F484557
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 882 | 320 | 882 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300035083|Ga0373926_0004110|Ga0373926_0004110_641_1522 |
| Length | 293 |
| Sequence | VISACGKQARKNPGAETMLSRRLERGSTSVALAFSVFLAFMTLVTVYIFWAKIWWFPPAITDFGHEIDSQFTRTFLITGIVFVAAQLGLAYAIFKFRDQGQKATYFEGNNTMEIVWTLATVVLFVGLGLYARNAWAEVHFMGAAPGALQIEVTGQQFVWNFRYAGQDGKFGREKPELVSASTGNPVGLDPTDPASKDDIVSPVIAVPAGREVELIIRSQDVTHSFFVRELRLKQDAVPGMEIHMHFTATVPGDYELVCAELCGLGHYRMHSMLSVMTEADFEKWQKEQEAANQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 138 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 216 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 242 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 243 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 244 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.64 |
| Metatranscriptomes | 1.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.42 |
| Rhizosphere | 95.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_3570058 | 2162886012 | Unclassified | 1520 |
| 2 | LJNas_1000490 | 3300000546 | Bacteria | 6924 |
| 3 | JGI24752J21851_1005021 | 3300001976 | Bacteria | 1730 |
| 4 | JGI24747J21853_1001593 | 3300001978 | Bacteria | 1730 |
| 5 | JGI24743J22301_10007922 | 3300001991 | Bacteria | 1853 |
| 6 | JGI24749J21850_1006732 | 3300002076 | Bacteria | 1598 |
| 7 | JGI24744J21845_10039926 | 3300002077 | Unclassified | 879 |
| 8 | JGI24033J26618_1005663 | 3300002155 | Bacteria | 1384 |
| 9 | JGI24034J26672_10000271 | 3300002239 | Bacteria | 6830 |
| 10 | JGI24751J29686_10001862 | 3300002459 | Bacteria | 4323 |
| 11 | Ga0058859_11144590 | 3300004798 | Unclassified | 1081 |
| 12 | Ga0065704_10174353 | 3300005289 | Bacteria | 1273 |
| 13 | Ga0065712_10012241 | 3300005290 | Unclassified | 1872 |
| 14 | Ga0065712_10077587 | 3300005290 | Bacteria | 3472 |
| 15 | Ga0065715_10036466 | 3300005293 | Bacteria | 1253 |
| 16 | Ga0065715_10060498 | 3300005293 | Bacteria | 987 |
| 17 | Ga0065715_10090120 | 3300005293 | Bacteria | 7629 |
| 18 | Ga0065707_10021967 | 3300005295 | Bacteria | 1810 |
| 19 | Ga0070658_10075888 | 3300005327 | Bacteria | 2758 |
| 20 | Ga0070676_10032231 | 3300005328 | Bacteria | 3001 |
| 21 | Ga0070683_100010189 | 3300005329 | Bacteria | 8071 |
| 22 | Ga0070690_100132376 | 3300005330 | Bacteria | 1685 |
| 23 | Ga0070670_100007150 | 3300005331 | Bacteria | 9454 |
| 24 | Ga0070677_10166839 | 3300005333 | Unclassified | 1037 |
| 25 | Ga0068869_100010394 | 3300005334 | Bacteria | 6071 |
| 26 | Ga0068869_100086016 | 3300005334 | Bacteria | 2356 |
| 27 | Ga0068869_100401518 | 3300005334 | Bacteria | 1127 |
| 28 | Ga0070666_10010583 | 3300005335 | Bacteria | 5773 |
| 29 | Ga0070666_10013323 | 3300005335 | Bacteria | 5214 |
| 30 | Ga0070680_100196766 | 3300005336 | Bacteria | 1699 |
| 31 | Ga0070682_100092903 | 3300005337 | Bacteria | 1977 |
| 32 | Ga0070682_100587186 | 3300005337 | Bacteria | 877 |
| 33 | Ga0068868_100008166 | 3300005338 | Bacteria | 7489 |
| 34 | Ga0068868_100093373 | 3300005338 | Bacteria | 2426 |
| 35 | Ga0068868_100100076 | 3300005338 | Bacteria | 2345 |
| 36 | Ga0068868_100384807 | 3300005338 | Bacteria | 1208 |
| 37 | Ga0068868_100459952 | 3300005338 | Bacteria | 1108 |
| 38 | Ga0070660_100009321 | 3300005339 | Bacteria | 6897 |
| 39 | Ga0070689_100036687 | 3300005340 | Bacteria | 3749 |
| 40 | Ga0070691_10052211 | 3300005341 | Bacteria | 1955 |
| 41 | Ga0070687_100008433 | 3300005343 | Bacteria | 4366 |
| 42 | Ga0070661_100001784 | 3300005344 | Bacteria | 14921 |
| 43 | Ga0070661_100015246 | 3300005344 | Bacteria | 5424 |
| 44 | Ga0070661_100027302 | 3300005344 | Bacteria | 4109 |
| 45 | Ga0070692_10066722 | 3300005345 | Bacteria | 1908 |
| 46 | Ga0070668_100021287 | 3300005347 | Bacteria | 4902 |
| 47 | Ga0070668_100047594 | 3300005347 | Bacteria | 3297 |
| 48 | Ga0070668_100427857 | 3300005347 | Bacteria | 1134 |
| 49 | Ga0070669_100008906 | 3300005353 | Bacteria | 7160 |
| 50 | Ga0070669_100012442 | 3300005353 | Bacteria | 6038 |
| 51 | Ga0070669_100105105 | 3300005353 | Unclassified | 2136 |
| 52 | Ga0070669_100239770 | 3300005353 | Bacteria | 1440 |
| 53 | Ga0070675_100075159 | 3300005354 | Bacteria | 2808 |
| 54 | Ga0070671_100150162 | 3300005355 | Bacteria | 1967 |
| 55 | Ga0070671_100336129 | 3300005355 | Bacteria | 1288 |
| 56 | Ga0070674_100006091 | 3300005356 | Bacteria | 7013 |
| 57 | Ga0070673_100008201 | 3300005364 | Bacteria | 6933 |
| 58 | Ga0070688_100000910 | 3300005365 | Bacteria | 14779 |
| 59 | Ga0070659_100003912 | 3300005366 | Bacteria | 10600 |
| 60 | Ga0070659_100072123 | 3300005366 | Bacteria | 2747 |
| 61 | Ga0070667_100362381 | 3300005367 | Unclassified | 1314 |
| 62 | Ga0070667_100488729 | 3300005367 | Bacteria | 1127 |
| 63 | Ga0070709_10001126 | 3300005434 | Bacteria | 14761 |
| 64 | Ga0070709_10023770 | 3300005434 | Bacteria | 3603 |
| 65 | Ga0070709_10042726 | 3300005434 | Bacteria | 2800 |
| 66 | Ga0070709_10043810 | 3300005434 | Bacteria | 2769 |
| 67 | Ga0070709_10054944 | 3300005434 | Bacteria | 2512 |
| 68 | Ga0070709_10069348 | 3300005434 | Bacteria | 2270 |
| 69 | Ga0070709_10077159 | 3300005434 | Bacteria | 2165 |
| 70 | Ga0070709_10184316 | 3300005434 | Bacteria | 1468 |
| 71 | Ga0070709_10297676 | 3300005434 | Bacteria | 1177 |
| 72 | Ga0070709_10314946 | 3300005434 | Bacteria | 1147 |
| 73 | Ga0070709_10423770 | 3300005434 | Bacteria | 998 |
| 74 | Ga0070714_100004845 | 3300005435 | Bacteria | 10215 |
| 75 | Ga0070714_100027361 | 3300005435 | Bacteria | 4721 |
| 76 | Ga0070714_100065168 | 3300005435 | Bacteria | 3138 |
| 77 | Ga0070714_100079630 | 3300005435 | Unclassified | 2849 |
| 78 | Ga0070714_100086463 | 3300005435 | Bacteria | 2740 |
| 79 | Ga0070714_100296553 | 3300005435 | Bacteria | 1506 |
| 80 | Ga0070714_100394967 | 3300005435 | Bacteria | 1306 |
| 81 | Ga0070713_100000288 | 3300005436 | Bacteria | 33342 |
| 82 | Ga0070713_100000337 | 3300005436 | Bacteria | 30469 |
| 83 | Ga0070713_100009860 | 3300005436 | Bacteria | 6869 |
| 84 | Ga0070713_100016178 | 3300005436 | Bacteria | 5606 |
| 85 | Ga0070713_100025846 | 3300005436 | Bacteria | 4599 |
| 86 | Ga0070713_100060343 | 3300005436 | Bacteria | 3170 |
| 87 | Ga0070713_100061724 | 3300005436 | Bacteria | 3136 |
| 88 | Ga0070713_100098953 | 3300005436 | Bacteria | 2523 |
| 89 | Ga0070713_100171928 | 3300005436 | Bacteria | 1941 |
| 90 | Ga0070713_100436796 | 3300005436 | Bacteria | 1227 |
| 91 | Ga0070710_10023036 | 3300005437 | Bacteria | 3267 |
| 92 | Ga0070710_10035310 | 3300005437 | Bacteria | 2725 |
| 93 | Ga0070710_10043821 | 3300005437 | Bacteria | 2480 |
| 94 | Ga0070710_10143191 | 3300005437 | Bacteria | 1468 |
| 95 | Ga0070711_100000500 | 3300005439 | Bacteria | 20405 |
| 96 | Ga0070711_100001487 | 3300005439 | Bacteria | 12854 |
| 97 | Ga0070711_100010972 | 3300005439 | Bacteria | 5616 |
| 98 | Ga0070711_100018440 | 3300005439 | Bacteria | 4457 |
| 99 | Ga0070711_100057138 | 3300005439 | Bacteria | 2701 |
| 100 | Ga0070711_100162362 | 3300005439 | Bacteria | 1695 |
| 101 | Ga0070711_100263576 | 3300005439 | Unclassified | 1357 |
| 102 | Ga0070705_100005272 | 3300005440 | Bacteria | 6284 |
| 103 | Ga0070705_100015063 | 3300005440 | Unclassified | 3990 |
| 104 | Ga0070705_100163695 | 3300005440 | Bacteria | 1490 |
| 105 | Ga0070700_100398200 | 3300005441 | Unclassified | 1034 |
| 106 | Ga0070700_100556417 | 3300005441 | Bacteria | 892 |
| 107 | Ga0070694_100003742 | 3300005444 | Bacteria | 9070 |
| 108 | Ga0070708_100001706 | 3300005445 | Bacteria | 16894 |
| 109 | Ga0070708_100002037 | 3300005445 | Bacteria | 15565 |
| 110 | Ga0070708_100002957 | 3300005445 | Bacteria | 13208 |
| 111 | Ga0070708_100004925 | 3300005445 | Bacteria | 10556 |
| 112 | Ga0070708_100005336 | 3300005445 | Bacteria | 10192 |
| 113 | Ga0070708_100017864 | 3300005445 | Bacteria | 5925 |
| 114 | Ga0070708_100042813 | 3300005445 | Bacteria | 3977 |
| 115 | Ga0070708_100105507 | 3300005445 | Bacteria | 2585 |
| 116 | Ga0070708_100129685 | 3300005445 | Bacteria | 2333 |
| 117 | Ga0070708_100170989 | 3300005445 | Bacteria | 2029 |
| 118 | Ga0070708_100178221 | 3300005445 | Bacteria | 1986 |
| 119 | Ga0070708_100433358 | 3300005445 | Bacteria | 1240 |
| 120 | Ga0070708_100624857 | 3300005445 | Unclassified | 1015 |
| 121 | Ga0070663_100030211 | 3300005455 | Bacteria | 3710 |
| 122 | Ga0070663_100065306 | 3300005455 | Bacteria | 2633 |
| 123 | Ga0070678_100053113 | 3300005456 | Bacteria | 2945 |
| 124 | Ga0070678_100072169 | 3300005456 | Bacteria | 2587 |
| 125 | Ga0070662_100008948 | 3300005457 | Bacteria | 6527 |
| 126 | Ga0070662_100085562 | 3300005457 | Bacteria | 2356 |
| 127 | Ga0070681_10070592 | 3300005458 | Bacteria | 3458 |
| 128 | Ga0070681_10087553 | 3300005458 | Bacteria | 3067 |
| 129 | Ga0068867_100186233 | 3300005459 | Bacteria | 1653 |
| 130 | Ga0070685_10035425 | 3300005466 | Bacteria | 2815 |
| 131 | Ga0070685_10040781 | 3300005466 | Bacteria | 2643 |
| 132 | Ga0070706_100000296 | 3300005467 | Bacteria | 60457 |
| 133 | Ga0070706_100000932 | 3300005467 | Bacteria | 32006 |
| 134 | Ga0070706_100002114 | 3300005467 | Bacteria | 20233 |
| 135 | Ga0070706_100014539 | 3300005467 | Bacteria | 7271 |
| 136 | Ga0070706_100023186 | 3300005467 | Bacteria | 5716 |
| 137 | Ga0070706_100152958 | 3300005467 | Bacteria | 2154 |
| 138 | Ga0070706_100426572 | 3300005467 | Unclassified | 1234 |
| 139 | Ga0070707_100001241 | 3300005468 | Bacteria | 25060 |
| 140 | Ga0070707_100001443 | 3300005468 | Bacteria | 23285 |
| 141 | Ga0070707_100001725 | 3300005468 | Bacteria | 21065 |
| 142 | Ga0070707_100002355 | 3300005468 | Bacteria | 18020 |
| 143 | Ga0070707_100010925 | 3300005468 | Bacteria | 8455 |
| 144 | Ga0070707_100030471 | 3300005468 | Bacteria | 5136 |
| 145 | Ga0070707_100049951 | 3300005468 | Bacteria | 4010 |
| 146 | Ga0070707_100063143 | 3300005468 | Bacteria | 3554 |
| 147 | Ga0070707_100211655 | 3300005468 | Unclassified | 1889 |
| 148 | Ga0070707_100293911 | 3300005468 | Bacteria | 1578 |
| 149 | Ga0070707_100318879 | 3300005468 | Unclassified | 1510 |
| 150 | Ga0070707_100530548 | 3300005468 | Bacteria | 1139 |
| 151 | Ga0070698_100000216 | 3300005471 | Bacteria | 56257 |
| 152 | Ga0070698_100002588 | 3300005471 | Bacteria | 19927 |
| 153 | Ga0070698_100018741 | 3300005471 | Bacteria | 7286 |
| 154 | Ga0070698_100097904 | 3300005471 | Bacteria | 2909 |
| 155 | Ga0070698_100235556 | 3300005471 | Bacteria | 1764 |
| 156 | Ga0070699_100008001 | 3300005518 | Bacteria | 9177 |
| 157 | Ga0070699_100008691 | 3300005518 | Bacteria | 8804 |
| 158 | Ga0070699_100009732 | 3300005518 | Bacteria | 8318 |
| 159 | Ga0070699_100010748 | 3300005518 | Bacteria | 7921 |
| 160 | Ga0070699_100018934 | 3300005518 | Bacteria | 5920 |
| 161 | Ga0070699_100044932 | 3300005518 | Bacteria | 3823 |
| 162 | Ga0070699_100075835 | 3300005518 | Bacteria | 2927 |
| 163 | Ga0070679_100181479 | 3300005530 | Bacteria | 2077 |
| 164 | Ga0070679_100187431 | 3300005530 | Bacteria | 2039 |
| 165 | Ga0070684_100001397 | 3300005535 | Bacteria | 17367 |
| 166 | Ga0070684_100283435 | 3300005535 | Bacteria | 1518 |
| 167 | Ga0070697_100000107 | 3300005536 | Bacteria | 65460 |
| 168 | Ga0070697_100000323 | 3300005536 | Bacteria | 37824 |
| 169 | Ga0070697_100000611 | 3300005536 | Bacteria | 27144 |
| 170 | Ga0070697_100000763 | 3300005536 | Bacteria | 24081 |
| 171 | Ga0070697_100002752 | 3300005536 | Bacteria | 13543 |
| 172 | Ga0070697_100014974 | 3300005536 | Bacteria | 6087 |
| 173 | Ga0070697_100038842 | 3300005536 | Bacteria | 3847 |
| 174 | Ga0070697_100040738 | 3300005536 | Unclassified | 3759 |
| 175 | Ga0070697_100067672 | 3300005536 | Unclassified | 2922 |
| 176 | Ga0070697_100139586 | 3300005536 | Bacteria | 2037 |
| 177 | Ga0070697_100401483 | 3300005536 | Bacteria | 1189 |
| 178 | Ga0070697_100719130 | 3300005536 | Unclassified | 881 |
| 179 | Ga0068853_100003624 | 3300005539 | Bacteria | 11837 |
| 180 | Ga0068853_100142488 | 3300005539 | Bacteria | 2152 |
| 181 | Ga0070672_100034411 | 3300005543 | Bacteria | 3845 |
| 182 | Ga0070672_100471539 | 3300005543 | Unclassified | 1083 |
| 183 | Ga0070686_100058478 | 3300005544 | Bacteria | 2480 |
| 184 | Ga0070695_100001372 | 3300005545 | Bacteria | 13517 |
| 185 | Ga0070695_100466899 | 3300005545 | Bacteria | 970 |
| 186 | Ga0070696_100002958 | 3300005546 | Bacteria | 11289 |
| 187 | Ga0070693_100000001 | 3300005547 | Bacteria | 99999 |
| 188 | Ga0070693_100021929 | 3300005547 | Bacteria | 3390 |
| 189 | Ga0070665_100480320 | 3300005548 | Bacteria | 1253 |
| 190 | Ga0070704_100008835 | 3300005549 | Bacteria | 6062 |
| 191 | Ga0070704_100115375 | 3300005549 | Bacteria | 2052 |
| 192 | Ga0068855_100031873 | 3300005563 | Bacteria | 6292 |
| 193 | Ga0068855_100075178 | 3300005563 | Bacteria | 3923 |
| 194 | Ga0070664_100012643 | 3300005564 | Bacteria | 6872 |
| 195 | Ga0070664_100076512 | 3300005564 | Bacteria | 2876 |
| 196 | Ga0070664_100132710 | 3300005564 | Unclassified | 2188 |
| 197 | Ga0068857_100002065 | 3300005577 | Bacteria | 16305 |
| 198 | Ga0068857_100358750 | 3300005577 | Bacteria | 1351 |
| 199 | Ga0068854_100053478 | 3300005578 | Bacteria | 2900 |
| 200 | Ga0068856_100001015 | 3300005614 | Bacteria | 29886 |
| 201 | Ga0068856_100006280 | 3300005614 | Bacteria | 11664 |
| 202 | Ga0068856_100047049 | 3300005614 | Bacteria | 4249 |
| 203 | Ga0068856_100064563 | 3300005614 | Bacteria | 3617 |
| 204 | Ga0068856_100161806 | 3300005614 | Unclassified | 2249 |
| 205 | Ga0070702_100031119 | 3300005615 | Bacteria | 2917 |
| 206 | Ga0068852_100029318 | 3300005616 | Bacteria | 4520 |
| 207 | Ga0068852_100042599 | 3300005616 | Bacteria | 3843 |
| 208 | Ga0068852_100419446 | 3300005616 | Bacteria | 1320 |
| 209 | Ga0068859_100011010 | 3300005617 | Bacteria | 9102 |
| 210 | Ga0068859_100148779 | 3300005617 | Bacteria | 2417 |
| 211 | Ga0068864_100010381 | 3300005618 | Bacteria | 7691 |
| 212 | Ga0068866_10003477 | 3300005718 | Bacteria | 6454 |
| 213 | Ga0068861_100012817 | 3300005719 | Bacteria | 5854 |
| 214 | Ga0068861_100269233 | 3300005719 | Bacteria | 1462 |
| 215 | Ga0068861_100340948 | 3300005719 | Bacteria | 1311 |
| 216 | Ga0068851_10095666 | 3300005834 | Bacteria | 1569 |
| 217 | Ga0068870_10016325 | 3300005840 | Bacteria | 3544 |
| 218 | Ga0068863_100003555 | 3300005841 | Bacteria | 15375 |
| 219 | Ga0068863_100053582 | 3300005841 | Bacteria | 3824 |
| 220 | Ga0068863_100241051 | 3300005841 | Bacteria | 1745 |
| 221 | Ga0068858_100042478 | 3300005842 | Bacteria | 4216 |
| 222 | Ga0068858_100063009 | 3300005842 | Bacteria | 3430 |
| 223 | Ga0068858_100083628 | 3300005842 | Bacteria | 2968 |
| 224 | Ga0068858_100155011 | 3300005842 | Bacteria | 2155 |
| 225 | Ga0068860_100040319 | 3300005843 | Bacteria | 4463 |
| 226 | Ga0068860_100045429 | 3300005843 | Bacteria | 4188 |
| 227 | Ga0068860_100087435 | 3300005843 | Bacteria | 2967 |
| 228 | Ga0068860_100228588 | 3300005843 | Bacteria | 1808 |
| 229 | Ga0068860_100373403 | 3300005843 | Bacteria | 1407 |
| 230 | Ga0068862_100013927 | 3300005844 | Bacteria | 6665 |
| 231 | Ga0068862_100015353 | 3300005844 | Bacteria | 6362 |
| 232 | Ga0081540_1026900 | 3300005983 | Bacteria | 3272 |
| 233 | Ga0070717_10001935 | 3300006028 | Bacteria | 14457 |
| 234 | Ga0070717_10002004 | 3300006028 | Bacteria | 14238 |
| 235 | Ga0070717_10054234 | 3300006028 | Bacteria | 3306 |
| 236 | Ga0070717_10057448 | 3300006028 | Unclassified | 3216 |
| 237 | Ga0070717_10136928 | 3300006028 | Bacteria | 2109 |
| 238 | Ga0070717_10216146 | 3300006028 | Bacteria | 1683 |
| 239 | Ga0070717_10296437 | 3300006028 | Bacteria | 1437 |
| 240 | Ga0070717_10329596 | 3300006028 | Unclassified | 1361 |
| 241 | Ga0070717_10365439 | 3300006028 | Bacteria | 1292 |
| 242 | Ga0070717_10515908 | 3300006028 | Bacteria | 1081 |
| 243 | Ga0070715_10002927 | 3300006163 | Bacteria | 5334 |
| 244 | Ga0070715_10026565 | 3300006163 | Bacteria | 2305 |
| 245 | Ga0070715_10059162 | 3300006163 | Bacteria | 1675 |
| 246 | Ga0070715_10102667 | 3300006163 | Unclassified | 1336 |
| 247 | Ga0070715_10130814 | 3300006163 | Unclassified | 1208 |
| 248 | Ga0070716_100001978 | 3300006173 | Bacteria | 9329 |
| 249 | Ga0070716_100003006 | 3300006173 | Bacteria | 7862 |
| 250 | Ga0070716_100027682 | 3300006173 | Bacteria | 3048 |
| 251 | Ga0070716_100047599 | 3300006173 | Bacteria | 2420 |
| 252 | Ga0070716_100080416 | 3300006173 | Bacteria | 1943 |
| 253 | Ga0070716_100088714 | 3300006173 | Viruses | 1866 |
| 254 | Ga0070716_100138850 | 3300006173 | Unclassified | 1547 |
| 255 | Ga0070716_100201027 | 3300006173 | Bacteria | 1325 |
| 256 | Ga0070716_100244040 | 3300006173 | Unclassified | 1220 |
| 257 | Ga0070712_100000294 | 3300006175 | Bacteria | 28077 |
| 258 | Ga0070712_100000362 | 3300006175 | Bacteria | 25689 |
| 259 | Ga0070712_100001143 | 3300006175 | Bacteria | 16021 |
| 260 | Ga0070712_100003130 | 3300006175 | Bacteria | 10204 |
| 261 | Ga0070712_100004465 | 3300006175 | Bacteria | 8638 |
| 262 | Ga0070712_100010715 | 3300006175 | Bacteria | 5792 |
| 263 | Ga0070712_100085010 | 3300006175 | Unclassified | 2302 |
| 264 | Ga0070712_100086484 | 3300006175 | Bacteria | 2285 |
| 265 | Ga0070712_100259653 | 3300006175 | Bacteria | 1392 |
| 266 | Ga0097621_100001923 | 3300006237 | Bacteria | 14185 |
| 267 | Ga0097621_100004889 | 3300006237 | Bacteria | 9396 |
| 268 | Ga0097621_100112026 | 3300006237 | Bacteria | 2306 |
| 269 | Ga0097621_100341071 | 3300006237 | Bacteria | 1331 |
| 270 | Ga0097621_100497738 | 3300006237 | Unclassified | 1103 |
| 271 | Ga0068871_100000585 | 3300006358 | Bacteria | 25031 |
| 272 | Ga0068871_100001832 | 3300006358 | Bacteria | 14357 |
| 273 | Ga0068871_100068666 | 3300006358 | Bacteria | 2910 |
| 274 | Ga0075431_100243288 | 3300006847 | Bacteria | 1829 |
| 275 | Ga0075433_10000127 | 3300006852 | Bacteria | 38862 |
| 276 | Ga0075434_100002022 | 3300006871 | Bacteria | 17622 |
| 277 | Ga0075434_100002031 | 3300006871 | Bacteria | 17565 |
| 278 | Ga0075434_100287348 | 3300006871 | Bacteria | 1664 |
| 279 | Ga0068865_100067859 | 3300006881 | Bacteria | 2520 |
| 280 | Ga0068865_100120366 | 3300006881 | Bacteria | 1951 |
| 281 | Ga0068865_100135548 | 3300006881 | Bacteria | 1849 |
| 282 | Ga0075436_100009653 | 3300006914 | Bacteria | 6605 |
| 283 | Ga0075436_100010926 | 3300006914 | Bacteria | 6231 |
| 284 | Ga0075436_100012042 | 3300006914 | Bacteria | 5932 |
| 285 | Ga0075436_100207071 | 3300006914 | Bacteria | 1390 |
| 286 | Ga0097620_100011010 | 3300006931 | Bacteria | 9102 |
| 287 | Ga0097620_100148776 | 3300006931 | Bacteria | 2417 |
| 288 | Ga0075435_100002355 | 3300007076 | Bacteria | 12522 |
| 289 | Ga0075435_100057909 | 3300007076 | Bacteria | 3135 |
| 290 | Ga0075435_100082975 | 3300007076 | Bacteria | 2635 |
| 291 | Ga0075435_100252271 | 3300007076 | Bacteria | 1502 |
| 292 | Ga0075435_100375043 | 3300007076 | Unclassified | 1222 |
| 293 | Ga0099794_10036795 | 3300007265 | Unclassified | 2316 |
| 294 | Ga0099794_10072730 | 3300007265 | Bacteria | 1686 |
| 295 | Ga0099794_10082756 | 3300007265 | Bacteria | 1585 |
| 296 | Ga0099795_10143338 | 3300007788 | Bacteria | 973 |
| 297 | Ga0105240_10020055 | 3300009093 | Bacteria | 8925 |
| 298 | Ga0105240_10050694 | 3300009093 | Bacteria | 5231 |
| 299 | Ga0105240_10070878 | 3300009093 | Bacteria | 4310 |
| 300 | Ga0105240_10252699 | 3300009093 | Bacteria | 2038 |
| 301 | Ga0105245_10003303 | 3300009098 | Bacteria | 14477 |
| 302 | Ga0105245_10044643 | 3300009098 | Bacteria | 3957 |
| 303 | Ga0105245_10065521 | 3300009098 | Bacteria | 3285 |
| 304 | Ga0105245_10069228 | 3300009098 | Bacteria | 3199 |
| 305 | Ga0105245_10215335 | 3300009098 | Unclassified | 1851 |
| 306 | Ga0105245_10622713 | 3300009098 | Bacteria | 1107 |
| 307 | Ga0105247_10002514 | 3300009101 | Bacteria | 12457 |
| 308 | Ga0105247_10116424 | 3300009101 | Bacteria | 1726 |
| 309 | Ga0105243_10123851 | 3300009148 | Bacteria | 2184 |
| 310 | Ga0105243_10317126 | 3300009148 | Bacteria | 1419 |
| 311 | Ga0105241_10005963 | 3300009174 | Bacteria | 8986 |
| 312 | Ga0105241_10012514 | 3300009174 | Bacteria | 6222 |
| 313 | Ga0105241_10014118 | 3300009174 | Bacteria | 5852 |
| 314 | Ga0105241_10033772 | 3300009174 | Bacteria | 3841 |
| 315 | Ga0105241_10083990 | 3300009174 | Bacteria | 2499 |
| 316 | Ga0105242_10010108 | 3300009176 | Bacteria | 7227 |
| 317 | Ga0105242_10020852 | 3300009176 | Bacteria | 5141 |
| 318 | Ga0105242_10357790 | 3300009176 | Bacteria | 1350 |
| 319 | Ga0105242_10539025 | 3300009176 | Unclassified | 1117 |
| 320 | Ga0105242_10658394 | 3300009176 | Bacteria | 1019 |
| 321 | Ga0105248_10055473 | 3300009177 | Bacteria | 4444 |
| 322 | Ga0105248_10307263 | 3300009177 | Bacteria | 1786 |
| 323 | Ga0105237_10025863 | 3300009545 | Bacteria | 6000 |
| 324 | Ga0105237_10303716 | 3300009545 | Bacteria | 1599 |
| 325 | Ga0105238_10041250 | 3300009551 | Bacteria | 4675 |
| 326 | Ga0105238_10365038 | 3300009551 | Bacteria | 1434 |
| 327 | Ga0105249_10010157 | 3300009553 | Bacteria | 8264 |
| 328 | Ga0105249_10206326 | 3300009553 | Bacteria | 1926 |
| 329 | Ga0105249_10436169 | 3300009553 | Unclassified | 1346 |
| 330 | Ga0099796_10021618 | 3300010159 | Unclassified | 1984 |
| 331 | Ga0105239_10011628 | 3300010375 | Bacteria | 9821 |
| 332 | Ga0105239_10095866 | 3300010375 | Bacteria | 3277 |
| 333 | Ga0105239_10097004 | 3300010375 | Bacteria | 3258 |
| 334 | Ga0105239_10222264 | 3300010375 | Bacteria | 2118 |
| 335 | Ga0105239_10415774 | 3300010375 | Bacteria | 1523 |
| 336 | Ga0105239_10795267 | 3300010375 | Unclassified | 1084 |
| 337 | Ga0105246_10005537 | 3300011119 | Bacteria | 7705 |
| 338 | Ga0157373_10000999 | 3300013100 | Bacteria | 21871 |
| 339 | Ga0157373_10055493 | 3300013100 | Bacteria | 2814 |
| 340 | Ga0157371_10006244 | 3300013102 | Bacteria | 9876 |
| 341 | Ga0157371_10026617 | 3300013102 | Bacteria | 4202 |
| 342 | Ga0157370_10198099 | 3300013104 | Bacteria | 1864 |
| 343 | Ga0157369_10008080 | 3300013105 | Bacteria | 12066 |
| 344 | Ga0157369_10019009 | 3300013105 | Bacteria | 7695 |
| 345 | Ga0157369_10037339 | 3300013105 | Bacteria | 5318 |
| 346 | Ga0157374_10004927 | 3300013296 | Bacteria | 11201 |
| 347 | Ga0157374_10010242 | 3300013296 | Bacteria | 8062 |
| 348 | Ga0157374_10031823 | 3300013296 | Bacteria | 4798 |
| 349 | Ga0157374_10046709 | 3300013296 | Bacteria | 4012 |
| 350 | Ga0157374_10057507 | 3300013296 | Bacteria | 3632 |
| 351 | Ga0157374_10058005 | 3300013296 | Bacteria | 3618 |
| 352 | Ga0157378_10004197 | 3300013297 | Bacteria | 12719 |
| 353 | Ga0157378_10053690 | 3300013297 | Bacteria | 3588 |
| 354 | Ga0157378_10088945 | 3300013297 | Bacteria | 2804 |
| 355 | Ga0157378_10173859 | 3300013297 | Bacteria | 2022 |
| 356 | Ga0157378_10256000 | 3300013297 | Bacteria | 1677 |
| 357 | Ga0163162_10003513 | 3300013306 | Bacteria | 14987 |
| 358 | Ga0163162_10014579 | 3300013306 | Bacteria | 7680 |
| 359 | Ga0163162_10034770 | 3300013306 | Bacteria | 5017 |
| 360 | Ga0163162_10088319 | 3300013306 | Bacteria | 3179 |
| 361 | Ga0163162_10364211 | 3300013306 | Bacteria | 1579 |
| 362 | Ga0163162_10383135 | 3300013306 | Bacteria | 1539 |
| 363 | Ga0157372_10031314 | 3300013307 | Bacteria | 5824 |
| 364 | Ga0157372_10032538 | 3300013307 | Bacteria | 5720 |
| 365 | Ga0157372_10059140 | 3300013307 | Bacteria | 4286 |
| 366 | Ga0157372_10324347 | 3300013307 | Bacteria | 1793 |
| 367 | Ga0157372_11125864 | 3300013307 | Unclassified | 908 |
| 368 | Ga0157375_10040143 | 3300013308 | Bacteria | 4510 |
| 369 | Ga0157375_10093761 | 3300013308 | Bacteria | 3069 |
| 370 | Ga0163163_10009183 | 3300014325 | Bacteria | 8812 |
| 371 | Ga0163163_10099155 | 3300014325 | Bacteria | 2935 |
| 372 | Ga0163163_10168815 | 3300014325 | Bacteria | 2234 |
| 373 | Ga0157380_10159859 | 3300014326 | Bacteria | 1957 |
| 374 | Ga0157380_10429244 | 3300014326 | Unclassified | 1263 |
| 375 | Ga0182008_10016550 | 3300014497 | Bacteria | 3831 |
| 376 | Ga0182008_10112926 | 3300014497 | Unclassified | 1347 |
| 377 | Ga0157377_10002369 | 3300014745 | Bacteria | 8311 |
| 378 | Ga0157379_10001668 | 3300014968 | Bacteria | 18355 |
| 379 | Ga0157379_10070163 | 3300014968 | Bacteria | 3135 |
| 380 | Ga0157379_10097968 | 3300014968 | Bacteria | 2633 |
| 381 | Ga0157379_10195239 | 3300014968 | Bacteria | 1829 |
| 382 | Ga0157376_10000401 | 3300014969 | Bacteria | 28141 |
| 383 | Ga0157376_10024743 | 3300014969 | Bacteria | 4720 |
| 384 | Ga0157376_10034140 | 3300014969 | Bacteria | 4105 |
| 385 | Ga0157376_10043187 | 3300014969 | Bacteria | 3698 |
| 386 | Ga0157376_10057703 | 3300014969 | Bacteria | 3249 |
| 387 | Ga0182007_10003616 | 3300015262 | Bacteria | 7253 |
| 388 | Ga0182007_10030822 | 3300015262 | Bacteria | 1830 |
| 389 | Ga0182005_1009258 | 3300015265 | Bacteria | 2870 |
| 390 | Ga0182005_1040254 | 3300015265 | Unclassified | 1271 |
| 391 | Ga0163161_10011112 | 3300017792 | Bacteria | 6238 |
| 392 | Ga0224712_10138969 | 3300022467 | Bacteria | 1067 |
| 393 | Ga0224570_100191 | 3300022730 | Bacteria | 4305 |
| 394 | Ga0228598_1002872 | 3300024227 | Bacteria | 3740 |
| 395 | Ga0228598_1002972 | 3300024227 | Bacteria | 3680 |
| 396 | Ga0228598_1011729 | 3300024227 | Unclassified | 1743 |
| 397 | Ga0207697_10085734 | 3300025315 | Unclassified | 1331 |
| 398 | Ga0207656_10068759 | 3300025321 | Bacteria | 1570 |
| 399 | Ga0207653_10002603 | 3300025885 | Bacteria | 5729 |
| 400 | Ga0207692_10011393 | 3300025898 | Bacteria | 3783 |
| 401 | Ga0207692_10023131 | 3300025898 | Unclassified | 2870 |
| 402 | Ga0207692_10031772 | 3300025898 | Unclassified | 2531 |
| 403 | Ga0207692_10207397 | 3300025898 | Bacteria | 1155 |
| 404 | Ga0207642_10073539 | 3300025899 | Bacteria | 1635 |
| 405 | Ga0207642_10303456 | 3300025899 | Bacteria | 926 |
| 406 | Ga0207710_10120127 | 3300025900 | Bacteria | 1254 |
| 407 | Ga0207688_10002555 | 3300025901 | Bacteria | 9838 |
| 408 | Ga0207680_10028391 | 3300025903 | Bacteria | 3129 |
| 409 | Ga0207680_10079085 | 3300025903 | Bacteria | 2061 |
| 410 | Ga0207647_10023570 | 3300025904 | Bacteria | 4069 |
| 411 | Ga0207647_10217804 | 3300025904 | Bacteria | 1101 |
| 412 | Ga0207685_10010035 | 3300025905 | Bacteria | 2777 |
| 413 | Ga0207699_10000912 | 3300025906 | Bacteria | 14126 |
| 414 | Ga0207699_10003305 | 3300025906 | Bacteria | 7685 |
| 415 | Ga0207699_10031282 | 3300025906 | Bacteria | 2987 |
| 416 | Ga0207699_10038591 | 3300025906 | Bacteria | 2739 |
| 417 | Ga0207699_10104809 | 3300025906 | Bacteria | 1802 |
| 418 | Ga0207699_10117232 | 3300025906 | Unclassified | 1716 |
| 419 | Ga0207699_10126084 | 3300025906 | Bacteria | 1662 |
| 420 | Ga0207699_10162179 | 3300025906 | Bacteria | 1489 |
| 421 | Ga0207699_10171860 | 3300025906 | Bacteria | 1450 |
| 422 | Ga0207699_10187640 | 3300025906 | Unclassified | 1393 |
| 423 | Ga0207699_10246682 | 3300025906 | Bacteria | 1229 |
| 424 | Ga0207699_10251533 | 3300025906 | Bacteria | 1218 |
| 425 | Ga0207645_10001175 | 3300025907 | Bacteria | 21634 |
| 426 | Ga0207645_10043419 | 3300025907 | Bacteria | 2877 |
| 427 | Ga0207643_10000391 | 3300025908 | Bacteria | 29201 |
| 428 | Ga0207705_10173386 | 3300025909 | Bacteria | 1625 |
| 429 | Ga0207684_10001228 | 3300025910 | Bacteria | 28451 |
| 430 | Ga0207684_10001445 | 3300025910 | Bacteria | 25710 |
| 431 | Ga0207684_10001633 | 3300025910 | Bacteria | 23811 |
| 432 | Ga0207684_10019027 | 3300025910 | Bacteria | 5874 |
| 433 | Ga0207684_10030972 | 3300025910 | Bacteria | 4553 |
| 434 | Ga0207684_10066170 | 3300025910 | Bacteria | 3069 |
| 435 | Ga0207684_10089974 | 3300025910 | Bacteria | 2615 |
| 436 | Ga0207684_10105717 | 3300025910 | Bacteria | 2408 |
| 437 | Ga0207654_10012536 | 3300025911 | Bacteria | 4345 |
| 438 | Ga0207654_10016176 | 3300025911 | Bacteria | 3880 |
| 439 | Ga0207654_10035438 | 3300025911 | Bacteria | 2781 |
| 440 | Ga0207654_10092027 | 3300025911 | Unclassified | 1851 |
| 441 | Ga0207707_10007054 | 3300025912 | Bacteria | 9793 |
| 442 | Ga0207707_10024519 | 3300025912 | Bacteria | 5278 |
| 443 | Ga0207695_10055095 | 3300025913 | Bacteria | 4147 |
| 444 | Ga0207671_10010924 | 3300025914 | Bacteria | 7442 |
| 445 | Ga0207671_10349776 | 3300025914 | Unclassified | 1172 |
| 446 | Ga0207693_10000203 | 3300025915 | Bacteria | 54373 |
| 447 | Ga0207693_10000403 | 3300025915 | Bacteria | 39465 |
| 448 | Ga0207693_10000785 | 3300025915 | Bacteria | 28435 |
| 449 | Ga0207693_10001032 | 3300025915 | Bacteria | 24921 |
| 450 | Ga0207693_10001069 | 3300025915 | Bacteria | 24543 |
| 451 | Ga0207693_10019304 | 3300025915 | Bacteria | 5424 |
| 452 | Ga0207693_10025559 | 3300025915 | Bacteria | 4681 |
| 453 | Ga0207693_10032951 | 3300025915 | Bacteria | 4089 |
| 454 | Ga0207693_10044646 | 3300025915 | Bacteria | 3483 |
| 455 | Ga0207693_10093298 | 3300025915 | Bacteria | 2359 |
| 456 | Ga0207693_10124888 | 3300025915 | Bacteria | 2022 |
| 457 | Ga0207693_10144533 | 3300025915 | Bacteria | 1870 |
| 458 | Ga0207693_10254760 | 3300025915 | Bacteria | 1377 |
| 459 | Ga0207693_10309519 | 3300025915 | Unclassified | 1237 |
| 460 | Ga0207693_10337500 | 3300025915 | Unclassified | 1179 |
| 461 | Ga0207663_10003917 | 3300025916 | Bacteria | 7361 |
| 462 | Ga0207663_10132822 | 3300025916 | Bacteria | 1723 |
| 463 | Ga0207663_10145153 | 3300025916 | Viruses | 1658 |
| 464 | Ga0207663_10302620 | 3300025916 | Bacteria | 1195 |
| 465 | Ga0207663_10451122 | 3300025916 | Unclassified | 992 |
| 466 | Ga0207663_10485923 | 3300025916 | Unclassified | 957 |
| 467 | Ga0207662_10004876 | 3300025918 | Bacteria | 7097 |
| 468 | Ga0207657_10000404 | 3300025919 | Bacteria | 45859 |
| 469 | Ga0207657_10004616 | 3300025919 | Bacteria | 14554 |
| 470 | Ga0207657_10010530 | 3300025919 | Bacteria | 9220 |
| 471 | Ga0207649_10000250 | 3300025920 | Bacteria | 43495 |
| 472 | Ga0207649_10016637 | 3300025920 | Bacteria | 4152 |
| 473 | Ga0207649_10078855 | 3300025920 | Unclassified | 2126 |
| 474 | Ga0207652_10009055 | 3300025921 | Bacteria | 8018 |
| 475 | Ga0207646_10000094 | 3300025922 | Bacteria | 119406 |
| 476 | Ga0207646_10000448 | 3300025922 | Bacteria | 55023 |
| 477 | Ga0207646_10001233 | 3300025922 | Bacteria | 32128 |
| 478 | Ga0207646_10002176 | 3300025922 | Bacteria | 23366 |
| 479 | Ga0207646_10114528 | 3300025922 | Bacteria | 2421 |
| 480 | Ga0207646_10116148 | 3300025922 | Bacteria | 2404 |
| 481 | Ga0207646_10249834 | 3300025922 | Bacteria | 1602 |
| 482 | Ga0207646_10333431 | 3300025922 | Bacteria | 1370 |
| 483 | Ga0207646_10334726 | 3300025922 | Bacteria | 1367 |
| 484 | Ga0207646_10341771 | 3300025922 | Unclassified | 1352 |
| 485 | Ga0207646_10381264 | 3300025922 | Unclassified | 1274 |
| 486 | Ga0207681_10172452 | 3300025923 | Bacteria | 1640 |
| 487 | Ga0207694_10008362 | 3300025924 | Bacteria | 7821 |
| 488 | Ga0207694_10568934 | 3300025924 | Unclassified | 952 |
| 489 | Ga0207650_10000124 | 3300025925 | Bacteria | 97031 |
| 490 | Ga0207659_10024310 | 3300025926 | Bacteria | 4057 |
| 491 | Ga0207687_10007312 | 3300025927 | Bacteria | 7282 |
| 492 | Ga0207687_10010974 | 3300025927 | Bacteria | 5920 |
| 493 | Ga0207687_10013447 | 3300025927 | Bacteria | 5343 |
| 494 | Ga0207687_10058589 | 3300025927 | Bacteria | 2710 |
| 495 | Ga0207687_10205980 | 3300025927 | Bacteria | 1540 |
| 496 | Ga0207700_10000273 | 3300025928 | Bacteria | 30773 |
| 497 | Ga0207700_10001454 | 3300025928 | Bacteria | 13442 |
| 498 | Ga0207700_10006930 | 3300025928 | Bacteria | 6893 |
| 499 | Ga0207700_10028886 | 3300025928 | Bacteria | 3907 |
| 500 | Ga0207700_10040290 | 3300025928 | Bacteria | 3408 |
| 501 | Ga0207700_10068965 | 3300025928 | Bacteria | 2712 |
| 502 | Ga0207700_10135791 | 3300025928 | Bacteria | 2014 |
| 503 | Ga0207700_10188032 | 3300025928 | Bacteria | 1734 |
| 504 | Ga0207700_10230367 | 3300025928 | Bacteria | 1575 |
| 505 | Ga0207700_10322721 | 3300025928 | Bacteria | 1339 |
| 506 | Ga0207700_10341955 | 3300025928 | Unclassified | 1301 |
| 507 | Ga0207700_10613750 | 3300025928 | Unclassified | 968 |
| 508 | Ga0207664_10000369 | 3300025929 | Bacteria | 32894 |
| 509 | Ga0207664_10080165 | 3300025929 | Bacteria | 2653 |
| 510 | Ga0207664_10200784 | 3300025929 | Unclassified | 1721 |
| 511 | Ga0207664_10329448 | 3300025929 | Bacteria | 1348 |
| 512 | Ga0207664_10334779 | 3300025929 | Bacteria | 1337 |
| 513 | Ga0207644_10039951 | 3300025931 | Bacteria | 3313 |
| 514 | Ga0207644_10066456 | 3300025931 | Bacteria | 2626 |
| 515 | Ga0207690_10005284 | 3300025932 | Bacteria | 7613 |
| 516 | Ga0207690_10137741 | 3300025932 | Unclassified | 1794 |
| 517 | Ga0207690_10324936 | 3300025932 | Bacteria | 1210 |
| 518 | Ga0207706_10001777 | 3300025933 | Bacteria | 21179 |
| 519 | Ga0207706_10008223 | 3300025933 | Bacteria | 9624 |
| 520 | Ga0207706_10008485 | 3300025933 | Bacteria | 9479 |
| 521 | Ga0207686_10082092 | 3300025934 | Bacteria | 2106 |
| 522 | Ga0207709_10087310 | 3300025935 | Bacteria | 2027 |
| 523 | Ga0207709_10279611 | 3300025935 | Bacteria | 1232 |
| 524 | Ga0207704_10019298 | 3300025938 | Bacteria | 3577 |
| 525 | Ga0207704_10055013 | 3300025938 | Bacteria | 2429 |
| 526 | Ga0207704_10234449 | 3300025938 | Unclassified | 1367 |
| 527 | Ga0207665_10001294 | 3300025939 | Bacteria | 16910 |
| 528 | Ga0207665_10008417 | 3300025939 | Bacteria | 6799 |
| 529 | Ga0207665_10010607 | 3300025939 | Bacteria | 6053 |
| 530 | Ga0207665_10012403 | 3300025939 | Bacteria | 5598 |
| 531 | Ga0207665_10030144 | 3300025939 | Bacteria | 3586 |
| 532 | Ga0207665_10032978 | 3300025939 | Bacteria | 3431 |
| 533 | Ga0207665_10040931 | 3300025939 | Bacteria | 3093 |
| 534 | Ga0207665_10051398 | 3300025939 | Bacteria | 2774 |
| 535 | Ga0207665_10104034 | 3300025939 | Bacteria | 1986 |
| 536 | Ga0207665_10249062 | 3300025939 | Unclassified | 1312 |
| 537 | Ga0207691_10014213 | 3300025940 | Bacteria | 7594 |
| 538 | Ga0207711_10003212 | 3300025941 | Bacteria | 14235 |
| 539 | Ga0207711_10004172 | 3300025941 | Bacteria | 12371 |
| 540 | Ga0207689_10000941 | 3300025942 | Bacteria | 27968 |
| 541 | Ga0207689_10068438 | 3300025942 | Bacteria | 2918 |
| 542 | Ga0207661_10000779 | 3300025944 | Bacteria | 20737 |
| 543 | Ga0207679_10000084 | 3300025945 | Bacteria | 82946 |
| 544 | Ga0207667_10027636 | 3300025949 | Bacteria | 6172 |
| 545 | Ga0207667_10030517 | 3300025949 | Bacteria | 5831 |
| 546 | Ga0207667_10068942 | 3300025949 | Bacteria | 3681 |
| 547 | Ga0207651_10004758 | 3300025960 | Bacteria | 6897 |
| 548 | Ga0207712_10221258 | 3300025961 | Bacteria | 1514 |
| 549 | Ga0207712_10524201 | 3300025961 | Bacteria | 1016 |
| 550 | Ga0207668_10039947 | 3300025972 | Bacteria | 3162 |
| 551 | Ga0207668_10048448 | 3300025972 | Bacteria | 2916 |
| 552 | Ga0207658_10006671 | 3300025986 | Bacteria | 7864 |
| 553 | Ga0207658_10282300 | 3300025986 | Bacteria | 1424 |
| 554 | Ga0207677_10015304 | 3300026023 | Bacteria | 4506 |
| 555 | Ga0207677_10040265 | 3300026023 | Bacteria | 3079 |
| 556 | Ga0207677_10261112 | 3300026023 | Bacteria | 1412 |
| 557 | Ga0207677_10271512 | 3300026023 | Bacteria | 1387 |
| 558 | Ga0207677_10476014 | 3300026023 | Bacteria | 1075 |
| 559 | Ga0207703_10020087 | 3300026035 | Bacteria | 5221 |
| 560 | Ga0207703_10026768 | 3300026035 | Bacteria | 4543 |
| 561 | Ga0207703_10045781 | 3300026035 | Bacteria | 3520 |
| 562 | Ga0207703_10122979 | 3300026035 | Bacteria | 2230 |
| 563 | Ga0207703_10325737 | 3300026035 | Unclassified | 1408 |
| 564 | Ga0207639_10003861 | 3300026041 | Bacteria | 10095 |
| 565 | Ga0207678_10002403 | 3300026067 | Bacteria | 17014 |
| 566 | Ga0207678_10005424 | 3300026067 | Bacteria | 11419 |
| 567 | Ga0207678_10143568 | 3300026067 | Bacteria | 2037 |
| 568 | Ga0207702_10001068 | 3300026078 | Bacteria | 28056 |
| 569 | Ga0207702_10010995 | 3300026078 | Bacteria | 7550 |
| 570 | Ga0207702_10013997 | 3300026078 | Bacteria | 6664 |
| 571 | Ga0207702_10132573 | 3300026078 | Bacteria | 2244 |
| 572 | Ga0207702_10133845 | 3300026078 | Unclassified | 2234 |
| 573 | Ga0207702_10257217 | 3300026078 | Bacteria | 1642 |
| 574 | Ga0207641_10000006 | 3300026088 | Bacteria | 442569 |
| 575 | Ga0207641_10086038 | 3300026088 | Bacteria | 2740 |
| 576 | Ga0207641_10107691 | 3300026088 | Bacteria | 2465 |
| 577 | Ga0207641_10116420 | 3300026088 | Bacteria | 2378 |
| 578 | Ga0207641_10205821 | 3300026088 | Bacteria | 1817 |
| 579 | Ga0207648_10001425 | 3300026089 | Bacteria | 26347 |
| 580 | Ga0207648_10057077 | 3300026089 | Bacteria | 3407 |
| 581 | Ga0207648_10361443 | 3300026089 | Unclassified | 1310 |
| 582 | Ga0207676_10000615 | 3300026095 | Bacteria | 29142 |
| 583 | Ga0207674_10001059 | 3300026116 | Bacteria | 35825 |
| 584 | Ga0207674_10056122 | 3300026116 | Bacteria | 4001 |
| 585 | Ga0207674_10259686 | 3300026116 | Bacteria | 1684 |
| 586 | Ga0207675_100031140 | 3300026118 | Bacteria | 4968 |
| 587 | Ga0207675_100052899 | 3300026118 | Bacteria | 3789 |
| 588 | Ga0207675_100114665 | 3300026118 | Bacteria | 2545 |
| 589 | Ga0207675_100316514 | 3300026118 | Bacteria | 1523 |
| 590 | Ga0207683_10001543 | 3300026121 | Bacteria | 20762 |
| 591 | Ga0207683_10021577 | 3300026121 | Bacteria | 5517 |
| 592 | Ga0207698_10356147 | 3300026142 | Unclassified | 1384 |
| 593 | Ga0207698_10386754 | 3300026142 | Bacteria | 1333 |
| 594 | Ga0209179_1031632 | 3300027512 | Unclassified | 1087 |
| 595 | Ga0209588_1085885 | 3300027671 | Bacteria | 1015 |
| 596 | Ga0265356_1000828 | 3300028017 | Bacteria | 5130 |
| 597 | Ga0268266_10001591 | 3300028379 | Bacteria | 26491 |
| 598 | Ga0268265_10028554 | 3300028380 | Bacteria | 3995 |
| 599 | Ga0268265_10055937 | 3300028380 | Bacteria | 2999 |
| 600 | Ga0268264_10053361 | 3300028381 | Bacteria | 3372 |
| 601 | Ga0268264_10140080 | 3300028381 | Bacteria | 2156 |
| 602 | Ga0268264_10166095 | 3300028381 | Unclassified | 1992 |
| 603 | Ga0268264_10786517 | 3300028381 | Bacteria | 950 |
| 604 | Ga0265319_1002497 | 3300028563 | Bacteria | 9999 |
| 605 | Ga0265318_10000631 | 3300028577 | Bacteria | 24267 |
| 606 | Ga0265338_10001433 | 3300028800 | Bacteria | 38741 |
| 607 | Ga0265338_10070618 | 3300028800 | Bacteria | 2993 |
| 608 | Ga0265338_10099018 | 3300028800 | Bacteria | 2383 |
| 609 | Ga0265338_10110142 | 3300028800 | Bacteria | 2220 |
| 610 | Ga0265338_10194389 | 3300028800 | Bacteria | 1535 |
| 611 | Ga0265338_10308892 | 3300028800 | Bacteria | 1147 |
| 612 | Ga0265762_1000624 | 3300030760 | Bacteria | 6215 |
| 613 | Ga0265765_1014203 | 3300030879 | Bacteria | 917 |
| 614 | Ga0265760_10002488 | 3300031090 | Bacteria | 5376 |
| 615 | Ga0265760_10003500 | 3300031090 | Bacteria | 4557 |
| 616 | Ga0265760_10005087 | 3300031090 | Bacteria | 3763 |
| 617 | Ga0265760_10012659 | 3300031090 | Bacteria | 2414 |
| 618 | Ga0265760_10022295 | 3300031090 | Bacteria | 1835 |
| 619 | Ga0265760_10030148 | 3300031090 | Bacteria | 1596 |
| 620 | Ga0265760_10063078 | 3300031090 | Bacteria | 1128 |
| 621 | Ga0265760_10084121 | 3300031090 | Bacteria | 989 |
| 622 | Ga0265332_10003618 | 3300031238 | Bacteria | 7406 |
| 623 | Ga0265320_10000455 | 3300031240 | Bacteria | 32146 |
| 624 | Ga0265320_10162629 | 3300031240 | Bacteria | 1005 |
| 625 | Ga0265325_10020580 | 3300031241 | Bacteria | 3636 |
| 626 | Ga0265325_10027829 | 3300031241 | Unclassified | 3052 |
| 627 | Ga0265325_10045881 | 3300031241 | Bacteria | 2269 |
| 628 | Ga0265325_10055801 | 3300031241 | Unclassified | 2019 |
| 629 | Ga0265329_10003081 | 3300031242 | Bacteria | 7385 |
| 630 | Ga0265339_10005326 | 3300031249 | Bacteria | 8574 |
| 631 | Ga0265339_10036741 | 3300031249 | Bacteria | 2739 |
| 632 | Ga0265331_10000595 | 3300031250 | Bacteria | 32131 |
| 633 | Ga0265331_10004780 | 3300031250 | Bacteria | 8343 |
| 634 | Ga0265316_10003768 | 3300031344 | Bacteria | 15248 |
| 635 | Ga0265316_10007087 | 3300031344 | Bacteria | 10611 |
| 636 | Ga0265313_10002041 | 3300031595 | Bacteria | 18119 |
| 637 | Ga0265342_10002561 | 3300031712 | Bacteria | 15602 |
| 638 | Ga0265342_10121926 | 3300031712 | Unclassified | 1467 |
| 639 | Ga0373926_0004110 | 3300035083 | Bacteria | 4755 |
| 640 | Ga0373926_0010540 | 3300035083 | Bacteria | 3099 |
| 641 | Ga0373934_0007445 | 3300035086 | Bacteria | 4065 |
| 642 | Ga0373944_0032896 | 3300035089 | Unclassified | 1569 |
| 643 | Ga0373944_0040477 | 3300035089 | Bacteria | 1439 |
| 644 | Ga0373923_0021997 | 3300035111 | Bacteria | 2495 |
| 645 | Ga0373923_0091494 | 3300035111 | Bacteria | 1331 |
| 646 | Ga0373936_0001155 | 3300035113 | Bacteria | 9484 |
| 647 | Ga0373936_0009759 | 3300035113 | Bacteria | 3622 |
| 648 | Ga0373945_0012240 | 3300035116 | Bacteria | 2846 |
| 649 | Ga0373945_0023231 | 3300035116 | Bacteria | 2141 |
| 650 | Ga0373953_0044465 | 3300035117 | Bacteria | 1776 |
| 651 | Ga0373953_0055699 | 3300035117 | Bacteria | 1606 |
| 652 | Ga0373954_0000475 | 3300035118 | Bacteria | 15039 |
| 653 | Ga0373954_0056114 | 3300035118 | Unclassified | 1853 |
| 654 | Ga0373954_0057777 | 3300035118 | Bacteria | 1827 |
| 655 | Ga0373954_0181570 | 3300035118 | Unclassified | 1032 |
| 656 | Ga0373956_0019698 | 3300035119 | Bacteria | 2863 |
| 657 | Ga0373956_0076692 | 3300035119 | Bacteria | 1530 |
| 658 | Ga0373943_0000002 | 3300035170 | Bacteria | 106064 |
| 659 | Ga0373946_0015758 | 3300035171 | Bacteria | 2871 |
| 660 | Ga0373955_0005326 | 3300035172 | Bacteria | 5776 |
| 661 | Ga0373955_0036434 | 3300035172 | Bacteria | 2610 |
| 662 | Ga0373924_0010012 | 3300035410 | Bacteria | 3489 |
| 663 | Ga0373924_0166802 | 3300035410 | Bacteria | 967 |
| 664 | Ga0373931_0016703 | 3300035691 | Bacteria | 3617 |
| 665 | Ga0373935_0001381 | 3300035692 | Bacteria | 13419 |
| 666 | Ga0373935_0010991 | 3300035692 | Bacteria | 5437 |
| 667 | Ga0373935_0136942 | 3300035692 | Unclassified | 1650 |
| 668 | Ga0373935_0177923 | 3300035692 | Bacteria | 1459 |
| 669 | Ga0373935_0324011 | 3300035692 | Unclassified | 1094 |
| 670 | Ga0373927_0000021 | 3300035695 | Bacteria | 124647 |
| 671 | Ga0373927_0041629 | 3300035695 | Unclassified | 2979 |
| 672 | Ga0373927_0142778 | 3300035695 | Bacteria | 1567 |
| 673 | Ga0373927_0282885 | 3300035695 | Bacteria | 1091 |
| 674 | Ga0373933_0000280 | 3300035724 | Bacteria | 33213 |
| 675 | Ga0373933_0028973 | 3300035724 | Bacteria | 3198 |
| 676 | Ga0373933_0064525 | 3300035724 | Bacteria | 2216 |
| 677 | Ga0373933_0080129 | 3300035724 | Unclassified | 2001 |
| 678 | Ga0373933_0108872 | 3300035724 | Bacteria | 1726 |
| 679 | Ga0373933_0219853 | 3300035724 | Bacteria | 1218 |
| 680 | Ga0373933_0330395 | 3300035724 | Bacteria | 989 |
| 681 | Ga0373937_0000932 | 3300036401 | Bacteria | 24796 |
| 682 | Ga0373937_0024674 | 3300036401 | Unclassified | 5425 |
| 683 | Ga0373937_0119670 | 3300036401 | Bacteria | 2454 |
| 684 | Ga0373937_0150777 | 3300036401 | Bacteria | 2178 |
| 685 | Ga0373937_0235436 | 3300036401 | Bacteria | 1725 |
| 686 | Ga0373937_0241157 | 3300036401 | Unclassified | 1703 |
| 687 | Ga0373925_0000151 | 3300037068 | Bacteria | 74246 |
| 688 | Ga0373925_0009744 | 3300037068 | Bacteria | 6979 |
| 689 | Ga0373925_0045837 | 3300037068 | Bacteria | 3249 |
| 690 | Ga0373925_0191216 | 3300037068 | Unclassified | 1624 |
| 691 | Ga0436360_0858745 | 3300039438 | Bacteria | 1787 |
| 692 | Ga0436361_0659691 | 3300039447 | Unclassified | 936 |
| 693 | Ga0436363_0566584 | 3300039450 | Bacteria | 2180 |
| 694 | Ga0436362_0103387 | 3300039453 | Bacteria | 6861 |
| 695 | Ga0451577_0260137 | 3300042876 | Bacteria | 1571 |
| 696 | Ga0453683_0055958 | 3300044673 | Bacteria | 2468 |
| 697 | Ga0453683_0066415 | 3300044673 | Bacteria | 2255 |
| 698 | Ga0453683_0090258 | 3300044673 | Bacteria | 1921 |
| 699 | Ga0466964_0174513 | 3300044706 | Bacteria | 1015 |
| 700 | Ga0453684_0059043 | 3300044712 | Bacteria | 4950 |
| 701 | Ga0453684_0339921 | 3300044712 | Unclassified | 1695 |
| 702 | Ga0453684_0604923 | 3300044712 | Unclassified | 1201 |
| 703 | Ga0451576_0003971 | 3300045051 | Bacteria | 19690 |
| 704 | Ga0495592_0021650 | 3300046454 | Bacteria | 4890 |
| 705 | Ga0495603_0038257 | 3300046455 | Bacteria | 2878 |
| 706 | Ga0495603_0091191 | 3300046455 | Bacteria | 1782 |
| 707 | Ga0495629_0026960 | 3300046459 | Bacteria | 4081 |
| 708 | Ga0495641_0037034 | 3300046461 | Bacteria | 2289 |
| 709 | Ga0495651_0000054 | 3300046462 | Bacteria | 84657 |
| 710 | Ga0495651_0002146 | 3300046462 | Bacteria | 15270 |
| 711 | Ga0495651_0032478 | 3300046462 | Unclassified | 4071 |
| 712 | Ga0495653_0029417 | 3300046463 | Bacteria | 4385 |
| 713 | Ga0495653_0094584 | 3300046463 | Bacteria | 2177 |
| 714 | Ga0495580_0000563 | 3300046472 | Bacteria | 31329 |
| 715 | Ga0495580_0001399 | 3300046472 | Bacteria | 21176 |
| 716 | Ga0495580_0002731 | 3300046472 | Bacteria | 15225 |
| 717 | Ga0495580_0003063 | 3300046472 | Bacteria | 14321 |
| 718 | Ga0495580_0003320 | 3300046472 | Bacteria | 13762 |
| 719 | Ga0495580_0004951 | 3300046472 | Bacteria | 11136 |
| 720 | Ga0495580_0058244 | 3300046472 | Bacteria | 2717 |
| 721 | Ga0495580_0200681 | 3300046472 | Unclassified | 1374 |
| 722 | Ga0495580_0201207 | 3300046472 | Bacteria | 1372 |
| 723 | Ga0495580_0209213 | 3300046472 | Bacteria | 1342 |
| 724 | Ga0495580_0264250 | 3300046472 | Bacteria | 1176 |
| 725 | Ga0495580_0269492 | 3300046472 | Unclassified | 1163 |
| 726 | Ga0495580_0386217 | 3300046472 | Bacteria | 945 |
| 727 | Ga0495582_0000306 | 3300046473 | Bacteria | 27098 |
| 728 | Ga0495582_0000740 | 3300046473 | Bacteria | 18038 |
| 729 | Ga0495582_0229225 | 3300046473 | Unclassified | 1063 |
| 730 | Ga0495639_0032047 | 3300046475 | Bacteria | 2343 |
| 731 | Ga0495664_0002060 | 3300046477 | Bacteria | 10749 |
| 732 | Ga0495664_0003944 | 3300046477 | Bacteria | 8098 |
| 733 | Ga0495664_0042197 | 3300046477 | Bacteria | 2701 |
| 734 | Ga0495584_0030969 | 3300046491 | Bacteria | 2708 |
| 735 | Ga0495594_0046273 | 3300046499 | Bacteria | 2389 |
| 736 | Ga0495608_0018800 | 3300046511 | Bacteria | 4761 |
| 737 | Ga0495608_0060570 | 3300046511 | Bacteria | 2490 |
| 738 | Ga0495608_0328837 | 3300046511 | Unclassified | 943 |
| 739 | Ga0495618_0031337 | 3300046514 | Bacteria | 3326 |
| 740 | Ga0495628_0003238 | 3300046516 | Bacteria | 14588 |
| 741 | Ga0495628_0009659 | 3300046516 | Bacteria | 8232 |
| 742 | Ga0495628_0027924 | 3300046516 | Bacteria | 4588 |
| 743 | Ga0495630_0003146 | 3300046517 | Bacteria | 11452 |
| 744 | Ga0495630_0039085 | 3300046517 | Bacteria | 3549 |
| 745 | Ga0495630_0040152 | 3300046517 | Bacteria | 3497 |
| 746 | Ga0495630_0140891 | 3300046517 | Unclassified | 1833 |
| 747 | Ga0495630_0362822 | 3300046517 | Bacteria | 1109 |
| 748 | Ga0495666_0135523 | 3300046526 | Unclassified | 1149 |
| 749 | Ga0495652_0002907 | 3300046529 | Bacteria | 17246 |
| 750 | Ga0495652_0008532 | 3300046529 | Bacteria | 9346 |
| 751 | Ga0495665_0002907 | 3300046531 | Bacteria | 9255 |
| 752 | Ga0495665_0034697 | 3300046531 | Bacteria | 2698 |
| 753 | Ga0495640_0055945 | 3300046533 | Bacteria | 2697 |
| 754 | Ga0495640_0197847 | 3300046533 | Bacteria | 1275 |
| 755 | Ga0495586_0003372 | 3300046535 | Bacteria | 8566 |
| 756 | Ga0495586_0043098 | 3300046535 | Bacteria | 2431 |
| 757 | Ga0495586_0126804 | 3300046535 | Unclassified | 1428 |
| 758 | Ga0495586_0272271 | 3300046535 | Unclassified | 968 |
| 759 | Ga0495587_0001030 | 3300046536 | Bacteria | 18342 |
| 760 | Ga0495587_0002156 | 3300046536 | Bacteria | 13169 |
| 761 | Ga0495587_0015903 | 3300046536 | Bacteria | 4686 |
| 762 | Ga0495645_0076199 | 3300046543 | Bacteria | 2414 |
| 763 | Ga0495645_0216502 | 3300046543 | Unclassified | 1290 |
| 764 | Ga0495667_0039968 | 3300046559 | Bacteria | 3116 |
| 765 | Ga0495634_0078523 | 3300046642 | Bacteria | 2162 |
| 766 | Ga0495635_0014674 | 3300046663 | Bacteria | 5480 |
| 767 | Ga0495635_0073044 | 3300046663 | Bacteria | 2350 |
| 768 | Ga0495657_0005949 | 3300046675 | Bacteria | 9582 |
| 769 | Ga0495657_0027886 | 3300046675 | Bacteria | 3977 |
| 770 | Ga0495657_0036310 | 3300046675 | Unclassified | 3406 |
| 771 | Ga0495599_0038108 | 3300046678 | Bacteria | 3020 |
| 772 | Ga0495599_0225409 | 3300046678 | Unclassified | 1146 |
| 773 | Ga0495623_0001870 | 3300046679 | Bacteria | 14119 |
| 774 | Ga0495623_0052150 | 3300046679 | Unclassified | 2586 |
| 775 | Ga0495646_0004619 | 3300046680 | Bacteria | 8670 |
| 776 | Ga0495646_0038890 | 3300046680 | Unclassified | 2935 |
| 777 | Ga0495647_0006318 | 3300046681 | Bacteria | 3918 |
| 778 | Ga0495647_0066614 | 3300046681 | Bacteria | 1433 |
| 779 | Ga0495658_0019002 | 3300046683 | Bacteria | 3581 |
| 780 | Ga0495669_0152987 | 3300046684 | Bacteria | 1093 |
| 781 | Ga0495613_0015136 | 3300046689 | Bacteria | 5730 |
| 782 | Ga0495613_0199028 | 3300046689 | Bacteria | 1413 |
| 783 | Ga0495624_0043783 | 3300046690 | Bacteria | 2854 |
| 784 | Ga0495624_0071534 | 3300046690 | Bacteria | 2158 |
| 785 | Ga0495624_0151092 | 3300046690 | Bacteria | 1421 |
| 786 | Ga0495600_0002114 | 3300046809 | Bacteria | 11241 |
| 787 | Ga0495600_0016996 | 3300046809 | Bacteria | 4625 |
| 788 | Ga0495600_0152441 | 3300046809 | Unclassified | 1496 |
| 789 | Ga0495604_0002567 | 3300047317 | Bacteria | 14531 |
| 790 | Ga0495604_0003548 | 3300047317 | Bacteria | 12445 |
| 791 | Ga0495604_0003740 | 3300047317 | Bacteria | 12121 |
| 792 | Ga0495604_0015361 | 3300047317 | Bacteria | 6110 |
| 793 | Ga0495674_0010839 | 3300047319 | Bacteria | 8621 |
| 794 | Ga0495674_0015134 | 3300047319 | Bacteria | 7215 |
| 795 | Ga0495674_0021593 | 3300047319 | Bacteria | 5952 |
| 796 | Ga0495674_0060767 | 3300047319 | Bacteria | 3296 |
| 797 | Ga0495674_0291614 | 3300047319 | Bacteria | 1334 |
| 798 | Ga0495674_0311434 | 3300047319 | Unclassified | 1284 |
| 799 | Ga0495676_0037314 | 3300047321 | Bacteria | 4046 |
| 800 | Ga0495676_0072551 | 3300047321 | Bacteria | 2643 |
| 801 | Ga0495680_0000034 | 3300047322 | Bacteria | 107708 |
| 802 | Ga0495680_0053832 | 3300047322 | Bacteria | 3129 |
| 803 | Ga0495680_0281645 | 3300047322 | Bacteria | 1171 |
| 804 | Ga0495675_0000165 | 3300047444 | Bacteria | 47340 |
| 805 | Ga0495675_0028779 | 3300047444 | Bacteria | 3541 |
| 806 | Ga0495684_0001335 | 3300047471 | Bacteria | 19857 |
| 807 | Ga0495684_0005485 | 3300047471 | Bacteria | 9873 |
| 808 | Ga0495684_0015457 | 3300047471 | Bacteria | 5873 |
| 809 | Ga0495684_0055020 | 3300047471 | Unclassified | 3035 |
| 810 | Ga0495593_0018017 | 3300047673 | Bacteria | 3972 |
| 811 | Ga0495593_0117137 | 3300047673 | Bacteria | 1357 |
| 812 | Ga0495602_0005726 | 3300048088 | Bacteria | 13034 |
| 813 | Ga0495602_0006658 | 3300048088 | Bacteria | 12110 |
| 814 | Ga0495602_0162949 | 3300048088 | Bacteria | 1739 |
| 815 | Ga0495614_0000713 | 3300048089 | Bacteria | 14018 |
| 816 | Ga0495614_0046936 | 3300048089 | Bacteria | 1852 |
| 817 | Ga0496100_0053817 | 3300048903 | Bacteria | 2622 |
| 818 | Ga0496100_0185522 | 3300048903 | Bacteria | 1507 |
| 819 | Ga0496101_0347876 | 3300048904 | Bacteria | 1165 |
| 820 | Ga0496102_0008775 | 3300048905 | Bacteria | 8669 |
| 821 | Ga0496102_0010411 | 3300048905 | Bacteria | 8002 |
| 822 | Ga0496102_0058594 | 3300048905 | Bacteria | 3519 |
| 823 | Ga0496102_0066826 | 3300048905 | Bacteria | 3296 |
| 824 | Ga0496103_0005654 | 3300048906 | Bacteria | 7472 |
| 825 | Ga0496103_0141251 | 3300048906 | Bacteria | 1540 |
| 826 | Ga0496104_0048492 | 3300048907 | Bacteria | 4004 |
| 827 | Ga0496104_0104969 | 3300048907 | Bacteria | 2707 |
| 828 | Ga0496104_0205488 | 3300048907 | Unclassified | 1881 |
| 829 | Ga0496105_0067714 | 3300048908 | Bacteria | 2948 |
| 830 | Ga0496105_0132881 | 3300048908 | Bacteria | 2051 |
| 831 | Ga0496105_0465079 | 3300048908 | Bacteria | 997 |
| 832 | Ga0496106_0035673 | 3300048909 | Bacteria | 3719 |
| 833 | Ga0496106_0042053 | 3300048909 | Bacteria | 3426 |
| 834 | Ga0496107_0121540 | 3300048910 | Bacteria | 1924 |
| 835 | Ga0496108_0000200 | 3300048911 | Bacteria | 55323 |
| 836 | Ga0496109_0000149 | 3300048912 | Bacteria | 68979 |
| 837 | Ga0496109_0029141 | 3300048912 | Bacteria | 4942 |
| 838 | Ga0496109_0409261 | 3300048912 | Unclassified | 1282 |
| 839 | Ga0496109_0531914 | 3300048912 | Bacteria | 1109 |
| 840 | Ga0496110_0011543 | 3300048913 | Bacteria | 7237 |
| 841 | Ga0496110_0014791 | 3300048913 | Bacteria | 6484 |
| 842 | Ga0496111_0301695 | 3300048914 | Bacteria | 1187 |
| 843 | Ga0496112_0000070 | 3300048915 | Bacteria | 67934 |
| 844 | Ga0496112_0006513 | 3300048915 | Bacteria | 10267 |
| 845 | Ga0496112_0071705 | 3300048915 | Bacteria | 3423 |
| 846 | Ga0496112_0106853 | 3300048915 | Bacteria | 2769 |
| 847 | Ga0496112_0162547 | 3300048915 | Bacteria | 2199 |
| 848 | Ga0496112_0178419 | 3300048915 | Bacteria | 2088 |
| 849 | Ga0496113_0000078 | 3300048916 | Bacteria | 42516 |
| 850 | Ga0496113_0230420 | 3300048916 | Bacteria | 1477 |
| 851 | Ga0496114_0033519 | 3300048917 | Bacteria | 4232 |
| 852 | Ga0496114_0341019 | 3300048917 | Bacteria | 1325 |
| 853 | Ga0496115_0008082 | 3300048918 | Bacteria | 7772 |
| 854 | Ga0496115_0016864 | 3300048918 | Bacteria | 5570 |
| 855 | Ga0496115_0047127 | 3300048918 | Bacteria | 3446 |
| 856 | Ga0501067_0113626 | 3300049583 | Unclassified | 1506 |
| 857 | Ga0501083_0050669 | 3300049744 | Bacteria | 2794 |
| 858 | nmdc:mga06r32_362577_c1 | 3300050510 | Bacteria | 1433 |
| 859 | nmdc:mga0n895_492038_c1 | 3300050512 | Unclassified | 1236 |
| 860 | nmdc:mga0n895_65637_c1 | 3300050512 | Bacteria | 3593 |
| 861 | nmdc:mga0n895_672_c1 | 3300050512 | Bacteria | 23989 |
| 862 | nmdc:mga0n895_913246_c1 | 3300050512 | Bacteria | 863 |
| 863 | nmdc:mga0n895_926_c1 | 3300050512 | Bacteria | 21152 |
| 864 | nmdc:mga0rr50_108950_c1 | 3300050513 | Bacteria | 2189 |
| 865 | nmdc:mga0rr50_123532_c1 | 3300050513 | Bacteria | 2064 |
| 866 | nmdc:mga0rr50_23863_c1 | 3300050513 | Bacteria | 4228 |
| 867 | nmdc:mga0rr50_287554_c1 | 3300050513 | Unclassified | 1373 |
| 868 | nmdc:mga0rr50_7147_c1 | 3300050513 | Bacteria | 6859 |
| 869 | nmdc:mga08x19_14262_c1 | 3300050514 | Bacteria | 4818 |
| 870 | nmdc:mga08x19_183681_c1 | 3300050514 | Bacteria | 1428 |
| 871 | nmdc:mga08x19_183807_c1 | 3300050514 | Bacteria | 1428 |
| 872 | nmdc:mga08x19_24657_c1 | 3300050514 | Bacteria | 3742 |
| 873 | nmdc:mga08x19_3079_c1 | 3300050514 | Bacteria | 10022 |
| 874 | nmdc:mga08x19_3287_c1 | 3300050514 | Bacteria | 9664 |
| 875 | nmdc:mga08x19_4596_c1 | 3300050514 | Bacteria | 8195 |
| 876 | nmdc:mga0a205_149_c2 | 3300050515 | Bacteria | 33259 |
| 877 | nmdc:mga0a205_8215_c2 | 3300050515 | Bacteria | 5363 |
| 878 | Ga0495601_0095488 | 3300053077 | Bacteria | 1917 |
| 879 | Ga0495612_0001441 | 3300053078 | Bacteria | 9788 |
| 880 | Ga0495612_0118616 | 3300053078 | Bacteria | 1137 |
| 881 | Ga0495619_0055893 | 3300053085 | Bacteria | 2616 |
| 882 | Ga0495619_0100376 | 3300053085 | Bacteria | 1969 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046681 | Ga0495647_0066614 | Ga0495647_0066614_737_1399 | 219 |
| 2 | 3300048908 | Ga0496105_0465079 | Ga0496105_0465079_316_978 | 220 |
| 3 | 3300048912 | Ga0496109_0531914 | Ga0496109_0531914_55_726 | 223 |
| 4 | 3300025906 | Ga0207699_10031282 | Ga0207699_100312823 | 229 |
| 5 | 3300026089 | Ga0207648_10361443 | Ga0207648_103614432 | 231 |
| 6 | 3300005439 | Ga0070711_100162362 | Ga0070711_1001623621 | 236 |
| 7 | 3300005440 | Ga0070705_100163695 | Ga0070705_1001636952 | 237 |
| 8 | 3300005468 | Ga0070707_100049951 | Ga0070707_1000499512 | 237 |
| 9 | 3300005841 | Ga0068863_100003555 | Ga0068863_1000035552 | 237 |
| 10 | 3300005842 | Ga0068858_100042478 | Ga0068858_1000424782 | 237 |
| 11 | 3300006173 | Ga0070716_100047599 | Ga0070716_1000475994 | 237 |
| 12 | 3300009553 | Ga0105249_10206326 | Ga0105249_102063262 | 237 |
| 13 | 3300010375 | Ga0105239_10415774 | Ga0105239_104157742 | 237 |
| 14 | 3300025922 | Ga0207646_10334726 | Ga0207646_103347262 | 237 |
| 15 | 3300026035 | Ga0207703_10026768 | Ga0207703_100267685 | 237 |
| 16 | 3300026088 | Ga0207641_10107691 | Ga0207641_101076913 | 237 |
| 17 | 3300046455 | Ga0495603_0091191 | Ga0495603_0091191_35_763 | 241 |
| 18 | 3300006173 | Ga0070716_100001978 | Ga0070716_1000019783 | 242 |
| 19 | 3300025939 | Ga0207665_10001294 | Ga0207665_100012946 | 242 |
| 20 | 3300046809 | Ga0495600_0152441 | Ga0495600_0152441_162_968 | 242 |
| 21 | 3300050514 | nmdc:mga08x19_183807_c1 | nmdc:mga08x19_183807_c1_59_865 | 242 |
| 22 | 3300007076 | Ga0075435_100082975 | Ga0075435_1000829753 | 243 |
| 23 | 3300050513 | nmdc:mga0rr50_123532_c1 | nmdc:mga0rr50_123532_c1_1227_2033 | 243 |
| 24 | 3300050514 | nmdc:mga08x19_183681_c1 | nmdc:mga08x19_183681_c1_413_1219 | 243 |
| 25 | 3300027512 | Ga0209179_1031632 | Ga0209179_10316321 | 245 |
| 26 | 3300005435 | Ga0070714_100065168 | Ga0070714_1000651683 | 246 |
| 27 | 3300005436 | Ga0070713_100009860 | Ga0070713_1000098602 | 246 |
| 28 | 3300005545 | Ga0070695_100466899 | Ga0070695_1004668991 | 246 |
| 29 | 3300006028 | Ga0070717_10136928 | Ga0070717_101369282 | 246 |
| 30 | 3300025928 | Ga0207700_10068965 | Ga0207700_100689652 | 246 |
| 31 | 3300005468 | Ga0070707_100211655 | Ga0070707_1002116552 | 247 |
| 32 | 3300025915 | Ga0207693_10309519 | Ga0207693_103095192 | 249 |
| 33 | 3300006871 | Ga0075434_100287348 | Ga0075434_1002873481 | 251 |
| 34 | 3300046455 | Ga0495603_0038257 | Ga0495603_0038257_1929_2735 | 251 |
| 35 | 3300046472 | Ga0495580_0000563 | Ga0495580_0000563_28902_29708 | 251 |
| 36 | 3300046472 | Ga0495580_0058244 | Ga0495580_0058244_510_1316 | 251 |
| 37 | 3300046473 | Ga0495582_0000306 | Ga0495582_0000306_24264_25070 | 251 |
| 38 | 3300050512 | nmdc:mga0n895_65637_c1 | nmdc:mga0n895_65637_c1_1284_2090 | 251 |
| 39 | 3300005434 | Ga0070709_10314946 | Ga0070709_103149461 | 252 |
| 40 | 3300005436 | Ga0070713_100016178 | Ga0070713_1000161786 | 252 |
| 41 | 3300005439 | Ga0070711_100263576 | Ga0070711_1002635762 | 252 |
| 42 | 3300025906 | Ga0207699_10171860 | Ga0207699_101718602 | 252 |
| 43 | 3300025928 | Ga0207700_10028886 | Ga0207700_100288864 | 252 |
| 44 | 3300028381 | Ga0268264_10786517 | Ga0268264_107865171 | 253 |
| 45 | 3300046462 | Ga0495651_0000054 | Ga0495651_0000054_64078_64839 | 253 |
| 46 | 3300046463 | Ga0495653_0094584 | Ga0495653_0094584_801_1562 | 253 |
| 47 | 3300046472 | Ga0495580_0269492 | Ga0495580_0269492_248_1009 | 253 |
| 48 | 3300046511 | Ga0495608_0328837 | Ga0495608_0328837_93_854 | 253 |
| 49 | 3300046517 | Ga0495630_0003146 | Ga0495630_0003146_10358_11119 | 253 |
| 50 | 3300046559 | Ga0495667_0039968 | Ga0495667_0039968_791_1552 | 253 |
| 51 | 3300046809 | Ga0495600_0016996 | Ga0495600_0016996_2614_3375 | 253 |
| 52 | 3300047319 | Ga0495674_0021593 | Ga0495674_0021593_4232_4993 | 253 |
| 53 | 3300047322 | Ga0495680_0000034 | Ga0495680_0000034_1193_1954 | 253 |
| 54 | 3300047444 | Ga0495675_0028779 | Ga0495675_0028779_2289_3050 | 253 |
| 55 | 3300025910 | Ga0207684_10019027 | Ga0207684_100190272 | 254 |
| 56 | 3300042876 | Ga0451577_0260137 | Ga0451577_0260137_41_808 | 255 |
| 57 | 3300046472 | Ga0495580_0201207 | Ga0495580_0201207_361_1167 | 261 |
| 58 | 3300005445 | Ga0070708_100624857 | Ga0070708_1006248571 | 262 |
| 59 | 3300031090 | Ga0265760_10063078 | Ga0265760_100630782 | 262 |
| 60 | 3300005843 | Ga0068860_100373403 | Ga0068860_1003734031 | 263 |
| 61 | 3300006175 | Ga0070712_100085010 | Ga0070712_1000850103 | 263 |
| 62 | 3300007265 | Ga0099794_10082756 | Ga0099794_100827562 | 263 |
| 63 | 3300013297 | Ga0157378_10088945 | Ga0157378_100889453 | 263 |
| 64 | 3300025915 | Ga0207693_10044646 | Ga0207693_100446462 | 263 |
| 65 | 3300027671 | Ga0209588_1085885 | Ga0209588_10858851 | 263 |
| 66 | 3300035724 | Ga0373933_0080129 | Ga0373933_0080129_630_1460 | 263 |
| 67 | 3300036401 | Ga0373937_0241157 | Ga0373937_0241157_473_1303 | 263 |
| 68 | 3300044673 | Ga0453683_0090258 | Ga0453683_0090258_322_1119 | 263 |
| 69 | 3300005468 | Ga0070707_100001725 | Ga0070707_10000172511 | 264 |
| 70 | 3300005468 | Ga0070707_100530548 | Ga0070707_1005305481 | 264 |
| 71 | 3300006237 | Ga0097621_100341071 | Ga0097621_1003410712 | 264 |
| 72 | 3300009093 | Ga0105240_10050694 | Ga0105240_100506944 | 264 |
| 73 | 3300009093 | Ga0105240_10252699 | Ga0105240_102526991 | 264 |
| 74 | 3300009098 | Ga0105245_10044643 | Ga0105245_100446431 | 264 |
| 75 | 3300024227 | Ga0228598_1011729 | Ga0228598_10117292 | 264 |
| 76 | 3300025922 | Ga0207646_10000094 | Ga0207646_1000009451 | 264 |
| 77 | 3300025922 | Ga0207646_10116148 | Ga0207646_101161485 | 264 |
| 78 | 3300025927 | Ga0207687_10010974 | Ga0207687_100109742 | 264 |
| 79 | 3300028563 | Ga0265319_1002497 | Ga0265319_10024979 | 264 |
| 80 | 3300028577 | Ga0265318_10000631 | Ga0265318_100006319 | 264 |
| 81 | 3300028800 | Ga0265338_10070618 | Ga0265338_100706182 | 264 |
| 82 | 3300028800 | Ga0265338_10110142 | Ga0265338_101101422 | 264 |
| 83 | 3300031090 | Ga0265760_10084121 | Ga0265760_100841211 | 264 |
| 84 | 3300031238 | Ga0265332_10003618 | Ga0265332_100036186 | 264 |
| 85 | 3300031240 | Ga0265320_10000455 | Ga0265320_1000045517 | 264 |
| 86 | 3300031240 | Ga0265320_10162629 | Ga0265320_101626291 | 264 |
| 87 | 3300031241 | Ga0265325_10020580 | Ga0265325_100205802 | 264 |
| 88 | 3300031241 | Ga0265325_10027829 | Ga0265325_100278292 | 264 |
| 89 | 3300031241 | Ga0265325_10055801 | Ga0265325_100558012 | 264 |
| 90 | 3300031242 | Ga0265329_10003081 | Ga0265329_100030818 | 264 |
| 91 | 3300031249 | Ga0265339_10005326 | Ga0265339_1000532611 | 264 |
| 92 | 3300031250 | Ga0265331_10000595 | Ga0265331_1000059520 | 264 |
| 93 | 3300031250 | Ga0265331_10004780 | Ga0265331_100047805 | 264 |
| 94 | 3300031344 | Ga0265316_10003768 | Ga0265316_100037687 | 264 |
| 95 | 3300031344 | Ga0265316_10007087 | Ga0265316_100070879 | 264 |
| 96 | 3300031595 | Ga0265313_10002041 | Ga0265313_1000204117 | 264 |
| 97 | 3300031712 | Ga0265342_10002561 | Ga0265342_100025612 | 264 |
| 98 | 3300031712 | Ga0265342_10121926 | Ga0265342_101219262 | 264 |
| 99 | 3300035083 | Ga0373926_0004110 | Ga0373926_0004110_641_1522 | 264 |
| 100 | 3300035111 | Ga0373923_0091494 | Ga0373923_0091494_355_1236 | 264 |
| 101 | 3300035118 | Ga0373954_0056114 | Ga0373954_0056114_838_1719 | 264 |
| 102 | 3300035172 | Ga0373955_0036434 | Ga0373955_0036434_1478_2359 | 264 |
| 103 | 3300035410 | Ga0373924_0166802 | Ga0373924_0166802_151_945 | 264 |
| 104 | 3300035692 | Ga0373935_0136942 | Ga0373935_0136942_274_1155 | 264 |
| 105 | 3300035695 | Ga0373927_0041629 | Ga0373927_0041629_1830_2711 | 264 |
| 106 | 3300035724 | Ga0373933_0219853 | Ga0373933_0219853_314_1195 | 264 |
| 107 | 3300035724 | Ga0373933_0330395 | Ga0373933_0330395_135_929 | 264 |
| 108 | 3300036401 | Ga0373937_0024674 | Ga0373937_0024674_4404_5285 | 264 |
| 109 | 3300037068 | Ga0373925_0191216 | Ga0373925_0191216_618_1499 | 264 |
| 110 | 3300044673 | Ga0453683_0055958 | Ga0453683_0055958_419_1261 | 264 |
| 111 | 3300044673 | Ga0453683_0066415 | Ga0453683_0066415_437_1267 | 264 |
| 112 | 3300044712 | Ga0453684_0059043 | Ga0453684_0059043_2171_3013 | 264 |
| 113 | 3300044712 | Ga0453684_0339921 | Ga0453684_0339921_539_1369 | 264 |
| 114 | 3300046454 | Ga0495592_0021650 | Ga0495592_0021650_1479_2360 | 264 |
| 115 | 3300046462 | Ga0495651_0002146 | Ga0495651_0002146_7264_8094 | 264 |
| 116 | 3300046463 | Ga0495653_0029417 | Ga0495653_0029417_788_1618 | 264 |
| 117 | 3300046472 | Ga0495580_0004951 | Ga0495580_0004951_9451_10332 | 264 |
| 118 | 3300046472 | Ga0495580_0209213 | Ga0495580_0209213_277_1077 | 264 |
| 119 | 3300046477 | Ga0495664_0002060 | Ga0495664_0002060_6455_7285 | 264 |
| 120 | 3300046511 | Ga0495608_0018800 | Ga0495608_0018800_598_1479 | 264 |
| 121 | 3300046514 | Ga0495618_0031337 | Ga0495618_0031337_55_885 | 264 |
| 122 | 3300046516 | Ga0495628_0003238 | Ga0495628_0003238_10180_11010 | 264 |
| 123 | 3300046516 | Ga0495628_0009659 | Ga0495628_0009659_34_915 | 264 |
| 124 | 3300046516 | Ga0495628_0027924 | Ga0495628_0027924_1753_2634 | 264 |
| 125 | 3300046517 | Ga0495630_0140891 | Ga0495630_0140891_930_1811 | 264 |
| 126 | 3300046526 | Ga0495666_0135523 | Ga0495666_0135523_152_1033 | 264 |
| 127 | 3300046529 | Ga0495652_0002907 | Ga0495652_0002907_8844_9674 | 264 |
| 128 | 3300046529 | Ga0495652_0008532 | Ga0495652_0008532_1200_2081 | 264 |
| 129 | 3300046531 | Ga0495665_0002907 | Ga0495665_0002907_7609_8490 | 264 |
| 130 | 3300046533 | Ga0495640_0197847 | Ga0495640_0197847_412_1242 | 264 |
| 131 | 3300046535 | Ga0495586_0003372 | Ga0495586_0003372_3293_4174 | 264 |
| 132 | 3300046535 | Ga0495586_0126804 | Ga0495586_0126804_494_1324 | 264 |
| 133 | 3300046535 | Ga0495586_0272271 | Ga0495586_0272271_59_889 | 264 |
| 134 | 3300046536 | Ga0495587_0001030 | Ga0495587_0001030_7477_8307 | 264 |
| 135 | 3300046536 | Ga0495587_0015903 | Ga0495587_0015903_1574_2455 | 264 |
| 136 | 3300046543 | Ga0495645_0076199 | Ga0495645_0076199_916_1746 | 264 |
| 137 | 3300046543 | Ga0495645_0216502 | Ga0495645_0216502_149_1030 | 264 |
| 138 | 3300046642 | Ga0495634_0078523 | Ga0495634_0078523_1195_2025 | 264 |
| 139 | 3300046663 | Ga0495635_0014674 | Ga0495635_0014674_453_1334 | 264 |
| 140 | 3300046675 | Ga0495657_0005949 | Ga0495657_0005949_3955_4785 | 264 |
| 141 | 3300046675 | Ga0495657_0027886 | Ga0495657_0027886_1040_1921 | 264 |
| 142 | 3300046675 | Ga0495657_0036310 | Ga0495657_0036310_1721_2602 | 264 |
| 143 | 3300046678 | Ga0495599_0038108 | Ga0495599_0038108_1240_2070 | 264 |
| 144 | 3300046678 | Ga0495599_0225409 | Ga0495599_0225409_90_971 | 264 |
| 145 | 3300046679 | Ga0495623_0001870 | Ga0495623_0001870_7328_8209 | 264 |
| 146 | 3300046680 | Ga0495646_0004619 | Ga0495646_0004619_382_1263 | 264 |
| 147 | 3300046680 | Ga0495646_0038890 | Ga0495646_0038890_1841_2722 | 264 |
| 148 | 3300046689 | Ga0495613_0015136 | Ga0495613_0015136_4763_5644 | 264 |
| 149 | 3300046689 | Ga0495613_0199028 | Ga0495613_0199028_223_1053 | 264 |
| 150 | 3300046690 | Ga0495624_0043783 | Ga0495624_0043783_1494_2375 | 264 |
| 151 | 3300046690 | Ga0495624_0151092 | Ga0495624_0151092_42_872 | 264 |
| 152 | 3300046809 | Ga0495600_0002114 | Ga0495600_0002114_3516_4346 | 264 |
| 153 | 3300047317 | Ga0495604_0003548 | Ga0495604_0003548_5324_6205 | 264 |
| 154 | 3300047317 | Ga0495604_0003740 | Ga0495604_0003740_7385_8215 | 264 |
| 155 | 3300047317 | Ga0495604_0015361 | Ga0495604_0015361_4408_5289 | 264 |
| 156 | 3300047319 | Ga0495674_0015134 | Ga0495674_0015134_1856_2686 | 264 |
| 157 | 3300047319 | Ga0495674_0291614 | Ga0495674_0291614_289_1119 | 264 |
| 158 | 3300047321 | Ga0495676_0072551 | Ga0495676_0072551_22_903 | 264 |
| 159 | 3300047322 | Ga0495680_0281645 | Ga0495680_0281645_294_1124 | 264 |
| 160 | 3300047444 | Ga0495675_0000165 | Ga0495675_0000165_32821_33651 | 264 |
| 161 | 3300047471 | Ga0495684_0001335 | Ga0495684_0001335_13312_14142 | 264 |
| 162 | 3300047471 | Ga0495684_0005485 | Ga0495684_0005485_4400_5281 | 264 |
| 163 | 3300047471 | Ga0495684_0015457 | Ga0495684_0015457_3208_4089 | 264 |
| 164 | 3300047673 | Ga0495593_0018017 | Ga0495593_0018017_253_1134 | 264 |
| 165 | 3300048088 | Ga0495602_0006658 | Ga0495602_0006658_2528_3358 | 264 |
| 166 | 3300048089 | Ga0495614_0000713 | Ga0495614_0000713_6312_7193 | 264 |
| 167 | 3300048915 | Ga0496112_0178419 | Ga0496112_0178419_1058_1888 | 264 |
| 168 | 3300053078 | Ga0495612_0001441 | Ga0495612_0001441_4391_5272 | 264 |
| 169 | 3300004798 | Ga0058859_11144590 | Ga0058859_111445901 | 265 |
| 170 | 3300005334 | Ga0068869_100010394 | Ga0068869_1000103946 | 265 |
| 171 | 3300005338 | Ga0068868_100093373 | Ga0068868_1000933732 | 265 |
| 172 | 3300005347 | Ga0070668_100427857 | Ga0070668_1004278572 | 265 |
| 173 | 3300005353 | Ga0070669_100008906 | Ga0070669_1000089066 | 265 |
| 174 | 3300005367 | Ga0070667_100362381 | Ga0070667_1003623812 | 265 |
| 175 | 3300005440 | Ga0070705_100005272 | Ga0070705_1000052726 | 265 |
| 176 | 3300005466 | Ga0070685_10040781 | Ga0070685_100407812 | 265 |
| 177 | 3300005468 | Ga0070707_100001241 | Ga0070707_10000124118 | 265 |
| 178 | 3300005518 | Ga0070699_100018934 | Ga0070699_1000189341 | 265 |
| 179 | 3300005617 | Ga0068859_100011010 | Ga0068859_1000110103 | 265 |
| 180 | 3300005842 | Ga0068858_100063009 | Ga0068858_1000630092 | 265 |
| 181 | 3300005842 | Ga0068858_100155011 | Ga0068858_1001550112 | 265 |
| 182 | 3300005843 | Ga0068860_100045429 | Ga0068860_1000454292 | 265 |
| 183 | 3300006847 | Ga0075431_100243288 | Ga0075431_1002432882 | 265 |
| 184 | 3300006881 | Ga0068865_100135548 | Ga0068865_1001355481 | 265 |
| 185 | 3300006931 | Ga0097620_100011010 | Ga0097620_1000110103 | 265 |
| 186 | 3300009098 | Ga0105245_10622713 | Ga0105245_106227132 | 265 |
| 187 | 3300013296 | Ga0157374_10004927 | Ga0157374_100049278 | 265 |
| 188 | 3300013297 | Ga0157378_10053690 | Ga0157378_100536903 | 265 |
| 189 | 3300013306 | Ga0163162_10003513 | Ga0163162_100035132 | 265 |
| 190 | 3300014326 | Ga0157380_10429244 | Ga0157380_104292442 | 265 |
| 191 | 3300014969 | Ga0157376_10057703 | Ga0157376_100577032 | 265 |
| 192 | 3300025899 | Ga0207642_10303456 | Ga0207642_103034561 | 265 |
| 193 | 3300025900 | Ga0207710_10120127 | Ga0207710_101201272 | 265 |
| 194 | 3300025904 | Ga0207647_10217804 | Ga0207647_102178041 | 265 |
| 195 | 3300025922 | Ga0207646_10000448 | Ga0207646_1000044832 | 265 |
| 196 | 3300025938 | Ga0207704_10019298 | Ga0207704_100192982 | 265 |
| 197 | 3300025942 | Ga0207689_10000941 | Ga0207689_100009416 | 265 |
| 198 | 3300026023 | Ga0207677_10271512 | Ga0207677_102715122 | 265 |
| 199 | 3300026035 | Ga0207703_10020087 | Ga0207703_100200872 | 265 |
| 200 | 3300026035 | Ga0207703_10122979 | Ga0207703_101229792 | 265 |
| 201 | 3300026088 | Ga0207641_10086038 | Ga0207641_100860382 | 265 |
| 202 | 3300026118 | Ga0207675_100114665 | Ga0207675_1001146652 | 265 |
| 203 | 3300028380 | Ga0268265_10028554 | Ga0268265_100285542 | 265 |
| 204 | 3300028381 | Ga0268264_10166095 | Ga0268264_101660952 | 265 |
| 205 | 3300045051 | Ga0451576_0003971 | Ga0451576_0003971_12136_12939 | 265 |
| 206 | 3300048915 | Ga0496112_0006513 | Ga0496112_0006513_5002_5799 | 265 |
| 207 | 3300050510 | nmdc:mga06r32_362577_c1 | nmdc:mga06r32_362577_c1_80_898 | 265 |
| 208 | 3300005436 | Ga0070713_100060343 | Ga0070713_1000603432 | 266 |
| 209 | 3300005437 | Ga0070710_10023036 | Ga0070710_100230362 | 266 |
| 210 | 3300005439 | Ga0070711_100001487 | Ga0070711_10000148711 | 266 |
| 211 | 3300005841 | Ga0068863_100241051 | Ga0068863_1002410512 | 266 |
| 212 | 3300005843 | Ga0068860_100087435 | Ga0068860_1000874353 | 266 |
| 213 | 3300005983 | Ga0081540_1026900 | Ga0081540_10269003 | 266 |
| 214 | 3300006163 | Ga0070715_10026565 | Ga0070715_100265652 | 266 |
| 215 | 3300006173 | Ga0070716_100027682 | Ga0070716_1000276821 | 266 |
| 216 | 3300006175 | Ga0070712_100000294 | Ga0070712_10000029418 | 266 |
| 217 | 3300013105 | Ga0157369_10019009 | Ga0157369_100190096 | 266 |
| 218 | 3300014968 | Ga0157379_10195239 | Ga0157379_101952392 | 266 |
| 219 | 3300025898 | Ga0207692_10031772 | Ga0207692_100317722 | 266 |
| 220 | 3300025898 | Ga0207692_10207397 | Ga0207692_102073972 | 266 |
| 221 | 3300025915 | Ga0207693_10000785 | Ga0207693_100007859 | 266 |
| 222 | 3300025916 | Ga0207663_10003917 | Ga0207663_100039176 | 266 |
| 223 | 3300025928 | Ga0207700_10135791 | Ga0207700_101357912 | 266 |
| 224 | 3300025939 | Ga0207665_10104034 | Ga0207665_101040343 | 266 |
| 225 | 3300026088 | Ga0207641_10205821 | Ga0207641_102058212 | 266 |
| 226 | 3300028381 | Ga0268264_10140080 | Ga0268264_101400801 | 266 |
| 227 | 3300044712 | Ga0453684_0604923 | Ga0453684_0604923_188_994 | 266 |
| 228 | 3300005434 | Ga0070709_10001126 | Ga0070709_100011266 | 267 |
| 229 | 3300005434 | Ga0070709_10069348 | Ga0070709_100693482 | 267 |
| 230 | 3300005434 | Ga0070709_10077159 | Ga0070709_100771591 | 267 |
| 231 | 3300005434 | Ga0070709_10184316 | Ga0070709_101843162 | 267 |
| 232 | 3300005435 | Ga0070714_100079630 | Ga0070714_1000796302 | 267 |
| 233 | 3300005436 | Ga0070713_100000288 | Ga0070713_10000028828 | 267 |
| 234 | 3300005439 | Ga0070711_100018440 | Ga0070711_1000184404 | 267 |
| 235 | 3300005439 | Ga0070711_100057138 | Ga0070711_1000571384 | 267 |
| 236 | 3300005445 | Ga0070708_100042813 | Ga0070708_1000428132 | 267 |
| 237 | 3300005467 | Ga0070706_100426572 | Ga0070706_1004265721 | 267 |
| 238 | 3300005468 | Ga0070707_100030471 | Ga0070707_1000304712 | 267 |
| 239 | 3300005518 | Ga0070699_100010748 | Ga0070699_1000107486 | 267 |
| 240 | 3300005536 | Ga0070697_100000107 | Ga0070697_1000001079 | 267 |
| 241 | 3300005536 | Ga0070697_100038842 | Ga0070697_1000388422 | 267 |
| 242 | 3300005614 | Ga0068856_100161806 | Ga0068856_1001618062 | 267 |
| 243 | 3300006163 | Ga0070715_10002927 | Ga0070715_100029276 | 267 |
| 244 | 3300006163 | Ga0070715_10130814 | Ga0070715_101308142 | 267 |
| 245 | 3300006173 | Ga0070716_100003006 | Ga0070716_1000030066 | 267 |
| 246 | 3300006175 | Ga0070712_100001143 | Ga0070712_10000114316 | 267 |
| 247 | 3300006175 | Ga0070712_100003130 | Ga0070712_1000031302 | 267 |
| 248 | 3300006175 | Ga0070712_100004465 | Ga0070712_1000044658 | 267 |
| 249 | 3300006237 | Ga0097621_100004889 | Ga0097621_1000048896 | 267 |
| 250 | 3300006358 | Ga0068871_100001832 | Ga0068871_1000018327 | 267 |
| 251 | 3300006871 | Ga0075434_100002022 | Ga0075434_1000020222 | 267 |
| 252 | 3300006914 | Ga0075436_100009653 | Ga0075436_1000096536 | 267 |
| 253 | 3300006914 | Ga0075436_100207071 | Ga0075436_1002070712 | 267 |
| 254 | 3300007076 | Ga0075435_100057909 | Ga0075435_1000579092 | 267 |
| 255 | 3300007076 | Ga0075435_100252271 | Ga0075435_1002522712 | 267 |
| 256 | 3300009098 | Ga0105245_10065521 | Ga0105245_100655212 | 267 |
| 257 | 3300009174 | Ga0105241_10012514 | Ga0105241_100125146 | 267 |
| 258 | 3300009176 | Ga0105242_10357790 | Ga0105242_103577902 | 267 |
| 259 | 3300009176 | Ga0105242_10539025 | Ga0105242_105390252 | 267 |
| 260 | 3300009551 | Ga0105238_10041250 | Ga0105238_100412504 | 267 |
| 261 | 3300010375 | Ga0105239_10097004 | Ga0105239_100970043 | 267 |
| 262 | 3300013296 | Ga0157374_10057507 | Ga0157374_100575073 | 267 |
| 263 | 3300013306 | Ga0163162_10014579 | Ga0163162_100145792 | 267 |
| 264 | 3300013306 | Ga0163162_10364211 | Ga0163162_103642112 | 267 |
| 265 | 3300013307 | Ga0157372_11125864 | Ga0157372_111258641 | 267 |
| 266 | 3300014969 | Ga0157376_10024743 | Ga0157376_100247433 | 267 |
| 267 | 3300024227 | Ga0228598_1002972 | Ga0228598_10029722 | 267 |
| 268 | 3300025898 | Ga0207692_10023131 | Ga0207692_100231314 | 267 |
| 269 | 3300025905 | Ga0207685_10010035 | Ga0207685_100100352 | 267 |
| 270 | 3300025906 | Ga0207699_10000912 | Ga0207699_100009126 | 267 |
| 271 | 3300025906 | Ga0207699_10038591 | Ga0207699_100385913 | 267 |
| 272 | 3300025911 | Ga0207654_10012536 | Ga0207654_100125362 | 267 |
| 273 | 3300025915 | Ga0207693_10000203 | Ga0207693_1000020349 | 267 |
| 274 | 3300025915 | Ga0207693_10001032 | Ga0207693_100010321 | 267 |
| 275 | 3300025915 | Ga0207693_10001069 | Ga0207693_100010694 | 267 |
| 276 | 3300025916 | Ga0207663_10302620 | Ga0207663_103026201 | 267 |
| 277 | 3300025916 | Ga0207663_10451122 | Ga0207663_104511221 | 267 |
| 278 | 3300025924 | Ga0207694_10568934 | Ga0207694_105689341 | 267 |
| 279 | 3300025927 | Ga0207687_10205980 | Ga0207687_102059802 | 267 |
| 280 | 3300025928 | Ga0207700_10001454 | Ga0207700_100014547 | 267 |
| 281 | 3300025939 | Ga0207665_10012403 | Ga0207665_100124031 | 267 |
| 282 | 3300026035 | Ga0207703_10325737 | Ga0207703_103257372 | 267 |
| 283 | 3300026078 | Ga0207702_10133845 | Ga0207702_101338453 | 267 |
| 284 | 3300026088 | Ga0207641_10116420 | Ga0207641_101164202 | 267 |
| 285 | 3300035089 | Ga0373944_0040477 | Ga0373944_0040477_516_1319 | 267 |
| 286 | 3300035692 | Ga0373935_0177923 | Ga0373935_0177923_412_1215 | 267 |
| 287 | 3300035695 | Ga0373927_0282885 | Ga0373927_0282885_21_827 | 267 |
| 288 | 3300035724 | Ga0373933_0064525 | Ga0373933_0064525_960_1763 | 267 |
| 289 | 3300036401 | Ga0373937_0235436 | Ga0373937_0235436_414_1217 | 267 |
| 290 | 3300039438 | Ga0436360_0858745 | Ga0436360_0858745_629_1435 | 267 |
| 291 | 3300039447 | Ga0436361_0659691 | Ga0436361_0659691_17_823 | 267 |
| 292 | 3300044706 | Ga0466964_0174513 | Ga0466964_0174513_139_942 | 267 |
| 293 | 3300046472 | Ga0495580_0003063 | Ga0495580_0003063_2502_3308 | 267 |
| 294 | 3300046472 | Ga0495580_0200681 | Ga0495580_0200681_509_1315 | 267 |
| 295 | 3300046472 | Ga0495580_0264250 | Ga0495580_0264250_174_980 | 267 |
| 296 | 3300046472 | Ga0495580_0386217 | Ga0495580_0386217_65_871 | 267 |
| 297 | 3300046491 | Ga0495584_0030969 | Ga0495584_0030969_913_1719 | 267 |
| 298 | 3300048903 | Ga0496100_0053817 | Ga0496100_0053817_1008_1811 | 267 |
| 299 | 3300048907 | Ga0496104_0048492 | Ga0496104_0048492_3037_3840 | 267 |
| 300 | 3300048909 | Ga0496106_0035673 | Ga0496106_0035673_1447_2250 | 267 |
| 301 | 3300048912 | Ga0496109_0409261 | Ga0496109_0409261_199_1002 | 267 |
| 302 | 3300048915 | Ga0496112_0106853 | Ga0496112_0106853_1143_1946 | 267 |
| 303 | 3300048916 | Ga0496113_0230420 | Ga0496113_0230420_158_961 | 267 |
| 304 | 3300048917 | Ga0496114_0033519 | Ga0496114_0033519_3001_3804 | 267 |
| 305 | 3300048918 | Ga0496115_0008082 | Ga0496115_0008082_2662_3465 | 267 |
| 306 | 3300050512 | nmdc:mga0n895_672_c1 | nmdc:mga0n895_672_c1_7060_7866 | 267 |
| 307 | 3300050512 | nmdc:mga0n895_913246_c1 | nmdc:mga0n895_913246_c1_47_850 | 267 |
| 308 | 3300050513 | nmdc:mga0rr50_108950_c1 | nmdc:mga0rr50_108950_c1_77_883 | 267 |
| 309 | 3300050513 | nmdc:mga0rr50_23863_c1 | nmdc:mga0rr50_23863_c1_2121_2924 | 267 |
| 310 | 3300050514 | nmdc:mga08x19_14262_c1 | nmdc:mga08x19_14262_c1_3776_4579 | 267 |
| 311 | 3300050514 | nmdc:mga08x19_24657_c1 | nmdc:mga08x19_24657_c1_743_1546 | 267 |
| 312 | 3300050514 | nmdc:mga08x19_4596_c1 | nmdc:mga08x19_4596_c1_527_1330 | 267 |
| 313 | 3300050515 | nmdc:mga0a205_8215_c2 | nmdc:mga0a205_8215_c2_4131_4937 | 267 |
| 314 | 3300053085 | Ga0495619_0100376 | Ga0495619_0100376_521_1324 | 267 |
| 315 | 2162886012 | MBSR1b_contig_3570058 | MBSR1b_0497.00000990 | 268 |
| 316 | 3300000546 | LJNas_1000490 | LJNas_10004903 | 268 |
| 317 | 3300001976 | JGI24752J21851_1005021 | JGI24752J21851_10050212 | 268 |
| 318 | 3300001978 | JGI24747J21853_1001593 | JGI24747J21853_10015932 | 268 |
| 319 | 3300001991 | JGI24743J22301_10007922 | JGI24743J22301_100079222 | 268 |
| 320 | 3300002076 | JGI24749J21850_1006732 | JGI24749J21850_10067321 | 268 |
| 321 | 3300002077 | JGI24744J21845_10039926 | JGI24744J21845_100399261 | 268 |
| 322 | 3300002155 | JGI24033J26618_1005663 | JGI24033J26618_10056632 | 268 |
| 323 | 3300002239 | JGI24034J26672_10000271 | JGI24034J26672_100002712 | 268 |
| 324 | 3300002459 | JGI24751J29686_10001862 | JGI24751J29686_100018623 | 268 |
| 325 | 3300005289 | Ga0065704_10174353 | Ga0065704_101743532 | 268 |
| 326 | 3300005290 | Ga0065712_10012241 | Ga0065712_100122413 | 268 |
| 327 | 3300005290 | Ga0065712_10077587 | Ga0065712_100775872 | 268 |
| 328 | 3300005293 | Ga0065715_10036466 | Ga0065715_100364662 | 268 |
| 329 | 3300005293 | Ga0065715_10060498 | Ga0065715_100604981 | 268 |
| 330 | 3300005293 | Ga0065715_10090120 | Ga0065715_1009012010 | 268 |
| 331 | 3300005295 | Ga0065707_10021967 | Ga0065707_100219672 | 268 |
| 332 | 3300005327 | Ga0070658_10075888 | Ga0070658_100758882 | 268 |
| 333 | 3300005328 | Ga0070676_10032231 | Ga0070676_100322312 | 268 |
| 334 | 3300005329 | Ga0070683_100010189 | Ga0070683_1000101892 | 268 |
| 335 | 3300005330 | Ga0070690_100132376 | Ga0070690_1001323762 | 268 |
| 336 | 3300005331 | Ga0070670_100007150 | Ga0070670_1000071502 | 268 |
| 337 | 3300005333 | Ga0070677_10166839 | Ga0070677_101668391 | 268 |
| 338 | 3300005334 | Ga0068869_100086016 | Ga0068869_1000860162 | 268 |
| 339 | 3300005334 | Ga0068869_100401518 | Ga0068869_1004015181 | 268 |
| 340 | 3300005335 | Ga0070666_10010583 | Ga0070666_100105837 | 268 |
| 341 | 3300005335 | Ga0070666_10013323 | Ga0070666_100133232 | 268 |
| 342 | 3300005336 | Ga0070680_100196766 | Ga0070680_1001967661 | 268 |
| 343 | 3300005337 | Ga0070682_100092903 | Ga0070682_1000929032 | 268 |
| 344 | 3300005337 | Ga0070682_100587186 | Ga0070682_1005871861 | 268 |
| 345 | 3300005338 | Ga0068868_100008166 | Ga0068868_1000081667 | 268 |
| 346 | 3300005338 | Ga0068868_100100076 | Ga0068868_1001000762 | 268 |
| 347 | 3300005338 | Ga0068868_100384807 | Ga0068868_1003848071 | 268 |
| 348 | 3300005338 | Ga0068868_100459952 | Ga0068868_1004599522 | 268 |
| 349 | 3300005339 | Ga0070660_100009321 | Ga0070660_10000932110 | 268 |
| 350 | 3300005340 | Ga0070689_100036687 | Ga0070689_1000366873 | 268 |
| 351 | 3300005341 | Ga0070691_10052211 | Ga0070691_100522113 | 268 |
| 352 | 3300005343 | Ga0070687_100008433 | Ga0070687_1000084333 | 268 |
| 353 | 3300005344 | Ga0070661_100001784 | Ga0070661_10000178412 | 268 |
| 354 | 3300005344 | Ga0070661_100015246 | Ga0070661_1000152463 | 268 |
| 355 | 3300005344 | Ga0070661_100027302 | Ga0070661_1000273024 | 268 |
| 356 | 3300005345 | Ga0070692_10066722 | Ga0070692_100667222 | 268 |
| 357 | 3300005347 | Ga0070668_100021287 | Ga0070668_1000212873 | 268 |
| 358 | 3300005347 | Ga0070668_100047594 | Ga0070668_1000475942 | 268 |
| 359 | 3300005353 | Ga0070669_100012442 | Ga0070669_1000124421 | 268 |
| 360 | 3300005353 | Ga0070669_100105105 | Ga0070669_1001051052 | 268 |
| 361 | 3300005353 | Ga0070669_100239770 | Ga0070669_1002397702 | 268 |
| 362 | 3300005354 | Ga0070675_100075159 | Ga0070675_1000751592 | 268 |
| 363 | 3300005355 | Ga0070671_100150162 | Ga0070671_1001501622 | 268 |
| 364 | 3300005355 | Ga0070671_100336129 | Ga0070671_1003361291 | 268 |
| 365 | 3300005356 | Ga0070674_100006091 | Ga0070674_1000060912 | 268 |
| 366 | 3300005364 | Ga0070673_100008201 | Ga0070673_1000082013 | 268 |
| 367 | 3300005365 | Ga0070688_100000910 | Ga0070688_10000091016 | 268 |
| 368 | 3300005366 | Ga0070659_100003912 | Ga0070659_1000039123 | 268 |
| 369 | 3300005366 | Ga0070659_100072123 | Ga0070659_1000721232 | 268 |
| 370 | 3300005367 | Ga0070667_100488729 | Ga0070667_1004887292 | 268 |
| 371 | 3300005434 | Ga0070709_10023770 | Ga0070709_100237704 | 268 |
| 372 | 3300005434 | Ga0070709_10042726 | Ga0070709_100427263 | 268 |
| 373 | 3300005434 | Ga0070709_10043810 | Ga0070709_100438102 | 268 |
| 374 | 3300005434 | Ga0070709_10054944 | Ga0070709_100549441 | 268 |
| 375 | 3300005434 | Ga0070709_10297676 | Ga0070709_102976762 | 268 |
| 376 | 3300005434 | Ga0070709_10423770 | Ga0070709_104237702 | 268 |
| 377 | 3300005435 | Ga0070714_100004845 | Ga0070714_1000048454 | 268 |
| 378 | 3300005435 | Ga0070714_100027361 | Ga0070714_1000273612 | 268 |
| 379 | 3300005435 | Ga0070714_100086463 | Ga0070714_1000864632 | 268 |
| 380 | 3300005435 | Ga0070714_100296553 | Ga0070714_1002965532 | 268 |
| 381 | 3300005435 | Ga0070714_100394967 | Ga0070714_1003949672 | 268 |
| 382 | 3300005436 | Ga0070713_100000337 | Ga0070713_10000033717 | 268 |
| 383 | 3300005436 | Ga0070713_100025846 | Ga0070713_1000258462 | 268 |
| 384 | 3300005436 | Ga0070713_100061724 | Ga0070713_1000617245 | 268 |
| 385 | 3300005436 | Ga0070713_100098953 | Ga0070713_1000989533 | 268 |
| 386 | 3300005436 | Ga0070713_100171928 | Ga0070713_1001719282 | 268 |
| 387 | 3300005436 | Ga0070713_100436796 | Ga0070713_1004367962 | 268 |
| 388 | 3300005437 | Ga0070710_10035310 | Ga0070710_100353103 | 268 |
| 389 | 3300005437 | Ga0070710_10043821 | Ga0070710_100438212 | 268 |
| 390 | 3300005437 | Ga0070710_10143191 | Ga0070710_101431911 | 268 |
| 391 | 3300005439 | Ga0070711_100000500 | Ga0070711_1000005001 | 268 |
| 392 | 3300005439 | Ga0070711_100010972 | Ga0070711_1000109722 | 268 |
| 393 | 3300005440 | Ga0070705_100015063 | Ga0070705_1000150633 | 268 |
| 394 | 3300005441 | Ga0070700_100398200 | Ga0070700_1003982001 | 268 |
| 395 | 3300005441 | Ga0070700_100556417 | Ga0070700_1005564171 | 268 |
| 396 | 3300005444 | Ga0070694_100003742 | Ga0070694_1000037425 | 268 |
| 397 | 3300005445 | Ga0070708_100001706 | Ga0070708_1000017068 | 268 |
| 398 | 3300005445 | Ga0070708_100002037 | Ga0070708_1000020373 | 268 |
| 399 | 3300005445 | Ga0070708_100002957 | Ga0070708_1000029574 | 268 |
| 400 | 3300005445 | Ga0070708_100004925 | Ga0070708_1000049253 | 268 |
| 401 | 3300005445 | Ga0070708_100005336 | Ga0070708_1000053367 | 268 |
| 402 | 3300005445 | Ga0070708_100017864 | Ga0070708_1000178643 | 268 |
| 403 | 3300005445 | Ga0070708_100105507 | Ga0070708_1001055072 | 268 |
| 404 | 3300005445 | Ga0070708_100129685 | Ga0070708_1001296853 | 268 |
| 405 | 3300005445 | Ga0070708_100170989 | Ga0070708_1001709892 | 268 |
| 406 | 3300005445 | Ga0070708_100178221 | Ga0070708_1001782212 | 268 |
| 407 | 3300005445 | Ga0070708_100433358 | Ga0070708_1004333582 | 268 |
| 408 | 3300005455 | Ga0070663_100030211 | Ga0070663_1000302112 | 268 |
| 409 | 3300005455 | Ga0070663_100065306 | Ga0070663_1000653062 | 268 |
| 410 | 3300005456 | Ga0070678_100053113 | Ga0070678_1000531132 | 268 |
| 411 | 3300005456 | Ga0070678_100072169 | Ga0070678_1000721692 | 268 |
| 412 | 3300005457 | Ga0070662_100008948 | Ga0070662_1000089482 | 268 |
| 413 | 3300005457 | Ga0070662_100085562 | Ga0070662_1000855622 | 268 |
| 414 | 3300005458 | Ga0070681_10070592 | Ga0070681_100705922 | 268 |
| 415 | 3300005458 | Ga0070681_10087553 | Ga0070681_100875533 | 268 |
| 416 | 3300005459 | Ga0068867_100186233 | Ga0068867_1001862332 | 268 |
| 417 | 3300005466 | Ga0070685_10035425 | Ga0070685_100354252 | 268 |
| 418 | 3300005467 | Ga0070706_100000296 | Ga0070706_10000029639 | 268 |
| 419 | 3300005467 | Ga0070706_100000932 | Ga0070706_10000093222 | 268 |
| 420 | 3300005467 | Ga0070706_100002114 | Ga0070706_1000021149 | 268 |
| 421 | 3300005467 | Ga0070706_100014539 | Ga0070706_1000145398 | 268 |
| 422 | 3300005467 | Ga0070706_100023186 | Ga0070706_1000231866 | 268 |
| 423 | 3300005467 | Ga0070706_100152958 | Ga0070706_1001529581 | 268 |
| 424 | 3300005468 | Ga0070707_100001443 | Ga0070707_10000144315 | 268 |
| 425 | 3300005468 | Ga0070707_100002355 | Ga0070707_1000023556 | 268 |
| 426 | 3300005468 | Ga0070707_100010925 | Ga0070707_1000109259 | 268 |
| 427 | 3300005468 | Ga0070707_100063143 | Ga0070707_1000631432 | 268 |
| 428 | 3300005468 | Ga0070707_100293911 | Ga0070707_1002939112 | 268 |
| 429 | 3300005468 | Ga0070707_100318879 | Ga0070707_1003188792 | 268 |
| 430 | 3300005471 | Ga0070698_100000216 | Ga0070698_10000021643 | 268 |
| 431 | 3300005471 | Ga0070698_100002588 | Ga0070698_1000025882 | 268 |
| 432 | 3300005471 | Ga0070698_100018741 | Ga0070698_1000187418 | 268 |
| 433 | 3300005471 | Ga0070698_100097904 | Ga0070698_1000979042 | 268 |
| 434 | 3300005471 | Ga0070698_100235556 | Ga0070698_1002355562 | 268 |
| 435 | 3300005518 | Ga0070699_100008001 | Ga0070699_1000080017 | 268 |
| 436 | 3300005518 | Ga0070699_100008691 | Ga0070699_1000086913 | 268 |
| 437 | 3300005518 | Ga0070699_100009732 | Ga0070699_1000097323 | 268 |
| 438 | 3300005518 | Ga0070699_100044932 | Ga0070699_1000449324 | 268 |
| 439 | 3300005518 | Ga0070699_100075835 | Ga0070699_1000758354 | 268 |
| 440 | 3300005530 | Ga0070679_100181479 | Ga0070679_1001814792 | 268 |
| 441 | 3300005530 | Ga0070679_100187431 | Ga0070679_1001874311 | 268 |
| 442 | 3300005535 | Ga0070684_100001397 | Ga0070684_1000013972 | 268 |
| 443 | 3300005535 | Ga0070684_100283435 | Ga0070684_1002834351 | 268 |
| 444 | 3300005536 | Ga0070697_100000323 | Ga0070697_10000032313 | 268 |
| 445 | 3300005536 | Ga0070697_100000611 | Ga0070697_10000061118 | 268 |
| 446 | 3300005536 | Ga0070697_100000763 | Ga0070697_1000007631 | 268 |
| 447 | 3300005536 | Ga0070697_100002752 | Ga0070697_10000275210 | 268 |
| 448 | 3300005536 | Ga0070697_100014974 | Ga0070697_1000149748 | 268 |
| 449 | 3300005536 | Ga0070697_100040738 | Ga0070697_1000407385 | 268 |
| 450 | 3300005536 | Ga0070697_100067672 | Ga0070697_1000676724 | 268 |
| 451 | 3300005536 | Ga0070697_100139586 | Ga0070697_1001395861 | 268 |
| 452 | 3300005536 | Ga0070697_100401483 | Ga0070697_1004014831 | 268 |
| 453 | 3300005536 | Ga0070697_100719130 | Ga0070697_1007191301 | 268 |
| 454 | 3300005539 | Ga0068853_100003624 | Ga0068853_1000036244 | 268 |
| 455 | 3300005539 | Ga0068853_100142488 | Ga0068853_1001424882 | 268 |
| 456 | 3300005543 | Ga0070672_100034411 | Ga0070672_1000344112 | 268 |
| 457 | 3300005543 | Ga0070672_100471539 | Ga0070672_1004715391 | 268 |
| 458 | 3300005544 | Ga0070686_100058478 | Ga0070686_1000584782 | 268 |
| 459 | 3300005545 | Ga0070695_100001372 | Ga0070695_1000013724 | 268 |
| 460 | 3300005546 | Ga0070696_100002958 | Ga0070696_1000029585 | 268 |
| 461 | 3300005547 | Ga0070693_100000001 | Ga0070693_10000000177 | 268 |
| 462 | 3300005547 | Ga0070693_100021929 | Ga0070693_1000219293 | 268 |
| 463 | 3300005548 | Ga0070665_100480320 | Ga0070665_1004803202 | 268 |
| 464 | 3300005549 | Ga0070704_100008835 | Ga0070704_1000088353 | 268 |
| 465 | 3300005549 | Ga0070704_100115375 | Ga0070704_1001153753 | 268 |
| 466 | 3300005563 | Ga0068855_100031873 | Ga0068855_1000318733 | 268 |
| 467 | 3300005563 | Ga0068855_100075178 | Ga0068855_1000751783 | 268 |
| 468 | 3300005564 | Ga0070664_100012643 | Ga0070664_1000126432 | 268 |
| 469 | 3300005564 | Ga0070664_100076512 | Ga0070664_1000765122 | 268 |
| 470 | 3300005564 | Ga0070664_100132710 | Ga0070664_1001327102 | 268 |
| 471 | 3300005577 | Ga0068857_100002065 | Ga0068857_1000020652 | 268 |
| 472 | 3300005577 | Ga0068857_100358750 | Ga0068857_1003587502 | 268 |
| 473 | 3300005578 | Ga0068854_100053478 | Ga0068854_1000534782 | 268 |
| 474 | 3300005614 | Ga0068856_100001015 | Ga0068856_10000101513 | 268 |
| 475 | 3300005614 | Ga0068856_100006280 | Ga0068856_10000628011 | 268 |
| 476 | 3300005614 | Ga0068856_100047049 | Ga0068856_1000470492 | 268 |
| 477 | 3300005614 | Ga0068856_100064563 | Ga0068856_1000645632 | 268 |
| 478 | 3300005615 | Ga0070702_100031119 | Ga0070702_1000311192 | 268 |
| 479 | 3300005616 | Ga0068852_100029318 | Ga0068852_1000293183 | 268 |
| 480 | 3300005616 | Ga0068852_100042599 | Ga0068852_1000425993 | 268 |
| 481 | 3300005616 | Ga0068852_100419446 | Ga0068852_1004194462 | 268 |
| 482 | 3300005617 | Ga0068859_100148779 | Ga0068859_1001487792 | 268 |
| 483 | 3300005618 | Ga0068864_100010381 | Ga0068864_10001038111 | 268 |
| 484 | 3300005718 | Ga0068866_10003477 | Ga0068866_100034775 | 268 |
| 485 | 3300005719 | Ga0068861_100012817 | Ga0068861_1000128176 | 268 |
| 486 | 3300005719 | Ga0068861_100269233 | Ga0068861_1002692332 | 268 |
| 487 | 3300005719 | Ga0068861_100340948 | Ga0068861_1003409481 | 268 |
| 488 | 3300005834 | Ga0068851_10095666 | Ga0068851_100956662 | 268 |
| 489 | 3300005840 | Ga0068870_10016325 | Ga0068870_100163252 | 268 |
| 490 | 3300005841 | Ga0068863_100053582 | Ga0068863_1000535824 | 268 |
| 491 | 3300005842 | Ga0068858_100083628 | Ga0068858_1000836282 | 268 |
| 492 | 3300005843 | Ga0068860_100040319 | Ga0068860_1000403193 | 268 |
| 493 | 3300005843 | Ga0068860_100228588 | Ga0068860_1002285882 | 268 |
| 494 | 3300005844 | Ga0068862_100013927 | Ga0068862_1000139276 | 268 |
| 495 | 3300005844 | Ga0068862_100015353 | Ga0068862_1000153532 | 268 |
| 496 | 3300006028 | Ga0070717_10001935 | Ga0070717_100019356 | 268 |
| 497 | 3300006028 | Ga0070717_10002004 | Ga0070717_1000200410 | 268 |
| 498 | 3300006028 | Ga0070717_10054234 | Ga0070717_100542343 | 268 |
| 499 | 3300006028 | Ga0070717_10057448 | Ga0070717_100574483 | 268 |
| 500 | 3300006028 | Ga0070717_10216146 | Ga0070717_102161462 | 268 |
| 501 | 3300006028 | Ga0070717_10296437 | Ga0070717_102964372 | 268 |
| 502 | 3300006028 | Ga0070717_10329596 | Ga0070717_103295962 | 268 |
| 503 | 3300006028 | Ga0070717_10365439 | Ga0070717_103654392 | 268 |
| 504 | 3300006028 | Ga0070717_10515908 | Ga0070717_105159082 | 268 |
| 505 | 3300006163 | Ga0070715_10059162 | Ga0070715_100591622 | 268 |
| 506 | 3300006163 | Ga0070715_10102667 | Ga0070715_101026672 | 268 |
| 507 | 3300006173 | Ga0070716_100080416 | Ga0070716_1000804163 | 268 |
| 508 | 3300006173 | Ga0070716_100088714 | Ga0070716_1000887141 | 268 |
| 509 | 3300006173 | Ga0070716_100138850 | Ga0070716_1001388501 | 268 |
| 510 | 3300006173 | Ga0070716_100201027 | Ga0070716_1002010272 | 268 |
| 511 | 3300006173 | Ga0070716_100244040 | Ga0070716_1002440402 | 268 |
| 512 | 3300006175 | Ga0070712_100000362 | Ga0070712_10000036210 | 268 |
| 513 | 3300006175 | Ga0070712_100010715 | Ga0070712_1000107153 | 268 |
| 514 | 3300006175 | Ga0070712_100086484 | Ga0070712_1000864842 | 268 |
| 515 | 3300006175 | Ga0070712_100259653 | Ga0070712_1002596532 | 268 |
| 516 | 3300006237 | Ga0097621_100001923 | Ga0097621_10000192311 | 268 |
| 517 | 3300006237 | Ga0097621_100112026 | Ga0097621_1001120262 | 268 |
| 518 | 3300006237 | Ga0097621_100497738 | Ga0097621_1004977382 | 268 |
| 519 | 3300006358 | Ga0068871_100000585 | Ga0068871_10000058521 | 268 |
| 520 | 3300006358 | Ga0068871_100068666 | Ga0068871_1000686662 | 268 |
| 521 | 3300006852 | Ga0075433_10000127 | Ga0075433_1000012723 | 268 |
| 522 | 3300006871 | Ga0075434_100002031 | Ga0075434_1000020314 | 268 |
| 523 | 3300006881 | Ga0068865_100067859 | Ga0068865_1000678592 | 268 |
| 524 | 3300006881 | Ga0068865_100120366 | Ga0068865_1001203662 | 268 |
| 525 | 3300006914 | Ga0075436_100010926 | Ga0075436_1000109262 | 268 |
| 526 | 3300006914 | Ga0075436_100012042 | Ga0075436_1000120423 | 268 |
| 527 | 3300006931 | Ga0097620_100148776 | Ga0097620_1001487762 | 268 |
| 528 | 3300007076 | Ga0075435_100002355 | Ga0075435_1000023557 | 268 |
| 529 | 3300007076 | Ga0075435_100375043 | Ga0075435_1003750432 | 268 |
| 530 | 3300007265 | Ga0099794_10036795 | Ga0099794_100367951 | 268 |
| 531 | 3300007265 | Ga0099794_10072730 | Ga0099794_100727301 | 268 |
| 532 | 3300007788 | Ga0099795_10143338 | Ga0099795_101433382 | 268 |
| 533 | 3300009093 | Ga0105240_10020055 | Ga0105240_100200555 | 268 |
| 534 | 3300009093 | Ga0105240_10070878 | Ga0105240_100708782 | 268 |
| 535 | 3300009098 | Ga0105245_10003303 | Ga0105245_100033034 | 268 |
| 536 | 3300009098 | Ga0105245_10069228 | Ga0105245_100692283 | 268 |
| 537 | 3300009098 | Ga0105245_10215335 | Ga0105245_102153352 | 268 |
| 538 | 3300009101 | Ga0105247_10002514 | Ga0105247_1000251414 | 268 |
| 539 | 3300009101 | Ga0105247_10116424 | Ga0105247_101164242 | 268 |
| 540 | 3300009148 | Ga0105243_10123851 | Ga0105243_101238512 | 268 |
| 541 | 3300009148 | Ga0105243_10317126 | Ga0105243_103171261 | 268 |
| 542 | 3300009174 | Ga0105241_10005963 | Ga0105241_100059638 | 268 |
| 543 | 3300009174 | Ga0105241_10014118 | Ga0105241_100141187 | 268 |
| 544 | 3300009174 | Ga0105241_10033772 | Ga0105241_100337724 | 268 |
| 545 | 3300009174 | Ga0105241_10083990 | Ga0105241_100839902 | 268 |
| 546 | 3300009176 | Ga0105242_10010108 | Ga0105242_100101088 | 268 |
| 547 | 3300009176 | Ga0105242_10020852 | Ga0105242_100208526 | 268 |
| 548 | 3300009176 | Ga0105242_10658394 | Ga0105242_106583941 | 268 |
| 549 | 3300009177 | Ga0105248_10055473 | Ga0105248_100554732 | 268 |
| 550 | 3300009177 | Ga0105248_10307263 | Ga0105248_103072632 | 268 |
| 551 | 3300009545 | Ga0105237_10025863 | Ga0105237_100258635 | 268 |
| 552 | 3300009545 | Ga0105237_10303716 | Ga0105237_103037161 | 268 |
| 553 | 3300009551 | Ga0105238_10365038 | Ga0105238_103650382 | 268 |
| 554 | 3300009553 | Ga0105249_10010157 | Ga0105249_100101577 | 268 |
| 555 | 3300009553 | Ga0105249_10436169 | Ga0105249_104361691 | 268 |
| 556 | 3300010159 | Ga0099796_10021618 | Ga0099796_100216182 | 268 |
| 557 | 3300010375 | Ga0105239_10011628 | Ga0105239_100116285 | 268 |
| 558 | 3300010375 | Ga0105239_10095866 | Ga0105239_100958662 | 268 |
| 559 | 3300010375 | Ga0105239_10222264 | Ga0105239_102222642 | 268 |
| 560 | 3300010375 | Ga0105239_10795267 | Ga0105239_107952672 | 268 |
| 561 | 3300011119 | Ga0105246_10005537 | Ga0105246_100055373 | 268 |
| 562 | 3300013100 | Ga0157373_10000999 | Ga0157373_100009993 | 268 |
| 563 | 3300013100 | Ga0157373_10055493 | Ga0157373_100554932 | 268 |
| 564 | 3300013102 | Ga0157371_10006244 | Ga0157371_100062443 | 268 |
| 565 | 3300013102 | Ga0157371_10026617 | Ga0157371_100266173 | 268 |
| 566 | 3300013104 | Ga0157370_10198099 | Ga0157370_101980992 | 268 |
| 567 | 3300013105 | Ga0157369_10008080 | Ga0157369_100080805 | 268 |
| 568 | 3300013105 | Ga0157369_10037339 | Ga0157369_100373392 | 268 |
| 569 | 3300013296 | Ga0157374_10010242 | Ga0157374_100102423 | 268 |
| 570 | 3300013296 | Ga0157374_10031823 | Ga0157374_100318233 | 268 |
| 571 | 3300013296 | Ga0157374_10046709 | Ga0157374_100467092 | 268 |
| 572 | 3300013296 | Ga0157374_10058005 | Ga0157374_100580052 | 268 |
| 573 | 3300013297 | Ga0157378_10004197 | Ga0157378_100041976 | 268 |
| 574 | 3300013297 | Ga0157378_10173859 | Ga0157378_101738591 | 268 |
| 575 | 3300013297 | Ga0157378_10256000 | Ga0157378_102560001 | 268 |
| 576 | 3300013306 | Ga0163162_10034770 | Ga0163162_100347706 | 268 |
| 577 | 3300013306 | Ga0163162_10088319 | Ga0163162_100883194 | 268 |
| 578 | 3300013306 | Ga0163162_10383135 | Ga0163162_103831351 | 268 |
| 579 | 3300013307 | Ga0157372_10031314 | Ga0157372_100313143 | 268 |
| 580 | 3300013307 | Ga0157372_10032538 | Ga0157372_100325388 | 268 |
| 581 | 3300013307 | Ga0157372_10059140 | Ga0157372_100591402 | 268 |
| 582 | 3300013307 | Ga0157372_10324347 | Ga0157372_103243472 | 268 |
| 583 | 3300013308 | Ga0157375_10040143 | Ga0157375_100401433 | 268 |
| 584 | 3300013308 | Ga0157375_10093761 | Ga0157375_100937611 | 268 |
| 585 | 3300014325 | Ga0163163_10009183 | Ga0163163_100091831 | 268 |
| 586 | 3300014325 | Ga0163163_10099155 | Ga0163163_100991552 | 268 |
| 587 | 3300014325 | Ga0163163_10168815 | Ga0163163_101688152 | 268 |
| 588 | 3300014326 | Ga0157380_10159859 | Ga0157380_101598592 | 268 |
| 589 | 3300014497 | Ga0182008_10016550 | Ga0182008_100165502 | 268 |
| 590 | 3300014497 | Ga0182008_10112926 | Ga0182008_101129262 | 268 |
| 591 | 3300014745 | Ga0157377_10002369 | Ga0157377_1000236912 | 268 |
| 592 | 3300014968 | Ga0157379_10001668 | Ga0157379_100016689 | 268 |
| 593 | 3300014968 | Ga0157379_10070163 | Ga0157379_100701632 | 268 |
| 594 | 3300014968 | Ga0157379_10097968 | Ga0157379_100979682 | 268 |
| 595 | 3300014969 | Ga0157376_10000401 | Ga0157376_1000040117 | 268 |
| 596 | 3300014969 | Ga0157376_10034140 | Ga0157376_100341403 | 268 |
| 597 | 3300014969 | Ga0157376_10043187 | Ga0157376_100431872 | 268 |
| 598 | 3300015262 | Ga0182007_10003616 | Ga0182007_100036163 | 268 |
| 599 | 3300015262 | Ga0182007_10030822 | Ga0182007_100308222 | 268 |
| 600 | 3300015265 | Ga0182005_1009258 | Ga0182005_10092582 | 268 |
| 601 | 3300015265 | Ga0182005_1040254 | Ga0182005_10402542 | 268 |
| 602 | 3300017792 | Ga0163161_10011112 | Ga0163161_100111122 | 268 |
| 603 | 3300022467 | Ga0224712_10138969 | Ga0224712_101389692 | 268 |
| 604 | 3300022730 | Ga0224570_100191 | Ga0224570_1001913 | 268 |
| 605 | 3300024227 | Ga0228598_1002872 | Ga0228598_10028723 | 268 |
| 606 | 3300025315 | Ga0207697_10085734 | Ga0207697_100857341 | 268 |
| 607 | 3300025321 | Ga0207656_10068759 | Ga0207656_100687592 | 268 |
| 608 | 3300025885 | Ga0207653_10002603 | Ga0207653_100026032 | 268 |
| 609 | 3300025898 | Ga0207692_10011393 | Ga0207692_100113932 | 268 |
| 610 | 3300025899 | Ga0207642_10073539 | Ga0207642_100735392 | 268 |
| 611 | 3300025901 | Ga0207688_10002555 | Ga0207688_100025556 | 268 |
| 612 | 3300025903 | Ga0207680_10028391 | Ga0207680_100283911 | 268 |
| 613 | 3300025903 | Ga0207680_10079085 | Ga0207680_100790852 | 268 |
| 614 | 3300025904 | Ga0207647_10023570 | Ga0207647_100235703 | 268 |
| 615 | 3300025906 | Ga0207699_10003305 | Ga0207699_100033054 | 268 |
| 616 | 3300025906 | Ga0207699_10104809 | Ga0207699_101048092 | 268 |
| 617 | 3300025906 | Ga0207699_10117232 | Ga0207699_101172322 | 268 |
| 618 | 3300025906 | Ga0207699_10126084 | Ga0207699_101260842 | 268 |
| 619 | 3300025906 | Ga0207699_10162179 | Ga0207699_101621792 | 268 |
| 620 | 3300025906 | Ga0207699_10187640 | Ga0207699_101876402 | 268 |
| 621 | 3300025906 | Ga0207699_10246682 | Ga0207699_102466821 | 268 |
| 622 | 3300025906 | Ga0207699_10251533 | Ga0207699_102515332 | 268 |
| 623 | 3300025907 | Ga0207645_10001175 | Ga0207645_1000117513 | 268 |
| 624 | 3300025907 | Ga0207645_10043419 | Ga0207645_100434192 | 268 |
| 625 | 3300025908 | Ga0207643_10000391 | Ga0207643_100003915 | 268 |
| 626 | 3300025909 | Ga0207705_10173386 | Ga0207705_101733862 | 268 |
| 627 | 3300025910 | Ga0207684_10001228 | Ga0207684_1000122822 | 268 |
| 628 | 3300025910 | Ga0207684_10001445 | Ga0207684_100014459 | 268 |
| 629 | 3300025910 | Ga0207684_10001633 | Ga0207684_100016333 | 268 |
| 630 | 3300025910 | Ga0207684_10030972 | Ga0207684_100309724 | 268 |
| 631 | 3300025910 | Ga0207684_10066170 | Ga0207684_100661702 | 268 |
| 632 | 3300025910 | Ga0207684_10089974 | Ga0207684_100899741 | 268 |
| 633 | 3300025910 | Ga0207684_10105717 | Ga0207684_101057173 | 268 |
| 634 | 3300025911 | Ga0207654_10016176 | Ga0207654_100161763 | 268 |
| 635 | 3300025911 | Ga0207654_10035438 | Ga0207654_100354383 | 268 |
| 636 | 3300025911 | Ga0207654_10092027 | Ga0207654_100920271 | 268 |
| 637 | 3300025912 | Ga0207707_10007054 | Ga0207707_1000705410 | 268 |
| 638 | 3300025912 | Ga0207707_10024519 | Ga0207707_100245192 | 268 |
| 639 | 3300025913 | Ga0207695_10055095 | Ga0207695_100550953 | 268 |
| 640 | 3300025914 | Ga0207671_10010924 | Ga0207671_100109242 | 268 |
| 641 | 3300025914 | Ga0207671_10349776 | Ga0207671_103497762 | 268 |
| 642 | 3300025915 | Ga0207693_10000403 | Ga0207693_100004033 | 268 |
| 643 | 3300025915 | Ga0207693_10019304 | Ga0207693_100193043 | 268 |
| 644 | 3300025915 | Ga0207693_10025559 | Ga0207693_100255592 | 268 |
| 645 | 3300025915 | Ga0207693_10032951 | Ga0207693_100329512 | 268 |
| 646 | 3300025915 | Ga0207693_10093298 | Ga0207693_100932982 | 268 |
| 647 | 3300025915 | Ga0207693_10124888 | Ga0207693_101248882 | 268 |
| 648 | 3300025915 | Ga0207693_10144533 | Ga0207693_101445332 | 268 |
| 649 | 3300025915 | Ga0207693_10254760 | Ga0207693_102547601 | 268 |
| 650 | 3300025915 | Ga0207693_10337500 | Ga0207693_103375001 | 268 |
| 651 | 3300025916 | Ga0207663_10132822 | Ga0207663_101328222 | 268 |
| 652 | 3300025916 | Ga0207663_10145153 | Ga0207663_101451533 | 268 |
| 653 | 3300025916 | Ga0207663_10485923 | Ga0207663_104859231 | 268 |
| 654 | 3300025918 | Ga0207662_10004876 | Ga0207662_100048763 | 268 |
| 655 | 3300025919 | Ga0207657_10000404 | Ga0207657_100004042 | 268 |
| 656 | 3300025919 | Ga0207657_10004616 | Ga0207657_100046164 | 268 |
| 657 | 3300025919 | Ga0207657_10010530 | Ga0207657_100105303 | 268 |
| 658 | 3300025920 | Ga0207649_10000250 | Ga0207649_100002502 | 268 |
| 659 | 3300025920 | Ga0207649_10016637 | Ga0207649_100166374 | 268 |
| 660 | 3300025920 | Ga0207649_10078855 | Ga0207649_100788552 | 268 |
| 661 | 3300025921 | Ga0207652_10009055 | Ga0207652_100090553 | 268 |
| 662 | 3300025922 | Ga0207646_10001233 | Ga0207646_1000123330 | 268 |
| 663 | 3300025922 | Ga0207646_10002176 | Ga0207646_100021763 | 268 |
| 664 | 3300025922 | Ga0207646_10114528 | Ga0207646_101145282 | 268 |
| 665 | 3300025922 | Ga0207646_10249834 | Ga0207646_102498342 | 268 |
| 666 | 3300025922 | Ga0207646_10333431 | Ga0207646_103334311 | 268 |
| 667 | 3300025922 | Ga0207646_10341771 | Ga0207646_103417712 | 268 |
| 668 | 3300025922 | Ga0207646_10381264 | Ga0207646_103812642 | 268 |
| 669 | 3300025923 | Ga0207681_10172452 | Ga0207681_101724522 | 268 |
| 670 | 3300025924 | Ga0207694_10008362 | Ga0207694_100083622 | 268 |
| 671 | 3300025925 | Ga0207650_10000124 | Ga0207650_1000012427 | 268 |
| 672 | 3300025926 | Ga0207659_10024310 | Ga0207659_100243104 | 268 |
| 673 | 3300025927 | Ga0207687_10007312 | Ga0207687_100073124 | 268 |
| 674 | 3300025927 | Ga0207687_10013447 | Ga0207687_100134476 | 268 |
| 675 | 3300025927 | Ga0207687_10058589 | Ga0207687_100585892 | 268 |
| 676 | 3300025928 | Ga0207700_10000273 | Ga0207700_1000027321 | 268 |
| 677 | 3300025928 | Ga0207700_10006930 | Ga0207700_100069303 | 268 |
| 678 | 3300025928 | Ga0207700_10040290 | Ga0207700_100402902 | 268 |
| 679 | 3300025928 | Ga0207700_10188032 | Ga0207700_101880322 | 268 |
| 680 | 3300025928 | Ga0207700_10230367 | Ga0207700_102303672 | 268 |
| 681 | 3300025928 | Ga0207700_10322721 | Ga0207700_103227212 | 268 |
| 682 | 3300025928 | Ga0207700_10341955 | Ga0207700_103419552 | 268 |
| 683 | 3300025928 | Ga0207700_10613750 | Ga0207700_106137501 | 268 |
| 684 | 3300025929 | Ga0207664_10000369 | Ga0207664_1000036916 | 268 |
| 685 | 3300025929 | Ga0207664_10080165 | Ga0207664_100801652 | 268 |
| 686 | 3300025929 | Ga0207664_10200784 | Ga0207664_102007841 | 268 |
| 687 | 3300025929 | Ga0207664_10329448 | Ga0207664_103294482 | 268 |
| 688 | 3300025929 | Ga0207664_10334779 | Ga0207664_103347791 | 268 |
| 689 | 3300025931 | Ga0207644_10039951 | Ga0207644_100399512 | 268 |
| 690 | 3300025931 | Ga0207644_10066456 | Ga0207644_100664562 | 268 |
| 691 | 3300025932 | Ga0207690_10005284 | Ga0207690_100052844 | 268 |
| 692 | 3300025932 | Ga0207690_10137741 | Ga0207690_101377413 | 268 |
| 693 | 3300025932 | Ga0207690_10324936 | Ga0207690_103249362 | 268 |
| 694 | 3300025933 | Ga0207706_10001777 | Ga0207706_100017777 | 268 |
| 695 | 3300025933 | Ga0207706_10008223 | Ga0207706_100082232 | 268 |
| 696 | 3300025933 | Ga0207706_10008485 | Ga0207706_100084852 | 268 |
| 697 | 3300025934 | Ga0207686_10082092 | Ga0207686_100820922 | 268 |
| 698 | 3300025935 | Ga0207709_10087310 | Ga0207709_100873102 | 268 |
| 699 | 3300025935 | Ga0207709_10279611 | Ga0207709_102796111 | 268 |
| 700 | 3300025938 | Ga0207704_10055013 | Ga0207704_100550132 | 268 |
| 701 | 3300025938 | Ga0207704_10234449 | Ga0207704_102344492 | 268 |
| 702 | 3300025939 | Ga0207665_10008417 | Ga0207665_100084174 | 268 |
| 703 | 3300025939 | Ga0207665_10010607 | Ga0207665_100106074 | 268 |
| 704 | 3300025939 | Ga0207665_10030144 | Ga0207665_100301442 | 268 |
| 705 | 3300025939 | Ga0207665_10032978 | Ga0207665_100329782 | 268 |
| 706 | 3300025939 | Ga0207665_10040931 | Ga0207665_100409313 | 268 |
| 707 | 3300025939 | Ga0207665_10051398 | Ga0207665_100513982 | 268 |
| 708 | 3300025939 | Ga0207665_10249062 | Ga0207665_102490622 | 268 |
| 709 | 3300025940 | Ga0207691_10014213 | Ga0207691_100142135 | 268 |
| 710 | 3300025941 | Ga0207711_10003212 | Ga0207711_100032125 | 268 |
| 711 | 3300025941 | Ga0207711_10004172 | Ga0207711_100041722 | 268 |
| 712 | 3300025942 | Ga0207689_10068438 | Ga0207689_100684381 | 268 |
| 713 | 3300025944 | Ga0207661_10000779 | Ga0207661_1000077916 | 268 |
| 714 | 3300025945 | Ga0207679_10000084 | Ga0207679_1000008420 | 268 |
| 715 | 3300025949 | Ga0207667_10027636 | Ga0207667_100276363 | 268 |
| 716 | 3300025949 | Ga0207667_10030517 | Ga0207667_100305172 | 268 |
| 717 | 3300025949 | Ga0207667_10068942 | Ga0207667_100689422 | 268 |
| 718 | 3300025960 | Ga0207651_10004758 | Ga0207651_100047588 | 268 |
| 719 | 3300025961 | Ga0207712_10221258 | Ga0207712_102212582 | 268 |
| 720 | 3300025961 | Ga0207712_10524201 | Ga0207712_105242011 | 268 |
| 721 | 3300025972 | Ga0207668_10039947 | Ga0207668_100399471 | 268 |
| 722 | 3300025972 | Ga0207668_10048448 | Ga0207668_100484482 | 268 |
| 723 | 3300025986 | Ga0207658_10006671 | Ga0207658_100066718 | 268 |
| 724 | 3300025986 | Ga0207658_10282300 | Ga0207658_102823001 | 268 |
| 725 | 3300026023 | Ga0207677_10015304 | Ga0207677_100153043 | 268 |
| 726 | 3300026023 | Ga0207677_10040265 | Ga0207677_100402652 | 268 |
| 727 | 3300026023 | Ga0207677_10261112 | Ga0207677_102611122 | 268 |
| 728 | 3300026023 | Ga0207677_10476014 | Ga0207677_104760141 | 268 |
| 729 | 3300026035 | Ga0207703_10045781 | Ga0207703_100457814 | 268 |
| 730 | 3300026041 | Ga0207639_10003861 | Ga0207639_100038617 | 268 |
| 731 | 3300026067 | Ga0207678_10002403 | Ga0207678_100024032 | 268 |
| 732 | 3300026067 | Ga0207678_10005424 | Ga0207678_100054249 | 268 |
| 733 | 3300026067 | Ga0207678_10143568 | Ga0207678_101435682 | 268 |
| 734 | 3300026078 | Ga0207702_10001068 | Ga0207702_1000106813 | 268 |
| 735 | 3300026078 | Ga0207702_10010995 | Ga0207702_100109952 | 268 |
| 736 | 3300026078 | Ga0207702_10013997 | Ga0207702_100139971 | 268 |
| 737 | 3300026078 | Ga0207702_10132573 | Ga0207702_101325732 | 268 |
| 738 | 3300026078 | Ga0207702_10257217 | Ga0207702_102572172 | 268 |
| 739 | 3300026088 | Ga0207641_10000006 | Ga0207641_10000006164 | 268 |
| 740 | 3300026089 | Ga0207648_10001425 | Ga0207648_100014252 | 268 |
| 741 | 3300026089 | Ga0207648_10057077 | Ga0207648_100570773 | 268 |
| 742 | 3300026095 | Ga0207676_10000615 | Ga0207676_100006156 | 268 |
| 743 | 3300026116 | Ga0207674_10001059 | Ga0207674_1000105919 | 268 |
| 744 | 3300026116 | Ga0207674_10056122 | Ga0207674_100561224 | 268 |
| 745 | 3300026116 | Ga0207674_10259686 | Ga0207674_102596862 | 268 |
| 746 | 3300026118 | Ga0207675_100031140 | Ga0207675_1000311406 | 268 |
| 747 | 3300026118 | Ga0207675_100052899 | Ga0207675_1000528993 | 268 |
| 748 | 3300026118 | Ga0207675_100316514 | Ga0207675_1003165142 | 268 |
| 749 | 3300026121 | Ga0207683_10001543 | Ga0207683_1000154314 | 268 |
| 750 | 3300026121 | Ga0207683_10021577 | Ga0207683_100215772 | 268 |
| 751 | 3300026142 | Ga0207698_10356147 | Ga0207698_103561472 | 268 |
| 752 | 3300026142 | Ga0207698_10386754 | Ga0207698_103867541 | 268 |
| 753 | 3300028017 | Ga0265356_1000828 | Ga0265356_10008282 | 268 |
| 754 | 3300028379 | Ga0268266_10001591 | Ga0268266_1000159113 | 268 |
| 755 | 3300028380 | Ga0268265_10055937 | Ga0268265_100559372 | 268 |
| 756 | 3300028381 | Ga0268264_10053361 | Ga0268264_100533612 | 268 |
| 757 | 3300028800 | Ga0265338_10001433 | Ga0265338_100014332 | 268 |
| 758 | 3300028800 | Ga0265338_10099018 | Ga0265338_100990182 | 268 |
| 759 | 3300028800 | Ga0265338_10194389 | Ga0265338_101943892 | 268 |
| 760 | 3300028800 | Ga0265338_10308892 | Ga0265338_103088921 | 268 |
| 761 | 3300030760 | Ga0265762_1000624 | Ga0265762_10006242 | 268 |
| 762 | 3300030879 | Ga0265765_1014203 | Ga0265765_10142031 | 268 |
| 763 | 3300031090 | Ga0265760_10002488 | Ga0265760_100024882 | 268 |
| 764 | 3300031090 | Ga0265760_10003500 | Ga0265760_100035004 | 268 |
| 765 | 3300031090 | Ga0265760_10005087 | Ga0265760_100050873 | 268 |
| 766 | 3300031090 | Ga0265760_10012659 | Ga0265760_100126591 | 268 |
| 767 | 3300031090 | Ga0265760_10022295 | Ga0265760_100222952 | 268 |
| 768 | 3300031090 | Ga0265760_10030148 | Ga0265760_100301482 | 268 |
| 769 | 3300031241 | Ga0265325_10045881 | Ga0265325_100458812 | 268 |
| 770 | 3300031249 | Ga0265339_10036741 | Ga0265339_100367414 | 268 |
| 771 | 3300035083 | Ga0373926_0010540 | Ga0373926_0010540_203_1009 | 268 |
| 772 | 3300035086 | Ga0373934_0007445 | Ga0373934_0007445_1988_2794 | 268 |
| 773 | 3300035089 | Ga0373944_0032896 | Ga0373944_0032896_204_1010 | 268 |
| 774 | 3300035111 | Ga0373923_0021997 | Ga0373923_0021997_802_1608 | 268 |
| 775 | 3300035113 | Ga0373936_0001155 | Ga0373936_0001155_8017_8823 | 268 |
| 776 | 3300035113 | Ga0373936_0009759 | Ga0373936_0009759_407_1213 | 268 |
| 777 | 3300035116 | Ga0373945_0012240 | Ga0373945_0012240_2003_2809 | 268 |
| 778 | 3300035116 | Ga0373945_0023231 | Ga0373945_0023231_388_1194 | 268 |
| 779 | 3300035117 | Ga0373953_0044465 | Ga0373953_0044465_886_1692 | 268 |
| 780 | 3300035117 | Ga0373953_0055699 | Ga0373953_0055699_640_1446 | 268 |
| 781 | 3300035118 | Ga0373954_0000475 | Ga0373954_0000475_4131_4937 | 268 |
| 782 | 3300035118 | Ga0373954_0057777 | Ga0373954_0057777_551_1357 | 268 |
| 783 | 3300035118 | Ga0373954_0181570 | Ga0373954_0181570_31_837 | 268 |
| 784 | 3300035119 | Ga0373956_0019698 | Ga0373956_0019698_877_1683 | 268 |
| 785 | 3300035119 | Ga0373956_0076692 | Ga0373956_0076692_282_1088 | 268 |
| 786 | 3300035170 | Ga0373943_0000002 | Ga0373943_0000002_95526_96332 | 268 |
| 787 | 3300035171 | Ga0373946_0015758 | Ga0373946_0015758_1709_2515 | 268 |
| 788 | 3300035172 | Ga0373955_0005326 | Ga0373955_0005326_1027_1833 | 268 |
| 789 | 3300035410 | Ga0373924_0010012 | Ga0373924_0010012_1007_1813 | 268 |
| 790 | 3300035691 | Ga0373931_0016703 | Ga0373931_0016703_2405_3211 | 268 |
| 791 | 3300035692 | Ga0373935_0001381 | Ga0373935_0001381_3024_3830 | 268 |
| 792 | 3300035692 | Ga0373935_0010991 | Ga0373935_0010991_3538_4344 | 268 |
| 793 | 3300035692 | Ga0373935_0324011 | Ga0373935_0324011_41_847 | 268 |
| 794 | 3300035695 | Ga0373927_0000021 | Ga0373927_0000021_96695_97501 | 268 |
| 795 | 3300035695 | Ga0373927_0142778 | Ga0373927_0142778_513_1319 | 268 |
| 796 | 3300035724 | Ga0373933_0000280 | Ga0373933_0000280_4705_5511 | 268 |
| 797 | 3300035724 | Ga0373933_0028973 | Ga0373933_0028973_1947_2753 | 268 |
| 798 | 3300035724 | Ga0373933_0108872 | Ga0373933_0108872_618_1424 | 268 |
| 799 | 3300036401 | Ga0373937_0000932 | Ga0373937_0000932_19617_20423 | 268 |
| 800 | 3300036401 | Ga0373937_0119670 | Ga0373937_0119670_1314_2120 | 268 |
| 801 | 3300036401 | Ga0373937_0150777 | Ga0373937_0150777_798_1604 | 268 |
| 802 | 3300037068 | Ga0373925_0000151 | Ga0373925_0000151_45897_46703 | 268 |
| 803 | 3300037068 | Ga0373925_0009744 | Ga0373925_0009744_236_1042 | 268 |
| 804 | 3300037068 | Ga0373925_0045837 | Ga0373925_0045837_1456_2262 | 268 |
| 805 | 3300039450 | Ga0436363_0566584 | Ga0436363_0566584_719_1525 | 268 |
| 806 | 3300039453 | Ga0436362_0103387 | Ga0436362_0103387_259_1065 | 268 |
| 807 | 3300046459 | Ga0495629_0026960 | Ga0495629_0026960_2461_3267 | 268 |
| 808 | 3300046461 | Ga0495641_0037034 | Ga0495641_0037034_344_1150 | 268 |
| 809 | 3300046462 | Ga0495651_0032478 | Ga0495651_0032478_744_1550 | 268 |
| 810 | 3300046472 | Ga0495580_0001399 | Ga0495580_0001399_3999_4805 | 268 |
| 811 | 3300046472 | Ga0495580_0002731 | Ga0495580_0002731_3848_4654 | 268 |
| 812 | 3300046472 | Ga0495580_0003320 | Ga0495580_0003320_7612_8418 | 268 |
| 813 | 3300046473 | Ga0495582_0000740 | Ga0495582_0000740_13957_14763 | 268 |
| 814 | 3300046473 | Ga0495582_0229225 | Ga0495582_0229225_143_949 | 268 |
| 815 | 3300046475 | Ga0495639_0032047 | Ga0495639_0032047_1369_2175 | 268 |
| 816 | 3300046477 | Ga0495664_0003944 | Ga0495664_0003944_3807_4613 | 268 |
| 817 | 3300046477 | Ga0495664_0042197 | Ga0495664_0042197_320_1126 | 268 |
| 818 | 3300046499 | Ga0495594_0046273 | Ga0495594_0046273_1395_2201 | 268 |
| 819 | 3300046511 | Ga0495608_0060570 | Ga0495608_0060570_323_1129 | 268 |
| 820 | 3300046517 | Ga0495630_0039085 | Ga0495630_0039085_912_1718 | 268 |
| 821 | 3300046517 | Ga0495630_0040152 | Ga0495630_0040152_2161_2967 | 268 |
| 822 | 3300046517 | Ga0495630_0362822 | Ga0495630_0362822_212_1018 | 268 |
| 823 | 3300046531 | Ga0495665_0034697 | Ga0495665_0034697_591_1397 | 268 |
| 824 | 3300046533 | Ga0495640_0055945 | Ga0495640_0055945_968_1774 | 268 |
| 825 | 3300046535 | Ga0495586_0043098 | Ga0495586_0043098_1450_2256 | 268 |
| 826 | 3300046536 | Ga0495587_0002156 | Ga0495587_0002156_9211_10017 | 268 |
| 827 | 3300046663 | Ga0495635_0073044 | Ga0495635_0073044_1516_2322 | 268 |
| 828 | 3300046679 | Ga0495623_0052150 | Ga0495623_0052150_350_1156 | 268 |
| 829 | 3300046681 | Ga0495647_0006318 | Ga0495647_0006318_1308_2114 | 268 |
| 830 | 3300046683 | Ga0495658_0019002 | Ga0495658_0019002_1372_2178 | 268 |
| 831 | 3300046684 | Ga0495669_0152987 | Ga0495669_0152987_187_993 | 268 |
| 832 | 3300046690 | Ga0495624_0071534 | Ga0495624_0071534_443_1249 | 268 |
| 833 | 3300047317 | Ga0495604_0002567 | Ga0495604_0002567_9391_10197 | 268 |
| 834 | 3300047319 | Ga0495674_0010839 | Ga0495674_0010839_7631_8437 | 268 |
| 835 | 3300047319 | Ga0495674_0060767 | Ga0495674_0060767_392_1198 | 268 |
| 836 | 3300047319 | Ga0495674_0311434 | Ga0495674_0311434_340_1146 | 268 |
| 837 | 3300047321 | Ga0495676_0037314 | Ga0495676_0037314_852_1658 | 268 |
| 838 | 3300047322 | Ga0495680_0053832 | Ga0495680_0053832_1086_1892 | 268 |
| 839 | 3300047471 | Ga0495684_0055020 | Ga0495684_0055020_1544_2350 | 268 |
| 840 | 3300047673 | Ga0495593_0117137 | Ga0495593_0117137_116_922 | 268 |
| 841 | 3300048088 | Ga0495602_0005726 | Ga0495602_0005726_5506_6312 | 268 |
| 842 | 3300048088 | Ga0495602_0162949 | Ga0495602_0162949_298_1104 | 268 |
| 843 | 3300048089 | Ga0495614_0046936 | Ga0495614_0046936_624_1430 | 268 |
| 844 | 3300048903 | Ga0496100_0185522 | Ga0496100_0185522_541_1347 | 268 |
| 845 | 3300048904 | Ga0496101_0347876 | Ga0496101_0347876_184_990 | 268 |
| 846 | 3300048905 | Ga0496102_0008775 | Ga0496102_0008775_354_1160 | 268 |
| 847 | 3300048905 | Ga0496102_0010411 | Ga0496102_0010411_6904_7710 | 268 |
| 848 | 3300048905 | Ga0496102_0058594 | Ga0496102_0058594_751_1557 | 268 |
| 849 | 3300048905 | Ga0496102_0066826 | Ga0496102_0066826_1626_2432 | 268 |
| 850 | 3300048906 | Ga0496103_0005654 | Ga0496103_0005654_4235_5041 | 268 |
| 851 | 3300048906 | Ga0496103_0141251 | Ga0496103_0141251_355_1161 | 268 |
| 852 | 3300048907 | Ga0496104_0104969 | Ga0496104_0104969_319_1125 | 268 |
| 853 | 3300048907 | Ga0496104_0205488 | Ga0496104_0205488_858_1664 | 268 |
| 854 | 3300048908 | Ga0496105_0067714 | Ga0496105_0067714_646_1452 | 268 |
| 855 | 3300048908 | Ga0496105_0132881 | Ga0496105_0132881_1129_1935 | 268 |
| 856 | 3300048909 | Ga0496106_0042053 | Ga0496106_0042053_335_1141 | 268 |
| 857 | 3300048910 | Ga0496107_0121540 | Ga0496107_0121540_756_1562 | 268 |
| 858 | 3300048911 | Ga0496108_0000200 | Ga0496108_0000200_49743_50549 | 268 |
| 859 | 3300048912 | Ga0496109_0000149 | Ga0496109_0000149_18056_18862 | 268 |
| 860 | 3300048912 | Ga0496109_0029141 | Ga0496109_0029141_1859_2665 | 268 |
| 861 | 3300048913 | Ga0496110_0011543 | Ga0496110_0011543_535_1341 | 268 |
| 862 | 3300048913 | Ga0496110_0014791 | Ga0496110_0014791_1927_2733 | 268 |
| 863 | 3300048914 | Ga0496111_0301695 | Ga0496111_0301695_293_1099 | 268 |
| 864 | 3300048915 | Ga0496112_0000070 | Ga0496112_0000070_32086_32892 | 268 |
| 865 | 3300048915 | Ga0496112_0071705 | Ga0496112_0071705_567_1373 | 268 |
| 866 | 3300048915 | Ga0496112_0162547 | Ga0496112_0162547_309_1115 | 268 |
| 867 | 3300048916 | Ga0496113_0000078 | Ga0496113_0000078_34881_35687 | 268 |
| 868 | 3300048917 | Ga0496114_0341019 | Ga0496114_0341019_43_849 | 268 |
| 869 | 3300048918 | Ga0496115_0016864 | Ga0496115_0016864_4165_4971 | 268 |
| 870 | 3300048918 | Ga0496115_0047127 | Ga0496115_0047127_1785_2591 | 268 |
| 871 | 3300049583 | Ga0501067_0113626 | Ga0501067_0113626_464_1270 | 268 |
| 872 | 3300049744 | Ga0501083_0050669 | Ga0501083_0050669_550_1356 | 268 |
| 873 | 3300050512 | nmdc:mga0n895_492038_c1 | nmdc:mga0n895_492038_c1_312_1118 | 268 |
| 874 | 3300050512 | nmdc:mga0n895_926_c1 | nmdc:mga0n895_926_c1_16171_16977 | 268 |
| 875 | 3300050513 | nmdc:mga0rr50_287554_c1 | nmdc:mga0rr50_287554_c1_211_1017 | 268 |
| 876 | 3300050513 | nmdc:mga0rr50_7147_c1 | nmdc:mga0rr50_7147_c1_2039_2845 | 268 |
| 877 | 3300050514 | nmdc:mga08x19_3079_c1 | nmdc:mga08x19_3079_c1_2874_3680 | 268 |
| 878 | 3300050514 | nmdc:mga08x19_3287_c1 | nmdc:mga08x19_3287_c1_858_1664 | 268 |
| 879 | 3300050515 | nmdc:mga0a205_149_c2 | nmdc:mga0a205_149_c2_10612_11418 | 268 |
| 880 | 3300053077 | Ga0495601_0095488 | Ga0495601_0095488_853_1659 | 268 |
| 881 | 3300053078 | Ga0495612_0118616 | Ga0495612_0118616_22_828 | 268 |
| 882 | 3300053085 | Ga0495619_0055893 | Ga0495619_0055893_1061_1867 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gym-assembly1.cif.gz_c2 | cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 | 0.8984 | 174 | 259 |
| 5u7n-assembly7.cif.gz_G | crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop | 0.8931 | 114 | 252 |
| 7w5z-assembly1.cif.gz_c2 | cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model | 0.8919 | 174 | 266 |
| 2cua-assembly2.cif.gz_B | the cua domain of cytochrome ba3 from thermus thermophilus | 0.8905 | 112 | 252 |
| 6ptt-assembly2.cif.gz_B | soluble model of arabidopsis thaliana cua (tt3lat) | 0.8902 | 116 | 250 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6ED90_406_498_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9586 | 178 | 259 | 2.60.40.420 |
| af_Q8I6V2_60_165_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.929 | 175 | 258 | 2.60.40.420 |
| 4hcfA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8969 | 178 | 251 | 2.60.40.420 |
| 2yevE02 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8953 | 116 | 262 | 2.60.40.420 |
| 5u7nF00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8919 | 114 | 252 | 2.60.40.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5UWG5-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9718 | 176 | 266 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-V4Y3K9-F1-model_v4 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | 0.9688 | 181 | 263 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A6M0AKU6-F1-model_v4 | Cytochrome c oxidase subunit II | 0.9674 | 178 | 261 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A536T2D0-F1-model_v4 | C-type cytochrome | 0.9659 | 178 | 268 |
GO:0004129
GO:0005507 GO:0016020 GO:0020037 GO:0042773 |
| AF-A0A1U8F2V9-F1-model_v4 | deleted | 0.9642 | 178 | 266 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar