | 3181 |
| 3 | JGI24752J21851_1001004 | 3300001976 | Bacteria | 3859 |
| 4 | JGI24739J22299_10003374 | 3300001989 | Bacteria | 6092 |
| 5 | JGI24749J21850_1000013 | 3300002076 | Bacteria | 36526 |
| 6 | JGI24751J29686_10000014 | 3300002459 | Bacteria | 113284 |
| 7 | JGI24751J29686_10000221 | 3300002459 | Bacteria | 24118 |
| 8 | JGI25165J46597_1000208 | 3300003214 | Bacteria | 84386 |
| 9 | JGI25153J46596_10013362 | 3300003215 | Bacteria | 3470 |
| 10 | Ga0055537_1001492 | 3300003773 | Bacteria | 9011 |
| 11 | Ga0055528_1002288 | 3300003790 | Bacteria | 10380 |
| 12 | Ga0055530_10000586 | 3300003791 | Bacteria | 31506 |
| 13 | Ga0055530_10007003 | 3300003791 | Bacteria | 4861 |
| 14 | Ga0055531_10002679 | 3300003794 | Bacteria | 11731 |
| 15 | Ga0055531_10003677 | 3300003794 | Bacteria | 9665 |
| 16 | Ga0055531_10005289 | 3300003794 | Bacteria | 7573 |
| 17 | Ga0055531_10008083 | 3300003794 | Bacteria | 5614 |
| 18 | Ga0055531_10036874 | 3300003794 | Bacteria | 1498 |
| 19 | Ga0065165_1000345 | 3300005262 | Bacteria | 76072 |
| 20 | Ga0065165_1000941 | 3300005262 | Bacteria | 37145 |
| 21 | Ga0065704_10000309 | 3300005289 | Bacteria | 58094 |
| 22 | Ga0065704_10004554 | 3300005289 | Bacteria | 4573 |
| 23 | Ga0065707_10081814 | 3300005295 | Bacteria | 36963 |
| 24 | Ga0070658_10000402 | 3300005327 | Bacteria | 37597 |
| 25 | Ga0070658_10003087 | 3300005327 | Bacteria | 13742 |
| 26 | Ga0070683_100090220 | 3300005329 | Bacteria | 2877 |
| 27 | Ga0070670_100000004 | 3300005331 | Bacteria | 392110 |
| 28 | Ga0070670_100000008 | 3300005331 | Bacteria | 292132 |
| 29 | Ga0070670_100000100 | 3300005331 | Bacteria | 79763 |
| 30 | Ga0070670_100006852 | 3300005331 | Bacteria | 9653 |
| 31 | Ga0070670_100012304 | 3300005331 | Bacteria | 7323 |
| 32 | Ga0070670_100031000 | 3300005331 | Bacteria | 4605 |
| 33 | Ga0070677_10013039 | 3300005333 | Bacteria | 2898 |
| 34 | Ga0070666_10006621 | 3300005335 | Bacteria | 7126 |
| 35 | Ga0070666_10049156 | 3300005335 | Bacteria | 2833 |
| 36 | Ga0070666_10058434 | 3300005335 | Bacteria | 2608 |
| 37 | Ga0070680_100017002 | 3300005336 | Bacteria | 5727 |
| 38 | Ga0070682_100082452 | 3300005337 | Bacteria | 2084 |
| 39 | Ga0068868_100000184 | 3300005338 | Bacteria | 41969 |
| 40 | Ga0070660_100001819 | 3300005339 | Bacteria | 14641 |
| 41 | Ga0070660_100001962 | 3300005339 | Bacteria | 14186 |
| 42 | Ga0070660_100028542 | 3300005339 | Bacteria | 4176 |
| 43 | Ga0070668_100000056 | 3300005347 | Bacteria | 70052 |
| 44 | Ga0070668_100000120 | 3300005347 | Bacteria | 48270 |
| 45 | Ga0070668_100000382 | 3300005347 | Bacteria | 29215 |
| 46 | Ga0070668_100000618 | 3300005347 | Bacteria | 23868 |
| 47 | Ga0070668_100001275 | 3300005347 | Bacteria | 18002 |
| 48 | Ga0070668_100002077 | 3300005347 | Bacteria | 14646 |
| 49 | Ga0070668_100005886 | 3300005347 | Bacteria | 9091 |
| 50 | Ga0070668_100009160 | 3300005347 | Bacteria | 7345 |
| 51 | Ga0070668_100016001 | 3300005347 | Bacteria | 5612 |
| 52 | Ga0070668_100018170 | 3300005347 | Bacteria | 5276 |
| 53 | Ga0070668_100038868 | 3300005347 | Bacteria | 3639 |
| 54 | Ga0070668_100054427 | 3300005347 | Bacteria | 3086 |
| 55 | Ga0070669_100000045 | 3300005353 | Bacteria | 119932 |
| 56 | Ga0070669_100000392 | 3300005353 | Bacteria | 33692 |
| 57 | Ga0070669_100000602 | 3300005353 | Bacteria | 26699 |
| 58 | Ga0070669_100000621 | 3300005353 | Bacteria | 26232 |
| 59 | Ga0070669_100043804 | 3300005353 | Bacteria | 3260 |
| 60 | Ga0070669_100075791 | 3300005353 | Bacteria | 2495 |
| 61 | Ga0070675_100146394 | 3300005354 | Bacteria | 2023 |
| 62 | Ga0070671_100000053 | 3300005355 | Bacteria | 78361 |
| 63 | Ga0070671_100000221 | 3300005355 | Bacteria | 37988 |
| 64 | Ga0070671_100000662 | 3300005355 | Bacteria | 24756 |
| 65 | Ga0070671_100004972 | 3300005355 | Bacteria | 10584 |
| 66 | Ga0070671_100007152 | 3300005355 | Bacteria | 8920 |
| 67 | Ga0070671_100020129 | 3300005355 | Bacteria | 5438 |
| 68 | Ga0070671_100033699 | 3300005355 | Bacteria | 4238 |
| 69 | Ga0070671_100046383 | 3300005355 | Bacteria | 3613 |
| 70 | Ga0070673_100076271 | 3300005364 | Bacteria | 2707 |
| 71 | Ga0070659_100000009 | 3300005366 | Bacteria | 203891 |
| 72 | Ga0070659_100001161 | 3300005366 | Bacteria | 19244 |
| 73 | Ga0070659_100018413 | 3300005366 | Bacteria | 5271 |
| 74 | Ga0070659_100172813 | 3300005366 | Bacteria | 1771 |
| 75 | Ga0070667_100000175 | 3300005367 | Bacteria | 79433 |
| 76 | Ga0070667_100000215 | 3300005367 | Bacteria | 67317 |
| 77 | Ga0070667_100000288 | 3300005367 | Bacteria | 56928 |
| 78 | Ga0070667_100000499 | 3300005367 | Bacteria | 39722 |
| 79 | Ga0070667_100000685 | 3300005367 | Bacteria | 32727 |
| 80 | Ga0070667_100024627 | 3300005367 | Bacteria | 5000 |
| 81 | Ga0070667_100048441 | 3300005367 | Bacteria | 3576 |
| 82 | Ga0070667_100070571 | 3300005367 | Bacteria | 2974 |
| 83 | Ga0070663_100297061 | 3300005455 | Bacteria | 1292 |
| 84 | Ga0070662_100000429 | 3300005457 | Bacteria | 24862 |
| 85 | Ga0070662_100004338 | 3300005457 | Bacteria | 8958 |
| 86 | Ga0070662_100088274 | 3300005457 | Bacteria | 2324 |
| 87 | Ga0070681_10038631 | 3300005458 | Bacteria | 4785 |
| 88 | Ga0070679_100021176 | 3300005530 | Bacteria | 6344 |
| 89 | Ga0070679_100050252 | 3300005530 | Bacteria | 4153 |
| 90 | Ga0070679_100137854 | 3300005530 | Bacteria | 2421 |
| 91 | Ga0070684_100180481 | 3300005535 | Bacteria | 1919 |
| 92 | Ga0068853_100019636 | 3300005539 | Bacteria | 5609 |
| 93 | Ga0068853_100032066 | 3300005539 | Bacteria | 4449 |
| 94 | Ga0068853_100208168 | 3300005539 | Bacteria | 1782 |
| 95 | Ga0070686_100001493 | 3300005544 | Bacteria | 13164 |
| 96 | Ga0070686_100007327 | 3300005544 | Bacteria | 6151 |
| 97 | Ga0070665_100000145 | 3300005548 | Bacteria | 131599 |
| 98 | Ga0070665_100000198 | 3300005548 | Bacteria | 105999 |
| 99 | Ga0070665_100000541 | 3300005548 | Bacteria | 53057 |
| 100 | Ga0070665_100002021 | 3300005548 | Bacteria | 22808 |
| 101 | Ga0070665_100002104 | 3300005548 | Bacteria | 22281 |
| 102 | Ga0070665_100002458 | 3300005548 | Bacteria | 20427 |
| 103 | Ga0070665_100015213 | 3300005548 | Bacteria | 7725 |
| 104 | Ga0070665_100098610 | 3300005548 | Bacteria | 2927 |
| 105 | Ga0070665_100334560 | 3300005548 | Bacteria | 1519 |
| 106 | Ga0068855_100000348 | 3300005563 | Bacteria | 57384 |
| 107 | Ga0068855_100008632 | 3300005563 | Bacteria | 12312 |
| 108 | Ga0068855_100008731 | 3300005563 | Bacteria | 12251 |
| 109 | Ga0068855_100121878 | 3300005563 | Bacteria | 2984 |
| 110 | Ga0070664_100052431 | 3300005564 | Bacteria | 3455 |
| 111 | Ga0070664_100072882 | 3300005564 | Bacteria | 2946 |
| 112 | Ga0068857_100001454 | 3300005577 | Bacteria | 18809 |
| 113 | Ga0068857_100012594 | 3300005577 | Bacteria | 7369 |
| 114 | Ga0068854_100010070 | 3300005578 | Bacteria | 6122 |
| 115 | Ga0068854_100011450 | 3300005578 | Bacteria | 5777 |
| 116 | Ga0068854_100036219 | 3300005578 | Bacteria | 3459 |
| 117 | Ga0068854_100107844 | 3300005578 | Bacteria | 2097 |
| 118 | Ga0068856_100014531 | 3300005614 | Bacteria | 7608 |
| 119 | Ga0068856_100063694 | 3300005614 | Bacteria | 3642 |
| 120 | Ga0068856_100072458 | 3300005614 | Bacteria | 3410 |
| 121 | Ga0068852_100000122 | 3300005616 | Bacteria | 52368 |
| 122 | Ga0068852_100035418 | 3300005616 | Bacteria | 4164 |
| 123 | Ga0068859_100001068 | 3300005617 | Bacteria | 28047 |
| 124 | Ga0068859_100002239 | 3300005617 | Bacteria | 19626 |
| 125 | Ga0068859_100025300 | 3300005617 | Bacteria | 5954 |
| 126 | Ga0068859_100060124 | 3300005617 | Bacteria | 3829 |
| 127 | Ga0068859_100062674 | 3300005617 | Bacteria | 3749 |
| 128 | Ga0068859_100064302 | 3300005617 | Bacteria | 3701 |
| 129 | Ga0068859_100216185 | 3300005617 | Bacteria | 2004 |
| 130 | Ga0068864_100000027 | 3300005618 | Bacteria | 229759 |
| 131 | Ga0068864_100000058 | 3300005618 | Bacteria | 125688 |
| 132 | Ga0068864_100000077 | 3300005618 | Bacteria | 104141 |
| 133 | Ga0068864_100000082 | 3300005618 | Bacteria | 101182 |
| 134 | Ga0068864_100000897 | 3300005618 | Bacteria | 25075 |
| 135 | Ga0068864_100002236 | 3300005618 | Bacteria | 15990 |
| 136 | Ga0068864_100006635 | 3300005618 | Bacteria | 9474 |
| 137 | Ga0068864_100017042 | 3300005618 | Bacteria | 6054 |
| 138 | Ga0068864_100215479 | 3300005618 | Bacteria | 1770 |
| 139 | Ga0068861_100005917 | 3300005719 | Bacteria | 8311 |
| 140 | Ga0068863_100000077 | 3300005841 | Bacteria | 108697 |
| 141 | Ga0068863_100000083 | 3300005841 | Bacteria | 104757 |
| 142 | Ga0068863_100000124 | 3300005841 | Bacteria | 80821 |
| 143 | Ga0068863_100000175 | 3300005841 | Bacteria | 67772 |
| 144 | Ga0068863_100000597 | 3300005841 | Bacteria | 36664 |
| 145 | Ga0068863_100003418 | 3300005841 | Bacteria | 15652 |
| 146 | Ga0068863_100010685 | 3300005841 | Bacteria | 8915 |
| 147 | Ga0068863_100055146 | 3300005841 | Bacteria | 3764 |
| 148 | Ga0068863_100074925 | 3300005841 | Bacteria | 3202 |
| 149 | Ga0068863_100086882 | 3300005841 | Bacteria | 2963 |
| 150 | Ga0068863_100283111 | 3300005841 | Bacteria | 1606 |
| 151 | Ga0068858_100000006 | 3300005842 | Bacteria | 256011 |
| 152 | Ga0068858_100001633 | 3300005842 | Bacteria | 22876 |
| 153 | Ga0068858_100001737 | 3300005842 | Bacteria | 22238 |
| 154 | Ga0068858_100004877 | 3300005842 | Bacteria | 13157 |
| 155 | Ga0068858_100008659 | 3300005842 | Bacteria | 9770 |
| 156 | Ga0068858_100020545 | 3300005842 | Bacteria | 6170 |
| 157 | Ga0068858_100026343 | 3300005842 | Bacteria | 5404 |
| 158 | Ga0068858_100100435 | 3300005842 | Bacteria | 2698 |
| 159 | Ga0068860_100000049 | 3300005843 | Bacteria | 208782 |
| 160 | Ga0068860_100000077 | 3300005843 | Bacteria | 171297 |
| 161 | Ga0068860_100001901 | 3300005843 | Bacteria | 22162 |
| 162 | Ga0068860_100002711 | 3300005843 | Bacteria | 18421 |
| 163 | Ga0068860_100014040 | 3300005843 | Bacteria | 7857 |
| 164 | Ga0068860_100014077 | 3300005843 | Bacteria | 7848 |
| 165 | Ga0068860_100016786 | 3300005843 | Bacteria | 7137 |
| 166 | Ga0068860_100036625 | 3300005843 | Bacteria | 4700 |
| 167 | Ga0068860_100255722 | 3300005843 | Bacteria | 1706 |
| 168 | Ga0068862_100000098 | 3300005844 | Bacteria | 104141 |
| 169 | Ga0068862_100000170 | 3300005844 | Bacteria | 72214 |
| 170 | Ga0068862_100000183 | 3300005844 | Bacteria | 68758 |
| 171 | Ga0068862_100002004 | 3300005844 | Bacteria | 18470 |
| 172 | Ga0068862_100014066 | 3300005844 | Bacteria | 6638 |
| 173 | Ga0068862_100042547 | 3300005844 | Bacteria | 3870 |
| 174 | Ga0068862_100043643 | 3300005844 | Bacteria | 3823 |
| 175 | Ga0068862_100056635 | 3300005844 | Bacteria | 3359 |
| 176 | Ga0081455_10000100 | 3300005937 | Bacteria | 95033 |
| 177 | Ga0081455_10050148 | 3300005937 | Bacteria | 3592 |
| 178 | Ga0070717_10191604 | 3300006028 | Bacteria | 1787 |
| 179 | Ga0075365_10045687 | 3300006038 | Bacteria | 2874 |
| 180 | Ga0075368_10000068 | 3300006042 | Bacteria | 24732 |
| 181 | Ga0075368_10000237 | 3300006042 | Bacteria | 15526 |
| 182 | Ga0075368_10007233 | 3300006042 | Bacteria | 3912 |
| 183 | Ga0075363_100015558 | 3300006048 | Bacteria | 3742 |
| 184 | Ga0075363_100088226 | 3300006048 | Bacteria | 1705 |
| 185 | Ga0075432_10013462 | 3300006058 | Bacteria | 2779 |
| 186 | Ga0075367_10002063 | 3300006178 | Bacteria | 8995 |
| 187 | Ga0075367_10003603 | 3300006178 | Bacteria | 7418 |
| 188 | Ga0075366_10019047 | 3300006195 | Bacteria | 3967 |
| 189 | Ga0075366_10030558 | 3300006195 | Bacteria | 3167 |
| 190 | Ga0075366_10044951 | 3300006195 | Bacteria | 2618 |
| 191 | Ga0075366_10068614 | 3300006195 | Bacteria | 2110 |
| 192 | Ga0097621_100036553 | 3300006237 | Bacteria | 3930 |
| 193 | Ga0075370_10006199 | 3300006353 | Bacteria | 6002 |
| 194 | Ga0075428_100169474 | 3300006844 | Bacteria | 2368 |
| 195 | Ga0075430_100012777 | 3300006846 | Bacteria | 7152 |
| 196 | Ga0075430_100073958 | 3300006846 | Bacteria | 2857 |
| 197 | Ga0075431_100018323 | 3300006847 | Bacteria | 7127 |
| 198 | Ga0075434_100118640 | 3300006871 | Bacteria | 2660 |
| 199 | Ga0068865_100000389 | 3300006881 | Bacteria | 24391 |
| 200 | Ga0097620_100001068 | 3300006931 | Bacteria | 28047 |
| 201 | Ga0097620_100002239 | 3300006931 | Bacteria | 19626 |
| 202 | Ga0097620_100025300 | 3300006931 | Bacteria | 5954 |
| 203 | Ga0097620_100060120 | 3300006931 | Bacteria | 3829 |
| 204 | Ga0097620_100062674 | 3300006931 | Bacteria | 3749 |
| 205 | Ga0097620_100064299 | 3300006931 | Bacteria | 3701 |
| 206 | Ga0097620_100216190 | 3300006931 | Bacteria | 2004 |
| 207 | Ga0079104_1022544 | 3300006946 | Bacteria | 1692 |
| 208 | Ga0075435_100120482 | 3300007076 | Bacteria | 2189 |
| 209 | Ga0105251_10003079 | 3300009011 | Bacteria | 12395 |
| 210 | Ga0105250_10005980 | 3300009092 | Bacteria | 5370 |
| 211 | Ga0105240_10011903 | 3300009093 | Bacteria | 12070 |
| 212 | Ga0105240_10050780 | 3300009093 | Bacteria | 5226 |
| 213 | Ga0105240_10068237 | 3300009093 | Bacteria | 4404 |
| 214 | Ga0111539_10349846 | 3300009094 | Bacteria | 1720 |
| 215 | Ga0105245_10004106 | 3300009098 | Bacteria | 12927 |
| 216 | Ga0105245_10329286 | 3300009098 | Bacteria | 1507 |
| 217 | Ga0105247_10005333 | 3300009101 | Bacteria | 8104 |
| 218 | Ga0114129_10184215 | 3300009147 | Bacteria | 2839 |
| 219 | Ga0105241_10128592 | 3300009174 | Bacteria | 2048 |
| 220 | Ga0105241_10192801 | 3300009174 | Bacteria | 1697 |
| 221 | Ga0105248_10000061 | 3300009177 | Bacteria | 125706 |
| 222 | Ga0105248_10000170 | 3300009177 | Bacteria | 75642 |
| 223 | Ga0105248_10005127 | 3300009177 | Bacteria | 14460 |
| 224 | Ga0105248_10011380 | 3300009177 | Bacteria | 9806 |
| 225 | Ga0105248_10018067 | 3300009177 | Bacteria | 7784 |
| 226 | Ga0105248_10021662 | 3300009177 | Bacteria | 7119 |
| 227 | Ga0105248_10053770 | 3300009177 | Bacteria | 4517 |
| 228 | Ga0105248_10060446 | 3300009177 | Bacteria | 4254 |
| 229 | Ga0105248_10114478 | 3300009177 | Bacteria | 3042 |
| 230 | Ga0105248_10138531 | 3300009177 | Bacteria | 2745 |
| 231 | Ga0105237_10072738 | 3300009545 | Bacteria | 3431 |
| 232 | Ga0105238_10005555 | 3300009551 | Bacteria | 12456 |
| 233 | Ga0105238_10324694 | 3300009551 | Bacteria | 1525 |
| 234 | Ga0105249_10000347 | 3300009553 | Bacteria | 46517 |
| 235 | Ga0105249_10000438 | 3300009553 | Bacteria | 39201 |
| 236 | Ga0105249_10067322 | 3300009553 | Bacteria | 3299 |
| 237 | Ga0105239_10146203 | 3300010375 | Bacteria | 2636 |
| 238 | Ga0157373_10006933 | 3300013100 | Bacteria | 8436 |
| 239 | Ga0157373_10007518 | 3300013100 | Bacteria | 8102 |
| 240 | Ga0157373_10189162 | 3300013100 | Bacteria | 1451 |
| 241 | Ga0157371_10011469 | 3300013102 | Bacteria | 6820 |
| 242 | Ga0157370_10012360 | 3300013104 | Bacteria | 8860 |
| 243 | Ga0157370_10032275 | 3300013104 | Bacteria | 5115 |
| 244 | Ga0157369_10010193 | 3300013105 | Bacteria | 10721 |
| 245 | Ga0157374_10150062 | 3300013296 | Bacteria | 2266 |
| 246 | Ga0163162_10008379 | 3300013306 | Bacteria | 10080 |
| 247 | Ga0163162_10010854 | 3300013306 | Bacteria | 8866 |
| 248 | Ga0163162_10098263 | 3300013306 | Bacteria | 3017 |
| 249 | Ga0163162_10210152 | 3300013306 | Bacteria | 2076 |
| 250 | Ga0157372_10054941 | 3300013307 | Bacteria | 4445 |
| 251 | Ga0157375_10046231 | 3300013308 | Bacteria | 4242 |
| 252 | Ga0163163_10016002 | 3300014325 | Bacteria | 6953 |
| 253 | Ga0163163_10081481 | 3300014325 | Bacteria | 3238 |
| 254 | Ga0163163_10188229 | 3300014325 | Bacteria | 2112 |
| 255 | Ga0157380_10000062 | 3300014326 | Bacteria | 61714 |
| 256 | Ga0157380_10005592 | 3300014326 | Bacteria | 8781 |
| 257 | Ga0157380_10382638 | 3300014326 | Bacteria | 1328 |
| 258 | Ga0182008_10096073 | 3300014497 | Bacteria | 1462 |
| 259 | Ga0157379_10006760 | 3300014968 | Bacteria | 9912 |
| 260 | Ga0157379_10058757 | 3300014968 | Bacteria | 3439 |
| 261 | Ga0183363_1006 | 3300015690 | Bacteria | 400466 |
| 262 | Ga0163161_10000536 | 3300017792 | Bacteria | 30955 |
| 263 | Ga0213876_10016426 | 3300021384 | Bacteria | 3912 |
| 264 | Ga0209147_101020 | 3300025229 | Bacteria | 11948 |
| 265 | Ga0209026_1004218 | 3300025250 | Bacteria | 4374 |
| 266 | Ga0209148_1008228 | 3300025254 | Bacteria | 2107 |
| 267 | Ga0209233_1000186 | 3300025261 | Bacteria | 133572 |
| 268 | Ga0209565_1001208 | 3300025263 | Bacteria | 12262 |
| 269 | Ga0209673_1000796 | 3300025273 | Bacteria | 42005 |
| 270 | Ga0209675_1009570 | 3300025291 | Bacteria | 3407 |
| 271 | Ga0209676_1000257 | 3300025292 | Bacteria | 112662 |
| 272 | Ga0209758_1000852 | 3300025297 | Bacteria | 42442 |
| 273 | Ga0209758_1002605 | 3300025297 | Bacteria | 18041 |
| 274 | Ga0209758_1005454 | 3300025297 | Bacteria | 9784 |
| 275 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 276 | Ga0209050_1001180 | 3300025298 | Bacteria | 30808 |
| 277 | Ga0209050_1004360 | 3300025298 | Bacteria | 9606 |
| 278 | Ga0209050_1016488 | 3300025298 | Bacteria | 3018 |
| 279 | Ga0209256_1015918 | 3300025299 | Bacteria | 2600 |
| 280 | Ga0209051_1002534 | 3300025303 | Bacteria | 12919 |
| 281 | Ga0209257_1000192 | 3300025304 | Bacteria | 151851 |
| 282 | Ga0209257_1000289 | 3300025304 | Bacteria | 110882 |
| 283 | Ga0209257_1001221 | 3300025304 | Bacteria | 32172 |
| 284 | Ga0209257_1003844 | 3300025304 | Bacteria | 12300 |
| 285 | Ga0207696_1009099 | 3300025711 | Bacteria | 3722 |
| 286 | Ga0207696_1009941 | 3300025711 | Bacteria | 3519 |
| 287 | Ga0207713_1010041 | 3300025735 | Bacteria | 5277 |
| 288 | Ga0207713_1016410 | 3300025735 | Bacteria | 3757 |
| 289 | Ga0207682_10015062 | 3300025893 | Bacteria | 3010 |
| 290 | Ga0207680_10003670 | 3300025903 | Bacteria | 7210 |
| 291 | Ga0207680_10053574 | 3300025903 | Bacteria | 2423 |
| 292 | Ga0207680_10079890 | 3300025903 | Bacteria | 2052 |
| 293 | Ga0207680_10188494 | 3300025903 | Bacteria | 1399 |
| 294 | Ga0207647_10028334 | 3300025904 | Bacteria | 3640 |
| 295 | Ga0207647_10029141 | 3300025904 | Bacteria | 3575 |
| 296 | Ga0207647_10037011 | 3300025904 | Bacteria | 3097 |
| 297 | Ga0207705_10000037 | 3300025909 | Bacteria | 197951 |
| 298 | Ga0207705_10000208 | 3300025909 | Bacteria | 59559 |
| 299 | Ga0207705_10001518 | 3300025909 | Bacteria | 18422 |
| 300 | Ga0207705_10003453 | 3300025909 | Bacteria | 12024 |
| 301 | Ga0207705_10028093 | 3300025909 | Bacteria | 4010 |
| 302 | Ga0207654_10072100 | 3300025911 | Bacteria | 2055 |
| 303 | Ga0207654_10078974 | 3300025911 | Bacteria | 1976 |
| 304 | Ga0207707_10018494 | 3300025912 | Bacteria | 6074 |
| 305 | Ga0207707_10034121 | 3300025912 | Bacteria | 4452 |
| 306 | Ga0207695_10011899 | 3300025913 | Bacteria | 10484 |
| 307 | Ga0207695_10012936 | 3300025913 | Bacteria | 9981 |
| 308 | Ga0207695_10018076 | 3300025913 | Bacteria | 8160 |
| 309 | Ga0207695_10066392 | 3300025913 | Bacteria | 3705 |
| 310 | Ga0207671_10004168 | 3300025914 | Bacteria | 13975 |
| 311 | Ga0207660_10002946 | 3300025917 | Bacteria | 11127 |
| 312 | Ga0207660_10016827 | 3300025917 | Bacteria | 4848 |
| 313 | Ga0207657_10002855 | 3300025919 | Bacteria | 18575 |
| 314 | Ga0207657_10004555 | 3300025919 | Bacteria | 14650 |
| 315 | Ga0207657_10025947 | 3300025919 | Bacteria | 5395 |
| 316 | Ga0207649_10003512 | 3300025920 | Bacteria | 8569 |
| 317 | Ga0207652_10001310 | 3300025921 | Bacteria | 22105 |
| 318 | Ga0207652_10004969 | 3300025921 | Bacteria | 10765 |
| 319 | Ga0207681_10000022 | 3300025923 | Bacteria | 230079 |
| 320 | Ga0207681_10000062 | 3300025923 | Bacteria | 99856 |
| 321 | Ga0207681_10000185 | 3300025923 | Bacteria | 50379 |
| 322 | Ga0207681_10000577 | 3300025923 | Bacteria | 24985 |
| 323 | Ga0207681_10025867 | 3300025923 | Bacteria | 3780 |
| 324 | Ga0207681_10045029 | 3300025923 | Bacteria | 2960 |
| 325 | Ga0207681_10108737 | 3300025923 | Bacteria | 2013 |
| 326 | Ga0207681_10165396 | 3300025923 | Bacteria | 1672 |
| 327 | Ga0207694_10288565 | 3300025924 | Bacteria | 1349 |
| 328 | Ga0207650_10000019 | 3300025925 | Bacteria | 344751 |
| 329 | Ga0207650_10000020 | 3300025925 | Bacteria | 342596 |
| 330 | Ga0207650_10000054 | 3300025925 | Bacteria | 162602 |
| 331 | Ga0207650_10000118 | 3300025925 | Bacteria | 104112 |
| 332 | Ga0207650_10025540 | 3300025925 | Bacteria | 4209 |
| 333 | Ga0207650_10041060 | 3300025925 | Bacteria | 3388 |
| 334 | Ga0207650_10177154 | 3300025925 | Bacteria | 1698 |
| 335 | Ga0207687_10002318 | 3300025927 | Bacteria | 12956 |
| 336 | Ga0207687_10031155 | 3300025927 | Bacteria | 3603 |
| 337 | Ga0207644_10000004 | 3300025931 | Bacteria | 566613 |
| 338 | Ga0207644_10000062 | 3300025931 | Bacteria | 78447 |
| 339 | Ga0207644_10000063 | 3300025931 | Bacteria | 78017 |
| 340 | Ga0207644_10000328 | 3300025931 | Bacteria | 30816 |
| 341 | Ga0207644_10000491 | 3300025931 | Bacteria | 25415 |
| 342 | Ga0207644_10000510 | 3300025931 | Bacteria | 25058 |
| 343 | Ga0207644_10020086 | 3300025931 | Bacteria | 4538 |
| 344 | Ga0207644_10023134 | 3300025931 | Bacteria | 4252 |
| 345 | Ga0207690_10000022 | 3300025932 | Bacteria | 215772 |
| 346 | Ga0207690_10000142 | 3300025932 | Bacteria | 57187 |
| 347 | Ga0207690_10002324 | 3300025932 | Bacteria | 11585 |
| 348 | Ga0207690_10042251 | 3300025932 | Bacteria | 2993 |
| 349 | Ga0207690_10045567 | 3300025932 | Bacteria | 2898 |
| 350 | Ga0207706_10001143 | 3300025933 | Bacteria | 27029 |
| 351 | Ga0207706_10047108 | 3300025933 | Bacteria | 3815 |
| 352 | Ga0207709_10024901 | 3300025935 | Bacteria | 3422 |
| 353 | Ga0207704_10001695 | 3300025938 | Bacteria | 9871 |
| 354 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 355 | Ga0207711_10000374 | 3300025941 | Bacteria | 47567 |
| 356 | Ga0207711_10001008 | 3300025941 | Bacteria | 27013 |
| 357 | Ga0207711_10001520 | 3300025941 | Bacteria | 21555 |
| 358 | Ga0207711_10012720 | 3300025941 | Bacteria | 6989 |
| 359 | Ga0207711_10020120 | 3300025941 | Bacteria | 5561 |
| 360 | Ga0207711_10043268 | 3300025941 | Bacteria | 3840 |
| 361 | Ga0207711_10116173 | 3300025941 | Bacteria | 2385 |
| 362 | Ga0207711_10137743 | 3300025941 | Bacteria | 2194 |
| 363 | Ga0207661_10222300 | 3300025944 | Bacteria | 1669 |
| 364 | Ga0207679_10010553 | 3300025945 | Bacteria | 5954 |
| 365 | Ga0207667_10003767 | 3300025949 | Bacteria | 18678 |
| 366 | Ga0207667_10004542 | 3300025949 | Bacteria | 17006 |
| 367 | Ga0207667_10004895 | 3300025949 | Bacteria | 16353 |
| 368 | Ga0207667_10008488 | 3300025949 | Bacteria | 12202 |
| 369 | Ga0207667_10018370 | 3300025949 | Bacteria | 7843 |
| 370 | Ga0207667_10054171 | 3300025949 | Bacteria | 4219 |
| 371 | Ga0207651_10167784 | 3300025960 | Bacteria | 1728 |
| 372 | Ga0207712_10001623 | 3300025961 | Bacteria | 15157 |
| 373 | Ga0207712_10002000 | 3300025961 | Bacteria | 13381 |
| 374 | Ga0207668_10000004 | 3300025972 | Bacteria | 201204 |
| 375 | Ga0207668_10000148 | 3300025972 | Bacteria | 48267 |
| 376 | Ga0207668_10000159 | 3300025972 | Bacteria | 47118 |
| 377 | Ga0207668_10000292 | 3300025972 | Bacteria | 32940 |
| 378 | Ga0207668_10000464 | 3300025972 | Bacteria | 25530 |
| 379 | Ga0207668_10007946 | 3300025972 | Bacteria | 6311 |
| 380 | Ga0207668_10009571 | 3300025972 | Bacteria | 5815 |
| 381 | Ga0207668_10068618 | 3300025972 | Bacteria | 2521 |
| 382 | Ga0207668_10120165 | 3300025972 | Bacteria | 1988 |
| 383 | Ga0207640_10010264 | 3300025981 | Bacteria | 5269 |
| 384 | Ga0207658_10000014 | 3300025986 | Bacteria | 218248 |
| 385 | Ga0207658_10000421 | 3300025986 | Bacteria | 40143 |
| 386 | Ga0207658_10000645 | 3300025986 | Bacteria | 30574 |
| 387 | Ga0207658_10005044 | 3300025986 | Bacteria | 9090 |
| 388 | Ga0207658_10005071 | 3300025986 | Bacteria | 9060 |
| 389 | Ga0207658_10010416 | 3300025986 | Bacteria | 6314 |
| 390 | Ga0207658_10125356 | 3300025986 | Bacteria | 2054 |
| 391 | Ga0207677_10000051 | 3300026023 | Bacteria | 100009 |
| 392 | Ga0207703_10000027 | 3300026035 | Bacteria | 209608 |
| 393 | Ga0207703_10000509 | 3300026035 | Bacteria | 40294 |
| 394 | Ga0207703_10000619 | 3300026035 | Bacteria | 35882 |
| 395 | Ga0207703_10001323 | 3300026035 | Bacteria | 22741 |
| 396 | Ga0207703_10007271 | 3300026035 | Bacteria | 8807 |
| 397 | Ga0207703_10013919 | 3300026035 | Bacteria | 6271 |
| 398 | Ga0207703_10189210 | 3300026035 | Bacteria | 1822 |
| 399 | Ga0207639_10004071 | 3300026041 | Bacteria | 9860 |
| 400 | Ga0207639_10007764 | 3300026041 | Bacteria | 7330 |
| 401 | Ga0207639_10041627 | 3300026041 | Bacteria | 3439 |
| 402 | Ga0207639_10079291 | 3300026041 | Bacteria | 2595 |
| 403 | Ga0207678_10167123 | 3300026067 | Bacteria | 1878 |
| 404 | Ga0207702_10010724 | 3300026078 | Bacteria | 7655 |
| 405 | Ga0207702_10020505 | 3300026078 | Bacteria | 5472 |
| 406 | Ga0207702_10027853 | 3300026078 | Bacteria | 4694 |
| 407 | Ga0207641_10000003 | 3300026088 | Bacteria | 496984 |
| 408 | Ga0207641_10000008 | 3300026088 | Bacteria | 424415 |
| 409 | Ga0207641_10000114 | 3300026088 | Bacteria | 118531 |
| 410 | Ga0207641_10000193 | 3300026088 | Bacteria | 83308 |
| 411 | Ga0207641_10001586 | 3300026088 | Bacteria | 22194 |
| 412 | Ga0207641_10001900 | 3300026088 | Bacteria | 20061 |
| 413 | Ga0207641_10005247 | 3300026088 | Bacteria | 11076 |
| 414 | Ga0207641_10013291 | 3300026088 | Bacteria | 6753 |
| 415 | Ga0207641_10013559 | 3300026088 | Bacteria | 6685 |
| 416 | Ga0207641_10044530 | 3300026088 | Bacteria | 3733 |
| 417 | Ga0207641_10053136 | 3300026088 | Bacteria | 3432 |
| 418 | Ga0207641_10056759 | 3300026088 | Bacteria | 3328 |
| 419 | Ga0207641_10101578 | 3300026088 | Bacteria | 2534 |
| 420 | Ga0207648_10085318 | 3300026089 | Bacteria | 2755 |
| 421 | Ga0207676_10000022 | 3300026095 | Bacteria | 296286 |
| 422 | Ga0207676_10000060 | 3300026095 | Bacteria | 118841 |
| 423 | Ga0207676_10000068 | 3300026095 | Bacteria | 104705 |
| 424 | Ga0207676_10000087 | 3300026095 | Bacteria | 85293 |
| 425 | Ga0207676_10003035 | 3300026095 | Bacteria | 11983 |
| 426 | Ga0207676_10004674 | 3300026095 | Bacteria | 9699 |
| 427 | Ga0207676_10027278 | 3300026095 | Bacteria | 4253 |
| 428 | Ga0207676_10201610 | 3300026095 | Bacteria | 1758 |
| 429 | Ga0207676_10319276 | 3300026095 | Bacteria | 1425 |
| 430 | Ga0207674_10003442 | 3300026116 | Bacteria | 19365 |
| 431 | Ga0207674_10024846 | 3300026116 | Bacteria | 6395 |
| 432 | Ga0207674_10038518 | 3300026116 | Bacteria | 4959 |
| 433 | Ga0207674_10055794 | 3300026116 | Bacteria | 4015 |
| 434 | Ga0207674_10103587 | 3300026116 | Bacteria | 2825 |
| 435 | Ga0207675_100008383 | 3300026118 | Bacteria | 9744 |
| 436 | Ga0207698_10001014 | 3300026142 | Bacteria | 16362 |
| 437 | Ga0207698_10192268 | 3300026142 | Bacteria | 1819 |
| 438 | Ga0207698_10390022 | 3300026142 | Bacteria | 1328 |
| 439 | Ga0209981_1007392 | 3300027378 | Bacteria | 1481 |
| 440 | Ga0209999_1000706 | 3300027543 | Bacteria | 5404 |
| 441 | Ga0209813_10000043 | 3300027866 | Bacteria | 51426 |
| 442 | Ga0209813_10000299 | 3300027866 | Bacteria | 13624 |
| 443 | Ga0207428_10034540 | 3300027907 | Bacteria | 4142 |
| 444 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 445 | Ga0268266_10000173 | 3300028379 | Bacteria | 117695 |
| 446 | Ga0268266_10000800 | 3300028379 | Bacteria | 41757 |
| 447 | Ga0268266_10003164 | 3300028379 | Bacteria | 16708 |
| 448 | Ga0268266_10003723 | 3300028379 | Bacteria | 15002 |
| 449 | Ga0268266_10105353 | 3300028379 | Bacteria | 2491 |
| 450 | Ga0268266_10275433 | 3300028379 | Bacteria | 1563 |
| 451 | Ga0268265_10000011 | 3300028380 | Bacteria | 343832 |
| 452 | Ga0268265_10000031 | 3300028380 | Bacteria | 226725 |
| 453 | Ga0268265_10000162 | 3300028380 | Bacteria | 81713 |
| 454 | Ga0268265_10000500 | 3300028380 | Bacteria | 40586 |
| 455 | Ga0268265_10002265 | 3300028380 | Bacteria | 14691 |
| 456 | Ga0268265_10009822 | 3300028380 | Bacteria | 6459 |
| 457 | Ga0268265_10013410 | 3300028380 | Bacteria | 5569 |
| 458 | Ga0268265_10030033 | 3300028380 | Bacteria | 3910 |
| 459 | Ga0268265_10105967 | 3300028380 | Bacteria | 2282 |
| 460 | Ga0268264_10000014 | 3300028381 | Bacteria | 509962 |
| 461 | Ga0268264_10000032 | 3300028381 | Bacteria | 408337 |
| 462 | Ga0268264_10000121 | 3300028381 | Bacteria | 190368 |
| 463 | Ga0268264_10000732 | 3300028381 | Bacteria | 37556 |
| 464 | Ga0268264_10008542 | 3300028381 | Bacteria | 8513 |
| 465 | Ga0268264_10014405 | 3300028381 | Bacteria | 6498 |
| 466 | Ga0268264_10023699 | 3300028381 | Bacteria | 5005 |
| 467 | Ga0265337_1032722 | 3300028556 | Bacteria | 1537 |
| 468 | Ga0307517_10003957 | 3300028786 | Bacteria | 22943 |
| 469 | Ga0307515_10056775 | 3300028794 | Bacteria | 5681 |
| 470 | Ga0307515_10072918 | 3300028794 | Bacteria | 4624 |
| 471 | Ga0307511_10032016 | 3300030521 | Bacteria | 4684 |
| 472 | Ga0265330_10018487 | 3300031235 | Bacteria | 3201 |
| 473 | Ga0265328_10000012 | 3300031239 | Bacteria | 157661 |
| 474 | Ga0265328_10000417 | 3300031239 | Bacteria | 19913 |
| 475 | Ga0265329_10002851 | 3300031242 | Bacteria | 7700 |
| 476 | Ga0265339_10070871 | 3300031249 | Bacteria | 1858 |
| 477 | Ga0265331_10001416 | 3300031250 | Bacteria | 17594 |
| 478 | Ga0265327_10001598 | 3300031251 | Bacteria | 27550 |
| 479 | Ga0265316_10001239 | 3300031344 | Bacteria | 27460 |
| 480 | Ga0307513_10000100 | 3300031456 | Bacteria | 125183 |
| 481 | Ga0307513_10000649 | 3300031456 | Bacteria | 50063 |
| 482 | Ga0307513_10003278 | 3300031456 | Bacteria | 22053 |
| 483 | Ga0307513_10005039 | 3300031456 | Bacteria | 17496 |
| 484 | Ga0307408_100013559 | 3300031548 | Bacteria | 5411 |
| 485 | Ga0307408_100109726 | 3300031548 | Bacteria | 2117 |
| 486 | Ga0307408_100188820 | 3300031548 | Bacteria | 1658 |
| 487 | Ga0307408_100214028 | 3300031548 | Bacteria | 1568 |
| 488 | Ga0307508_10000405 | 3300031616 | Bacteria | 51700 |
| 489 | Ga0307508_10047229 | 3300031616 | Bacteria | 3841 |
| 490 | Ga0307516_10000338 | 3300031730 | Bacteria | 61339 |
| 491 | Ga0307405_10000127 | 3300031731 | Bacteria | 30152 |
| 492 | Ga0307405_10026630 | 3300031731 | Bacteria | 3339 |
| 493 | Ga0307405_10219701 | 3300031731 | Bacteria | 1393 |
| 494 | Ga0307413_10109102 | 3300031824 | Bacteria | 1849 |
| 495 | Ga0307413_10177191 | 3300031824 | Bacteria | 1516 |
| 496 | Ga0307406_10091799 | 3300031901 | Bacteria | 2046 |
| 497 | Ga0307412_10000284 | 3300031911 | Bacteria | 32285 |
| 498 | Ga0307412_10000717 | 3300031911 | Bacteria | 19141 |
| 499 | Ga0307412_10003649 | 3300031911 | Bacteria | 8555 |
| 500 | Ga0307412_10007519 | 3300031911 | Bacteria | 6187 |
| 501 | Ga0307412_10017480 | 3300031911 | Bacteria | 4293 |
| 502 | Ga0307412_10019409 | 3300031911 | Bacteria | 4117 |
| 503 | Ga0307412_10024559 | 3300031911 | Bacteria | 3721 |
| 504 | Ga0307412_10032687 | 3300031911 | Bacteria | 3300 |
| 505 | Ga0307412_10042734 | 3300031911 | Bacteria | 2947 |
| 506 | Ga0307412_10089847 | 3300031911 | Bacteria | 2146 |
| 507 | Ga0307409_100018347 | 3300031995 | Bacteria | 4701 |
| 508 | Ga0307409_100031859 | 3300031995 | Bacteria | 3813 |
| 509 | Ga0307409_100072711 | 3300031995 | Bacteria | 2739 |
| 510 | Ga0307416_100112131 | 3300032002 | Bacteria | 2406 |
| 511 | Ga0307416_100274793 | 3300032002 | Bacteria | 1657 |
| 512 | Ga0307414_10000266 | 3300032004 | Bacteria | 32800 |
| 513 | Ga0307414_10001045 | 3300032004 | Bacteria | 14151 |
| 514 | Ga0307414_10012685 | 3300032004 | Bacteria | 4995 |
| 515 | Ga0307414_10067776 | 3300032004 | Bacteria | 2558 |
| 516 | Ga0307414_10127635 | 3300032004 | Bacteria | 1968 |
| 517 | Ga0307414_10175096 | 3300032004 | Bacteria | 1720 |
| 518 | Ga0307414_10190156 | 3300032004 | Bacteria | 1660 |
| 519 | Ga0307414_10219363 | 3300032004 | Bacteria | 1560 |
| 520 | Ga0307411_10043670 | 3300032005 | Bacteria | 2869 |
| 521 | Ga0307510_10018167 | 3300033180 | Bacteria | 8278 |
| 522 | Ga0373944_0003119 | 3300035089 | Bacteria | 4267 |
| 523 | Ga0373936_0001631 | 3300035113 | Bacteria | 8220 |
| 524 | Ga0373927_0112027 | 3300035695 | Bacteria | 1778 |
| 525 | Ga0373925_0000199 | 3300037068 | Bacteria | 65400 |
| 526 | Ga0395899_0000018 | 3300037312 | Bacteria | 423194 |
| 527 | Ga0395899_0000560 | 3300037312 | Bacteria | 39802 |
| 528 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 529 | Ga0395900_0188408 | 3300037418 | Bacteria | 2093 |
| 530 | Ga0395905_0029197 | 3300037471 | Bacteria | 5197 |
| 531 | Ga0395905_0052510 | 3300037471 | Bacteria | 3816 |
| 532 | Ga0436364_1348264 | 3300037853 | Bacteria | 1842 |
| 533 | Ga0395901_0000021 | 3300038443 | Bacteria | 307734 |
| 534 | Ga0395901_0155909 | 3300038443 | Bacteria | 2398 |
| 535 | Ga0436365_0309457 | 3300039437 | Bacteria | 7698 |
| 536 | Ga0439443_001447 | 3300042003 | Bacteria | 2616 |
| 537 | Ga0450890_007344 | 3300042127 | Bacteria | 1407 |
| 538 | Ga0466966_0046157 | 3300044684 | Bacteria | 2783 |
| 539 | Ga0453684_0070680 | 3300044712 | Unclassified | 4419 |
| 540 | Ga0453684_0179386 | 3300044712 | Bacteria | 2487 |
| 541 | Ga0453684_0203510 | 3300044712 | Bacteria | 2306 |
| 542 | Ga0466970_0139934 | 3300044765 | Bacteria | 1333 |
| 543 | Ga0466959_0018063 | 3300045049 | Bacteria | 5176 |
| 544 | Ga0451576_0062375 | 3300045051 | Bacteria | 3886 |
| 545 | Ga0466967_0002033 | 3300045976 | Bacteria | 12337 |
| 546 | Ga0495617_003563 | 3300046452 | Bacteria | 5824 |
| 547 | Ga0495627_000108 | 3300046453 | Bacteria | 102455 |
| 548 | Ga0495627_000242 | 3300046453 | Bacteria | 57277 |
| 549 | Ga0495627_000954 | 3300046453 | Bacteria | 19825 |
| 550 | Ga0495627_012439 | 3300046453 | Bacteria | 3019 |
| 551 | Ga0495590_0004610 | 3300046457 | Bacteria | 5537 |
| 552 | Ga0495638_0001571 | 3300046460 | Bacteria | 20485 |
| 553 | Ga0495638_0001805 | 3300046460 | Bacteria | 18647 |
| 554 | Ga0495638_0004499 | 3300046460 | Bacteria | 10561 |
| 555 | Ga0495638_0009105 | 3300046460 | Bacteria | 6990 |
| 556 | Ga0495638_0009709 | 3300046460 | Bacteria | 6727 |
| 557 | Ga0495638_0040628 | 3300046460 | Bacteria | 2947 |
| 558 | Ga0495638_0160779 | 3300046460 | Bacteria | 1296 |
| 559 | Ga0495650_0000468 | 3300046471 | Bacteria | 62149 |
| 560 | Ga0495650_0000914 | 3300046471 | Bacteria | 34702 |
| 561 | Ga0495650_0002053 | 3300046471 | Bacteria | 17532 |
| 562 | Ga0495607_0072090 | 3300046501 | Bacteria | 1924 |
| 563 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 564 | Ga0495583_0019518 | 3300046506 | Bacteria | 3536 |
| 565 | Ga0495606_0084953 | 3300046507 | Bacteria | 1958 |
| 566 | Ga0495610_0000662 | 3300046512 | Bacteria | 33529 |
| 567 | Ga0495610_0000816 | 3300046512 | Bacteria | 29254 |
| 568 | Ga0495610_0001741 | 3300046512 | Bacteria | 19066 |
| 569 | Ga0495610_0002953 | 3300046512 | Bacteria | 13709 |
| 570 | Ga0495610_0005936 | 3300046512 | Bacteria | 8552 |
| 571 | Ga0495610_0034718 | 3300046512 | Bacteria | 2595 |
| 572 | Ga0495616_0000405 | 3300046513 | Bacteria | 33255 |
| 573 | Ga0495620_0012177 | 3300046515 | Bacteria | 4457 |
| 574 | Ga0495628_0020975 | 3300046516 | Bacteria | 5382 |
| 575 | Ga0495631_0003695 | 3300046518 | Bacteria | 8348 |
| 576 | Ga0495632_0000039 | 3300046519 | Bacteria | 150268 |
| 577 | Ga0495632_0005313 | 3300046519 | Bacteria | 8555 |
| 578 | Ga0495632_0009504 | 3300046519 | Bacteria | 5857 |
| 579 | Ga0495637_0004308 | 3300046520 | Bacteria | 7388 |
| 580 | Ga0495637_0017773 | 3300046520 | Bacteria | 3306 |
| 581 | Ga0495643_0000162 | 3300046522 | Bacteria | 106672 |
| 582 | Ga0495643_0006107 | 3300046522 | Bacteria | 8006 |
| 583 | Ga0495648_0003006 | 3300046524 | Bacteria | 15116 |
| 584 | Ga0495648_0020364 | 3300046524 | Bacteria | 4627 |
| 585 | Ga0495648_0043915 | 3300046524 | Bacteria | 2795 |
| 586 | Ga0495663_0000006 | 3300046525 | Bacteria | 306938 |
| 587 | Ga0495663_0003709 | 3300046525 | Bacteria | 4366 |
| 588 | Ga0495654_0000199 | 3300046530 | Bacteria | 58450 |
| 589 | Ga0495654_0031774 | 3300046530 | Bacteria | 2679 |
| 590 | Ga0495609_0050631 | 3300046538 | Bacteria | 1851 |
| 591 | Ga0495597_0012544 | 3300046542 | Bacteria | 4087 |
| 592 | Ga0495622_0005241 | 3300046557 | Bacteria | 6010 |
| 593 | Ga0495633_0000789 | 3300046558 | Bacteria | 28320 |
| 594 | Ga0495633_0005248 | 3300046558 | Bacteria | 7988 |
| 595 | Ga0495633_0005452 | 3300046558 | Bacteria | 7766 |
| 596 | Ga0495668_0003831 | 3300046616 | Bacteria | 11013 |
| 597 | Ga0495668_0008079 | 3300046616 | Bacteria | 6626 |
| 598 | Ga0495668_0081640 | 3300046616 | Bacteria | 1773 |
| 599 | Ga0495625_0000615 | 3300046660 | Bacteria | 51688 |
| 600 | Ga0495625_0019243 | 3300046660 | Bacteria | 5302 |
| 601 | Ga0495625_0047142 | 3300046660 | Bacteria | 3107 |
| 602 | Ga0495625_0052653 | 3300046660 | Bacteria | 2914 |
| 603 | Ga0495625_0073786 | 3300046660 | Bacteria | 2391 |
| 604 | Ga0495625_0115292 | 3300046660 | Bacteria | 1833 |
| 605 | Ga0495669_0000007 | 3300046684 | Bacteria | 180797 |
| 606 | Ga0495669_0000318 | 3300046684 | Bacteria | 26632 |
| 607 | Ga0495669_0009864 | 3300046684 | Bacteria | 4034 |
| 608 | Ga0495671_0000062 | 3300046692 | Bacteria | 106672 |
| 609 | Ga0495589_0005526 | 3300046794 | Bacteria | 6667 |
| 610 | Ga0495672_0006075 | 3300047320 | Bacteria | 9435 |
| 611 | Ga0495672_0060172 | 3300047320 | Bacteria | 2195 |
| 612 | Ga0495672_0113105 | 3300047320 | Bacteria | 1454 |
| 613 | Ga0495687_033764 | 3300047443 | Bacteria | 2317 |
| 614 | Ga0495677_0019475 | 3300047445 | Bacteria | 2461 |
| 615 | Ga0495679_002677 | 3300047446 | Bacteria | 8899 |
| 616 | Ga0495673_0000370 | 3300047469 | Bacteria | 54131 |
| 617 | Ga0495673_0001884 | 3300047469 | Bacteria | 15741 |
| 618 | Ga0495673_0017007 | 3300047469 | Bacteria | 3704 |
| 619 | Ga0495681_0000060 | 3300047470 | Bacteria | 99989 |
| 620 | Ga0495681_0000129 | 3300047470 | Bacteria | 66033 |
| 621 | Ga0495681_0078345 | 3300047470 | Bacteria | 1481 |
| 622 | Ga0495686_0000147 | 3300047472 | Bacteria | 139008 |
| 623 | Ga0495686_0003469 | 3300047472 | Bacteria | 13649 |
| 624 | Ga0495686_0005110 | 3300047472 | Bacteria | 10482 |
| 625 | Ga0495686_0006442 | 3300047472 | Bacteria | 8987 |
| 626 | Ga0495686_0025205 | 3300047472 | Bacteria | 3900 |
| 627 | Ga0495686_0030146 | 3300047472 | Bacteria | 3525 |
| 628 | Ga0495593_0025107 | 3300047673 | Bacteria | 3298 |
| 629 | Ga0495626_0002698 | 3300048091 | Bacteria | 11983 |
| 630 | Ga0496100_0029671 | 3300048903 | Bacteria | 3385 |
| 631 | Ga0496100_0060094 | 3300048903 | Bacteria | 2500 |
| 632 | Ga0496101_0054917 | 3300048904 | Bacteria | 2875 |
| 633 | Ga0496102_0000209 | 3300048905 | Bacteria | 78525 |
| 634 | Ga0496102_0049820 | 3300048905 | Bacteria | 3811 |
| 635 | Ga0496102_0162320 | 3300048905 | Bacteria | 2102 |
| 636 | Ga0496103_0000136 | 3300048906 | Bacteria | 76530 |
| 637 | Ga0496103_0005756 | 3300048906 | Bacteria | 7398 |
| 638 | Ga0496103_0046980 | 3300048906 | Bacteria | 2666 |
| 639 | Ga0496104_0076191 | 3300048907 | Bacteria | 3194 |
| 640 | Ga0496104_0102283 | 3300048907 | Bacteria | 2744 |
| 641 | Ga0496105_0010034 | 3300048908 | Bacteria | 7432 |
| 642 | Ga0496105_0083290 | 3300048908 | Bacteria | 2641 |
| 643 | Ga0496105_0111132 | 3300048908 | Bacteria | 2262 |
| 644 | Ga0496106_0004669 | 3300048909 | Bacteria | 10158 |
| 645 | Ga0496107_0000039 | 3300048910 | Bacteria | 77588 |
| 646 | Ga0496107_0001041 | 3300048910 | Bacteria | 16606 |
| 647 | Ga0496107_0018954 | 3300048910 | Bacteria | 4851 |
| 648 | Ga0496107_0077321 | 3300048910 | Bacteria | 2424 |
| 649 | Ga0496108_0051057 | 3300048911 | Bacteria | 3464 |
| 650 | Ga0496108_0053601 | 3300048911 | Bacteria | 3382 |
| 651 | Ga0496109_0052504 | 3300048912 | Bacteria | 3716 |
| 652 | Ga0496109_0067293 | 3300048912 | Bacteria | 3281 |
| 653 | Ga0496109_0153945 | 3300048912 | Bacteria | 2153 |
| 654 | Ga0496109_0169880 | 3300048912 | Bacteria | 2045 |
| 655 | Ga0496109_0233720 | 3300048912 | Bacteria | 1730 |
| 656 | Ga0496110_0004039 | 3300048913 | Bacteria | 11323 |
| 657 | Ga0496110_0044529 | 3300048913 | Bacteria | 3875 |
| 658 | Ga0496110_0080965 | 3300048913 | Bacteria | 2894 |
| 659 | Ga0496111_0000244 | 3300048914 | Bacteria | 26061 |
| 660 | Ga0496111_0101193 | 3300048914 | Bacteria | 2117 |
| 661 | Ga0496112_0015115 | 3300048915 | Bacteria | 7191 |
| 662 | Ga0496112_0022637 | 3300048915 | Bacteria | 5991 |
| 663 | Ga0496112_0101121 | 3300048915 | Bacteria | 2853 |
| 664 | Ga0496112_0170355 | 3300048915 | Bacteria | 2142 |
| 665 | Ga0496113_0000515 | 3300048916 | Bacteria | 19121 |
| 666 | Ga0496113_0063133 | 3300048916 | Bacteria | 2799 |
| 667 | Ga0496114_0161563 | 3300048917 | Bacteria | 1948 |
| 668 | Ga0496115_0036911 | 3300048918 | Bacteria | 3870 |
| 669 | Ga0496115_0047345 | 3300048918 | Bacteria | 3438 |
| 670 | Ga0496116_0000045 | 3300048919 | Bacteria | 324307 |
| 671 | Ga0496117_0000526 | 3300048920 | Bacteria | 63085 |
| 672 | Ga0496117_0003070 | 3300048920 | Bacteria | 20017 |
| 673 | Ga0496117_0005479 | 3300048920 | Bacteria | 13301 |
| 674 | Ga0496117_0048957 | 3300048920 | Bacteria | 3012 |
| 675 | Ga0496117_0102966 | 3300048920 | Bacteria | 1800 |
| 676 | Ga0496118_0000162 | 3300048921 | Bacteria | 119635 |
| 677 | Ga0496118_0002204 | 3300048921 | Bacteria | 27048 |
| 678 | Ga0496118_0007520 | 3300048921 | Bacteria | 11514 |
| 679 | Ga0496118_0012359 | 3300048921 | Bacteria | 8208 |
| 680 | Ga0496118_0026820 | 3300048921 | Bacteria | 4895 |
| 681 | Ga0496118_0085182 | 3300048921 | Bacteria | 2202 |
| 682 | Ga0496119_0017828 | 3300048922 | Bacteria | 5322 |
| 683 | Ga0496119_0039220 | 3300048922 | Bacteria | 3046 |
| 684 | Ga0496119_0066746 | 3300048922 | Bacteria | 2124 |
| 685 | Ga0496120_0031176 | 3300048923 | Bacteria | 3232 |
| 686 | Ga0496121_0000042 | 3300048924 | Bacteria | 342304 |
| 687 | Ga0496121_0000104 | 3300048924 | Bacteria | 192186 |
| 688 | Ga0496121_0000187 | 3300048924 | Bacteria | 138361 |
| 689 | Ga0496121_0001456 | 3300048924 | Bacteria | 39986 |
| 690 | Ga0496121_0001823 | 3300048924 | Bacteria | 34373 |
| 691 | Ga0496121_0010011 | 3300048924 | Bacteria | 10778 |
| 692 | Ga0496121_0038799 | 3300048924 | Bacteria | 4209 |
| 693 | Ga0496121_0090579 | 3300048924 | Bacteria | 2390 |
| 694 | Ga0496122_0001120 | 3300048925 | Bacteria | 46162 |
| 695 | Ga0496122_0005307 | 3300048925 | Bacteria | 15416 |
| 696 | Ga0496123_0000495 | 3300048926 | Bacteria | 68284 |
| 697 | Ga0496123_0003093 | 3300048926 | Bacteria | 19114 |
| 698 | Ga0496124_0000325 | 3300048927 | Bacteria | 88310 |
| 699 | Ga0496124_0000844 | 3300048927 | Bacteria | 50021 |
| 700 | Ga0496124_0001703 | 3300048927 | Bacteria | 31097 |
| 701 | Ga0496124_0119644 | 3300048927 | Bacteria | 2106 |
| 702 | Ga0496124_0125050 | 3300048927 | Bacteria | 2050 |
| 703 | Ga0496125_0003210 | 3300048928 | Bacteria | 20186 |
| 704 | Ga0496125_0050674 | 3300048928 | Bacteria | 3434 |
| 705 | Ga0496126_0002167 | 3300048929 | Bacteria | 27302 |
| 706 | Ga0496126_0002377 | 3300048929 | Bacteria | 25612 |
| 707 | Ga0496126_0002394 | 3300048929 | Bacteria | 25490 |
| 708 | Ga0496126_0013475 | 3300048929 | Bacteria | 8309 |
| 709 | Ga0496126_0024245 | 3300048929 | Bacteria | 5859 |
| 710 | Ga0496126_0024281 | 3300048929 | Bacteria | 5855 |
| 711 | Ga0496126_0139169 | 3300048929 | Bacteria | 2091 |
| 712 | Ga0501306_007814 | 3300049127 | Bacteria | 1289 |
| 713 | Ga0495678_002398 | 3300049459 | Bacteria | 12804 |
| 714 | Ga0495678_016792 | 3300049459 | Bacteria | 3336 |
| 715 | Ga0501290_000021 | 3300049513 | Bacteria | 21304 |
| 716 | Ga0501292_000017 | 3300049515 | Bacteria | 57254 |
| 717 | Ga0501314_001000 | 3300049530 | Bacteria | 1929 |
| 718 | Ga0501032_0036503 | 3300049569 | Bacteria | 3354 |
| 719 | Ga0501033_0216622 | 3300049570 | Bacteria | 1364 |
| 720 | Ga0501034_0170492 | 3300049571 | Bacteria | 2144 |
| 721 | Ga0501043_0031530 | 3300049579 | Bacteria | 4166 |
| 722 | Ga0501043_0071185 | 3300049579 | Bacteria | 2732 |
| 723 | Ga0501047_0004654 | 3300049581 | Bacteria | 12909 |
| 724 | Ga0501047_0007125 | 3300049581 | Bacteria | 10502 |
| 725 | Ga0501047_0032668 | 3300049581 | Bacteria | 5026 |
| 726 | Ga0501223_000164 | 3300049663 | Bacteria | 17213 |
| 727 | Ga0501224_000015 | 3300049664 | Bacteria | 90971 |
| 728 | Ga0501238_002281 | 3300049671 | Bacteria | 2280 |
| 729 | Ga0501249_000274 | 3300049679 | Bacteria | 14750 |
| 730 | Ga0501257_000140 | 3300049686 | Bacteria | 16197 |
| 731 | Ga0501261_000002 | 3300049690 | Bacteria | 117168 |
| 732 | Ga0501225_0000539 | 3300049705 | Bacteria | 11838 |
| 733 | Ga0501245_000065 | 3300049708 | Bacteria | 9997 |
| 734 | Ga0501279_000019 | 3300049775 | Bacteria | 58746 |
| 735 | Ga0501280_000075 | 3300049776 | Bacteria | 26746 |
| 736 | Ga0501281_00040 | 3300049777 | Bacteria | 14878 |
| 737 | Ga0501282_000991 | 3300049778 | Bacteria | 3220 |
| 738 | Ga0501035_0277577 | 3300049822 | Bacteria | 1417 |
| 739 | Ga0501044_0001217 | 3300049823 | Bacteria | 30550 |
| 740 | Ga0501044_0013059 | 3300049823 | Bacteria | 8988 |
| 741 | Ga0501226_000027 | 3300049853 | Bacteria | 89557 |
| 742 | nmdc:mga03683_1290_c1 | 3300050489 | Bacteria | 7411 |
| 743 | nmdc:mga00v17_481_c1 | 3300050491 | Bacteria | 22300 |
| 744 | nmdc:mga0k408_26261_c1 | 3300050493 | Bacteria | 3301 |
| 745 | nmdc:mga0k408_27250_c1 | 3300050493 | Bacteria | 3244 |
| 746 | nmdc:mga06z11_12224_c1 | 3300050494 | Bacteria | 3729 |
| 747 | nmdc:mga06z11_232_c1 | 3300050494 | Bacteria | 21713 |
| 748 | nmdc:mga06z11_56_c1 | 3300050494 | Bacteria | 48168 |
| 749 | nmdc:mga04h51_113_c1 | 3300050495 | Bacteria | 24050 |
| 750 | nmdc:mga04h51_193_c1 | 3300050495 | Bacteria | 16722 |
| 751 | nmdc:mga07m45_10684_c1 | 3300050496 | Bacteria | 4804 |
| 752 | nmdc:mga07m45_12_c1 | 3300050496 | Bacteria | 158130 |
| 753 | nmdc:mga07m45_84254_c1 | 3300050496 | Bacteria | 1817 |
| 754 | nmdc:mga05p37_26594_c1 | 3300050507 | Bacteria | 7036 |
| 755 | nmdc:mga0qj67_10069_c1 | 3300050509 | Bacteria | 7055 |
| 756 | nmdc:mga0qj67_6321_c1 | 3300050509 | Bacteria | 8697 |
| 757 | nmdc:mga06r32_14610_c1 | 3300050510 | Bacteria | 7128 |
| 758 | nmdc:mga08y16_305522_c1 | 3300050511 | Bacteria | 1639 |
| 759 | nmdc:mga0sz30_15639_c1 | 3300050516 | Bacteria | 3001 |
| 760 | Ga0500635_0000172 | 3300053080 | Bacteria | 33572 |
| 761 | Ga0500578_0000015 | 3300053086 | Bacteria | 179217 |
| 762 | Ga0500643_000065 | 3300053087 | Bacteria | 119995 |
| 763 | Ga0500643_001942 | 3300053087 | Bacteria | 11204 |
| 764 | Ga0500643_005646 | 3300053087 | Bacteria | 5351 |
| 765 | Ga0500643_006801 | 3300053087 | Bacteria | 4712 |
| 766 | Ga0500644_0001179 | 3300053088 | Bacteria | 7482 |
| 767 | Ga0500651_0004810 | 3300053093 | Bacteria | 7617 |
| 768 | Ga0500566_0024545 | 3300053094 | Bacteria | 3538 |
| 769 | Ga0500641_0018537 | 3300053096 | Bacteria | 2619 |
| 770 | Ga0500641_0058775 | 3300053096 | Bacteria | 1597 |
| 771 | Ga0500555_002226 | 3300053103 | Bacteria | 5659 |
| 772 | Ga0500556_0001545 | 3300053104 | Bacteria | 9394 |
| 773 | Ga0500562_001104 | 3300053108 | Bacteria | 6634 |
| 774 | Ga0500562_002398 | 3300053108 | Bacteria | 4703 |
| 775 | Ga0500592_000010 | 3300053116 | Bacteria | 76714 |
| 776 | Ga0500594_0000117 | 3300053118 | Bacteria | 22333 |
| 777 | Ga0500607_046225 | 3300053121 | Bacteria | 2334 |
| 778 | Ga0500608_000052 | 3300053122 | Bacteria | 51638 |
| 779 | Ga0500608_000611 | 3300053122 | Bacteria | 13123 |
| 780 | Ga0500608_011952 | 3300053122 | Bacteria | 3789 |
| 781 | Ga0500614_006085 | 3300053123 | Bacteria | 2538 |
| 782 | Ga0500618_000617 | 3300053125 | Bacteria | 21732 |
| 783 | Ga0500618_005116 | 3300053125 | Bacteria | 4038 |
| 784 | Ga0500642_0002144 | 3300053130 | Bacteria | 5736 |
| 785 | Ga0500642_0064757 | 3300053130 | Bacteria | 1650 |
| 786 | Ga0500655_000338 | 3300053133 | Bacteria | 10331 |
| 787 | Ga0500658_0000708 | 3300053134 | Bacteria | 13778 |
| 788 | Ga0500658_0018677 | 3300053134 | Bacteria | 2602 |
| 789 | Ga0500559_0000009 | 3300053136 | Bacteria | 174153 |
| 790 | Ga0500559_0004249 | 3300053136 | Bacteria | 6853 |
| 791 | Ga0500559_0005128 | 3300053136 | Bacteria | 6055 |
| 792 | Ga0500559_0032960 | 3300053136 | Bacteria | 2229 |
| 793 | Ga0500564_000254 | 3300053138 | Bacteria | 14954 |
| 794 | Ga0500564_023909 | 3300053138 | Bacteria | 2803 |
| 795 | Ga0500590_000023 | 3300053148 | Bacteria | 41133 |
| 796 | Ga0500604_0000007 | 3300053151 | Bacteria | 115773 |
| 797 | Ga0500616_0017908 | 3300053153 | Bacteria | 4011 |
| 798 | Ga0500616_0022468 | 3300053153 | Bacteria | 3521 |
| 799 | Ga0500616_0030851 | 3300053153 | Bacteria | 2940 |
| 800 | Ga0500622_0001045 | 3300053156 | Bacteria | 23113 |
| 801 | Ga0500622_0006519 | 3300053156 | Bacteria | 6749 |
| 802 | Ga0500622_0059953 | 3300053156 | Bacteria | 1942 |
| 803 | Ga0500624_000007 | 3300053157 | Bacteria | 184487 |
| 804 | Ga0500627_0001068 | 3300053158 | Bacteria | 7462 |
| 805 | Ga0500636_0047338 | 3300053177 | Bacteria | 2533 |
| 806 | Ga0500637_0001911 | 3300053178 | Bacteria | 9062 |
| 807 | Ga0500637_0027363 | 3300053178 | Bacteria | 3147 |
| 808 | Ga0500570_014168 | 3300053724 | Bacteria | 4475 |
| 809 | Ga0500611_001246 | 3300053727 | Bacteria | 2733 |
| 810 | Ga0500625_000011 | 3300053729 | Bacteria | 133655 |
| 811 | Ga0500645_001524 | 3300053730 | Bacteria | 11599 |
| 812 | Ga0500645_002661 | 3300053730 | Bacteria | 7784 |
| 813 | Ga0500645_002789 | 3300053730 | Bacteria | 7538 |
| 814 | Ga0500609_000474 | 3300053731 | Bacteria | 5984 |
| 815 | Ga0500596_000548 | 3300053735 | Bacteria | 7138 |
| 816 | Ga0587084_005664 | 3300059477 | Bacteria | 1489 |
| 817 | 2511120949 | 2510917020 | Bacteria | 5657507 |
| 818 | 2512642607 | 2512564014 | Bacteria | 4639632 |
| 819 | 2585149834 | 2582581279 | Bacteria | 4980720 |
| 820 | 2585151270 | 2582581280 | Bacteria | 5994497 |
| 821 | 2585197139 | 2582581293 | Bacteria | 5907401 |
| 822 | 2585261023 | 2582581305 | Bacteria | 4895574 |
| 823 | 2587919940 | 2585428106 | Bacteria | 5179711 |
| 824 | 2600203327 | 2599185354 | Bacteria | 4398675 |
| 825 | 2643731052 | 2643221541 | Bacteria | 5498788 |
| 826 | 2643747686 | 2643221545 | Bacteria | 5083237 |
| 827 | 2643780879 | 2643221552 | Bacteria | 5708754 |
| 828 | 2643926795 | 2643221583 | Bacteria | 5218014 |
| 829 | 2643929625 | 2643221584 | Bacteria | 5511711 |
| 830 | 2643999690 | 2643221598 | Bacteria | 4578346 |
| 831 | 2644040073 | 2643221605 | Bacteria | 4772303 |
| 832 | 2644044296 | 2643221606 | Bacteria | 5588032 |
| 833 | 2644087679 | 2643221614 | Bacteria | 4260023 |
| 834 | 2644223427 | 2643221640 | Bacteria | 5258820 |
| 835 | 2644237169 | 2643221642 | Bacteria | 5357871 |
| 836 | 2644344278 | 2643221661 | Bacteria | 4267604 |
| 837 | 2644367037 | 2643221666 | Bacteria | 4265935 |
| 838 | 2644391780 | 2643221671 | Bacteria | 5496681 |
| 839 | 2644506931 | 2643221691 | Bacteria | 5093099 |
| 840 | 2738710561 | 2738541275 | Bacteria | 4830863 |
| 841 | 2738848986 | 2738541301 | Bacteria | 4834102 |
| 842 | 2738864715 | 2738541304 | Bacteria | 4833665 |
| 843 | 2739297233 | 2738543022 | Bacteria | 4835059 |
| 844 | 2739358911 | 2738543033 | Bacteria | 4833336 |
| 845 | 2739650935 | 2739367664 | Bacteria | 4114334 |
| 846 | 2740029408 | 2739367865 | Bacteria | 4114482 |
| 847 | 2753765870 | 2751185897 | Bacteria | 5322941 |
| 848 | 2753765878 | 2751185897 | Bacteria | 5322941 |
| 849 | 2792460774 | 2791355048 | Bacteria | 5832535 |
| 850 | 2809061916 | 2808606401 | Bacteria | 4586670 |
| 851 | 2809077880 | 2808606404 | Bacteria | 4652788 |
| 852 | 2809082412 | 2808606405 | Bacteria | 4586632 |
| 853 | 2819540186 | 2818991435 | Bacteria | 5433759 |
| 854 | 2819551248 | 2818991438 | Bacteria | 5793701 |
| 855 | 2819647084 | 2818991454 | Bacteria | 5563326 |
| 856 | 2830076854 | 2830075706 | Bacteria | 3855215 |
| 857 | 2843745567 | 2843744320 | Bacteria | 5659202 |
| 858 | 2849561182 | 2849560528 | Bacteria | 5393480 |
| 859 | 2849576163 | 2849573788 | Bacteria | 5421256 |
| 860 | 2851157217 | 2851153111 | Bacteria | 5542585 |
| 861 | 2857505801 | 2857504554 | Bacteria | 5369913 |
| 862 | 2880519901 | 2880518877 | Bacteria | 5012590 |
| 863 | 2882809541 | 2882806704 | Bacteria | 3007728 |
| 864 | 2884965479 | 2884960567 | Bacteria | 5437054 |
| 865 | 2891091295 | 2891088606 | Bacteria | 4762464 |
| 866 | 2895881348 | 2895880812 | Bacteria | 11255272 |
| 867 | 2896185949 | 2896184354 | Bacteria | 3258548 |
| 868 | 2898332876 | 2898329390 | Bacteria | 5168154 |
| 869 | 2919143130 | 2919138771 | Bacteria | 5281312 |
| 870 | 2919711627 | 2919709256 | Bacteria | 4318106 |
| 871 | 2928029042 | 2928027323 | Bacteria | 4382488 |
| 872 | 2928100660 | 2928100450 | Bacteria | 4837635 |
| 873 | 2928532082 | 2928531327 | Bacteria | 5101314 |
| 874 | 2928960723 | 2928959182 | Bacteria | 4725774 |
| 875 | 2946789873 | 2946787523 | Bacteria | 4366789 |
| 876 | 2984556003 | 2984555340 | Bacteria | 4247089 |
| 877 | 2984565891 | 2984564862 | Bacteria | 4339992 |
| 878 | 2990269083 | 2990265787 | Bacteria | 3943888 |
| 879 | 2993356900 | 2993356040 | Bacteria | 4247105 |
| 880 | 2993694786 | 2993693658 | Bacteria | 4040749 |
| 881 | 3000867941 | 3000865235 | Bacteria | 3106258 |
| 882 | 8057103226 | 8057101203 | Bacteria | 5034064 |
| 883 | Ga0068854_100004175 | |||
| 884 | SwRhRL2b_contig_1291094 | |||
| 885 | JGI24752J21851_1001004 | |||
| 886 | JGI24739J22299_10003374 | |||
| 887 | JGI24749J21850_1000013 | |||
| 888 | JGI24751J29686_10000014 | |||
| 889 | JGI24751J29686_10000221 | |||
| 890 | JGI25165J46597_1000208 | |||
| 891 | JGI25153J46596_10013362 | |||
| 892 | Ga0055537_1001492 | |||
| 893 | Ga0055528_1002288 | |||
| 894 | Ga0055530_10000586 | |||
| 895 | Ga0055530_10007003 | |||
| 896 | Ga0055531_10002679 | |||
| 897 | Ga0055531_10003677 | |||
| 898 | Ga0055531_10005289 | |||
| 899 | Ga0055531_10008083 | |||
| 900 | Ga0055531_10036874 | |||
| 901 | Ga0065165_1000345 | |||
| 902 | Ga0065165_1000941 | |||
| 903 | Ga0065704_10000309 | |||
| 904 | Ga0065704_10004554 | |||
| 905 | Ga0065707_10081814 | |||
| 906 | Ga0070658_10000402 | |||
| 907 | Ga0070658_10003087 | |||
| 908 | Ga0070683_100090220 | |||
| 909 | Ga0070670_100000004 | |||
| 910 | Ga0070670_100000008 | |||
| 911 | Ga0070670_100000100 | |||
| 912 | Ga0070670_100006852 | |||
| 913 | Ga0070670_100012304 | |||
| 914 | Ga0070670_100031000 | |||
| 915 | Ga0070677_10013039 | |||
| 916 | Ga0070666_10006621 | |||
| 917 | Ga0070666_10049156 | |||
| 918 | Ga0070666_10058434 | |||
| 919 | Ga0070680_100017002 | |||
| 920 | Ga0070682_100082452 | |||
| 921 | Ga0068868_100000184 | |||
| 922 | Ga0070660_100001819 | |||
| 923 | Ga0070660_100001962 | |||
| 924 | Ga0070660_100028542 | |||
| 925 | Ga0070668_100000056 | |||
| 926 | Ga0070668_100000120 | |||
| 927 | Ga0070668_100000382 | |||
| 928 | Ga0070668_100000618 | |||
| 929 | Ga0070668_100001275 | |||
| 930 | Ga0070668_100002077 | |||
| 931 | Ga0070668_100005886 | |||
| 932 | Ga0070668_100009160 | |||
| 933 | Ga0070668_100016001 | |||
| 934 | Ga0070668_100018170 | |||
| 935 | Ga0070668_100038868 | |||
| 936 | Ga0070668_100054427 | |||
| 937 | Ga0070669_100000045 | |||
| 938 | Ga0070669_100000392 | |||
| 939 | Ga0070669_100000602 | |||
| 940 | Ga0070669_100000621 | |||
| 941 | Ga0070669_100043804 | |||
| 942 | Ga0070669_100075791 | |||
| 943 | Ga0070675_100146394 | |||
| 944 | Ga0070671_100000053 | |||
| 945 | Ga0070671_100000221 | |||
| 946 | Ga0070671_100000662 | |||
| 947 | Ga0070671_100004972 | |||
| 948 | Ga0070671_100007152 | |||
| 949 | Ga0070671_100020129 | |||
| 950 | Ga0070671_100033699 | |||
| 951 | Ga0070671_100046383 | |||
| 952 | Ga0070673_100076271 | |||
| 953 | Ga0070659_100000009 | |||
| 954 | Ga0070659_100001161 | |||
| 955 | Ga0070659_100018413 | |||
| 956 | Ga0070659_100172813 | |||
| 957 | Ga0070667_100000175 | |||
| 958 | Ga0070667_100000215 | |||
| 959 | Ga0070667_100000288 | |||
| 960 | Ga0070667_100000499 | |||
| 961 | Ga0070667_100000685 | |||
| 962 | Ga0070667_100024627 | |||
| 963 | Ga0070667_100048441 | |||
| 964 | Ga0070667_100070571 | |||
| 965 | Ga0070663_100297061 | |||
| 966 | Ga0070662_100000429 | |||
| 967 | Ga0070662_100004338 | |||
| 968 | Ga0070662_100088274 | |||
| 969 | Ga0070681_10038631 | |||
| 970 | Ga0070679_100021176 | |||
| 971 | Ga0070679_100050252 | |||
| 972 | Ga0070679_100137854 | |||
| 973 | Ga0070684_100180481 | |||
| 974 | Ga0068853_100019636 | |||
| 975 | Ga0068853_100032066 | |||
| 976 | Ga0068853_100208168 | |||
| 977 | Ga0070686_100001493 | |||
| 978 | Ga0070686_100007327 | |||
| 979 | Ga0070665_100000145 | |||
| 980 | Ga0070665_100000198 | |||
| 981 | Ga0070665_100000541 | |||
| 982 | Ga0070665_100002021 | |||
| 983 | Ga0070665_100002104 | |||
| 984 | Ga0070665_100002458 | |||
| 985 | Ga0070665_100015213 | |||
| 986 | Ga0070665_100098610 | |||
| 987 | Ga0070665_100334560 | |||
| 988 | Ga0068855_100000348 | |||
| 989 | Ga0068855_100008632 | |||
| 990 | Ga0068855_100008731 | |||
| 991 | Ga0068855_100121878 | |||
| 992 | Ga0070664_100052431 | |||
| 993 | Ga0070664_100072882 | |||
| 994 | Ga0068857_100001454 | |||
| 995 | Ga0068857_100012594 | |||
| 996 | Ga0068854_100010070 | |||
| 997 | Ga0068854_100011450 | |||
| 998 | Ga0068854_100036219 | |||
| 999 | Ga0068854_100107844 | |||
| 1000 | Ga0068856_100014531 | |||
| 1001 | Ga0068856_100063694 | |||
| 1002 | Ga0068856_100072458 | |||
| 1003 | Ga0068852_100000122 | |||
| 1004 | Ga0068852_100035418 | |||
| 1005 | Ga0068859_100001068 | |||
| 1006 | Ga0068859_100002239 | |||
| 1007 | Ga0068859_100025300 | |||
| 1008 | Ga0068859_100060124 | |||
| 1009 | Ga0068859_100062674 | |||
| 1010 | Ga0068859_100064302 | |||
| 1011 | Ga0068859_100216185 | |||
| 1012 | Ga0068864_100000027 | |||
| 1013 | Ga0068864_100000058 | |||
| 1014 | Ga0068864_100000077 | |||
| 1015 | Ga0068864_100000082 | |||
| 1016 | Ga0068864_100000897 | |||
| 1017 | Ga0068864_100002236 | |||
| 1018 | Ga0068864_100006635 | |||
| 1019 | Ga0068864_100017042 | |||
| 1020 | Ga0068864_100215479 | |||
| 1021 | Ga0068861_100005917 | |||
| 1022 | Ga0068863_100000077 | |||
| 1023 | Ga0068863_100000083 | |||
| 1024 | Ga0068863_100000124 | |||
| 1025 | Ga0068863_100000175 | |||
| 1026 | Ga0068863_100000597 | |||
| 1027 | Ga0068863_100003418 | |||
| 1028 | Ga0068863_100010685 | |||
| 1029 | Ga0068863_100055146 | |||
| 1030 | Ga0068863_100074925 | |||
| 1031 | Ga0068863_100086882 | |||
| 1032 | Ga0068863_100283111 | |||
| 1033 | Ga0068858_100000006 | |||
| 1034 | Ga0068858_100001633 | |||
| 1035 | Ga0068858_100001737 | |||
| 1036 | Ga0068858_100004877 | |||
| 1037 | Ga0068858_100008659 | |||
| 1038 | Ga0068858_100020545 | |||
| 1039 | Ga0068858_100026343 | |||
| 1040 | Ga0068858_100100435 | |||
| 1041 | Ga0068860_100000049 | |||
| 1042 | Ga0068860_100000077 | |||
| 1043 | Ga0068860_100001901 | |||
| 1044 | Ga0068860_100002711 | |||
| 1045 | Ga0068860_100014040 | |||
| 1046 | Ga0068860_100014077 | |||
| 1047 | Ga0068860_100016786 | |||
| 1048 | Ga0068860_100036625 | |||
| 1049 | Ga0068860_100255722 | |||
| 1050 | Ga0068862_100000098 | |||
| 1051 | Ga0068862_100000170 | |||
| 1052 | Ga0068862_100000183 | |||
| 1053 | Ga0068862_100002004 | |||
| 1054 | Ga0068862_100014066 | |||
| 1055 | Ga0068862_100042547 | |||
| 1056 | Ga0068862_100043643 | |||
| 1057 | Ga0068862_100056635 | |||
| 1058 | Ga0081455_10000100 | |||
| 1059 | Ga0081455_10050148 | |||
| 1060 | Ga0070717_10191604 | |||
| 1061 | Ga0075365_10045687 | |||
| 1062 | Ga0075368_10000068 | |||
| 1063 | Ga0075368_10000237 | |||
| 1064 | Ga0075368_10007233 | |||
| 1065 | Ga0075363_100015558 | |||
| 1066 | Ga0075363_100088226 | |||
| 1067 | Ga0075432_10013462 | |||
| 1068 | Ga0075367_10002063 | |||
| 1069 | Ga0075367_10003603 | |||
| 1070 | Ga0075366_10019047 | |||
| 1071 | Ga0075366_10030558 | |||
| 1072 | Ga0075366_10044951 | |||
| 1073 | Ga0075366_10068614 | |||
| 1074 | Ga0097621_100036553 | |||
| 1075 | Ga0075370_10006199 | |||
| 1076 | Ga0075428_100169474 | |||
| 1077 | Ga0075430_100012777 | |||
| 1078 | Ga0075430_100073958 | |||
| 1079 | Ga0075431_100018323 | |||
| 1080 | Ga0075434_100118640 | |||
| 1081 | Ga0068865_100000389 | |||
| 1082 | Ga0097620_100001068 | |||
| 1083 | Ga0097620_100002239 | |||
| 1084 | Ga0097620_100025300 | |||
| 1085 | Ga0097620_100060120 | |||
| 1086 | Ga0097620_100062674 | |||
| 1087 | Ga0097620_100064299 | |||
| 1088 | Ga0097620_100216190 | |||
| 1089 | Ga0079104_1022544 | |||
| 1090 | Ga0075435_100120482 | |||
| 1091 | Ga0105251_10003079 | |||
| 1092 | Ga0105250_10005980 | |||
| 1093 | Ga0105240_10011903 | |||
| 1094 | Ga0105240_10050780 | |||
| 1095 | Ga0105240_10068237 | |||
| 1096 | Ga0111539_10349846 | |||
| 1097 | Ga0105245_10004106 | |||
| 1098 | Ga0105245_10329286 | |||
| 1099 | Ga0105247_10005333 | |||
| 1100 | Ga0114129_10184215 | |||
| 1101 | Ga0105241_10128592 | |||
| 1102 | Ga0105241_10192801 | |||
| 1103 | Ga0105248_10000061 | |||
| 1104 | Ga0105248_10000170 | |||
| 1105 | Ga0105248_10005127 | |||
| 1106 | Ga0105248_10011380 | |||
| 1107 | Ga0105248_10018067 | |||
| 1108 | Ga0105248_10021662 | |||
| 1109 | Ga0105248_10053770 | |||
| 1110 | Ga0105248_10060446 | |||
| 1111 | Ga0105248_10114478 | |||
| 1112 | Ga0105248_10138531 | |||
| 1113 | Ga0105237_10072738 | |||
| 1114 | Ga0105238_10005555 | |||
| 1115 | Ga0105238_10324694 | |||
| 1116 | Ga0105249_10000347 | |||
| 1117 | Ga0105249_10000438 | |||
| 1118 | Ga0105249_10067322 | |||
| 1119 | Ga0105239_10146203 | |||
| 1120 | Ga0157373_10006933 | |||
| 1121 | Ga0157373_10007518 | |||
| 1122 | Ga0157373_10189162 | |||
| 1123 | Ga0157371_10011469 | |||
| 1124 | Ga0157370_10012360 | |||
| 1125 | Ga0157370_10032275 | |||
| 1126 | Ga0157369_10010193 | |||
| 1127 | Ga0157374_10150062 | |||
| 1128 | Ga0163162_10008379 | |||
| 1129 | Ga0163162_10010854 | |||
| 1130 | Ga0163162_10098263 | |||
| 1131 | Ga0163162_10210152 | |||
| 1132 | Ga0157372_10054941 | |||
| 1133 | Ga0157375_10046231 | |||
| 1134 | Ga0163163_10016002 | |||
| 1135 | Ga0163163_10081481 | |||
| 1136 | Ga0163163_10188229 | |||
| 1137 | Ga0157380_10000062 | |||
| 1138 | Ga0157380_10005592 | |||
| 1139 | Ga0157380_10382638 | |||
| 1140 | Ga0182008_10096073 | |||
| 1141 | Ga0157379_10006760 | |||
| 1142 | Ga0157379_10058757 | |||
| 1143 | Ga0183363_1006 | |||
| 1144 | Ga0163161_10000536 | |||
| 1145 | Ga0213876_10016426 | |||
| 1146 | Ga0209147_101020 | |||
| 1147 | Ga0209026_1004218 | |||
| 1148 | Ga0209148_1008228 | |||
| 1149 | Ga0209233_1000186 | |||
| 1150 | Ga0209565_1001208 | |||
| 1151 | Ga0209673_1000796 | |||
| 1152 | Ga0209675_1009570 | |||
| 1153 | Ga0209676_1000257 | |||
| 1154 | Ga0209758_1000852 | |||
| 1155 | Ga0209758_1002605 | |||
| 1156 | Ga0209758_1005454 | |||
| 1157 | Ga0209050_1000053 | |||
| 1158 | Ga0209050_1001180 | |||
| 1159 | Ga0209050_1004360 | |||
| 1160 | Ga0209050_1016488 | |||
| 1161 | Ga0209256_1015918 | |||
| 1162 | Ga0209051_1002534 | |||
| 1163 | Ga0209257_1000192 | |||
| 1164 | Ga0209257_1000289 | |||
| 1165 | Ga0209257_1001221 | |||
| 1166 | Ga0209257_1003844 | |||
| 1167 | Ga0207696_1009099 | |||
| 1168 | Ga0207696_1009941 | |||
| 1169 | Ga0207713_1010041 | |||
| 1170 | Ga0207713_1016410 | |||
| 1171 | Ga0207682_10015062 | |||
| 1172 | Ga0207680_10003670 | |||
| 1173 | Ga0207680_10053574 | |||
| 1174 | Ga0207680_10079890 | |||
| 1175 | Ga0207680_10188494 | |||
| 1176 | Ga0207647_10028334 | |||
| 1177 | Ga0207647_10029141 | |||
| 1178 | Ga0207647_10037011 | |||
| 1179 | Ga0207705_10000037 | |||
| 1180 | Ga0207705_10000208 | |||
| 1181 | Ga0207705_10001518 | |||
| 1182 | Ga0207705_10003453 | |||
| 1183 | Ga0207705_10028093 | |||
| 1184 | Ga0207654_10072100 | |||
| 1185 | Ga0207654_10078974 | |||
| 1186 | Ga0207707_10018494 | |||
| 1187 | Ga0207707_10034121 | |||
| 1188 | Ga0207695_10011899 | |||
| 1189 | Ga0207695_10012936 | |||
| 1190 | Ga0207695_10018076 | |||
| 1191 | Ga0207695_10066392 | |||
| 1192 | Ga0207671_10004168 | |||
| 1193 | Ga0207660_10002946 | |||
| 1194 | Ga0207660_10016827 | |||
| 1195 | Ga0207657_10002855 | |||
| 1196 | Ga0207657_10004555 | |||
| 1197 | Ga0207657_10025947 | |||
| 1198 | Ga0207649_10003512 | |||
| 1199 | Ga0207652_10001310 | |||
| 1200 | Ga0207652_10004969 | |||
| 1201 | Ga0207681_10000022 | |||
| 1202 | Ga0207681_10000062 | |||
| 1203 | Ga0207681_10000185 | |||
| 1204 | Ga0207681_10000577 | |||
| 1205 | Ga0207681_10025867 | |||
| 1206 | Ga0207681_10045029 | |||
| 1207 | Ga0207681_10108737 | |||
| 1208 | Ga0207681_10165396 | |||
| 1209 | Ga0207694_10288565 | |||
| 1210 | Ga0207650_10000019 | |||
| 1211 | Ga0207650_10000020 | |||
| 1212 | Ga0207650_10000054 | |||
| 1213 | Ga0207650_10000118 | |||
| 1214 | Ga0207650_10025540 | |||
| 1215 | Ga0207650_10041060 | |||
| 1216 | Ga0207650_10177154 | |||
| 1217 | Ga0207687_10002318 | |||
| 1218 | Ga0207687_10031155 | |||
| 1219 | Ga0207644_10000004 | |||
| 1220 | Ga0207644_10000062 | |||
| 1221 | Ga0207644_10000063 | |||
| 1222 | Ga0207644_10000328 | |||
| 1223 | Ga0207644_10000491 | |||
| 1224 | Ga0207644_10000510 | |||
| 1225 | Ga0207644_10020086 | |||
| 1226 | Ga0207644_10023134 | |||
| 1227 | Ga0207690_10000022 | |||
| 1228 | Ga0207690_10000142 | |||
| 1229 | Ga0207690_10002324 | |||
| 1230 | Ga0207690_10042251 | |||
| 1231 | Ga0207690_10045567 | |||
| 1232 | Ga0207706_10001143 | |||
| 1233 | Ga0207706_10047108 | |||
| 1234 | Ga0207709_10024901 | |||
| 1235 | Ga0207704_10001695 | |||
| 1236 | Ga0207711_10000017 | |||
| 1237 | Ga0207711_10000374 | |||
| 1238 | Ga0207711_10001008 | |||
| 1239 | Ga0207711_10001520 | |||
| 1240 | Ga0207711_10012720 | |||
| 1241 | Ga0207711_10020120 | |||
| 1242 | Ga0207711_10043268 | |||
| 1243 | Ga0207711_10116173 | |||
| 1244 | Ga0207711_10137743 | |||
| 1245 | Ga0207661_10222300 | |||
| 1246 | Ga0207679_10010553 | |||
| 1247 | Ga0207667_10003767 | |||
| 1248 | Ga0207667_10004542 | |||
| 1249 | Ga0207667_10004895 | |||
| 1250 | Ga0207667_10008488 | |||
| 1251 | Ga0207667_10018370 | |||
| 1252 | Ga0207667_10054171 | |||
| 1253 | Ga0207651_10167784 | |||
| 1254 | Ga0207712_10001623 | |||
| 1255 | Ga0207712_10002000 | |||
| 1256 | Ga0207668_10000004 | |||
| 1257 | Ga0207668_10000148 | |||
| 1258 | Ga0207668_10000159 | |||
| 1259 | Ga0207668_10000292 | |||
| 1260 | Ga0207668_10000464 | |||
| 1261 | Ga0207668_10007946 | |||
| 1262 | Ga0207668_10009571 | |||
| 1263 | Ga0207668_10068618 | |||
| 1264 | Ga0207668_10120165 | |||
| 1265 | Ga0207640_10010264 | |||
| 1266 | Ga0207658_10000014 | |||
| 1267 | Ga0207658_10000421 | |||
| 1268 | Ga0207658_10000645 | |||
| 1269 | Ga0207658_10005044 | |||
| 1270 | Ga0207658_10005071 | |||
| 1271 | Ga0207658_10010416 | |||
| 1272 | Ga0207658_10125356 | |||
| 1273 | Ga0207677_10000051 | |||
| 1274 | Ga0207703_10000027 | |||
| 1275 | Ga0207703_10000509 | |||
| 1276 | Ga0207703_10000619 | |||
| 1277 | Ga0207703_10001323 | |||
| 1278 | Ga0207703_10007271 | |||
| 1279 | Ga0207703_10013919 | |||
| 1280 | Ga0207703_10189210 | |||
| 1281 | Ga0207639_10004071 | |||
| 1282 | Ga0207639_10007764 | |||
| 1283 | Ga0207639_10041627 | |||
| 1284 | Ga0207639_10079291 | |||
| 1285 | Ga0207678_10167123 | |||
| 1286 | Ga0207702_10010724 | |||
| 1287 | Ga0207702_10020505 | |||
| 1288 | Ga0207702_10027853 | |||
| 1289 | Ga0207641_10000003 | |||
| 1290 | Ga0207641_10000008 | |||
| 1291 | Ga0207641_10000114 | |||
| 1292 | Ga0207641_10000193 | |||
| 1293 | Ga0207641_10001586 | |||
| 1294 | Ga0207641_10001900 | |||
| 1295 | Ga0207641_10005247 | |||
| 1296 | Ga0207641_10013291 | |||
| 1297 | Ga0207641_10013559 | |||
| 1298 | Ga0207641_10044530 | |||
| 1299 | Ga0207641_10053136 | |||
| 1300 | Ga0207641_10056759 | |||
| 1301 | Ga0207641_10101578 | |||
| 1302 | Ga0207648_10085318 | |||
| 1303 | Ga0207676_10000022 | |||
| 1304 | Ga0207676_10000060 | |||
| 1305 | Ga0207676_10000068 | |||
| 1306 | Ga0207676_10000087 | |||
| 1307 | Ga0207676_10003035 | |||
| 1308 | Ga0207676_10004674 | |||
| 1309 | Ga0207676_10027278 | |||
| 1310 | Ga0207676_10201610 | |||
| 1311 | Ga0207676_10319276 | |||
| 1312 | Ga0207674_10003442 | |||
| 1313 | Ga0207674_10024846 | |||
| 1314 | Ga0207674_10038518 | |||
| 1315 | Ga0207674_10055794 | |||
| 1316 | Ga0207674_10103587 | |||
| 1317 | Ga0207675_100008383 | |||
| 1318 | Ga0207698_10001014 | |||
| 1319 | Ga0207698_10192268 | |||
| 1320 | Ga0207698_10390022 | |||
| 1321 | Ga0209981_1007392 | |||
| 1322 | Ga0209999_1000706 | |||
| 1323 | Ga0209813_10000043 | |||
| 1324 | Ga0209813_10000299 | |||
| 1325 | Ga0207428_10034540 | |||
| 1326 | Ga0268266_10000003 | |||
| 1327 | Ga0268266_10000173 | |||
| 1328 | Ga0268266_10000800 | |||
| 1329 | Ga0268266_10003164 | |||
| 1330 | Ga0268266_10003723 | |||
| 1331 | Ga0268266_10105353 | |||
| 1332 | Ga0268266_10275433 | |||
| 1333 | Ga0268265_10000011 | |||
| 1334 | Ga0268265_10000031 | |||
| 1335 | Ga0268265_10000162 | |||
| 1336 | Ga0268265_10000500 | |||
| 1337 | Ga0268265_10002265 | |||
| 1338 | Ga0268265_10009822 | |||
| 1339 | Ga0268265_10013410 | |||
| 1340 | Ga0268265_10030033 | |||
| 1341 | Ga0268265_10105967 | |||
| 1342 | Ga0268264_10000014 | |||
| 1343 | Ga0268264_10000032 | |||
| 1344 | Ga0268264_10000121 | |||
| 1345 | Ga0268264_10000732 | |||
| 1346 | Ga0268264_10008542 | |||
| 1347 | Ga0268264_10014405 | |||
| 1348 | Ga0268264_10023699 | |||
| 1349 | Ga0265337_1032722 | |||
| 1350 | Ga0307517_10003957 | |||
| 1351 | Ga0307515_10056775 | |||
| 1352 | Ga0307515_10072918 | |||
| 1353 | Ga0307511_10032016 | |||
| 1354 | Ga0265330_10018487 | |||
| 1355 | Ga0265328_10000012 | |||
| 1356 | Ga0265328_10000417 | |||
| 1357 | Ga0265329_10002851 | |||
| 1358 | Ga0265339_10070871 | |||
| 1359 | Ga0265331_10001416 | |||
| 1360 | Ga0265327_10001598 | |||
| 1361 | Ga0265316_10001239 | |||
| 1362 | Ga0307513_10000100 | |||
| 1363 | Ga0307513_10000649 | |||
| 1364 | Ga0307513_10003278 | |||
| 1365 | Ga0307513_10005039 | |||
| 1366 | Ga0307408_100013559 | |||
| 1367 | Ga0307408_100109726 | |||
| 1368 | Ga0307408_100188820 | |||
| 1369 | Ga0307408_100214028 | |||
| 1370 | Ga0307508_10000405 | |||
| 1371 | Ga0307508_10047229 | |||
| 1372 | Ga0307516_10000338 | |||
| 1373 | Ga0307405_10000127 | |||
| 1374 | Ga0307405_10026630 | |||
| 1375 | Ga0307405_10219701 | |||
| 1376 | Ga0307413_10109102 | |||
| 1377 | Ga0307413_10177191 | |||
| 1378 | Ga0307406_10091799 | |||
| 1379 | Ga0307412_10000284 | |||
| 1380 | Ga0307412_10000717 | |||
| 1381 | Ga0307412_10003649 | |||
| 1382 | Ga0307412_10007519 | |||
| 1383 | Ga0307412_10017480 | |||
| 1384 | Ga0307412_10019409 | |||
| 1385 | Ga0307412_10024559 | |||
| 1386 | Ga0307412_10032687 | |||
| 1387 | Ga0307412_10042734 | |||
| 1388 | Ga0307412_10089847 | |||
| 1389 | Ga0307409_100018347 | |||
| 1390 | Ga0307409_100031859 | |||
| 1391 | Ga0307409_100072711 | |||
| 1392 | Ga0307416_100112131 | |||
| 1393 | Ga0307416_100274793 | |||
| 1394 | Ga0307414_10000266 | |||
| 1395 | Ga0307414_10001045 | |||
| 1396 | Ga0307414_10012685 | |||
| 1397 | Ga0307414_10067776 | |||
| 1398 | Ga0307414_10127635 | |||
| 1399 | Ga0307414_10175096 | |||
| 1400 | Ga0307414_10190156 | |||
| 1401 | Ga0307414_10219363 | |||
| 1402 | Ga0307411_10043670 | |||
| 1403 | Ga0307510_10018167 | |||
| 1404 | Ga0373944_0003119 | |||
| 1405 | Ga0373936_0001631 | |||
| 1406 | Ga0373927_0112027 | |||
| 1407 | Ga0373925_0000199 | |||
| 1408 | Ga0395899_0000018 | |||
| 1409 | Ga0395899_0000560 | |||
| 1410 | Ga0395900_0000002 | |||
| 1411 | Ga0395900_0188408 | |||
| 1412 | Ga0395905_0029197 | |||
| 1413 | Ga0395905_0052510 | |||
| 1414 | Ga0436364_1348264 | |||
| 1415 | Ga0395901_0000021 | |||
| 1416 | Ga0395901_0155909 | |||
| 1417 | Ga0436365_0309457 | |||
| 1418 | Ga0439443_001447 | |||
| 1419 | Ga0450890_007344 | |||
| 1420 | Ga0466966_0046157 | |||
| 1421 | Ga0453684_0070680 | |||
| 1422 | Ga0453684_0179386 | |||
| 1423 | Ga0453684_0203510 | |||
| 1424 | Ga0466970_0139934 | |||
| 1425 | Ga0466959_0018063 | |||
| 1426 | Ga0451576_0062375 | |||
| 1427 | Ga0466967_0002033 | |||
| 1428 | Ga0495617_003563 | |||
| 1429 | Ga0495627_000108 | |||
| 1430 | Ga0495627_000242 | |||
| 1431 | Ga0495627_000954 | |||
| 1432 | Ga0495627_012439 | |||
| 1433 | Ga0495590_0004610 | |||
| 1434 | Ga0495638_0001571 | |||
| 1435 | Ga0495638_0001805 | |||
| 1436 | Ga0495638_0004499 | |||
| 1437 | Ga0495638_0009105 | |||
| 1438 | Ga0495638_0009709 | |||
| 1439 | Ga0495638_0040628 | |||
| 1440 | Ga0495638_0160779 | |||
| 1441 | Ga0495650_0000468 | |||
| 1442 | Ga0495650_0000914 | |||
| 1443 | Ga0495650_0002053 | |||
| 1444 | Ga0495607_0072090 | |||
| 1445 | Ga0495583_0000003 | |||
| 1446 | Ga0495583_0019518 | |||
| 1447 | Ga0495606_0084953 | |||
| 1448 | Ga0495610_0000662 | |||
| 1449 | Ga0495610_0000816 | |||
| 1450 | Ga0495610_0001741 | |||
| 1451 | Ga0495610_0002953 | |||
| 1452 | Ga0495610_0005936 | |||
| 1453 | Ga0495610_0034718 | |||
| 1454 | Ga0495616_0000405 | |||
| 1455 | Ga0495620_0012177 | |||
| 1456 | Ga0495628_0020975 | |||
| 1457 | Ga0495631_0003695 | |||
| 1458 | Ga0495632_0000039 | |||
| 1459 | Ga0495632_0005313 | |||
| 1460 | Ga0495632_0009504 | |||
| 1461 | Ga0495637_0004308 | |||
| 1462 | Ga0495637_0017773 | |||
| 1463 | Ga0495643_0000162 | |||
| 1464 | Ga0495643_0006107 | |||
| 1465 | Ga0495648_0003006 | |||
| 1466 | Ga0495648_0020364 | |||
| 1467 | Ga0495648_0043915 | |||
| 1468 | Ga0495663_0000006 | |||
| 1469 | Ga0495663_0003709 | |||
| 1470 | Ga0495654_0000199 | |||
| 1471 | Ga0495654_0031774 | |||
| 1472 | Ga0495609_0050631 | |||
| 1473 | Ga0495597_0012544 | |||
| 1474 | Ga0495622_0005241 | |||
| 1475 | Ga0495633_0000789 | |||
| 1476 | Ga0495633_0005248 | |||
| 1477 | Ga0495633_0005452 | |||
| 1478 | Ga0495668_0003831 | |||
| 1479 | Ga0495668_0008079 | |||
| 1480 | Ga0495668_0081640 | |||
| 1481 | Ga0495625_0000615 | |||
| 1482 | Ga0495625_0019243 | |||
| 1483 | Ga0495625_0047142 | |||
| 1484 | Ga0495625_0052653 | |||
| 1485 | Ga0495625_0073786 | |||
| 1486 | Ga0495625_0115292 | |||
| 1487 | Ga0495669_0000007 | |||
| 1488 | Ga0495669_0000318 | |||
| 1489 | Ga0495669_0009864 | |||
| 1490 | Ga0495671_0000062 | |||
| 1491 | Ga0495589_0005526 | |||
| 1492 | Ga0495672_0006075 | |||
| 1493 | Ga0495672_0060172 | |||
| 1494 | Ga0495672_0113105 | |||
| 1495 | Ga0495687_033764 | |||
| 1496 | Ga0495677_0019475 | |||
| 1497 | Ga0495679_002677 | |||
| 1498 | Ga0495673_0000370 | |||
| 1499 | Ga0495673_0001884 | |||
| 1500 | Ga0495673_0017007 | |||
| 1501 | Ga0495681_0000060 | |||
| 1502 | Ga0495681_0000129 | |||
| 1503 | Ga0495681_0078345 | |||
| 1504 | Ga0495686_0000147 | |||
| 1505 | Ga0495686_0003469 | |||
| 1506 | Ga0495686_0005110 | |||
| 1507 | Ga0495686_0006442 | |||
| 1508 | Ga0495686_0025205 | |||
| 1509 | Ga0495686_0030146 | |||
| 1510 | Ga0495593_0025107 | |||
| 1511 | Ga0495626_0002698 | |||
| 1512 | Ga0496100_0029671 | |||
| 1513 | Ga0496100_0060094 | |||
| 1514 | Ga0496101_0054917 | |||
| 1515 | Ga0496102_0000209 | |||
| 1516 | Ga0496102_0049820 | |||
| 1517 | Ga0496102_0162320 | |||
| 1518 | Ga0496103_0000136 | |||
| 1519 | Ga0496103_0005756 | |||
| 1520 | Ga0496103_0046980 | |||
| 1521 | Ga0496104_0076191 | |||
| 1522 | Ga0496104_0102283 | |||
| 1523 | Ga0496105_0010034 | |||
| 1524 | Ga0496105_0083290 | |||
| 1525 | Ga0496105_0111132 | |||
| 1526 | Ga0496106_0004669 | |||
| 1527 | Ga0496107_0000039 | |||
| 1528 | Ga0496107_0001041 | |||
| 1529 | Ga0496107_0018954 | |||
| 1530 | Ga0496107_0077321 | |||
| 1531 | Ga0496108_0051057 | |||
| 1532 | Ga0496108_0053601 | |||
| 1533 | Ga0496109_0052504 | |||
| 1534 | Ga0496109_0067293 | |||
| 1535 | Ga0496109_0153945 | |||
| 1536 | Ga0496109_0169880 | |||
| 1537 | Ga0496109_0233720 | |||
| 1538 | Ga0496110_0004039 | |||
| 1539 | Ga0496110_0044529 | |||
| 1540 | Ga0496110_0080965 | |||
| 1541 | Ga0496111_0000244 | |||
| 1542 | Ga0496111_0101193 | |||
| 1543 | Ga0496112_0015115 | |||
| 1544 | Ga0496112_0022637 | |||
| 1545 | Ga0496112_0101121 | |||
| 1546 | Ga0496112_0170355 | |||
| 1547 | Ga0496113_0000515 | |||
| 1548 | Ga0496113_0063133 | |||
| 1549 | Ga0496114_0161563 | |||
| 1550 | Ga0496115_0036911 | |||
| 1551 | Ga0496115_0047345 | |||
| 1552 | Ga0496116_0000045 | |||
| 1553 | Ga0496117_0000526 | |||
| 1554 | Ga0496117_0003070 | |||
| 1555 | Ga0496117_0005479 | |||
| 1556 | Ga0496117_0048957 | |||
| 1557 | Ga0496117_0102966 | |||
| 1558 | Ga0496118_0000162 | |||
| 1559 | Ga0496118_0002204 | |||
| 1560 | Ga0496118_0007520 | |||
| 1561 | Ga0496118_0012359 | |||
| 1562 | Ga0496118_0026820 | |||
| 1563 | Ga0496118_0085182 | |||
| 1564 | Ga0496119_0017828 | |||
| 1565 | Ga0496119_0039220 | |||
| 1566 | Ga0496119_0066746 | |||
| 1567 | Ga0496120_0031176 | |||
| 1568 | Ga0496121_0000042 | |||
| 1569 | Ga0496121_0000104 | |||
| 1570 | Ga0496121_0000187 | |||
| 1571 | Ga0496121_0001456 | |||
| 1572 | Ga0496121_0001823 | |||
| 1573 | Ga0496121_0010011 | |||
| 1574 | Ga0496121_0038799 | |||
| 1575 | Ga0496121_0090579 | |||
| 1576 | Ga0496122_0001120 | |||
| 1577 | Ga0496122_0005307 | |||
| 1578 | Ga0496123_0000495 | |||
| 1579 | Ga0496123_0003093 | |||
| 1580 | Ga0496124_0000325 | |||
| 1581 | Ga0496124_0000844 | |||
| 1582 | Ga0496124_0001703 | |||
| 1583 | Ga0496124_0119644 | |||
| 1584 | Ga0496124_0125050 | |||
| 1585 | Ga0496125_0003210 | |||
| 1586 | Ga0496125_0050674 | |||
| 1587 | Ga0496126_0002167 | |||
| 1588 | Ga0496126_0002377 | |||
| 1589 | Ga0496126_0002394 | |||
| 1590 | Ga0496126_0013475 | |||
| 1591 | Ga0496126_0024245 | |||
| 1592 | Ga0496126_0024281 | |||
| 1593 | Ga0496126_0139169 | |||
| 1594 | Ga0501306_007814 | |||
| 1595 | Ga0495678_002398 | |||
| 1596 | Ga0495678_016792 | |||
| 1597 | Ga0501290_000021 | |||
| 1598 | Ga0501292_000017 | |||
| 1599 | Ga0501314_001000 | |||
| 1600 | Ga0501032_0036503 | |||
| 1601 | Ga0501033_0216622 | |||
| 1602 | Ga0501034_0170492 | |||
| 1603 | Ga0501043_0031530 | |||
| 1604 | Ga0501043_0071185 | |||
| 1605 | Ga0501047_0004654 | |||
| 1606 | Ga0501047_0007125 | |||
| 1607 | Ga0501047_0032668 | |||
| 1608 | Ga0501223_000164 | |||
| 1609 | Ga0501224_000015 | |||
| 1610 | Ga0501238_002281 | |||
| 1611 | Ga0501249_000274 | |||
| 1612 | Ga0501257_000140 | |||
| 1613 | Ga0501261_000002 | |||
| 1614 | Ga0501225_0000539 | |||
| 1615 | Ga0501245_000065 | |||
| 1616 | Ga0501279_000019 | |||
| 1617 | Ga0501280_000075 | |||
| 1618 | Ga0501281_00040 | |||
| 1619 | Ga0501282_000991 | |||
| 1620 | Ga0501035_0277577 | |||
| 1621 | Ga0501044_0001217 | |||
| 1622 | Ga0501044_0013059 | |||
| 1623 | Ga0501226_000027 | |||
| 1624 | nmdc:mga03683_1290_c1 | |||
| 1625 | nmdc:mga00v17_481_c1 | |||
| 1626 | nmdc:mga0k408_26261_c1 | |||
| 1627 | nmdc:mga0k408_27250_c1 | |||
| 1628 | nmdc:mga06z11_12224_c1 | |||
| 1629 | nmdc:mga06z11_232_c1 | |||
| 1630 | nmdc:mga06z11_56_c1 | |||
| 1631 | nmdc:mga04h51_113_c1 | |||
| 1632 | nmdc:mga04h51_193_c1 | |||
| 1633 | nmdc:mga07m45_10684_c1 | |||
| 1634 | nmdc:mga07m45_12_c1 | |||
| 1635 | nmdc:mga07m45_84254_c1 | |||
| 1636 | nmdc:mga05p37_26594_c1 | |||
| 1637 | nmdc:mga0qj67_10069_c1 | |||
| 1638 | nmdc:mga0qj67_6321_c1 | |||
| 1639 | nmdc:mga06r32_14610_c1 | |||
| 1640 | nmdc:mga08y16_305522_c1 | |||
| 1641 | nmdc:mga0sz30_15639_c1 | |||
| 1642 | Ga0500635_0000172 | |||
| 1643 | Ga0500578_0000015 | |||
| 1644 | Ga0500643_000065 | |||
| 1645 | Ga0500643_001942 | |||
| 1646 | Ga0500643_005646 | |||
| 1647 | Ga0500643_006801 | |||
| 1648 | Ga0500644_0001179 | |||
| 1649 | Ga0500651_0004810 | |||
| 1650 | Ga0500566_0024545 | |||
| 1651 | Ga0500641_0018537 | |||
| 1652 | Ga0500641_0058775 | |||
| 1653 | Ga0500555_002226 | |||
| 1654 | Ga0500556_0001545 | |||
| 1655 | Ga0500562_001104 | |||
| 1656 | Ga0500562_002398 | |||
| 1657 | Ga0500592_000010 | |||
| 1658 | Ga0500594_0000117 | |||
| 1659 | Ga0500607_046225 | |||
| 1660 | Ga0500608_000052 | |||
| 1661 | Ga0500608_000611 | |||
| 1662 | Ga0500608_011952 | |||
| 1663 | Ga0500614_006085 | |||
| 1664 | Ga0500618_000617 | |||
| 1665 | Ga0500618_005116 | |||
| 1666 | Ga0500642_0002144 | |||
| 1667 | Ga0500642_0064757 | |||
| 1668 | Ga0500655_000338 | |||
| 1669 | Ga0500658_0000708 | |||
| 1670 | Ga0500658_0018677 | |||
| 1671 | Ga0500559_0000009 | |||
| 1672 | Ga0500559_0004249 | |||
| 1673 | Ga0500559_0005128 | |||
| 1674 | Ga0500559_0032960 | |||
| 1675 | Ga0500564_000254 | |||
| 1676 | Ga0500564_023909 | |||
| 1677 | Ga0500590_000023 | |||
| 1678 | Ga0500604_0000007 | |||
| 1679 | Ga0500616_0017908 | |||
| 1680 | Ga0500616_0022468 | |||
| 1681 | Ga0500616_0030851 | |||
| 1682 | Ga0500622_0001045 | |||
| 1683 | Ga0500622_0006519 | |||
| 1684 | Ga0500622_0059953 | |||
| 1685 | Ga0500624_000007 | |||
| 1686 | Ga0500627_0001068 | |||
| 1687 | Ga0500636_0047338 | |||
| 1688 | Ga0500637_0001911 | |||
| 1689 | Ga0500637_0027363 | |||
| 1690 | Ga0500570_014168 | |||
| 1691 | Ga0500611_001246 | |||
| 1692 | Ga0500625_000011 | |||
| 1693 | Ga0500645_001524 | |||
| 1694 | Ga0500645_002661 | |||
| 1695 | Ga0500645_002789 | |||
| 1696 | Ga0500609_000474 | |||
| 1697 | Ga0500596_000548 | |||
| 1698 | Ga0587084_005664 | |||
| 1699 | 2511120949 | |||
| 1700 | 2512642607 | |||
| 1701 | 2585149834 | |||
| 1702 | 2585151270 | |||
| 1703 | 2585197139 | |||
| 1704 | 2585261023 | |||
| 1705 | 2587919940 | |||
| 1706 | 2600203327 | |||
| 1707 | 2643731052 | |||
| 1708 | 2643747686 | |||
| 1709 | 2643780879 | |||
| 1710 | 2643926795 | |||
| 1711 | 2643929625 | |||
| 1712 | 2643999690 | |||
| 1713 | 2644040073 | |||
| 1714 | 2644044296 | |||
| 1715 | 2644087679 | |||
| 1716 | 2644223427 | |||
| 1717 | 2644237169 | |||
| 1718 | 2644344278 | |||
| 1719 | 2644367037 | |||
| 1720 | 2644391780 | |||
| 1721 | 2644506931 | |||
| 1722 | 2738710561 | |||
| 1723 | 2738848986 | |||
| 1724 | 2738864715 | |||
| 1725 | 2739297233 | |||
| 1726 | 2739358911 | |||
| 1727 | 2739650935 | |||
| 1728 | 2740029408 | |||
| 1729 | 2753765870 | |||
| 1730 | 2753765878 | |||
| 1731 | 2792460774 | |||
| 1732 | 2809061916 | |||
| 1733 | 2809077880 | |||
| 1734 | 2809082412 | |||
| 1735 | 2819540186 | |||
| 1736 | 2819551248 | |||
| 1737 | 2819647084 | |||
| 1738 | 2830076854 | |||
| 1739 | 2843745567 | |||
| 1740 | 2849561182 | |||
| 1741 | 2849576163 | |||
| 1742 | 2851157217 | |||
| 1743 | 2857505801 | |||
| 1744 | 2880519901 | |||
| 1745 | 2882809541 | |||
| 1746 | 2884965479 | |||
| 1747 | 2891091295 | |||
| 1748 | 2895881348 | |||
| 1749 | 2896185949 | |||
| 1750 | 2898332876 | |||
| 1751 | 2919143130 | |||
| 1752 | 2919711627 | |||
| 1753 | 2928029042 | |||
| 1754 | 2928100660 | |||
| 1755 | 2928532082 | |||
| 1756 | 2928960723 | |||
| 1757 | 2946789873 | |||
| 1758 | 2984556003 | |||
| 1759 | 2984565891 | |||
| 1760 | 2990269083 | |||
| 1761 | 2993356900 | |||
| 1762 | 2993694786 | |||
| 1763 | 3000867941 | |||
| 1764 | 8057103226 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iml-assembly2.cif.gz_D | crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei | 0.9564 | 5 | 395 |
| 3iml-assembly1.cif.gz_B | crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei | 0.9535 | 5 | 405 |
| 3iml-assembly1.cif.gz_B | crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei | 0.9509 | 5 | 405 |
| 3iml-assembly2.cif.gz_C | crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei | 0.9505 | 5 | 395 |
| 3iml-assembly2.cif.gz_D | crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei | 0.9504 | 5 | 395 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1W4_285_396_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.951 | 287 | 403 | 3.30.300.10 |
| 1fugB01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9351 | 285 | 405 | 3.30.300.10 |
| af_Q2G1W4_285_396_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9264 | 287 | 403 | 3.30.300.10 |
| af_Q2G1W4_138_246_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9253 | 138 | 247 | 3.30.300.10 |
| af_I1LVJ0_12_119_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9228 | 14 | 118 | 3.30.300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520IDV7-F1-model_v4 | Methionine adenosyltransferase | 0.9892 | 1 | 185 |
GO:0004478
GO:0005524 GO:0006556 GO:0046872 |
| AF-A0A519NZ21-F1-model_v4 | Methionine adenosyltransferase | 0.9882 | 2 | 189 |
GO:0004478
GO:0005524 GO:0006556 GO:0046872 |
| AF-Q2N5U2-F1-model_v4 | S-adenosylmethionine synthase (AdoMet synthase) (EC 2.5.1.6) (MAT) (Methionine adenosyltransferase) | 0.9872 | 1 | 405 |
GO:0000287
GO:0004478 GO:0005524 GO:0005737 GO:0006556 GO:0006730 |
| AF-A0A2A5YXV4-F1-model_v4 | Methionine adenosyltransferase (EC 2.5.1.6) | 0.9855 | 1 | 285 |
GO:0004478
GO:0005524 GO:0005737 GO:0006556 GO:0006730 GO:0046872 |
| AF-Q2N5U2-F1-model_v4 | S-adenosylmethionine synthase (AdoMet synthase) (EC 2.5.1.6) (MAT) (Methionine adenosyltransferase) | 0.9847 | 1 | 405 |
GO:0000287
GO:0004478 GO:0005524 GO:0005737 GO:0006556 GO:0006730 |