F484557

General Info

Members Datasets Scaffolds Average Seq Length
882 320 882 268

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0004110|Ga0373926_0004110_641_1522
Length 293
Sequence VISACGKQARKNPGAETMLSRRLERGSTSVALAFSVFLAFMTLVTVYIFWAKIWWFPPAITDFGHEIDSQFTRTFLITGIVFVAAQLGLAYAIFKFRDQGQKATYFEGNNTMEIVWTLATVVLFVGLGLYARNAWAEVHFMGAAPGALQIEVTGQQFVWNFRYAGQDGKFGREKPELVSASTGNPVGLDPTDPASKDDIVSPVIAVPAGREVELIIRSQDVTHSFFVRELRLKQDAVPGMEIHMHFTATVPGDYELVCAELCGLGHYRMHSMLSVMTEADFEKWQKEQEAANQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
138 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
208 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
214 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.42
Rhizosphere 95.35
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3570058 2162886012 Unclassified 1520
2 LJNas_1000490 3300000546 Bacteria 6924
3 JGI24752J21851_1005021 3300001976 Bacteria 1730
4 JGI24747J21853_1001593 3300001978 Bacteria 1730
5 JGI24743J22301_10007922 3300001991 Bacteria 1853
6 JGI24749J21850_1006732 3300002076 Bacteria 1598
7 JGI24744J21845_10039926 3300002077 Unclassified 879
8 JGI24033J26618_1005663 3300002155 Bacteria 1384
9 JGI24034J26672_10000271 3300002239 Bacteria 6830
10 JGI24751J29686_10001862 3300002459 Bacteria 4323
11 Ga0058859_11144590 3300004798 Unclassified 1081
12 Ga0065704_10174353 3300005289 Bacteria 1273
13 Ga0065712_10012241 3300005290 Unclassified 1872
14 Ga0065712_10077587 3300005290 Bacteria 3472
15 Ga0065715_10036466 3300005293 Bacteria 1253
16 Ga0065715_10060498 3300005293 Bacteria 987
17 Ga0065715_10090120 3300005293 Bacteria 7629
18 Ga0065707_10021967 3300005295 Bacteria 1810
19 Ga0070658_10075888 3300005327 Bacteria 2758
20 Ga0070676_10032231 3300005328 Bacteria 3001
21 Ga0070683_100010189 3300005329 Bacteria 8071
22 Ga0070690_100132376 3300005330 Bacteria 1685
23 Ga0070670_100007150 3300005331 Bacteria 9454
24 Ga0070677_10166839 3300005333 Unclassified 1037
25 Ga0068869_100010394 3300005334 Bacteria 6071
26 Ga0068869_100086016 3300005334 Bacteria 2356
27 Ga0068869_100401518 3300005334 Bacteria 1127
28 Ga0070666_10010583 3300005335 Bacteria 5773
29 Ga0070666_10013323 3300005335 Bacteria 5214
30 Ga0070680_100196766 3300005336 Bacteria 1699
31 Ga0070682_100092903 3300005337 Bacteria 1977
32 Ga0070682_100587186 3300005337 Bacteria 877
33 Ga0068868_100008166 3300005338 Bacteria 7489
34 Ga0068868_100093373 3300005338 Bacteria 2426
35 Ga0068868_100100076 3300005338 Bacteria 2345
36 Ga0068868_100384807 3300005338 Bacteria 1208
37 Ga0068868_100459952 3300005338 Bacteria 1108
38 Ga0070660_100009321 3300005339 Bacteria 6897
39 Ga0070689_100036687 3300005340 Bacteria 3749
40 Ga0070691_10052211 3300005341 Bacteria 1955
41 Ga0070687_100008433 3300005343 Bacteria 4366
42 Ga0070661_100001784 3300005344 Bacteria 14921
43 Ga0070661_100015246 3300005344 Bacteria 5424
44 Ga0070661_100027302 3300005344 Bacteria 4109
45 Ga0070692_10066722 3300005345 Bacteria 1908
46 Ga0070668_100021287 3300005347 Bacteria 4902
47 Ga0070668_100047594 3300005347 Bacteria 3297
48 Ga0070668_100427857 3300005347 Bacteria 1134
49 Ga0070669_100008906 3300005353 Bacteria 7160
50 Ga0070669_100012442 3300005353 Bacteria 6038
51 Ga0070669_100105105 3300005353 Unclassified 2136
52 Ga0070669_100239770 3300005353 Bacteria 1440
53 Ga0070675_100075159 3300005354 Bacteria 2808
54 Ga0070671_100150162 3300005355 Bacteria 1967
55 Ga0070671_100336129 3300005355 Bacteria 1288
56 Ga0070674_100006091 3300005356 Bacteria 7013
57 Ga0070673_100008201 3300005364 Bacteria 6933
58 Ga0070688_100000910 3300005365 Bacteria 14779
59 Ga0070659_100003912 3300005366 Bacteria 10600
60 Ga0070659_100072123 3300005366 Bacteria 2747
61 Ga0070667_100362381 3300005367 Unclassified 1314
62 Ga0070667_100488729 3300005367 Bacteria 1127
63 Ga0070709_10001126 3300005434 Bacteria 14761
64 Ga0070709_10023770 3300005434 Bacteria 3603
65 Ga0070709_10042726 3300005434 Bacteria 2800
66 Ga0070709_10043810 3300005434 Bacteria 2769
67 Ga0070709_10054944 3300005434 Bacteria 2512
68 Ga0070709_10069348 3300005434 Bacteria 2270
69 Ga0070709_10077159 3300005434 Bacteria 2165
70 Ga0070709_10184316 3300005434 Bacteria 1468
71 Ga0070709_10297676 3300005434 Bacteria 1177
72 Ga0070709_10314946 3300005434 Bacteria 1147
73 Ga0070709_10423770 3300005434 Bacteria 998
74 Ga0070714_100004845 3300005435 Bacteria 10215
75 Ga0070714_100027361 3300005435 Bacteria 4721
76 Ga0070714_100065168 3300005435 Bacteria 3138
77 Ga0070714_100079630 3300005435 Unclassified 2849
78 Ga0070714_100086463 3300005435 Bacteria 2740
79 Ga0070714_100296553 3300005435 Bacteria 1506
80 Ga0070714_100394967 3300005435 Bacteria 1306
81 Ga0070713_100000288 3300005436 Bacteria 33342
82 Ga0070713_100000337 3300005436 Bacteria 30469
83 Ga0070713_100009860 3300005436 Bacteria 6869
84 Ga0070713_100016178 3300005436 Bacteria 5606
85 Ga0070713_100025846 3300005436 Bacteria 4599
86 Ga0070713_100060343 3300005436 Bacteria 3170
87 Ga0070713_100061724 3300005436 Bacteria 3136
88 Ga0070713_100098953 3300005436 Bacteria 2523
89 Ga0070713_100171928 3300005436 Bacteria 1941
90 Ga0070713_100436796 3300005436 Bacteria 1227
91 Ga0070710_10023036 3300005437 Bacteria 3267
92 Ga0070710_10035310 3300005437 Bacteria 2725
93 Ga0070710_10043821 3300005437 Bacteria 2480
94 Ga0070710_10143191 3300005437 Bacteria 1468
95 Ga0070711_100000500 3300005439 Bacteria 20405
96 Ga0070711_100001487 3300005439 Bacteria 12854
97 Ga0070711_100010972 3300005439 Bacteria 5616
98 Ga0070711_100018440 3300005439 Bacteria 4457
99 Ga0070711_100057138 3300005439 Bacteria 2701
100 Ga0070711_100162362 3300005439 Bacteria 1695
101 Ga0070711_100263576 3300005439 Unclassified 1357
102 Ga0070705_100005272 3300005440 Bacteria 6284
103 Ga0070705_100015063 3300005440 Unclassified 3990
104 Ga0070705_100163695 3300005440 Bacteria 1490
105 Ga0070700_100398200 3300005441 Unclassified 1034
106 Ga0070700_100556417 3300005441 Bacteria 892
107 Ga0070694_100003742 3300005444 Bacteria 9070
108 Ga0070708_100001706 3300005445 Bacteria 16894
109 Ga0070708_100002037 3300005445 Bacteria 15565
110 Ga0070708_100002957 3300005445 Bacteria 13208
111 Ga0070708_100004925 3300005445 Bacteria 10556
112 Ga0070708_100005336 3300005445 Bacteria 10192
113 Ga0070708_100017864 3300005445 Bacteria 5925
114 Ga0070708_100042813 3300005445 Bacteria 3977
115 Ga0070708_100105507 3300005445 Bacteria 2585
116 Ga0070708_100129685 3300005445 Bacteria 2333
117 Ga0070708_100170989 3300005445 Bacteria 2029
118 Ga0070708_100178221 3300005445 Bacteria 1986
119 Ga0070708_100433358 3300005445 Bacteria 1240
120 Ga0070708_100624857 3300005445 Unclassified 1015
121 Ga0070663_100030211 3300005455 Bacteria 3710
122 Ga0070663_100065306 3300005455 Bacteria 2633
123 Ga0070678_100053113 3300005456 Bacteria 2945
124 Ga0070678_100072169 3300005456 Bacteria 2587
125 Ga0070662_100008948 3300005457 Bacteria 6527
126 Ga0070662_100085562 3300005457 Bacteria 2356
127 Ga0070681_10070592 3300005458 Bacteria 3458
128 Ga0070681_10087553 3300005458 Bacteria 3067
129 Ga0068867_100186233 3300005459 Bacteria 1653
130 Ga0070685_10035425 3300005466 Bacteria 2815
131 Ga0070685_10040781 3300005466 Bacteria 2643
132 Ga0070706_100000296 3300005467 Bacteria 60457
133 Ga0070706_100000932 3300005467 Bacteria 32006
134 Ga0070706_100002114 3300005467 Bacteria 20233
135 Ga0070706_100014539 3300005467 Bacteria 7271
136 Ga0070706_100023186 3300005467 Bacteria 5716
137 Ga0070706_100152958 3300005467 Bacteria 2154
138 Ga0070706_100426572 3300005467 Unclassified 1234
139 Ga0070707_100001241 3300005468 Bacteria 25060
140 Ga0070707_100001443 3300005468 Bacteria 23285
141 Ga0070707_100001725 3300005468 Bacteria 21065
142 Ga0070707_100002355 3300005468 Bacteria 18020
143 Ga0070707_100010925 3300005468 Bacteria 8455
144 Ga0070707_100030471 3300005468 Bacteria 5136
145 Ga0070707_100049951 3300005468 Bacteria 4010
146 Ga0070707_100063143 3300005468 Bacteria 3554
147 Ga0070707_100211655 3300005468 Unclassified 1889
148 Ga0070707_100293911 3300005468 Bacteria 1578
149 Ga0070707_100318879 3300005468 Unclassified 1510
150 Ga0070707_100530548 3300005468 Bacteria 1139
151 Ga0070698_100000216 3300005471 Bacteria 56257
152 Ga0070698_100002588 3300005471 Bacteria 19927
153 Ga0070698_100018741 3300005471 Bacteria 7286
154 Ga0070698_100097904 3300005471 Bacteria 2909
155 Ga0070698_100235556 3300005471 Bacteria 1764
156 Ga0070699_100008001 3300005518 Bacteria 9177
157 Ga0070699_100008691 3300005518 Bacteria 8804
158 Ga0070699_100009732 3300005518 Bacteria 8318
159 Ga0070699_100010748 3300005518 Bacteria 7921
160 Ga0070699_100018934 3300005518 Bacteria 5920
161 Ga0070699_100044932 3300005518 Bacteria 3823
162 Ga0070699_100075835 3300005518 Bacteria 2927
163 Ga0070679_100181479 3300005530 Bacteria 2077
164 Ga0070679_100187431 3300005530 Bacteria 2039
165 Ga0070684_100001397 3300005535 Bacteria 17367
166 Ga0070684_100283435 3300005535 Bacteria 1518
167 Ga0070697_100000107 3300005536 Bacteria 65460
168 Ga0070697_100000323 3300005536 Bacteria 37824
169 Ga0070697_100000611 3300005536 Bacteria 27144
170 Ga0070697_100000763 3300005536 Bacteria 24081
171 Ga0070697_100002752 3300005536 Bacteria 13543
172 Ga0070697_100014974 3300005536 Bacteria 6087
173 Ga0070697_100038842 3300005536 Bacteria 3847
174 Ga0070697_100040738 3300005536 Unclassified 3759
175 Ga0070697_100067672 3300005536 Unclassified 2922
176 Ga0070697_100139586 3300005536 Bacteria 2037
177 Ga0070697_100401483 3300005536 Bacteria 1189
178 Ga0070697_100719130 3300005536 Unclassified 881
179 Ga0068853_100003624 3300005539 Bacteria 11837
180 Ga0068853_100142488 3300005539 Bacteria 2152
181 Ga0070672_100034411 3300005543 Bacteria 3845
182 Ga0070672_100471539 3300005543 Unclassified 1083
183 Ga0070686_100058478 3300005544 Bacteria 2480
184 Ga0070695_100001372 3300005545 Bacteria 13517
185 Ga0070695_100466899 3300005545 Bacteria 970
186 Ga0070696_100002958 3300005546 Bacteria 11289
187 Ga0070693_100000001 3300005547 Bacteria 99999
188 Ga0070693_100021929 3300005547 Bacteria 3390
189 Ga0070665_100480320 3300005548 Bacteria 1253
190 Ga0070704_100008835 3300005549 Bacteria 6062
191 Ga0070704_100115375 3300005549 Bacteria 2052
192 Ga0068855_100031873 3300005563 Bacteria 6292
193 Ga0068855_100075178 3300005563 Bacteria 3923
194 Ga0070664_100012643 3300005564 Bacteria 6872
195 Ga0070664_100076512 3300005564 Bacteria 2876
196 Ga0070664_100132710 3300005564 Unclassified 2188
197 Ga0068857_100002065 3300005577 Bacteria 16305
198 Ga0068857_100358750 3300005577 Bacteria 1351
199 Ga0068854_100053478 3300005578 Bacteria 2900
200 Ga0068856_100001015 3300005614 Bacteria 29886
201 Ga0068856_100006280 3300005614 Bacteria 11664
202 Ga0068856_100047049 3300005614 Bacteria 4249
203 Ga0068856_100064563 3300005614 Bacteria 3617
204 Ga0068856_100161806 3300005614 Unclassified 2249
205 Ga0070702_100031119 3300005615 Bacteria 2917
206 Ga0068852_100029318 3300005616 Bacteria 4520
207 Ga0068852_100042599 3300005616 Bacteria 3843
208 Ga0068852_100419446 3300005616 Bacteria 1320
209 Ga0068859_100011010 3300005617 Bacteria 9102
210 Ga0068859_100148779 3300005617 Bacteria 2417
211 Ga0068864_100010381 3300005618 Bacteria 7691
212 Ga0068866_10003477 3300005718 Bacteria 6454
213 Ga0068861_100012817 3300005719 Bacteria 5854
214 Ga0068861_100269233 3300005719 Bacteria 1462
215 Ga0068861_100340948 3300005719 Bacteria 1311
216 Ga0068851_10095666 3300005834 Bacteria 1569
217 Ga0068870_10016325 3300005840 Bacteria 3544
218 Ga0068863_100003555 3300005841 Bacteria 15375
219 Ga0068863_100053582 3300005841 Bacteria 3824
220 Ga0068863_100241051 3300005841 Bacteria 1745
221 Ga0068858_100042478 3300005842 Bacteria 4216
222 Ga0068858_100063009 3300005842 Bacteria 3430
223 Ga0068858_100083628 3300005842 Bacteria 2968
224 Ga0068858_100155011 3300005842 Bacteria 2155
225 Ga0068860_100040319 3300005843 Bacteria 4463
226 Ga0068860_100045429 3300005843 Bacteria 4188
227 Ga0068860_100087435 3300005843 Bacteria 2967
228 Ga0068860_100228588 3300005843 Bacteria 1808
229 Ga0068860_100373403 3300005843 Bacteria 1407
230 Ga0068862_100013927 3300005844 Bacteria 6665
231 Ga0068862_100015353 3300005844 Bacteria 6362
232 Ga0081540_1026900 3300005983 Bacteria 3272
233 Ga0070717_10001935 3300006028 Bacteria 14457
234 Ga0070717_10002004 3300006028 Bacteria 14238
235 Ga0070717_10054234 3300006028 Bacteria 3306
236 Ga0070717_10057448 3300006028 Unclassified 3216
237 Ga0070717_10136928 3300006028 Bacteria 2109
238 Ga0070717_10216146 3300006028 Bacteria 1683
239 Ga0070717_10296437 3300006028 Bacteria 1437
240 Ga0070717_10329596 3300006028 Unclassified 1361
241 Ga0070717_10365439 3300006028 Bacteria 1292
242 Ga0070717_10515908 3300006028 Bacteria 1081
243 Ga0070715_10002927 3300006163 Bacteria 5334
244 Ga0070715_10026565 3300006163 Bacteria 2305
245 Ga0070715_10059162 3300006163 Bacteria 1675
246 Ga0070715_10102667 3300006163 Unclassified 1336
247 Ga0070715_10130814 3300006163 Unclassified 1208
248 Ga0070716_100001978 3300006173 Bacteria 9329
249 Ga0070716_100003006 3300006173 Bacteria 7862
250 Ga0070716_100027682 3300006173 Bacteria 3048
251 Ga0070716_100047599 3300006173 Bacteria 2420
252 Ga0070716_100080416 3300006173 Bacteria 1943
253 Ga0070716_100088714 3300006173 Viruses 1866
254 Ga0070716_100138850 3300006173 Unclassified 1547
255 Ga0070716_100201027 3300006173 Bacteria 1325
256 Ga0070716_100244040 3300006173 Unclassified 1220
257 Ga0070712_100000294 3300006175 Bacteria 28077
258 Ga0070712_100000362 3300006175 Bacteria 25689
259 Ga0070712_100001143 3300006175 Bacteria 16021
260 Ga0070712_100003130 3300006175 Bacteria 10204
261 Ga0070712_100004465 3300006175 Bacteria 8638
262 Ga0070712_100010715 3300006175 Bacteria 5792
263 Ga0070712_100085010 3300006175 Unclassified 2302
264 Ga0070712_100086484 3300006175 Bacteria 2285
265 Ga0070712_100259653 3300006175 Bacteria 1392
266 Ga0097621_100001923 3300006237 Bacteria 14185
267 Ga0097621_100004889 3300006237 Bacteria 9396
268 Ga0097621_100112026 3300006237 Bacteria 2306
269 Ga0097621_100341071 3300006237 Bacteria 1331
270 Ga0097621_100497738 3300006237 Unclassified 1103
271 Ga0068871_100000585 3300006358 Bacteria 25031
272 Ga0068871_100001832 3300006358 Bacteria 14357
273 Ga0068871_100068666 3300006358 Bacteria 2910
274 Ga0075431_100243288 3300006847 Bacteria 1829
275 Ga0075433_10000127 3300006852 Bacteria 38862
276 Ga0075434_100002022 3300006871 Bacteria 17622
277 Ga0075434_100002031 3300006871 Bacteria 17565
278 Ga0075434_100287348 3300006871 Bacteria 1664
279 Ga0068865_100067859 3300006881 Bacteria 2520
280 Ga0068865_100120366 3300006881 Bacteria 1951
281 Ga0068865_100135548 3300006881 Bacteria 1849
282 Ga0075436_100009653 3300006914 Bacteria 6605
283 Ga0075436_100010926 3300006914 Bacteria 6231
284 Ga0075436_100012042 3300006914 Bacteria 5932
285 Ga0075436_100207071 3300006914 Bacteria 1390
286 Ga0097620_100011010 3300006931 Bacteria 9102
287 Ga0097620_100148776 3300006931 Bacteria 2417
288 Ga0075435_100002355 3300007076 Bacteria 12522
289 Ga0075435_100057909 3300007076 Bacteria 3135
290 Ga0075435_100082975 3300007076 Bacteria 2635
291 Ga0075435_100252271 3300007076 Bacteria 1502
292 Ga0075435_100375043 3300007076 Unclassified 1222
293 Ga0099794_10036795 3300007265 Unclassified 2316
294 Ga0099794_10072730 3300007265 Bacteria 1686
295 Ga0099794_10082756 3300007265 Bacteria 1585
296 Ga0099795_10143338 3300007788 Bacteria 973
297 Ga0105240_10020055 3300009093 Bacteria 8925
298 Ga0105240_10050694 3300009093 Bacteria 5231
299 Ga0105240_10070878 3300009093 Bacteria 4310
300 Ga0105240_10252699 3300009093 Bacteria 2038
301 Ga0105245_10003303 3300009098 Bacteria 14477
302 Ga0105245_10044643 3300009098 Bacteria 3957
303 Ga0105245_10065521 3300009098 Bacteria 3285
304 Ga0105245_10069228 3300009098 Bacteria 3199
305 Ga0105245_10215335 3300009098 Unclassified 1851
306 Ga0105245_10622713 3300009098 Bacteria 1107
307 Ga0105247_10002514 3300009101 Bacteria 12457
308 Ga0105247_10116424 3300009101 Bacteria 1726
309 Ga0105243_10123851 3300009148 Bacteria 2184
310 Ga0105243_10317126 3300009148 Bacteria 1419
311 Ga0105241_10005963 3300009174 Bacteria 8986
312 Ga0105241_10012514 3300009174 Bacteria 6222
313 Ga0105241_10014118 3300009174 Bacteria 5852
314 Ga0105241_10033772 3300009174 Bacteria 3841
315 Ga0105241_10083990 3300009174 Bacteria 2499
316 Ga0105242_10010108 3300009176 Bacteria 7227
317 Ga0105242_10020852 3300009176 Bacteria 5141
318 Ga0105242_10357790 3300009176 Bacteria 1350
319 Ga0105242_10539025 3300009176 Unclassified 1117
320 Ga0105242_10658394 3300009176 Bacteria 1019
321 Ga0105248_10055473 3300009177 Bacteria 4444
322 Ga0105248_10307263 3300009177 Bacteria 1786
323 Ga0105237_10025863 3300009545 Bacteria 6000
324 Ga0105237_10303716 3300009545 Bacteria 1599
325 Ga0105238_10041250 3300009551 Bacteria 4675
326 Ga0105238_10365038 3300009551 Bacteria 1434
327 Ga0105249_10010157 3300009553 Bacteria 8264
328 Ga0105249_10206326 3300009553 Bacteria 1926
329 Ga0105249_10436169 3300009553 Unclassified 1346
330 Ga0099796_10021618 3300010159 Unclassified 1984
331 Ga0105239_10011628 3300010375 Bacteria 9821
332 Ga0105239_10095866 3300010375 Bacteria 3277
333 Ga0105239_10097004 3300010375 Bacteria 3258
334 Ga0105239_10222264 3300010375 Bacteria 2118
335 Ga0105239_10415774 3300010375 Bacteria 1523
336 Ga0105239_10795267 3300010375 Unclassified 1084
337 Ga0105246_10005537 3300011119 Bacteria 7705
338 Ga0157373_10000999 3300013100 Bacteria 21871
339 Ga0157373_10055493 3300013100 Bacteria 2814
340 Ga0157371_10006244 3300013102 Bacteria 9876
341 Ga0157371_10026617 3300013102 Bacteria 4202
342 Ga0157370_10198099 3300013104 Bacteria 1864
343 Ga0157369_10008080 3300013105 Bacteria 12066
344 Ga0157369_10019009 3300013105 Bacteria 7695
345 Ga0157369_10037339 3300013105 Bacteria 5318
346 Ga0157374_10004927 3300013296 Bacteria 11201
347 Ga0157374_10010242 3300013296 Bacteria 8062
348 Ga0157374_10031823 3300013296 Bacteria 4798
349 Ga0157374_10046709 3300013296 Bacteria 4012
350 Ga0157374_10057507 3300013296 Bacteria 3632
351 Ga0157374_10058005 3300013296 Bacteria 3618
352 Ga0157378_10004197 3300013297 Bacteria 12719
353 Ga0157378_10053690 3300013297 Bacteria 3588
354 Ga0157378_10088945 3300013297 Bacteria 2804
355 Ga0157378_10173859 3300013297 Bacteria 2022
356 Ga0157378_10256000 3300013297 Bacteria 1677
357 Ga0163162_10003513 3300013306 Bacteria 14987
358 Ga0163162_10014579 3300013306 Bacteria 7680
359 Ga0163162_10034770 3300013306 Bacteria 5017
360 Ga0163162_10088319 3300013306 Bacteria 3179
361 Ga0163162_10364211 3300013306 Bacteria 1579
362 Ga0163162_10383135 3300013306 Bacteria 1539
363 Ga0157372_10031314 3300013307 Bacteria 5824
364 Ga0157372_10032538 3300013307 Bacteria 5720
365 Ga0157372_10059140 3300013307 Bacteria 4286
366 Ga0157372_10324347 3300013307 Bacteria 1793
367 Ga0157372_11125864 3300013307 Unclassified 908
368 Ga0157375_10040143 3300013308 Bacteria 4510
369 Ga0157375_10093761 3300013308 Bacteria 3069
370 Ga0163163_10009183 3300014325 Bacteria 8812
371 Ga0163163_10099155 3300014325 Bacteria 2935
372 Ga0163163_10168815 3300014325 Bacteria 2234
373 Ga0157380_10159859 3300014326 Bacteria 1957
374 Ga0157380_10429244 3300014326 Unclassified 1263
375 Ga0182008_10016550 3300014497 Bacteria 3831
376 Ga0182008_10112926 3300014497 Unclassified 1347
377 Ga0157377_10002369 3300014745 Bacteria 8311
378 Ga0157379_10001668 3300014968 Bacteria 18355
379 Ga0157379_10070163 3300014968 Bacteria 3135
380 Ga0157379_10097968 3300014968 Bacteria 2633
381 Ga0157379_10195239 3300014968 Bacteria 1829
382 Ga0157376_10000401 3300014969 Bacteria 28141
383 Ga0157376_10024743 3300014969 Bacteria 4720
384 Ga0157376_10034140 3300014969 Bacteria 4105
385 Ga0157376_10043187 3300014969 Bacteria 3698
386 Ga0157376_10057703 3300014969 Bacteria 3249
387 Ga0182007_10003616 3300015262 Bacteria 7253
388 Ga0182007_10030822 3300015262 Bacteria 1830
389 Ga0182005_1009258 3300015265 Bacteria 2870
390 Ga0182005_1040254 3300015265 Unclassified 1271
391 Ga0163161_10011112 3300017792 Bacteria 6238
392 Ga0224712_10138969 3300022467 Bacteria 1067
393 Ga0224570_100191 3300022730 Bacteria 4305
394 Ga0228598_1002872 3300024227 Bacteria 3740
395 Ga0228598_1002972 3300024227 Bacteria 3680
396 Ga0228598_1011729 3300024227 Unclassified 1743
397 Ga0207697_10085734 3300025315 Unclassified 1331
398 Ga0207656_10068759 3300025321 Bacteria 1570
399 Ga0207653_10002603 3300025885 Bacteria 5729
400 Ga0207692_10011393 3300025898 Bacteria 3783
401 Ga0207692_10023131 3300025898 Unclassified 2870
402 Ga0207692_10031772 3300025898 Unclassified 2531
403 Ga0207692_10207397 3300025898 Bacteria 1155
404 Ga0207642_10073539 3300025899 Bacteria 1635
405 Ga0207642_10303456 3300025899 Bacteria 926
406 Ga0207710_10120127 3300025900 Bacteria 1254
407 Ga0207688_10002555 3300025901 Bacteria 9838
408 Ga0207680_10028391 3300025903 Bacteria 3129
409 Ga0207680_10079085 3300025903 Bacteria 2061
410 Ga0207647_10023570 3300025904 Bacteria 4069
411 Ga0207647_10217804 3300025904 Bacteria 1101
412 Ga0207685_10010035 3300025905 Bacteria 2777
413 Ga0207699_10000912 3300025906 Bacteria 14126
414 Ga0207699_10003305 3300025906 Bacteria 7685
415 Ga0207699_10031282 3300025906 Bacteria 2987
416 Ga0207699_10038591 3300025906 Bacteria 2739
417 Ga0207699_10104809 3300025906 Bacteria 1802
418 Ga0207699_10117232 3300025906 Unclassified 1716
419 Ga0207699_10126084 3300025906 Bacteria 1662
420 Ga0207699_10162179 3300025906 Bacteria 1489
421 Ga0207699_10171860 3300025906 Bacteria 1450
422 Ga0207699_10187640 3300025906 Unclassified 1393
423 Ga0207699_10246682 3300025906 Bacteria 1229
424 Ga0207699_10251533 3300025906 Bacteria 1218
425 Ga0207645_10001175 3300025907 Bacteria 21634
426 Ga0207645_10043419 3300025907 Bacteria 2877
427 Ga0207643_10000391 3300025908 Bacteria 29201
428 Ga0207705_10173386 3300025909 Bacteria 1625
429 Ga0207684_10001228 3300025910 Bacteria 28451
430 Ga0207684_10001445 3300025910 Bacteria 25710
431 Ga0207684_10001633 3300025910 Bacteria 23811
432 Ga0207684_10019027 3300025910 Bacteria 5874
433 Ga0207684_10030972 3300025910 Bacteria 4553
434 Ga0207684_10066170 3300025910 Bacteria 3069
435 Ga0207684_10089974 3300025910 Bacteria 2615
436 Ga0207684_10105717 3300025910 Bacteria 2408
437 Ga0207654_10012536 3300025911 Bacteria 4345
438 Ga0207654_10016176 3300025911 Bacteria 3880
439 Ga0207654_10035438 3300025911 Bacteria 2781
440 Ga0207654_10092027 3300025911 Unclassified 1851
441 Ga0207707_10007054 3300025912 Bacteria 9793
442 Ga0207707_10024519 3300025912 Bacteria 5278
443 Ga0207695_10055095 3300025913 Bacteria 4147
444 Ga0207671_10010924 3300025914 Bacteria 7442
445 Ga0207671_10349776 3300025914 Unclassified 1172
446 Ga0207693_10000203 3300025915 Bacteria 54373
447 Ga0207693_10000403 3300025915 Bacteria 39465
448 Ga0207693_10000785 3300025915 Bacteria 28435
449 Ga0207693_10001032 3300025915 Bacteria 24921
450 Ga0207693_10001069 3300025915 Bacteria 24543
451 Ga0207693_10019304 3300025915 Bacteria 5424
452 Ga0207693_10025559 3300025915 Bacteria 4681
453 Ga0207693_10032951 3300025915 Bacteria 4089
454 Ga0207693_10044646 3300025915 Bacteria 3483
455 Ga0207693_10093298 3300025915 Bacteria 2359
456 Ga0207693_10124888 3300025915 Bacteria 2022
457 Ga0207693_10144533 3300025915 Bacteria 1870
458 Ga0207693_10254760 3300025915 Bacteria 1377
459 Ga0207693_10309519 3300025915 Unclassified 1237
460 Ga0207693_10337500 3300025915 Unclassified 1179
461 Ga0207663_10003917 3300025916 Bacteria 7361
462 Ga0207663_10132822 3300025916 Bacteria 1723
463 Ga0207663_10145153 3300025916 Viruses 1658
464 Ga0207663_10302620 3300025916 Bacteria 1195
465 Ga0207663_10451122 3300025916 Unclassified 992
466 Ga0207663_10485923 3300025916 Unclassified 957
467 Ga0207662_10004876 3300025918 Bacteria 7097
468 Ga0207657_10000404 3300025919 Bacteria 45859
469 Ga0207657_10004616 3300025919 Bacteria 14554
470 Ga0207657_10010530 3300025919 Bacteria 9220
471 Ga0207649_10000250 3300025920 Bacteria 43495
472 Ga0207649_10016637 3300025920 Bacteria 4152
473 Ga0207649_10078855 3300025920 Unclassified 2126
474 Ga0207652_10009055 3300025921 Bacteria 8018
475 Ga0207646_10000094 3300025922 Bacteria 119406
476 Ga0207646_10000448 3300025922 Bacteria 55023
477 Ga0207646_10001233 3300025922 Bacteria 32128
478 Ga0207646_10002176 3300025922 Bacteria 23366
479 Ga0207646_10114528 3300025922 Bacteria 2421
480 Ga0207646_10116148 3300025922 Bacteria 2404
481 Ga0207646_10249834 3300025922 Bacteria 1602
482 Ga0207646_10333431 3300025922 Bacteria 1370
483 Ga0207646_10334726 3300025922 Bacteria 1367
484 Ga0207646_10341771 3300025922 Unclassified 1352
485 Ga0207646_10381264 3300025922 Unclassified 1274
486 Ga0207681_10172452 3300025923 Bacteria 1640
487 Ga0207694_10008362 3300025924 Bacteria 7821
488 Ga0207694_10568934 3300025924 Unclassified 952
489 Ga0207650_10000124 3300025925 Bacteria 97031
490 Ga0207659_10024310 3300025926 Bacteria 4057
491 Ga0207687_10007312 3300025927 Bacteria 7282
492 Ga0207687_10010974 3300025927 Bacteria 5920
493 Ga0207687_10013447 3300025927 Bacteria 5343
494 Ga0207687_10058589 3300025927 Bacteria 2710
495 Ga0207687_10205980 3300025927 Bacteria 1540
496 Ga0207700_10000273 3300025928 Bacteria 30773
497 Ga0207700_10001454 3300025928 Bacteria 13442
498 Ga0207700_10006930 3300025928 Bacteria 6893
499 Ga0207700_10028886 3300025928 Bacteria 3907
500 Ga0207700_10040290 3300025928 Bacteria 3408
501 Ga0207700_10068965 3300025928 Bacteria 2712
502 Ga0207700_10135791 3300025928 Bacteria 2014
503 Ga0207700_10188032 3300025928 Bacteria 1734
504 Ga0207700_10230367 3300025928 Bacteria 1575
505 Ga0207700_10322721 3300025928 Bacteria 1339
506 Ga0207700_10341955 3300025928 Unclassified 1301
507 Ga0207700_10613750 3300025928 Unclassified 968
508 Ga0207664_10000369 3300025929 Bacteria 32894
509 Ga0207664_10080165 3300025929 Bacteria 2653
510 Ga0207664_10200784 3300025929 Unclassified 1721
511 Ga0207664_10329448 3300025929 Bacteria 1348
512 Ga0207664_10334779 3300025929 Bacteria 1337
513 Ga0207644_10039951 3300025931 Bacteria 3313
514 Ga0207644_10066456 3300025931 Bacteria 2626
515 Ga0207690_10005284 3300025932 Bacteria 7613
516 Ga0207690_10137741 3300025932 Unclassified 1794
517 Ga0207690_10324936 3300025932 Bacteria 1210
518 Ga0207706_10001777 3300025933 Bacteria 21179
519 Ga0207706_10008223 3300025933 Bacteria 9624
520 Ga0207706_10008485 3300025933 Bacteria 9479
521 Ga0207686_10082092 3300025934 Bacteria 2106
522 Ga0207709_10087310 3300025935 Bacteria 2027
523 Ga0207709_10279611 3300025935 Bacteria 1232
524 Ga0207704_10019298 3300025938 Bacteria 3577
525 Ga0207704_10055013 3300025938 Bacteria 2429
526 Ga0207704_10234449 3300025938 Unclassified 1367
527 Ga0207665_10001294 3300025939 Bacteria 16910
528 Ga0207665_10008417 3300025939 Bacteria 6799
529 Ga0207665_10010607 3300025939 Bacteria 6053
530 Ga0207665_10012403 3300025939 Bacteria 5598
531 Ga0207665_10030144 3300025939 Bacteria 3586
532 Ga0207665_10032978 3300025939 Bacteria 3431
533 Ga0207665_10040931 3300025939 Bacteria 3093
534 Ga0207665_10051398 3300025939 Bacteria 2774
535 Ga0207665_10104034 3300025939 Bacteria 1986
536 Ga0207665_10249062 3300025939 Unclassified 1312
537 Ga0207691_10014213 3300025940 Bacteria 7594
538 Ga0207711_10003212 3300025941 Bacteria 14235
539 Ga0207711_10004172 3300025941 Bacteria 12371
540 Ga0207689_10000941 3300025942 Bacteria 27968
541 Ga0207689_10068438 3300025942 Bacteria 2918
542 Ga0207661_10000779 3300025944 Bacteria 20737
543 Ga0207679_10000084 3300025945 Bacteria 82946
544 Ga0207667_10027636 3300025949 Bacteria 6172
545 Ga0207667_10030517 3300025949 Bacteria 5831
546 Ga0207667_10068942 3300025949 Bacteria 3681
547 Ga0207651_10004758 3300025960 Bacteria 6897
548 Ga0207712_10221258 3300025961 Bacteria 1514
549 Ga0207712_10524201 3300025961 Bacteria 1016
550 Ga0207668_10039947 3300025972 Bacteria 3162
551 Ga0207668_10048448 3300025972 Bacteria 2916
552 Ga0207658_10006671 3300025986 Bacteria 7864
553 Ga0207658_10282300 3300025986 Bacteria 1424
554 Ga0207677_10015304 3300026023 Bacteria 4506
555 Ga0207677_10040265 3300026023 Bacteria 3079
556 Ga0207677_10261112 3300026023 Bacteria 1412
557 Ga0207677_10271512 3300026023 Bacteria 1387
558 Ga0207677_10476014 3300026023 Bacteria 1075
559 Ga0207703_10020087 3300026035 Bacteria 5221
560 Ga0207703_10026768 3300026035 Bacteria 4543
561 Ga0207703_10045781 3300026035 Bacteria 3520
562 Ga0207703_10122979 3300026035 Bacteria 2230
563 Ga0207703_10325737 3300026035 Unclassified 1408
564 Ga0207639_10003861 3300026041 Bacteria 10095
565 Ga0207678_10002403 3300026067 Bacteria 17014
566 Ga0207678_10005424 3300026067 Bacteria 11419
567 Ga0207678_10143568 3300026067 Bacteria 2037
568 Ga0207702_10001068 3300026078 Bacteria 28056
569 Ga0207702_10010995 3300026078 Bacteria 7550
570 Ga0207702_10013997 3300026078 Bacteria 6664
571 Ga0207702_10132573 3300026078 Bacteria 2244
572 Ga0207702_10133845 3300026078 Unclassified 2234
573 Ga0207702_10257217 3300026078 Bacteria 1642
574 Ga0207641_10000006 3300026088 Bacteria 442569
575 Ga0207641_10086038 3300026088 Bacteria 2740
576 Ga0207641_10107691 3300026088 Bacteria 2465
577 Ga0207641_10116420 3300026088 Bacteria 2378
578 Ga0207641_10205821 3300026088 Bacteria 1817
579 Ga0207648_10001425 3300026089 Bacteria 26347
580 Ga0207648_10057077 3300026089 Bacteria 3407
581 Ga0207648_10361443 3300026089 Unclassified 1310
582 Ga0207676_10000615 3300026095 Bacteria 29142
583 Ga0207674_10001059 3300026116 Bacteria 35825
584 Ga0207674_10056122 3300026116 Bacteria 4001
585 Ga0207674_10259686 3300026116 Bacteria 1684
586 Ga0207675_100031140 3300026118 Bacteria 4968
587 Ga0207675_100052899 3300026118 Bacteria 3789
588 Ga0207675_100114665 3300026118 Bacteria 2545
589 Ga0207675_100316514 3300026118 Bacteria 1523
590 Ga0207683_10001543 3300026121 Bacteria 20762
591 Ga0207683_10021577 3300026121 Bacteria 5517
592 Ga0207698_10356147 3300026142 Unclassified 1384
593 Ga0207698_10386754 3300026142 Bacteria 1333
594 Ga0209179_1031632 3300027512 Unclassified 1087
595 Ga0209588_1085885 3300027671 Bacteria 1015
596 Ga0265356_1000828 3300028017 Bacteria 5130
597 Ga0268266_10001591 3300028379 Bacteria 26491
598 Ga0268265_10028554 3300028380 Bacteria 3995
599 Ga0268265_10055937 3300028380 Bacteria 2999
600 Ga0268264_10053361 3300028381 Bacteria 3372
601 Ga0268264_10140080 3300028381 Bacteria 2156
602 Ga0268264_10166095 3300028381 Unclassified 1992
603 Ga0268264_10786517 3300028381 Bacteria 950
604 Ga0265319_1002497 3300028563 Bacteria 9999
605 Ga0265318_10000631 3300028577 Bacteria 24267
606 Ga0265338_10001433 3300028800 Bacteria 38741
607 Ga0265338_10070618 3300028800 Bacteria 2993
608 Ga0265338_10099018 3300028800 Bacteria 2383
609 Ga0265338_10110142 3300028800 Bacteria 2220
610 Ga0265338_10194389 3300028800 Bacteria 1535
611 Ga0265338_10308892 3300028800 Bacteria 1147
612 Ga0265762_1000624 3300030760 Bacteria 6215
613 Ga0265765_1014203 3300030879 Bacteria 917
614 Ga0265760_10002488 3300031090 Bacteria 5376
615 Ga0265760_10003500 3300031090 Bacteria 4557
616 Ga0265760_10005087 3300031090 Bacteria 3763
617 Ga0265760_10012659 3300031090 Bacteria 2414
618 Ga0265760_10022295 3300031090 Bacteria 1835
619 Ga0265760_10030148 3300031090 Bacteria 1596
620 Ga0265760_10063078 3300031090 Bacteria 1128
621 Ga0265760_10084121 3300031090 Bacteria 989
622 Ga0265332_10003618 3300031238 Bacteria 7406
623 Ga0265320_10000455 3300031240 Bacteria 32146
624 Ga0265320_10162629 3300031240 Bacteria 1005
625 Ga0265325_10020580 3300031241 Bacteria 3636
626 Ga0265325_10027829 3300031241 Unclassified 3052
627 Ga0265325_10045881 3300031241 Bacteria 2269
628 Ga0265325_10055801 3300031241 Unclassified 2019
629 Ga0265329_10003081 3300031242 Bacteria 7385
630 Ga0265339_10005326 3300031249 Bacteria 8574
631 Ga0265339_10036741 3300031249 Bacteria 2739
632 Ga0265331_10000595 3300031250 Bacteria 32131
633 Ga0265331_10004780 3300031250 Bacteria 8343
634 Ga0265316_10003768 3300031344 Bacteria 15248
635 Ga0265316_10007087 3300031344 Bacteria 10611
636 Ga0265313_10002041 3300031595 Bacteria 18119
637 Ga0265342_10002561 3300031712 Bacteria 15602
638 Ga0265342_10121926 3300031712 Unclassified 1467
639 Ga0373926_0004110 3300035083 Bacteria 4755
640 Ga0373926_0010540 3300035083 Bacteria 3099
641 Ga0373934_0007445 3300035086 Bacteria 4065
642 Ga0373944_0032896 3300035089 Unclassified 1569
643 Ga0373944_0040477 3300035089 Bacteria 1439
644 Ga0373923_0021997 3300035111 Bacteria 2495
645 Ga0373923_0091494 3300035111 Bacteria 1331
646 Ga0373936_0001155 3300035113 Bacteria 9484
647 Ga0373936_0009759 3300035113 Bacteria 3622
648 Ga0373945_0012240 3300035116 Bacteria 2846
649 Ga0373945_0023231 3300035116 Bacteria 2141
650 Ga0373953_0044465 3300035117 Bacteria 1776
651 Ga0373953_0055699 3300035117 Bacteria 1606
652 Ga0373954_0000475 3300035118 Bacteria 15039
653 Ga0373954_0056114 3300035118 Unclassified 1853
654 Ga0373954_0057777 3300035118 Bacteria 1827
655 Ga0373954_0181570 3300035118 Unclassified 1032
656 Ga0373956_0019698 3300035119 Bacteria 2863
657 Ga0373956_0076692 3300035119 Bacteria 1530
658 Ga0373943_0000002 3300035170 Bacteria 106064
659 Ga0373946_0015758 3300035171 Bacteria 2871
660 Ga0373955_0005326 3300035172 Bacteria 5776
661 Ga0373955_0036434 3300035172 Bacteria 2610
662 Ga0373924_0010012 3300035410 Bacteria 3489
663 Ga0373924_0166802 3300035410 Bacteria 967
664 Ga0373931_0016703 3300035691 Bacteria 3617
665 Ga0373935_0001381 3300035692 Bacteria 13419
666 Ga0373935_0010991 3300035692 Bacteria 5437
667 Ga0373935_0136942 3300035692 Unclassified 1650
668 Ga0373935_0177923 3300035692 Bacteria 1459
669 Ga0373935_0324011 3300035692 Unclassified 1094
670 Ga0373927_0000021 3300035695 Bacteria 124647
671 Ga0373927_0041629 3300035695 Unclassified 2979
672 Ga0373927_0142778 3300035695 Bacteria 1567
673 Ga0373927_0282885 3300035695 Bacteria 1091
674 Ga0373933_0000280 3300035724 Bacteria 33213
675 Ga0373933_0028973 3300035724 Bacteria 3198
676 Ga0373933_0064525 3300035724 Bacteria 2216
677 Ga0373933_0080129 3300035724 Unclassified 2001
678 Ga0373933_0108872 3300035724 Bacteria 1726
679 Ga0373933_0219853 3300035724 Bacteria 1218
680 Ga0373933_0330395 3300035724 Bacteria 989
681 Ga0373937_0000932 3300036401 Bacteria 24796
682 Ga0373937_0024674 3300036401 Unclassified 5425
683 Ga0373937_0119670 3300036401 Bacteria 2454
684 Ga0373937_0150777 3300036401 Bacteria 2178
685 Ga0373937_0235436 3300036401 Bacteria 1725
686 Ga0373937_0241157 3300036401 Unclassified 1703
687 Ga0373925_0000151 3300037068 Bacteria 74246
688 Ga0373925_0009744 3300037068 Bacteria 6979
689 Ga0373925_0045837 3300037068 Bacteria 3249
690 Ga0373925_0191216 3300037068 Unclassified 1624
691 Ga0436360_0858745 3300039438 Bacteria 1787
692 Ga0436361_0659691 3300039447 Unclassified 936
693 Ga0436363_0566584 3300039450 Bacteria 2180
694 Ga0436362_0103387 3300039453 Bacteria 6861
695 Ga0451577_0260137 3300042876 Bacteria 1571
696 Ga0453683_0055958 3300044673 Bacteria 2468
697 Ga0453683_0066415 3300044673 Bacteria 2255
698 Ga0453683_0090258 3300044673 Bacteria 1921
699 Ga0466964_0174513 3300044706 Bacteria 1015
700 Ga0453684_0059043 3300044712 Bacteria 4950
701 Ga0453684_0339921 3300044712 Unclassified 1695
702 Ga0453684_0604923 3300044712 Unclassified 1201
703 Ga0451576_0003971 3300045051 Bacteria 19690
704 Ga0495592_0021650 3300046454 Bacteria 4890
705 Ga0495603_0038257 3300046455 Bacteria 2878
706 Ga0495603_0091191 3300046455 Bacteria 1782
707 Ga0495629_0026960 3300046459 Bacteria 4081
708 Ga0495641_0037034 3300046461 Bacteria 2289
709 Ga0495651_0000054 3300046462 Bacteria 84657
710 Ga0495651_0002146 3300046462 Bacteria 15270
711 Ga0495651_0032478 3300046462 Unclassified 4071
712 Ga0495653_0029417 3300046463 Bacteria 4385
713 Ga0495653_0094584 3300046463 Bacteria 2177
714 Ga0495580_0000563 3300046472 Bacteria 31329
715 Ga0495580_0001399 3300046472 Bacteria 21176
716 Ga0495580_0002731 3300046472 Bacteria 15225
717 Ga0495580_0003063 3300046472 Bacteria 14321
718 Ga0495580_0003320 3300046472 Bacteria 13762
719 Ga0495580_0004951 3300046472 Bacteria 11136
720 Ga0495580_0058244 3300046472 Bacteria 2717
721 Ga0495580_0200681 3300046472 Unclassified 1374
722 Ga0495580_0201207 3300046472 Bacteria 1372
723 Ga0495580_0209213 3300046472 Bacteria 1342
724 Ga0495580_0264250 3300046472 Bacteria 1176
725 Ga0495580_0269492 3300046472 Unclassified 1163
726 Ga0495580_0386217 3300046472 Bacteria 945
727 Ga0495582_0000306 3300046473 Bacteria 27098
728 Ga0495582_0000740 3300046473 Bacteria 18038
729 Ga0495582_0229225 3300046473 Unclassified 1063
730 Ga0495639_0032047 3300046475 Bacteria 2343
731 Ga0495664_0002060 3300046477 Bacteria 10749
732 Ga0495664_0003944 3300046477 Bacteria 8098
733 Ga0495664_0042197 3300046477 Bacteria 2701
734 Ga0495584_0030969 3300046491 Bacteria 2708
735 Ga0495594_0046273 3300046499 Bacteria 2389
736 Ga0495608_0018800 3300046511 Bacteria 4761
737 Ga0495608_0060570 3300046511 Bacteria 2490
738 Ga0495608_0328837 3300046511 Unclassified 943
739 Ga0495618_0031337 3300046514 Bacteria 3326
740 Ga0495628_0003238 3300046516 Bacteria 14588
741 Ga0495628_0009659 3300046516 Bacteria 8232
742 Ga0495628_0027924 3300046516 Bacteria 4588
743 Ga0495630_0003146 3300046517 Bacteria 11452
744 Ga0495630_0039085 3300046517 Bacteria 3549
745 Ga0495630_0040152 3300046517 Bacteria 3497
746 Ga0495630_0140891 3300046517 Unclassified 1833
747 Ga0495630_0362822 3300046517 Bacteria 1109
748 Ga0495666_0135523 3300046526 Unclassified 1149
749 Ga0495652_0002907 3300046529 Bacteria 17246
750 Ga0495652_0008532 3300046529 Bacteria 9346
751 Ga0495665_0002907 3300046531 Bacteria 9255
752 Ga0495665_0034697 3300046531 Bacteria 2698
753 Ga0495640_0055945 3300046533 Bacteria 2697
754 Ga0495640_0197847 3300046533 Bacteria 1275
755 Ga0495586_0003372 3300046535 Bacteria 8566
756 Ga0495586_0043098 3300046535 Bacteria 2431
757 Ga0495586_0126804 3300046535 Unclassified 1428
758 Ga0495586_0272271 3300046535 Unclassified 968
759 Ga0495587_0001030 3300046536 Bacteria 18342
760 Ga0495587_0002156 3300046536 Bacteria 13169
761 Ga0495587_0015903 3300046536 Bacteria 4686
762 Ga0495645_0076199 3300046543 Bacteria 2414
763 Ga0495645_0216502 3300046543 Unclassified 1290
764 Ga0495667_0039968 3300046559 Bacteria 3116
765 Ga0495634_0078523 3300046642 Bacteria 2162
766 Ga0495635_0014674 3300046663 Bacteria 5480
767 Ga0495635_0073044 3300046663 Bacteria 2350
768 Ga0495657_0005949 3300046675 Bacteria 9582
769 Ga0495657_0027886 3300046675 Bacteria 3977
770 Ga0495657_0036310 3300046675 Unclassified 3406
771 Ga0495599_0038108 3300046678 Bacteria 3020
772 Ga0495599_0225409 3300046678 Unclassified 1146
773 Ga0495623_0001870 3300046679 Bacteria 14119
774 Ga0495623_0052150 3300046679 Unclassified 2586
775 Ga0495646_0004619 3300046680 Bacteria 8670
776 Ga0495646_0038890 3300046680 Unclassified 2935
777 Ga0495647_0006318 3300046681 Bacteria 3918
778 Ga0495647_0066614 3300046681 Bacteria 1433
779 Ga0495658_0019002 3300046683 Bacteria 3581
780 Ga0495669_0152987 3300046684 Bacteria 1093
781 Ga0495613_0015136 3300046689 Bacteria 5730
782 Ga0495613_0199028 3300046689 Bacteria 1413
783 Ga0495624_0043783 3300046690 Bacteria 2854
784 Ga0495624_0071534 3300046690 Bacteria 2158
785 Ga0495624_0151092 3300046690 Bacteria 1421
786 Ga0495600_0002114 3300046809 Bacteria 11241
787 Ga0495600_0016996 3300046809 Bacteria 4625
788 Ga0495600_0152441 3300046809 Unclassified 1496
789 Ga0495604_0002567 3300047317 Bacteria 14531
790 Ga0495604_0003548 3300047317 Bacteria 12445
791 Ga0495604_0003740 3300047317 Bacteria 12121
792 Ga0495604_0015361 3300047317 Bacteria 6110
793 Ga0495674_0010839 3300047319 Bacteria 8621
794 Ga0495674_0015134 3300047319 Bacteria 7215
795 Ga0495674_0021593 3300047319 Bacteria 5952
796 Ga0495674_0060767 3300047319 Bacteria 3296
797 Ga0495674_0291614 3300047319 Bacteria 1334
798 Ga0495674_0311434 3300047319 Unclassified 1284
799 Ga0495676_0037314 3300047321 Bacteria 4046
800 Ga0495676_0072551 3300047321 Bacteria 2643
801 Ga0495680_0000034 3300047322 Bacteria 107708
802 Ga0495680_0053832 3300047322 Bacteria 3129
803 Ga0495680_0281645 3300047322 Bacteria 1171
804 Ga0495675_0000165 3300047444 Bacteria 47340
805 Ga0495675_0028779 3300047444 Bacteria 3541
806 Ga0495684_0001335 3300047471 Bacteria 19857
807 Ga0495684_0005485 3300047471 Bacteria 9873
808 Ga0495684_0015457 3300047471 Bacteria 5873
809 Ga0495684_0055020 3300047471 Unclassified 3035
810 Ga0495593_0018017 3300047673 Bacteria 3972
811 Ga0495593_0117137 3300047673 Bacteria 1357
812 Ga0495602_0005726 3300048088 Bacteria 13034
813 Ga0495602_0006658 3300048088 Bacteria 12110
814 Ga0495602_0162949 3300048088 Bacteria 1739
815 Ga0495614_0000713 3300048089 Bacteria 14018
816 Ga0495614_0046936 3300048089 Bacteria 1852
817 Ga0496100_0053817 3300048903 Bacteria 2622
818 Ga0496100_0185522 3300048903 Bacteria 1507
819 Ga0496101_0347876 3300048904 Bacteria 1165
820 Ga0496102_0008775 3300048905 Bacteria 8669
821 Ga0496102_0010411 3300048905 Bacteria 8002
822 Ga0496102_0058594 3300048905 Bacteria 3519
823 Ga0496102_0066826 3300048905 Bacteria 3296
824 Ga0496103_0005654 3300048906 Bacteria 7472
825 Ga0496103_0141251 3300048906 Bacteria 1540
826 Ga0496104_0048492 3300048907 Bacteria 4004
827 Ga0496104_0104969 3300048907 Bacteria 2707
828 Ga0496104_0205488 3300048907 Unclassified 1881
829 Ga0496105_0067714 3300048908 Bacteria 2948
830 Ga0496105_0132881 3300048908 Bacteria 2051
831 Ga0496105_0465079 3300048908 Bacteria 997
832 Ga0496106_0035673 3300048909 Bacteria 3719
833 Ga0496106_0042053 3300048909 Bacteria 3426
834 Ga0496107_0121540 3300048910 Bacteria 1924
835 Ga0496108_0000200 3300048911 Bacteria 55323
836 Ga0496109_0000149 3300048912 Bacteria 68979
837 Ga0496109_0029141 3300048912 Bacteria 4942
838 Ga0496109_0409261 3300048912 Unclassified 1282
839 Ga0496109_0531914 3300048912 Bacteria 1109
840 Ga0496110_0011543 3300048913 Bacteria 7237
841 Ga0496110_0014791 3300048913 Bacteria 6484
842 Ga0496111_0301695 3300048914 Bacteria 1187
843 Ga0496112_0000070 3300048915 Bacteria 67934
844 Ga0496112_0006513 3300048915 Bacteria 10267
845 Ga0496112_0071705 3300048915 Bacteria 3423
846 Ga0496112_0106853 3300048915 Bacteria 2769
847 Ga0496112_0162547 3300048915 Bacteria 2199
848 Ga0496112_0178419 3300048915 Bacteria 2088
849 Ga0496113_0000078 3300048916 Bacteria 42516
850 Ga0496113_0230420 3300048916 Bacteria 1477
851 Ga0496114_0033519 3300048917 Bacteria 4232
852 Ga0496114_0341019 3300048917 Bacteria 1325
853 Ga0496115_0008082 3300048918 Bacteria 7772
854 Ga0496115_0016864 3300048918 Bacteria 5570
855 Ga0496115_0047127 3300048918 Bacteria 3446
856 Ga0501067_0113626 3300049583 Unclassified 1506
857 Ga0501083_0050669 3300049744 Bacteria 2794
858 nmdc:mga06r32_362577_c1 3300050510 Bacteria 1433
859 nmdc:mga0n895_492038_c1 3300050512 Unclassified 1236
860 nmdc:mga0n895_65637_c1 3300050512 Bacteria 3593
861 nmdc:mga0n895_672_c1 3300050512 Bacteria 23989
862 nmdc:mga0n895_913246_c1 3300050512 Bacteria 863
863 nmdc:mga0n895_926_c1 3300050512 Bacteria 21152
864 nmdc:mga0rr50_108950_c1 3300050513 Bacteria 2189
865 nmdc:mga0rr50_123532_c1 3300050513 Bacteria 2064
866 nmdc:mga0rr50_23863_c1 3300050513 Bacteria 4228
867 nmdc:mga0rr50_287554_c1 3300050513 Unclassified 1373
868 nmdc:mga0rr50_7147_c1 3300050513 Bacteria 6859
869 nmdc:mga08x19_14262_c1 3300050514 Bacteria 4818
870 nmdc:mga08x19_183681_c1 3300050514 Bacteria 1428
871 nmdc:mga08x19_183807_c1 3300050514 Bacteria 1428
872 nmdc:mga08x19_24657_c1 3300050514 Bacteria 3742
873 nmdc:mga08x19_3079_c1 3300050514 Bacteria 10022
874 nmdc:mga08x19_3287_c1 3300050514 Bacteria 9664
875 nmdc:mga08x19_4596_c1 3300050514 Bacteria 8195
876 nmdc:mga0a205_149_c2 3300050515 Bacteria 33259
877 nmdc:mga0a205_8215_c2 3300050515 Bacteria 5363
878 Ga0495601_0095488 3300053077 Bacteria 1917
879 Ga0495612_0001441 3300053078 Bacteria 9788
880 Ga0495612_0118616 3300053078 Bacteria 1137
881 Ga0495619_0055893 3300053085 Bacteria 2616
882 Ga0495619_0100376 3300053085 Bacteria 1969

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046681 Ga0495647_0066614 Ga0495647_0066614_737_1399 219
2 3300048908 Ga0496105_0465079 Ga0496105_0465079_316_978 220
3 3300048912 Ga0496109_0531914 Ga0496109_0531914_55_726 223
4 3300025906 Ga0207699_10031282 Ga0207699_100312823 229
5 3300026089 Ga0207648_10361443 Ga0207648_103614432 231
6 3300005439 Ga0070711_100162362 Ga0070711_1001623621 236
7 3300005440 Ga0070705_100163695 Ga0070705_1001636952 237
8 3300005468 Ga0070707_100049951 Ga0070707_1000499512 237
9 3300005841 Ga0068863_100003555 Ga0068863_1000035552 237
10 3300005842 Ga0068858_100042478 Ga0068858_1000424782 237
11 3300006173 Ga0070716_100047599 Ga0070716_1000475994 237
12 3300009553 Ga0105249_10206326 Ga0105249_102063262 237
13 3300010375 Ga0105239_10415774 Ga0105239_104157742 237
14 3300025922 Ga0207646_10334726 Ga0207646_103347262 237
15 3300026035 Ga0207703_10026768 Ga0207703_100267685 237
16 3300026088 Ga0207641_10107691 Ga0207641_101076913 237
17 3300046455 Ga0495603_0091191 Ga0495603_0091191_35_763 241
18 3300006173 Ga0070716_100001978 Ga0070716_1000019783 242
19 3300025939 Ga0207665_10001294 Ga0207665_100012946 242
20 3300046809 Ga0495600_0152441 Ga0495600_0152441_162_968 242
21 3300050514 nmdc:mga08x19_183807_c1 nmdc:mga08x19_183807_c1_59_865 242
22 3300007076 Ga0075435_100082975 Ga0075435_1000829753 243
23 3300050513 nmdc:mga0rr50_123532_c1 nmdc:mga0rr50_123532_c1_1227_2033 243
24 3300050514 nmdc:mga08x19_183681_c1 nmdc:mga08x19_183681_c1_413_1219 243
25 3300027512 Ga0209179_1031632 Ga0209179_10316321 245
26 3300005435 Ga0070714_100065168 Ga0070714_1000651683 246
27 3300005436 Ga0070713_100009860 Ga0070713_1000098602 246
28 3300005545 Ga0070695_100466899 Ga0070695_1004668991 246
29 3300006028 Ga0070717_10136928 Ga0070717_101369282 246
30 3300025928 Ga0207700_10068965 Ga0207700_100689652 246
31 3300005468 Ga0070707_100211655 Ga0070707_1002116552 247
32 3300025915 Ga0207693_10309519 Ga0207693_103095192 249
33 3300006871 Ga0075434_100287348 Ga0075434_1002873481 251
34 3300046455 Ga0495603_0038257 Ga0495603_0038257_1929_2735 251
35 3300046472 Ga0495580_0000563 Ga0495580_0000563_28902_29708 251
36 3300046472 Ga0495580_0058244 Ga0495580_0058244_510_1316 251
37 3300046473 Ga0495582_0000306 Ga0495582_0000306_24264_25070 251
38 3300050512 nmdc:mga0n895_65637_c1 nmdc:mga0n895_65637_c1_1284_2090 251
39 3300005434 Ga0070709_10314946 Ga0070709_103149461 252
40 3300005436 Ga0070713_100016178 Ga0070713_1000161786 252
41 3300005439 Ga0070711_100263576 Ga0070711_1002635762 252
42 3300025906 Ga0207699_10171860 Ga0207699_101718602 252
43 3300025928 Ga0207700_10028886 Ga0207700_100288864 252
44 3300028381 Ga0268264_10786517 Ga0268264_107865171 253
45 3300046462 Ga0495651_0000054 Ga0495651_0000054_64078_64839 253
46 3300046463 Ga0495653_0094584 Ga0495653_0094584_801_1562 253
47 3300046472 Ga0495580_0269492 Ga0495580_0269492_248_1009 253
48 3300046511 Ga0495608_0328837 Ga0495608_0328837_93_854 253
49 3300046517 Ga0495630_0003146 Ga0495630_0003146_10358_11119 253
50 3300046559 Ga0495667_0039968 Ga0495667_0039968_791_1552 253
51 3300046809 Ga0495600_0016996 Ga0495600_0016996_2614_3375 253
52 3300047319 Ga0495674_0021593 Ga0495674_0021593_4232_4993 253
53 3300047322 Ga0495680_0000034 Ga0495680_0000034_1193_1954 253
54 3300047444 Ga0495675_0028779 Ga0495675_0028779_2289_3050 253
55 3300025910 Ga0207684_10019027 Ga0207684_100190272 254
56 3300042876 Ga0451577_0260137 Ga0451577_0260137_41_808 255
57 3300046472 Ga0495580_0201207 Ga0495580_0201207_361_1167 261
58 3300005445 Ga0070708_100624857 Ga0070708_1006248571 262
59 3300031090 Ga0265760_10063078 Ga0265760_100630782 262
60 3300005843 Ga0068860_100373403 Ga0068860_1003734031 263
61 3300006175 Ga0070712_100085010 Ga0070712_1000850103 263
62 3300007265 Ga0099794_10082756 Ga0099794_100827562 263
63 3300013297 Ga0157378_10088945 Ga0157378_100889453 263
64 3300025915 Ga0207693_10044646 Ga0207693_100446462 263
65 3300027671 Ga0209588_1085885 Ga0209588_10858851 263
66 3300035724 Ga0373933_0080129 Ga0373933_0080129_630_1460 263
67 3300036401 Ga0373937_0241157 Ga0373937_0241157_473_1303 263
68 3300044673 Ga0453683_0090258 Ga0453683_0090258_322_1119 263
69 3300005468 Ga0070707_100001725 Ga0070707_10000172511 264
70 3300005468 Ga0070707_100530548 Ga0070707_1005305481 264
71 3300006237 Ga0097621_100341071 Ga0097621_1003410712 264
72 3300009093 Ga0105240_10050694 Ga0105240_100506944 264
73 3300009093 Ga0105240_10252699 Ga0105240_102526991 264
74 3300009098 Ga0105245_10044643 Ga0105245_100446431 264
75 3300024227 Ga0228598_1011729 Ga0228598_10117292 264
76 3300025922 Ga0207646_10000094 Ga0207646_1000009451 264
77 3300025922 Ga0207646_10116148 Ga0207646_101161485 264
78 3300025927 Ga0207687_10010974 Ga0207687_100109742 264
79 3300028563 Ga0265319_1002497 Ga0265319_10024979 264
80 3300028577 Ga0265318_10000631 Ga0265318_100006319 264
81 3300028800 Ga0265338_10070618 Ga0265338_100706182 264
82 3300028800 Ga0265338_10110142 Ga0265338_101101422 264
83 3300031090 Ga0265760_10084121 Ga0265760_100841211 264
84 3300031238 Ga0265332_10003618 Ga0265332_100036186 264
85 3300031240 Ga0265320_10000455 Ga0265320_1000045517 264
86 3300031240 Ga0265320_10162629 Ga0265320_101626291 264
87 3300031241 Ga0265325_10020580 Ga0265325_100205802 264
88 3300031241 Ga0265325_10027829 Ga0265325_100278292 264
89 3300031241 Ga0265325_10055801 Ga0265325_100558012 264
90 3300031242 Ga0265329_10003081 Ga0265329_100030818 264
91 3300031249 Ga0265339_10005326 Ga0265339_1000532611 264
92 3300031250 Ga0265331_10000595 Ga0265331_1000059520 264
93 3300031250 Ga0265331_10004780 Ga0265331_100047805 264
94 3300031344 Ga0265316_10003768 Ga0265316_100037687 264
95 3300031344 Ga0265316_10007087 Ga0265316_100070879 264
96 3300031595 Ga0265313_10002041 Ga0265313_1000204117 264
97 3300031712 Ga0265342_10002561 Ga0265342_100025612 264
98 3300031712 Ga0265342_10121926 Ga0265342_101219262 264
99 3300035083 Ga0373926_0004110 Ga0373926_0004110_641_1522 264
100 3300035111 Ga0373923_0091494 Ga0373923_0091494_355_1236 264
101 3300035118 Ga0373954_0056114 Ga0373954_0056114_838_1719 264
102 3300035172 Ga0373955_0036434 Ga0373955_0036434_1478_2359 264
103 3300035410 Ga0373924_0166802 Ga0373924_0166802_151_945 264
104 3300035692 Ga0373935_0136942 Ga0373935_0136942_274_1155 264
105 3300035695 Ga0373927_0041629 Ga0373927_0041629_1830_2711 264
106 3300035724 Ga0373933_0219853 Ga0373933_0219853_314_1195 264
107 3300035724 Ga0373933_0330395 Ga0373933_0330395_135_929 264
108 3300036401 Ga0373937_0024674 Ga0373937_0024674_4404_5285 264
109 3300037068 Ga0373925_0191216 Ga0373925_0191216_618_1499 264
110 3300044673 Ga0453683_0055958 Ga0453683_0055958_419_1261 264
111 3300044673 Ga0453683_0066415 Ga0453683_0066415_437_1267 264
112 3300044712 Ga0453684_0059043 Ga0453684_0059043_2171_3013 264
113 3300044712 Ga0453684_0339921 Ga0453684_0339921_539_1369 264
114 3300046454 Ga0495592_0021650 Ga0495592_0021650_1479_2360 264
115 3300046462 Ga0495651_0002146 Ga0495651_0002146_7264_8094 264
116 3300046463 Ga0495653_0029417 Ga0495653_0029417_788_1618 264
117 3300046472 Ga0495580_0004951 Ga0495580_0004951_9451_10332 264
118 3300046472 Ga0495580_0209213 Ga0495580_0209213_277_1077 264
119 3300046477 Ga0495664_0002060 Ga0495664_0002060_6455_7285 264
120 3300046511 Ga0495608_0018800 Ga0495608_0018800_598_1479 264
121 3300046514 Ga0495618_0031337 Ga0495618_0031337_55_885 264
122 3300046516 Ga0495628_0003238 Ga0495628_0003238_10180_11010 264
123 3300046516 Ga0495628_0009659 Ga0495628_0009659_34_915 264
124 3300046516 Ga0495628_0027924 Ga0495628_0027924_1753_2634 264
125 3300046517 Ga0495630_0140891 Ga0495630_0140891_930_1811 264
126 3300046526 Ga0495666_0135523 Ga0495666_0135523_152_1033 264
127 3300046529 Ga0495652_0002907 Ga0495652_0002907_8844_9674 264
128 3300046529 Ga0495652_0008532 Ga0495652_0008532_1200_2081 264
129 3300046531 Ga0495665_0002907 Ga0495665_0002907_7609_8490 264
130 3300046533 Ga0495640_0197847 Ga0495640_0197847_412_1242 264
131 3300046535 Ga0495586_0003372 Ga0495586_0003372_3293_4174 264
132 3300046535 Ga0495586_0126804 Ga0495586_0126804_494_1324 264
133 3300046535 Ga0495586_0272271 Ga0495586_0272271_59_889 264
134 3300046536 Ga0495587_0001030 Ga0495587_0001030_7477_8307 264
135 3300046536 Ga0495587_0015903 Ga0495587_0015903_1574_2455 264
136 3300046543 Ga0495645_0076199 Ga0495645_0076199_916_1746 264
137 3300046543 Ga0495645_0216502 Ga0495645_0216502_149_1030 264
138 3300046642 Ga0495634_0078523 Ga0495634_0078523_1195_2025 264
139 3300046663 Ga0495635_0014674 Ga0495635_0014674_453_1334 264
140 3300046675 Ga0495657_0005949 Ga0495657_0005949_3955_4785 264
141 3300046675 Ga0495657_0027886 Ga0495657_0027886_1040_1921 264
142 3300046675 Ga0495657_0036310 Ga0495657_0036310_1721_2602 264
143 3300046678 Ga0495599_0038108 Ga0495599_0038108_1240_2070 264
144 3300046678 Ga0495599_0225409 Ga0495599_0225409_90_971 264
145 3300046679 Ga0495623_0001870 Ga0495623_0001870_7328_8209 264
146 3300046680 Ga0495646_0004619 Ga0495646_0004619_382_1263 264
147 3300046680 Ga0495646_0038890 Ga0495646_0038890_1841_2722 264
148 3300046689 Ga0495613_0015136 Ga0495613_0015136_4763_5644 264
149 3300046689 Ga0495613_0199028 Ga0495613_0199028_223_1053 264
150 3300046690 Ga0495624_0043783 Ga0495624_0043783_1494_2375 264
151 3300046690 Ga0495624_0151092 Ga0495624_0151092_42_872 264
152 3300046809 Ga0495600_0002114 Ga0495600_0002114_3516_4346 264
153 3300047317 Ga0495604_0003548 Ga0495604_0003548_5324_6205 264
154 3300047317 Ga0495604_0003740 Ga0495604_0003740_7385_8215 264
155 3300047317 Ga0495604_0015361 Ga0495604_0015361_4408_5289 264
156 3300047319 Ga0495674_0015134 Ga0495674_0015134_1856_2686 264
157 3300047319 Ga0495674_0291614 Ga0495674_0291614_289_1119 264
158 3300047321 Ga0495676_0072551 Ga0495676_0072551_22_903 264
159 3300047322 Ga0495680_0281645 Ga0495680_0281645_294_1124 264
160 3300047444 Ga0495675_0000165 Ga0495675_0000165_32821_33651 264
161 3300047471 Ga0495684_0001335 Ga0495684_0001335_13312_14142 264
162 3300047471 Ga0495684_0005485 Ga0495684_0005485_4400_5281 264
163 3300047471 Ga0495684_0015457 Ga0495684_0015457_3208_4089 264
164 3300047673 Ga0495593_0018017 Ga0495593_0018017_253_1134 264
165 3300048088 Ga0495602_0006658 Ga0495602_0006658_2528_3358 264
166 3300048089 Ga0495614_0000713 Ga0495614_0000713_6312_7193 264
167 3300048915 Ga0496112_0178419 Ga0496112_0178419_1058_1888 264
168 3300053078 Ga0495612_0001441 Ga0495612_0001441_4391_5272 264
169 3300004798 Ga0058859_11144590 Ga0058859_111445901 265
170 3300005334 Ga0068869_100010394 Ga0068869_1000103946 265
171 3300005338 Ga0068868_100093373 Ga0068868_1000933732 265
172 3300005347 Ga0070668_100427857 Ga0070668_1004278572 265
173 3300005353 Ga0070669_100008906 Ga0070669_1000089066 265
174 3300005367 Ga0070667_100362381 Ga0070667_1003623812 265
175 3300005440 Ga0070705_100005272 Ga0070705_1000052726 265
176 3300005466 Ga0070685_10040781 Ga0070685_100407812 265
177 3300005468 Ga0070707_100001241 Ga0070707_10000124118 265
178 3300005518 Ga0070699_100018934 Ga0070699_1000189341 265
179 3300005617 Ga0068859_100011010 Ga0068859_1000110103 265
180 3300005842 Ga0068858_100063009 Ga0068858_1000630092 265
181 3300005842 Ga0068858_100155011 Ga0068858_1001550112 265
182 3300005843 Ga0068860_100045429 Ga0068860_1000454292 265
183 3300006847 Ga0075431_100243288 Ga0075431_1002432882 265
184 3300006881 Ga0068865_100135548 Ga0068865_1001355481 265
185 3300006931 Ga0097620_100011010 Ga0097620_1000110103 265
186 3300009098 Ga0105245_10622713 Ga0105245_106227132 265
187 3300013296 Ga0157374_10004927 Ga0157374_100049278 265
188 3300013297 Ga0157378_10053690 Ga0157378_100536903 265
189 3300013306 Ga0163162_10003513 Ga0163162_100035132 265
190 3300014326 Ga0157380_10429244 Ga0157380_104292442 265
191 3300014969 Ga0157376_10057703 Ga0157376_100577032 265
192 3300025899 Ga0207642_10303456 Ga0207642_103034561 265
193 3300025900 Ga0207710_10120127 Ga0207710_101201272 265
194 3300025904 Ga0207647_10217804 Ga0207647_102178041 265
195 3300025922 Ga0207646_10000448 Ga0207646_1000044832 265
196 3300025938 Ga0207704_10019298 Ga0207704_100192982 265
197 3300025942 Ga0207689_10000941 Ga0207689_100009416 265
198 3300026023 Ga0207677_10271512 Ga0207677_102715122 265
199 3300026035 Ga0207703_10020087 Ga0207703_100200872 265
200 3300026035 Ga0207703_10122979 Ga0207703_101229792 265
201 3300026088 Ga0207641_10086038 Ga0207641_100860382 265
202 3300026118 Ga0207675_100114665 Ga0207675_1001146652 265
203 3300028380 Ga0268265_10028554 Ga0268265_100285542 265
204 3300028381 Ga0268264_10166095 Ga0268264_101660952 265
205 3300045051 Ga0451576_0003971 Ga0451576_0003971_12136_12939 265
206 3300048915 Ga0496112_0006513 Ga0496112_0006513_5002_5799 265
207 3300050510 nmdc:mga06r32_362577_c1 nmdc:mga06r32_362577_c1_80_898 265
208 3300005436 Ga0070713_100060343 Ga0070713_1000603432 266
209 3300005437 Ga0070710_10023036 Ga0070710_100230362 266
210 3300005439 Ga0070711_100001487 Ga0070711_10000148711 266
211 3300005841 Ga0068863_100241051 Ga0068863_1002410512 266
212 3300005843 Ga0068860_100087435 Ga0068860_1000874353 266
213 3300005983 Ga0081540_1026900 Ga0081540_10269003 266
214 3300006163 Ga0070715_10026565 Ga0070715_100265652 266
215 3300006173 Ga0070716_100027682 Ga0070716_1000276821 266
216 3300006175 Ga0070712_100000294 Ga0070712_10000029418 266
217 3300013105 Ga0157369_10019009 Ga0157369_100190096 266
218 3300014968 Ga0157379_10195239 Ga0157379_101952392 266
219 3300025898 Ga0207692_10031772 Ga0207692_100317722 266
220 3300025898 Ga0207692_10207397 Ga0207692_102073972 266
221 3300025915 Ga0207693_10000785 Ga0207693_100007859 266
222 3300025916 Ga0207663_10003917 Ga0207663_100039176 266
223 3300025928 Ga0207700_10135791 Ga0207700_101357912 266
224 3300025939 Ga0207665_10104034 Ga0207665_101040343 266
225 3300026088 Ga0207641_10205821 Ga0207641_102058212 266
226 3300028381 Ga0268264_10140080 Ga0268264_101400801 266
227 3300044712 Ga0453684_0604923 Ga0453684_0604923_188_994 266
228 3300005434 Ga0070709_10001126 Ga0070709_100011266 267
229 3300005434 Ga0070709_10069348 Ga0070709_100693482 267
230 3300005434 Ga0070709_10077159 Ga0070709_100771591 267
231 3300005434 Ga0070709_10184316 Ga0070709_101843162 267
232 3300005435 Ga0070714_100079630 Ga0070714_1000796302 267
233 3300005436 Ga0070713_100000288 Ga0070713_10000028828 267
234 3300005439 Ga0070711_100018440 Ga0070711_1000184404 267
235 3300005439 Ga0070711_100057138 Ga0070711_1000571384 267
236 3300005445 Ga0070708_100042813 Ga0070708_1000428132 267
237 3300005467 Ga0070706_100426572 Ga0070706_1004265721 267
238 3300005468 Ga0070707_100030471 Ga0070707_1000304712 267
239 3300005518 Ga0070699_100010748 Ga0070699_1000107486 267
240 3300005536 Ga0070697_100000107 Ga0070697_1000001079 267
241 3300005536 Ga0070697_100038842 Ga0070697_1000388422 267
242 3300005614 Ga0068856_100161806 Ga0068856_1001618062 267
243 3300006163 Ga0070715_10002927 Ga0070715_100029276 267
244 3300006163 Ga0070715_10130814 Ga0070715_101308142 267
245 3300006173 Ga0070716_100003006 Ga0070716_1000030066 267
246 3300006175 Ga0070712_100001143 Ga0070712_10000114316 267
247 3300006175 Ga0070712_100003130 Ga0070712_1000031302 267
248 3300006175 Ga0070712_100004465 Ga0070712_1000044658 267
249 3300006237 Ga0097621_100004889 Ga0097621_1000048896 267
250 3300006358 Ga0068871_100001832 Ga0068871_1000018327 267
251 3300006871 Ga0075434_100002022 Ga0075434_1000020222 267
252 3300006914 Ga0075436_100009653 Ga0075436_1000096536 267
253 3300006914 Ga0075436_100207071 Ga0075436_1002070712 267
254 3300007076 Ga0075435_100057909 Ga0075435_1000579092 267
255 3300007076 Ga0075435_100252271 Ga0075435_1002522712 267
256 3300009098 Ga0105245_10065521 Ga0105245_100655212 267
257 3300009174 Ga0105241_10012514 Ga0105241_100125146 267
258 3300009176 Ga0105242_10357790 Ga0105242_103577902 267
259 3300009176 Ga0105242_10539025 Ga0105242_105390252 267
260 3300009551 Ga0105238_10041250 Ga0105238_100412504 267
261 3300010375 Ga0105239_10097004 Ga0105239_100970043 267
262 3300013296 Ga0157374_10057507 Ga0157374_100575073 267
263 3300013306 Ga0163162_10014579 Ga0163162_100145792 267
264 3300013306 Ga0163162_10364211 Ga0163162_103642112 267
265 3300013307 Ga0157372_11125864 Ga0157372_111258641 267
266 3300014969 Ga0157376_10024743 Ga0157376_100247433 267
267 3300024227 Ga0228598_1002972 Ga0228598_10029722 267
268 3300025898 Ga0207692_10023131 Ga0207692_100231314 267
269 3300025905 Ga0207685_10010035 Ga0207685_100100352 267
270 3300025906 Ga0207699_10000912 Ga0207699_100009126 267
271 3300025906 Ga0207699_10038591 Ga0207699_100385913 267
272 3300025911 Ga0207654_10012536 Ga0207654_100125362 267
273 3300025915 Ga0207693_10000203 Ga0207693_1000020349 267
274 3300025915 Ga0207693_10001032 Ga0207693_100010321 267
275 3300025915 Ga0207693_10001069 Ga0207693_100010694 267
276 3300025916 Ga0207663_10302620 Ga0207663_103026201 267
277 3300025916 Ga0207663_10451122 Ga0207663_104511221 267
278 3300025924 Ga0207694_10568934 Ga0207694_105689341 267
279 3300025927 Ga0207687_10205980 Ga0207687_102059802 267
280 3300025928 Ga0207700_10001454 Ga0207700_100014547 267
281 3300025939 Ga0207665_10012403 Ga0207665_100124031 267
282 3300026035 Ga0207703_10325737 Ga0207703_103257372 267
283 3300026078 Ga0207702_10133845 Ga0207702_101338453 267
284 3300026088 Ga0207641_10116420 Ga0207641_101164202 267
285 3300035089 Ga0373944_0040477 Ga0373944_0040477_516_1319 267
286 3300035692 Ga0373935_0177923 Ga0373935_0177923_412_1215 267
287 3300035695 Ga0373927_0282885 Ga0373927_0282885_21_827 267
288 3300035724 Ga0373933_0064525 Ga0373933_0064525_960_1763 267
289 3300036401 Ga0373937_0235436 Ga0373937_0235436_414_1217 267
290 3300039438 Ga0436360_0858745 Ga0436360_0858745_629_1435 267
291 3300039447 Ga0436361_0659691 Ga0436361_0659691_17_823 267
292 3300044706 Ga0466964_0174513 Ga0466964_0174513_139_942 267
293 3300046472 Ga0495580_0003063 Ga0495580_0003063_2502_3308 267
294 3300046472 Ga0495580_0200681 Ga0495580_0200681_509_1315 267
295 3300046472 Ga0495580_0264250 Ga0495580_0264250_174_980 267
296 3300046472 Ga0495580_0386217 Ga0495580_0386217_65_871 267
297 3300046491 Ga0495584_0030969 Ga0495584_0030969_913_1719 267
298 3300048903 Ga0496100_0053817 Ga0496100_0053817_1008_1811 267
299 3300048907 Ga0496104_0048492 Ga0496104_0048492_3037_3840 267
300 3300048909 Ga0496106_0035673 Ga0496106_0035673_1447_2250 267
301 3300048912 Ga0496109_0409261 Ga0496109_0409261_199_1002 267
302 3300048915 Ga0496112_0106853 Ga0496112_0106853_1143_1946 267
303 3300048916 Ga0496113_0230420 Ga0496113_0230420_158_961 267
304 3300048917 Ga0496114_0033519 Ga0496114_0033519_3001_3804 267
305 3300048918 Ga0496115_0008082 Ga0496115_0008082_2662_3465 267
306 3300050512 nmdc:mga0n895_672_c1 nmdc:mga0n895_672_c1_7060_7866 267
307 3300050512 nmdc:mga0n895_913246_c1 nmdc:mga0n895_913246_c1_47_850 267
308 3300050513 nmdc:mga0rr50_108950_c1 nmdc:mga0rr50_108950_c1_77_883 267
309 3300050513 nmdc:mga0rr50_23863_c1 nmdc:mga0rr50_23863_c1_2121_2924 267
310 3300050514 nmdc:mga08x19_14262_c1 nmdc:mga08x19_14262_c1_3776_4579 267
311 3300050514 nmdc:mga08x19_24657_c1 nmdc:mga08x19_24657_c1_743_1546 267
312 3300050514 nmdc:mga08x19_4596_c1 nmdc:mga08x19_4596_c1_527_1330 267
313 3300050515 nmdc:mga0a205_8215_c2 nmdc:mga0a205_8215_c2_4131_4937 267
314 3300053085 Ga0495619_0100376 Ga0495619_0100376_521_1324 267
315 2162886012 MBSR1b_contig_3570058 MBSR1b_0497.00000990 268
316 3300000546 LJNas_1000490 LJNas_10004903 268
317 3300001976 JGI24752J21851_1005021 JGI24752J21851_10050212 268
318 3300001978 JGI24747J21853_1001593 JGI24747J21853_10015932 268
319 3300001991 JGI24743J22301_10007922 JGI24743J22301_100079222 268
320 3300002076 JGI24749J21850_1006732 JGI24749J21850_10067321 268
321 3300002077 JGI24744J21845_10039926 JGI24744J21845_100399261 268
322 3300002155 JGI24033J26618_1005663 JGI24033J26618_10056632 268
323 3300002239 JGI24034J26672_10000271 JGI24034J26672_100002712 268
324 3300002459 JGI24751J29686_10001862 JGI24751J29686_100018623 268
325 3300005289 Ga0065704_10174353 Ga0065704_101743532 268
326 3300005290 Ga0065712_10012241 Ga0065712_100122413 268
327 3300005290 Ga0065712_10077587 Ga0065712_100775872 268
328 3300005293 Ga0065715_10036466 Ga0065715_100364662 268
329 3300005293 Ga0065715_10060498 Ga0065715_100604981 268
330 3300005293 Ga0065715_10090120 Ga0065715_1009012010 268
331 3300005295 Ga0065707_10021967 Ga0065707_100219672 268
332 3300005327 Ga0070658_10075888 Ga0070658_100758882 268
333 3300005328 Ga0070676_10032231 Ga0070676_100322312 268
334 3300005329 Ga0070683_100010189 Ga0070683_1000101892 268
335 3300005330 Ga0070690_100132376 Ga0070690_1001323762 268
336 3300005331 Ga0070670_100007150 Ga0070670_1000071502 268
337 3300005333 Ga0070677_10166839 Ga0070677_101668391 268
338 3300005334 Ga0068869_100086016 Ga0068869_1000860162 268
339 3300005334 Ga0068869_100401518 Ga0068869_1004015181 268
340 3300005335 Ga0070666_10010583 Ga0070666_100105837 268
341 3300005335 Ga0070666_10013323 Ga0070666_100133232 268
342 3300005336 Ga0070680_100196766 Ga0070680_1001967661 268
343 3300005337 Ga0070682_100092903 Ga0070682_1000929032 268
344 3300005337 Ga0070682_100587186 Ga0070682_1005871861 268
345 3300005338 Ga0068868_100008166 Ga0068868_1000081667 268
346 3300005338 Ga0068868_100100076 Ga0068868_1001000762 268
347 3300005338 Ga0068868_100384807 Ga0068868_1003848071 268
348 3300005338 Ga0068868_100459952 Ga0068868_1004599522 268
349 3300005339 Ga0070660_100009321 Ga0070660_10000932110 268
350 3300005340 Ga0070689_100036687 Ga0070689_1000366873 268
351 3300005341 Ga0070691_10052211 Ga0070691_100522113 268
352 3300005343 Ga0070687_100008433 Ga0070687_1000084333 268
353 3300005344 Ga0070661_100001784 Ga0070661_10000178412 268
354 3300005344 Ga0070661_100015246 Ga0070661_1000152463 268
355 3300005344 Ga0070661_100027302 Ga0070661_1000273024 268
356 3300005345 Ga0070692_10066722 Ga0070692_100667222 268
357 3300005347 Ga0070668_100021287 Ga0070668_1000212873 268
358 3300005347 Ga0070668_100047594 Ga0070668_1000475942 268
359 3300005353 Ga0070669_100012442 Ga0070669_1000124421 268
360 3300005353 Ga0070669_100105105 Ga0070669_1001051052 268
361 3300005353 Ga0070669_100239770 Ga0070669_1002397702 268
362 3300005354 Ga0070675_100075159 Ga0070675_1000751592 268
363 3300005355 Ga0070671_100150162 Ga0070671_1001501622 268
364 3300005355 Ga0070671_100336129 Ga0070671_1003361291 268
365 3300005356 Ga0070674_100006091 Ga0070674_1000060912 268
366 3300005364 Ga0070673_100008201 Ga0070673_1000082013 268
367 3300005365 Ga0070688_100000910 Ga0070688_10000091016 268
368 3300005366 Ga0070659_100003912 Ga0070659_1000039123 268
369 3300005366 Ga0070659_100072123 Ga0070659_1000721232 268
370 3300005367 Ga0070667_100488729 Ga0070667_1004887292 268
371 3300005434 Ga0070709_10023770 Ga0070709_100237704 268
372 3300005434 Ga0070709_10042726 Ga0070709_100427263 268
373 3300005434 Ga0070709_10043810 Ga0070709_100438102 268
374 3300005434 Ga0070709_10054944 Ga0070709_100549441 268
375 3300005434 Ga0070709_10297676 Ga0070709_102976762 268
376 3300005434 Ga0070709_10423770 Ga0070709_104237702 268
377 3300005435 Ga0070714_100004845 Ga0070714_1000048454 268
378 3300005435 Ga0070714_100027361 Ga0070714_1000273612 268
379 3300005435 Ga0070714_100086463 Ga0070714_1000864632 268
380 3300005435 Ga0070714_100296553 Ga0070714_1002965532 268
381 3300005435 Ga0070714_100394967 Ga0070714_1003949672 268
382 3300005436 Ga0070713_100000337 Ga0070713_10000033717 268
383 3300005436 Ga0070713_100025846 Ga0070713_1000258462 268
384 3300005436 Ga0070713_100061724 Ga0070713_1000617245 268
385 3300005436 Ga0070713_100098953 Ga0070713_1000989533 268
386 3300005436 Ga0070713_100171928 Ga0070713_1001719282 268
387 3300005436 Ga0070713_100436796 Ga0070713_1004367962 268
388 3300005437 Ga0070710_10035310 Ga0070710_100353103 268
389 3300005437 Ga0070710_10043821 Ga0070710_100438212 268
390 3300005437 Ga0070710_10143191 Ga0070710_101431911 268
391 3300005439 Ga0070711_100000500 Ga0070711_1000005001 268
392 3300005439 Ga0070711_100010972 Ga0070711_1000109722 268
393 3300005440 Ga0070705_100015063 Ga0070705_1000150633 268
394 3300005441 Ga0070700_100398200 Ga0070700_1003982001 268
395 3300005441 Ga0070700_100556417 Ga0070700_1005564171 268
396 3300005444 Ga0070694_100003742 Ga0070694_1000037425 268
397 3300005445 Ga0070708_100001706 Ga0070708_1000017068 268
398 3300005445 Ga0070708_100002037 Ga0070708_1000020373 268
399 3300005445 Ga0070708_100002957 Ga0070708_1000029574 268
400 3300005445 Ga0070708_100004925 Ga0070708_1000049253 268
401 3300005445 Ga0070708_100005336 Ga0070708_1000053367 268
402 3300005445 Ga0070708_100017864 Ga0070708_1000178643 268
403 3300005445 Ga0070708_100105507 Ga0070708_1001055072 268
404 3300005445 Ga0070708_100129685 Ga0070708_1001296853 268
405 3300005445 Ga0070708_100170989 Ga0070708_1001709892 268
406 3300005445 Ga0070708_100178221 Ga0070708_1001782212 268
407 3300005445 Ga0070708_100433358 Ga0070708_1004333582 268
408 3300005455 Ga0070663_100030211 Ga0070663_1000302112 268
409 3300005455 Ga0070663_100065306 Ga0070663_1000653062 268
410 3300005456 Ga0070678_100053113 Ga0070678_1000531132 268
411 3300005456 Ga0070678_100072169 Ga0070678_1000721692 268
412 3300005457 Ga0070662_100008948 Ga0070662_1000089482 268
413 3300005457 Ga0070662_100085562 Ga0070662_1000855622 268
414 3300005458 Ga0070681_10070592 Ga0070681_100705922 268
415 3300005458 Ga0070681_10087553 Ga0070681_100875533 268
416 3300005459 Ga0068867_100186233 Ga0068867_1001862332 268
417 3300005466 Ga0070685_10035425 Ga0070685_100354252 268
418 3300005467 Ga0070706_100000296 Ga0070706_10000029639 268
419 3300005467 Ga0070706_100000932 Ga0070706_10000093222 268
420 3300005467 Ga0070706_100002114 Ga0070706_1000021149 268
421 3300005467 Ga0070706_100014539 Ga0070706_1000145398 268
422 3300005467 Ga0070706_100023186 Ga0070706_1000231866 268
423 3300005467 Ga0070706_100152958 Ga0070706_1001529581 268
424 3300005468 Ga0070707_100001443 Ga0070707_10000144315 268
425 3300005468 Ga0070707_100002355 Ga0070707_1000023556 268
426 3300005468 Ga0070707_100010925 Ga0070707_1000109259 268
427 3300005468 Ga0070707_100063143 Ga0070707_1000631432 268
428 3300005468 Ga0070707_100293911 Ga0070707_1002939112 268
429 3300005468 Ga0070707_100318879 Ga0070707_1003188792 268
430 3300005471 Ga0070698_100000216 Ga0070698_10000021643 268
431 3300005471 Ga0070698_100002588 Ga0070698_1000025882 268
432 3300005471 Ga0070698_100018741 Ga0070698_1000187418 268
433 3300005471 Ga0070698_100097904 Ga0070698_1000979042 268
434 3300005471 Ga0070698_100235556 Ga0070698_1002355562 268
435 3300005518 Ga0070699_100008001 Ga0070699_1000080017 268
436 3300005518 Ga0070699_100008691 Ga0070699_1000086913 268
437 3300005518 Ga0070699_100009732 Ga0070699_1000097323 268
438 3300005518 Ga0070699_100044932 Ga0070699_1000449324 268
439 3300005518 Ga0070699_100075835 Ga0070699_1000758354 268
440 3300005530 Ga0070679_100181479 Ga0070679_1001814792 268
441 3300005530 Ga0070679_100187431 Ga0070679_1001874311 268
442 3300005535 Ga0070684_100001397 Ga0070684_1000013972 268
443 3300005535 Ga0070684_100283435 Ga0070684_1002834351 268
444 3300005536 Ga0070697_100000323 Ga0070697_10000032313 268
445 3300005536 Ga0070697_100000611 Ga0070697_10000061118 268
446 3300005536 Ga0070697_100000763 Ga0070697_1000007631 268
447 3300005536 Ga0070697_100002752 Ga0070697_10000275210 268
448 3300005536 Ga0070697_100014974 Ga0070697_1000149748 268
449 3300005536 Ga0070697_100040738 Ga0070697_1000407385 268
450 3300005536 Ga0070697_100067672 Ga0070697_1000676724 268
451 3300005536 Ga0070697_100139586 Ga0070697_1001395861 268
452 3300005536 Ga0070697_100401483 Ga0070697_1004014831 268
453 3300005536 Ga0070697_100719130 Ga0070697_1007191301 268
454 3300005539 Ga0068853_100003624 Ga0068853_1000036244 268
455 3300005539 Ga0068853_100142488 Ga0068853_1001424882 268
456 3300005543 Ga0070672_100034411 Ga0070672_1000344112 268
457 3300005543 Ga0070672_100471539 Ga0070672_1004715391 268
458 3300005544 Ga0070686_100058478 Ga0070686_1000584782 268
459 3300005545 Ga0070695_100001372 Ga0070695_1000013724 268
460 3300005546 Ga0070696_100002958 Ga0070696_1000029585 268
461 3300005547 Ga0070693_100000001 Ga0070693_10000000177 268
462 3300005547 Ga0070693_100021929 Ga0070693_1000219293 268
463 3300005548 Ga0070665_100480320 Ga0070665_1004803202 268
464 3300005549 Ga0070704_100008835 Ga0070704_1000088353 268
465 3300005549 Ga0070704_100115375 Ga0070704_1001153753 268
466 3300005563 Ga0068855_100031873 Ga0068855_1000318733 268
467 3300005563 Ga0068855_100075178 Ga0068855_1000751783 268
468 3300005564 Ga0070664_100012643 Ga0070664_1000126432 268
469 3300005564 Ga0070664_100076512 Ga0070664_1000765122 268
470 3300005564 Ga0070664_100132710 Ga0070664_1001327102 268
471 3300005577 Ga0068857_100002065 Ga0068857_1000020652 268
472 3300005577 Ga0068857_100358750 Ga0068857_1003587502 268
473 3300005578 Ga0068854_100053478 Ga0068854_1000534782 268
474 3300005614 Ga0068856_100001015 Ga0068856_10000101513 268
475 3300005614 Ga0068856_100006280 Ga0068856_10000628011 268
476 3300005614 Ga0068856_100047049 Ga0068856_1000470492 268
477 3300005614 Ga0068856_100064563 Ga0068856_1000645632 268
478 3300005615 Ga0070702_100031119 Ga0070702_1000311192 268
479 3300005616 Ga0068852_100029318 Ga0068852_1000293183 268
480 3300005616 Ga0068852_100042599 Ga0068852_1000425993 268
481 3300005616 Ga0068852_100419446 Ga0068852_1004194462 268
482 3300005617 Ga0068859_100148779 Ga0068859_1001487792 268
483 3300005618 Ga0068864_100010381 Ga0068864_10001038111 268
484 3300005718 Ga0068866_10003477 Ga0068866_100034775 268
485 3300005719 Ga0068861_100012817 Ga0068861_1000128176 268
486 3300005719 Ga0068861_100269233 Ga0068861_1002692332 268
487 3300005719 Ga0068861_100340948 Ga0068861_1003409481 268
488 3300005834 Ga0068851_10095666 Ga0068851_100956662 268
489 3300005840 Ga0068870_10016325 Ga0068870_100163252 268
490 3300005841 Ga0068863_100053582 Ga0068863_1000535824 268
491 3300005842 Ga0068858_100083628 Ga0068858_1000836282 268
492 3300005843 Ga0068860_100040319 Ga0068860_1000403193 268
493 3300005843 Ga0068860_100228588 Ga0068860_1002285882 268
494 3300005844 Ga0068862_100013927 Ga0068862_1000139276 268
495 3300005844 Ga0068862_100015353 Ga0068862_1000153532 268
496 3300006028 Ga0070717_10001935 Ga0070717_100019356 268
497 3300006028 Ga0070717_10002004 Ga0070717_1000200410 268
498 3300006028 Ga0070717_10054234 Ga0070717_100542343 268
499 3300006028 Ga0070717_10057448 Ga0070717_100574483 268
500 3300006028 Ga0070717_10216146 Ga0070717_102161462 268
501 3300006028 Ga0070717_10296437 Ga0070717_102964372 268
502 3300006028 Ga0070717_10329596 Ga0070717_103295962 268
503 3300006028 Ga0070717_10365439 Ga0070717_103654392 268
504 3300006028 Ga0070717_10515908 Ga0070717_105159082 268
505 3300006163 Ga0070715_10059162 Ga0070715_100591622 268
506 3300006163 Ga0070715_10102667 Ga0070715_101026672 268
507 3300006173 Ga0070716_100080416 Ga0070716_1000804163 268
508 3300006173 Ga0070716_100088714 Ga0070716_1000887141 268
509 3300006173 Ga0070716_100138850 Ga0070716_1001388501 268
510 3300006173 Ga0070716_100201027 Ga0070716_1002010272 268
511 3300006173 Ga0070716_100244040 Ga0070716_1002440402 268
512 3300006175 Ga0070712_100000362 Ga0070712_10000036210 268
513 3300006175 Ga0070712_100010715 Ga0070712_1000107153 268
514 3300006175 Ga0070712_100086484 Ga0070712_1000864842 268
515 3300006175 Ga0070712_100259653 Ga0070712_1002596532 268
516 3300006237 Ga0097621_100001923 Ga0097621_10000192311 268
517 3300006237 Ga0097621_100112026 Ga0097621_1001120262 268
518 3300006237 Ga0097621_100497738 Ga0097621_1004977382 268
519 3300006358 Ga0068871_100000585 Ga0068871_10000058521 268
520 3300006358 Ga0068871_100068666 Ga0068871_1000686662 268
521 3300006852 Ga0075433_10000127 Ga0075433_1000012723 268
522 3300006871 Ga0075434_100002031 Ga0075434_1000020314 268
523 3300006881 Ga0068865_100067859 Ga0068865_1000678592 268
524 3300006881 Ga0068865_100120366 Ga0068865_1001203662 268
525 3300006914 Ga0075436_100010926 Ga0075436_1000109262 268
526 3300006914 Ga0075436_100012042 Ga0075436_1000120423 268
527 3300006931 Ga0097620_100148776 Ga0097620_1001487762 268
528 3300007076 Ga0075435_100002355 Ga0075435_1000023557 268
529 3300007076 Ga0075435_100375043 Ga0075435_1003750432 268
530 3300007265 Ga0099794_10036795 Ga0099794_100367951 268
531 3300007265 Ga0099794_10072730 Ga0099794_100727301 268
532 3300007788 Ga0099795_10143338 Ga0099795_101433382 268
533 3300009093 Ga0105240_10020055 Ga0105240_100200555 268
534 3300009093 Ga0105240_10070878 Ga0105240_100708782 268
535 3300009098 Ga0105245_10003303 Ga0105245_100033034 268
536 3300009098 Ga0105245_10069228 Ga0105245_100692283 268
537 3300009098 Ga0105245_10215335 Ga0105245_102153352 268
538 3300009101 Ga0105247_10002514 Ga0105247_1000251414 268
539 3300009101 Ga0105247_10116424 Ga0105247_101164242 268
540 3300009148 Ga0105243_10123851 Ga0105243_101238512 268
541 3300009148 Ga0105243_10317126 Ga0105243_103171261 268
542 3300009174 Ga0105241_10005963 Ga0105241_100059638 268
543 3300009174 Ga0105241_10014118 Ga0105241_100141187 268
544 3300009174 Ga0105241_10033772 Ga0105241_100337724 268
545 3300009174 Ga0105241_10083990 Ga0105241_100839902 268
546 3300009176 Ga0105242_10010108 Ga0105242_100101088 268
547 3300009176 Ga0105242_10020852 Ga0105242_100208526 268
548 3300009176 Ga0105242_10658394 Ga0105242_106583941 268
549 3300009177 Ga0105248_10055473 Ga0105248_100554732 268
550 3300009177 Ga0105248_10307263 Ga0105248_103072632 268
551 3300009545 Ga0105237_10025863 Ga0105237_100258635 268
552 3300009545 Ga0105237_10303716 Ga0105237_103037161 268
553 3300009551 Ga0105238_10365038 Ga0105238_103650382 268
554 3300009553 Ga0105249_10010157 Ga0105249_100101577 268
555 3300009553 Ga0105249_10436169 Ga0105249_104361691 268
556 3300010159 Ga0099796_10021618 Ga0099796_100216182 268
557 3300010375 Ga0105239_10011628 Ga0105239_100116285 268
558 3300010375 Ga0105239_10095866 Ga0105239_100958662 268
559 3300010375 Ga0105239_10222264 Ga0105239_102222642 268
560 3300010375 Ga0105239_10795267 Ga0105239_107952672 268
561 3300011119 Ga0105246_10005537 Ga0105246_100055373 268
562 3300013100 Ga0157373_10000999 Ga0157373_100009993 268
563 3300013100 Ga0157373_10055493 Ga0157373_100554932 268
564 3300013102 Ga0157371_10006244 Ga0157371_100062443 268
565 3300013102 Ga0157371_10026617 Ga0157371_100266173 268
566 3300013104 Ga0157370_10198099 Ga0157370_101980992 268
567 3300013105 Ga0157369_10008080 Ga0157369_100080805 268
568 3300013105 Ga0157369_10037339 Ga0157369_100373392 268
569 3300013296 Ga0157374_10010242 Ga0157374_100102423 268
570 3300013296 Ga0157374_10031823 Ga0157374_100318233 268
571 3300013296 Ga0157374_10046709 Ga0157374_100467092 268
572 3300013296 Ga0157374_10058005 Ga0157374_100580052 268
573 3300013297 Ga0157378_10004197 Ga0157378_100041976 268
574 3300013297 Ga0157378_10173859 Ga0157378_101738591 268
575 3300013297 Ga0157378_10256000 Ga0157378_102560001 268
576 3300013306 Ga0163162_10034770 Ga0163162_100347706 268
577 3300013306 Ga0163162_10088319 Ga0163162_100883194 268
578 3300013306 Ga0163162_10383135 Ga0163162_103831351 268
579 3300013307 Ga0157372_10031314 Ga0157372_100313143 268
580 3300013307 Ga0157372_10032538 Ga0157372_100325388 268
581 3300013307 Ga0157372_10059140 Ga0157372_100591402 268
582 3300013307 Ga0157372_10324347 Ga0157372_103243472 268
583 3300013308 Ga0157375_10040143 Ga0157375_100401433 268
584 3300013308 Ga0157375_10093761 Ga0157375_100937611 268
585 3300014325 Ga0163163_10009183 Ga0163163_100091831 268
586 3300014325 Ga0163163_10099155 Ga0163163_100991552 268
587 3300014325 Ga0163163_10168815 Ga0163163_101688152 268
588 3300014326 Ga0157380_10159859 Ga0157380_101598592 268
589 3300014497 Ga0182008_10016550 Ga0182008_100165502 268
590 3300014497 Ga0182008_10112926 Ga0182008_101129262 268
591 3300014745 Ga0157377_10002369 Ga0157377_1000236912 268
592 3300014968 Ga0157379_10001668 Ga0157379_100016689 268
593 3300014968 Ga0157379_10070163 Ga0157379_100701632 268
594 3300014968 Ga0157379_10097968 Ga0157379_100979682 268
595 3300014969 Ga0157376_10000401 Ga0157376_1000040117 268
596 3300014969 Ga0157376_10034140 Ga0157376_100341403 268
597 3300014969 Ga0157376_10043187 Ga0157376_100431872 268
598 3300015262 Ga0182007_10003616 Ga0182007_100036163 268
599 3300015262 Ga0182007_10030822 Ga0182007_100308222 268
600 3300015265 Ga0182005_1009258 Ga0182005_10092582 268
601 3300015265 Ga0182005_1040254 Ga0182005_10402542 268
602 3300017792 Ga0163161_10011112 Ga0163161_100111122 268
603 3300022467 Ga0224712_10138969 Ga0224712_101389692 268
604 3300022730 Ga0224570_100191 Ga0224570_1001913 268
605 3300024227 Ga0228598_1002872 Ga0228598_10028723 268
606 3300025315 Ga0207697_10085734 Ga0207697_100857341 268
607 3300025321 Ga0207656_10068759 Ga0207656_100687592 268
608 3300025885 Ga0207653_10002603 Ga0207653_100026032 268
609 3300025898 Ga0207692_10011393 Ga0207692_100113932 268
610 3300025899 Ga0207642_10073539 Ga0207642_100735392 268
611 3300025901 Ga0207688_10002555 Ga0207688_100025556 268
612 3300025903 Ga0207680_10028391 Ga0207680_100283911 268
613 3300025903 Ga0207680_10079085 Ga0207680_100790852 268
614 3300025904 Ga0207647_10023570 Ga0207647_100235703 268
615 3300025906 Ga0207699_10003305 Ga0207699_100033054 268
616 3300025906 Ga0207699_10104809 Ga0207699_101048092 268
617 3300025906 Ga0207699_10117232 Ga0207699_101172322 268
618 3300025906 Ga0207699_10126084 Ga0207699_101260842 268
619 3300025906 Ga0207699_10162179 Ga0207699_101621792 268
620 3300025906 Ga0207699_10187640 Ga0207699_101876402 268
621 3300025906 Ga0207699_10246682 Ga0207699_102466821 268
622 3300025906 Ga0207699_10251533 Ga0207699_102515332 268
623 3300025907 Ga0207645_10001175 Ga0207645_1000117513 268
624 3300025907 Ga0207645_10043419 Ga0207645_100434192 268
625 3300025908 Ga0207643_10000391 Ga0207643_100003915 268
626 3300025909 Ga0207705_10173386 Ga0207705_101733862 268
627 3300025910 Ga0207684_10001228 Ga0207684_1000122822 268
628 3300025910 Ga0207684_10001445 Ga0207684_100014459 268
629 3300025910 Ga0207684_10001633 Ga0207684_100016333 268
630 3300025910 Ga0207684_10030972 Ga0207684_100309724 268
631 3300025910 Ga0207684_10066170 Ga0207684_100661702 268
632 3300025910 Ga0207684_10089974 Ga0207684_100899741 268
633 3300025910 Ga0207684_10105717 Ga0207684_101057173 268
634 3300025911 Ga0207654_10016176 Ga0207654_100161763 268
635 3300025911 Ga0207654_10035438 Ga0207654_100354383 268
636 3300025911 Ga0207654_10092027 Ga0207654_100920271 268
637 3300025912 Ga0207707_10007054 Ga0207707_1000705410 268
638 3300025912 Ga0207707_10024519 Ga0207707_100245192 268
639 3300025913 Ga0207695_10055095 Ga0207695_100550953 268
640 3300025914 Ga0207671_10010924 Ga0207671_100109242 268
641 3300025914 Ga0207671_10349776 Ga0207671_103497762 268
642 3300025915 Ga0207693_10000403 Ga0207693_100004033 268
643 3300025915 Ga0207693_10019304 Ga0207693_100193043 268
644 3300025915 Ga0207693_10025559 Ga0207693_100255592 268
645 3300025915 Ga0207693_10032951 Ga0207693_100329512 268
646 3300025915 Ga0207693_10093298 Ga0207693_100932982 268
647 3300025915 Ga0207693_10124888 Ga0207693_101248882 268
648 3300025915 Ga0207693_10144533 Ga0207693_101445332 268
649 3300025915 Ga0207693_10254760 Ga0207693_102547601 268
650 3300025915 Ga0207693_10337500 Ga0207693_103375001 268
651 3300025916 Ga0207663_10132822 Ga0207663_101328222 268
652 3300025916 Ga0207663_10145153 Ga0207663_101451533 268
653 3300025916 Ga0207663_10485923 Ga0207663_104859231 268
654 3300025918 Ga0207662_10004876 Ga0207662_100048763 268
655 3300025919 Ga0207657_10000404 Ga0207657_100004042 268
656 3300025919 Ga0207657_10004616 Ga0207657_100046164 268
657 3300025919 Ga0207657_10010530 Ga0207657_100105303 268
658 3300025920 Ga0207649_10000250 Ga0207649_100002502 268
659 3300025920 Ga0207649_10016637 Ga0207649_100166374 268
660 3300025920 Ga0207649_10078855 Ga0207649_100788552 268
661 3300025921 Ga0207652_10009055 Ga0207652_100090553 268
662 3300025922 Ga0207646_10001233 Ga0207646_1000123330 268
663 3300025922 Ga0207646_10002176 Ga0207646_100021763 268
664 3300025922 Ga0207646_10114528 Ga0207646_101145282 268
665 3300025922 Ga0207646_10249834 Ga0207646_102498342 268
666 3300025922 Ga0207646_10333431 Ga0207646_103334311 268
667 3300025922 Ga0207646_10341771 Ga0207646_103417712 268
668 3300025922 Ga0207646_10381264 Ga0207646_103812642 268
669 3300025923 Ga0207681_10172452 Ga0207681_101724522 268
670 3300025924 Ga0207694_10008362 Ga0207694_100083622 268
671 3300025925 Ga0207650_10000124 Ga0207650_1000012427 268
672 3300025926 Ga0207659_10024310 Ga0207659_100243104 268
673 3300025927 Ga0207687_10007312 Ga0207687_100073124 268
674 3300025927 Ga0207687_10013447 Ga0207687_100134476 268
675 3300025927 Ga0207687_10058589 Ga0207687_100585892 268
676 3300025928 Ga0207700_10000273 Ga0207700_1000027321 268
677 3300025928 Ga0207700_10006930 Ga0207700_100069303 268
678 3300025928 Ga0207700_10040290 Ga0207700_100402902 268
679 3300025928 Ga0207700_10188032 Ga0207700_101880322 268
680 3300025928 Ga0207700_10230367 Ga0207700_102303672 268
681 3300025928 Ga0207700_10322721 Ga0207700_103227212 268
682 3300025928 Ga0207700_10341955 Ga0207700_103419552 268
683 3300025928 Ga0207700_10613750 Ga0207700_106137501 268
684 3300025929 Ga0207664_10000369 Ga0207664_1000036916 268
685 3300025929 Ga0207664_10080165 Ga0207664_100801652 268
686 3300025929 Ga0207664_10200784 Ga0207664_102007841 268
687 3300025929 Ga0207664_10329448 Ga0207664_103294482 268
688 3300025929 Ga0207664_10334779 Ga0207664_103347791 268
689 3300025931 Ga0207644_10039951 Ga0207644_100399512 268
690 3300025931 Ga0207644_10066456 Ga0207644_100664562 268
691 3300025932 Ga0207690_10005284 Ga0207690_100052844 268
692 3300025932 Ga0207690_10137741 Ga0207690_101377413 268
693 3300025932 Ga0207690_10324936 Ga0207690_103249362 268
694 3300025933 Ga0207706_10001777 Ga0207706_100017777 268
695 3300025933 Ga0207706_10008223 Ga0207706_100082232 268
696 3300025933 Ga0207706_10008485 Ga0207706_100084852 268
697 3300025934 Ga0207686_10082092 Ga0207686_100820922 268
698 3300025935 Ga0207709_10087310 Ga0207709_100873102 268
699 3300025935 Ga0207709_10279611 Ga0207709_102796111 268
700 3300025938 Ga0207704_10055013 Ga0207704_100550132 268
701 3300025938 Ga0207704_10234449 Ga0207704_102344492 268
702 3300025939 Ga0207665_10008417 Ga0207665_100084174 268
703 3300025939 Ga0207665_10010607 Ga0207665_100106074 268
704 3300025939 Ga0207665_10030144 Ga0207665_100301442 268
705 3300025939 Ga0207665_10032978 Ga0207665_100329782 268
706 3300025939 Ga0207665_10040931 Ga0207665_100409313 268
707 3300025939 Ga0207665_10051398 Ga0207665_100513982 268
708 3300025939 Ga0207665_10249062 Ga0207665_102490622 268
709 3300025940 Ga0207691_10014213 Ga0207691_100142135 268
710 3300025941 Ga0207711_10003212 Ga0207711_100032125 268
711 3300025941 Ga0207711_10004172 Ga0207711_100041722 268
712 3300025942 Ga0207689_10068438 Ga0207689_100684381 268
713 3300025944 Ga0207661_10000779 Ga0207661_1000077916 268
714 3300025945 Ga0207679_10000084 Ga0207679_1000008420 268
715 3300025949 Ga0207667_10027636 Ga0207667_100276363 268
716 3300025949 Ga0207667_10030517 Ga0207667_100305172 268
717 3300025949 Ga0207667_10068942 Ga0207667_100689422 268
718 3300025960 Ga0207651_10004758 Ga0207651_100047588 268
719 3300025961 Ga0207712_10221258 Ga0207712_102212582 268
720 3300025961 Ga0207712_10524201 Ga0207712_105242011 268
721 3300025972 Ga0207668_10039947 Ga0207668_100399471 268
722 3300025972 Ga0207668_10048448 Ga0207668_100484482 268
723 3300025986 Ga0207658_10006671 Ga0207658_100066718 268
724 3300025986 Ga0207658_10282300 Ga0207658_102823001 268
725 3300026023 Ga0207677_10015304 Ga0207677_100153043 268
726 3300026023 Ga0207677_10040265 Ga0207677_100402652 268
727 3300026023 Ga0207677_10261112 Ga0207677_102611122 268
728 3300026023 Ga0207677_10476014 Ga0207677_104760141 268
729 3300026035 Ga0207703_10045781 Ga0207703_100457814 268
730 3300026041 Ga0207639_10003861 Ga0207639_100038617 268
731 3300026067 Ga0207678_10002403 Ga0207678_100024032 268
732 3300026067 Ga0207678_10005424 Ga0207678_100054249 268
733 3300026067 Ga0207678_10143568 Ga0207678_101435682 268
734 3300026078 Ga0207702_10001068 Ga0207702_1000106813 268
735 3300026078 Ga0207702_10010995 Ga0207702_100109952 268
736 3300026078 Ga0207702_10013997 Ga0207702_100139971 268
737 3300026078 Ga0207702_10132573 Ga0207702_101325732 268
738 3300026078 Ga0207702_10257217 Ga0207702_102572172 268
739 3300026088 Ga0207641_10000006 Ga0207641_10000006164 268
740 3300026089 Ga0207648_10001425 Ga0207648_100014252 268
741 3300026089 Ga0207648_10057077 Ga0207648_100570773 268
742 3300026095 Ga0207676_10000615 Ga0207676_100006156 268
743 3300026116 Ga0207674_10001059 Ga0207674_1000105919 268
744 3300026116 Ga0207674_10056122 Ga0207674_100561224 268
745 3300026116 Ga0207674_10259686 Ga0207674_102596862 268
746 3300026118 Ga0207675_100031140 Ga0207675_1000311406 268
747 3300026118 Ga0207675_100052899 Ga0207675_1000528993 268
748 3300026118 Ga0207675_100316514 Ga0207675_1003165142 268
749 3300026121 Ga0207683_10001543 Ga0207683_1000154314 268
750 3300026121 Ga0207683_10021577 Ga0207683_100215772 268
751 3300026142 Ga0207698_10356147 Ga0207698_103561472 268
752 3300026142 Ga0207698_10386754 Ga0207698_103867541 268
753 3300028017 Ga0265356_1000828 Ga0265356_10008282 268
754 3300028379 Ga0268266_10001591 Ga0268266_1000159113 268
755 3300028380 Ga0268265_10055937 Ga0268265_100559372 268
756 3300028381 Ga0268264_10053361 Ga0268264_100533612 268
757 3300028800 Ga0265338_10001433 Ga0265338_100014332 268
758 3300028800 Ga0265338_10099018 Ga0265338_100990182 268
759 3300028800 Ga0265338_10194389 Ga0265338_101943892 268
760 3300028800 Ga0265338_10308892 Ga0265338_103088921 268
761 3300030760 Ga0265762_1000624 Ga0265762_10006242 268
762 3300030879 Ga0265765_1014203 Ga0265765_10142031 268
763 3300031090 Ga0265760_10002488 Ga0265760_100024882 268
764 3300031090 Ga0265760_10003500 Ga0265760_100035004 268
765 3300031090 Ga0265760_10005087 Ga0265760_100050873 268
766 3300031090 Ga0265760_10012659 Ga0265760_100126591 268
767 3300031090 Ga0265760_10022295 Ga0265760_100222952 268
768 3300031090 Ga0265760_10030148 Ga0265760_100301482 268
769 3300031241 Ga0265325_10045881 Ga0265325_100458812 268
770 3300031249 Ga0265339_10036741 Ga0265339_100367414 268
771 3300035083 Ga0373926_0010540 Ga0373926_0010540_203_1009 268
772 3300035086 Ga0373934_0007445 Ga0373934_0007445_1988_2794 268
773 3300035089 Ga0373944_0032896 Ga0373944_0032896_204_1010 268
774 3300035111 Ga0373923_0021997 Ga0373923_0021997_802_1608 268
775 3300035113 Ga0373936_0001155 Ga0373936_0001155_8017_8823 268
776 3300035113 Ga0373936_0009759 Ga0373936_0009759_407_1213 268
777 3300035116 Ga0373945_0012240 Ga0373945_0012240_2003_2809 268
778 3300035116 Ga0373945_0023231 Ga0373945_0023231_388_1194 268
779 3300035117 Ga0373953_0044465 Ga0373953_0044465_886_1692 268
780 3300035117 Ga0373953_0055699 Ga0373953_0055699_640_1446 268
781 3300035118 Ga0373954_0000475 Ga0373954_0000475_4131_4937 268
782 3300035118 Ga0373954_0057777 Ga0373954_0057777_551_1357 268
783 3300035118 Ga0373954_0181570 Ga0373954_0181570_31_837 268
784 3300035119 Ga0373956_0019698 Ga0373956_0019698_877_1683 268
785 3300035119 Ga0373956_0076692 Ga0373956_0076692_282_1088 268
786 3300035170 Ga0373943_0000002 Ga0373943_0000002_95526_96332 268
787 3300035171 Ga0373946_0015758 Ga0373946_0015758_1709_2515 268
788 3300035172 Ga0373955_0005326 Ga0373955_0005326_1027_1833 268
789 3300035410 Ga0373924_0010012 Ga0373924_0010012_1007_1813 268
790 3300035691 Ga0373931_0016703 Ga0373931_0016703_2405_3211 268
791 3300035692 Ga0373935_0001381 Ga0373935_0001381_3024_3830 268
792 3300035692 Ga0373935_0010991 Ga0373935_0010991_3538_4344 268
793 3300035692 Ga0373935_0324011 Ga0373935_0324011_41_847 268
794 3300035695 Ga0373927_0000021 Ga0373927_0000021_96695_97501 268
795 3300035695 Ga0373927_0142778 Ga0373927_0142778_513_1319 268
796 3300035724 Ga0373933_0000280 Ga0373933_0000280_4705_5511 268
797 3300035724 Ga0373933_0028973 Ga0373933_0028973_1947_2753 268
798 3300035724 Ga0373933_0108872 Ga0373933_0108872_618_1424 268
799 3300036401 Ga0373937_0000932 Ga0373937_0000932_19617_20423 268
800 3300036401 Ga0373937_0119670 Ga0373937_0119670_1314_2120 268
801 3300036401 Ga0373937_0150777 Ga0373937_0150777_798_1604 268
802 3300037068 Ga0373925_0000151 Ga0373925_0000151_45897_46703 268
803 3300037068 Ga0373925_0009744 Ga0373925_0009744_236_1042 268
804 3300037068 Ga0373925_0045837 Ga0373925_0045837_1456_2262 268
805 3300039450 Ga0436363_0566584 Ga0436363_0566584_719_1525 268
806 3300039453 Ga0436362_0103387 Ga0436362_0103387_259_1065 268
807 3300046459 Ga0495629_0026960 Ga0495629_0026960_2461_3267 268
808 3300046461 Ga0495641_0037034 Ga0495641_0037034_344_1150 268
809 3300046462 Ga0495651_0032478 Ga0495651_0032478_744_1550 268
810 3300046472 Ga0495580_0001399 Ga0495580_0001399_3999_4805 268
811 3300046472 Ga0495580_0002731 Ga0495580_0002731_3848_4654 268
812 3300046472 Ga0495580_0003320 Ga0495580_0003320_7612_8418 268
813 3300046473 Ga0495582_0000740 Ga0495582_0000740_13957_14763 268
814 3300046473 Ga0495582_0229225 Ga0495582_0229225_143_949 268
815 3300046475 Ga0495639_0032047 Ga0495639_0032047_1369_2175 268
816 3300046477 Ga0495664_0003944 Ga0495664_0003944_3807_4613 268
817 3300046477 Ga0495664_0042197 Ga0495664_0042197_320_1126 268
818 3300046499 Ga0495594_0046273 Ga0495594_0046273_1395_2201 268
819 3300046511 Ga0495608_0060570 Ga0495608_0060570_323_1129 268
820 3300046517 Ga0495630_0039085 Ga0495630_0039085_912_1718 268
821 3300046517 Ga0495630_0040152 Ga0495630_0040152_2161_2967 268
822 3300046517 Ga0495630_0362822 Ga0495630_0362822_212_1018 268
823 3300046531 Ga0495665_0034697 Ga0495665_0034697_591_1397 268
824 3300046533 Ga0495640_0055945 Ga0495640_0055945_968_1774 268
825 3300046535 Ga0495586_0043098 Ga0495586_0043098_1450_2256 268
826 3300046536 Ga0495587_0002156 Ga0495587_0002156_9211_10017 268
827 3300046663 Ga0495635_0073044 Ga0495635_0073044_1516_2322 268
828 3300046679 Ga0495623_0052150 Ga0495623_0052150_350_1156 268
829 3300046681 Ga0495647_0006318 Ga0495647_0006318_1308_2114 268
830 3300046683 Ga0495658_0019002 Ga0495658_0019002_1372_2178 268
831 3300046684 Ga0495669_0152987 Ga0495669_0152987_187_993 268
832 3300046690 Ga0495624_0071534 Ga0495624_0071534_443_1249 268
833 3300047317 Ga0495604_0002567 Ga0495604_0002567_9391_10197 268
834 3300047319 Ga0495674_0010839 Ga0495674_0010839_7631_8437 268
835 3300047319 Ga0495674_0060767 Ga0495674_0060767_392_1198 268
836 3300047319 Ga0495674_0311434 Ga0495674_0311434_340_1146 268
837 3300047321 Ga0495676_0037314 Ga0495676_0037314_852_1658 268
838 3300047322 Ga0495680_0053832 Ga0495680_0053832_1086_1892 268
839 3300047471 Ga0495684_0055020 Ga0495684_0055020_1544_2350 268
840 3300047673 Ga0495593_0117137 Ga0495593_0117137_116_922 268
841 3300048088 Ga0495602_0005726 Ga0495602_0005726_5506_6312 268
842 3300048088 Ga0495602_0162949 Ga0495602_0162949_298_1104 268
843 3300048089 Ga0495614_0046936 Ga0495614_0046936_624_1430 268
844 3300048903 Ga0496100_0185522 Ga0496100_0185522_541_1347 268
845 3300048904 Ga0496101_0347876 Ga0496101_0347876_184_990 268
846 3300048905 Ga0496102_0008775 Ga0496102_0008775_354_1160 268
847 3300048905 Ga0496102_0010411 Ga0496102_0010411_6904_7710 268
848 3300048905 Ga0496102_0058594 Ga0496102_0058594_751_1557 268
849 3300048905 Ga0496102_0066826 Ga0496102_0066826_1626_2432 268
850 3300048906 Ga0496103_0005654 Ga0496103_0005654_4235_5041 268
851 3300048906 Ga0496103_0141251 Ga0496103_0141251_355_1161 268
852 3300048907 Ga0496104_0104969 Ga0496104_0104969_319_1125 268
853 3300048907 Ga0496104_0205488 Ga0496104_0205488_858_1664 268
854 3300048908 Ga0496105_0067714 Ga0496105_0067714_646_1452 268
855 3300048908 Ga0496105_0132881 Ga0496105_0132881_1129_1935 268
856 3300048909 Ga0496106_0042053 Ga0496106_0042053_335_1141 268
857 3300048910 Ga0496107_0121540 Ga0496107_0121540_756_1562 268
858 3300048911 Ga0496108_0000200 Ga0496108_0000200_49743_50549 268
859 3300048912 Ga0496109_0000149 Ga0496109_0000149_18056_18862 268
860 3300048912 Ga0496109_0029141 Ga0496109_0029141_1859_2665 268
861 3300048913 Ga0496110_0011543 Ga0496110_0011543_535_1341 268
862 3300048913 Ga0496110_0014791 Ga0496110_0014791_1927_2733 268
863 3300048914 Ga0496111_0301695 Ga0496111_0301695_293_1099 268
864 3300048915 Ga0496112_0000070 Ga0496112_0000070_32086_32892 268
865 3300048915 Ga0496112_0071705 Ga0496112_0071705_567_1373 268
866 3300048915 Ga0496112_0162547 Ga0496112_0162547_309_1115 268
867 3300048916 Ga0496113_0000078 Ga0496113_0000078_34881_35687 268
868 3300048917 Ga0496114_0341019 Ga0496114_0341019_43_849 268
869 3300048918 Ga0496115_0016864 Ga0496115_0016864_4165_4971 268
870 3300048918 Ga0496115_0047127 Ga0496115_0047127_1785_2591 268
871 3300049583 Ga0501067_0113626 Ga0501067_0113626_464_1270 268
872 3300049744 Ga0501083_0050669 Ga0501083_0050669_550_1356 268
873 3300050512 nmdc:mga0n895_492038_c1 nmdc:mga0n895_492038_c1_312_1118 268
874 3300050512 nmdc:mga0n895_926_c1 nmdc:mga0n895_926_c1_16171_16977 268
875 3300050513 nmdc:mga0rr50_287554_c1 nmdc:mga0rr50_287554_c1_211_1017 268
876 3300050513 nmdc:mga0rr50_7147_c1 nmdc:mga0rr50_7147_c1_2039_2845 268
877 3300050514 nmdc:mga08x19_3079_c1 nmdc:mga08x19_3079_c1_2874_3680 268
878 3300050514 nmdc:mga08x19_3287_c1 nmdc:mga08x19_3287_c1_858_1664 268
879 3300050515 nmdc:mga0a205_149_c2 nmdc:mga0a205_149_c2_10612_11418 268
880 3300053077 Ga0495601_0095488 Ga0495601_0095488_853_1659 268
881 3300053078 Ga0495612_0118616 Ga0495612_0118616_22_828 268
882 3300053085 Ga0495619_0055893 Ga0495619_0055893_1061_1867 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02790

COX2_TM

Cytochrome C oxidase subunit II, transmembrane domain

48

132

0.85

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

148

277

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gym-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.8984 174 259
5u7n-assembly7.cif.gz_G crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop 0.8931 114 252
7w5z-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.8919 174 266
2cua-assembly2.cif.gz_B the cua domain of cytochrome ba3 from thermus thermophilus 0.8905 112 252
6ptt-assembly2.cif.gz_B soluble model of arabidopsis thaliana cua (tt3lat) 0.8902 116 250
ID Description Score Start End Superfamily
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9586 178 259 2.60.40.420
af_Q8I6V2_60_165_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.929 175 258 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8969 178 251 2.60.40.420
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8953 116 262 2.60.40.420
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8919 114 252 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A2V5UWG5-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9718 176 266 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-V4Y3K9-F1-model_v4 Heme/copper-type cytochrome/quinol oxidase, subunit 2 0.9688 181 263 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A6M0AKU6-F1-model_v4 Cytochrome c oxidase subunit II 0.9674 178 261 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A536T2D0-F1-model_v4 C-type cytochrome 0.9659 178 268 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A1U8F2V9-F1-model_v4 deleted 0.9642 178 266

Feature Viewer

pLDDT pTM Quality
88.2 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map