F484559

General Info

Members Datasets Scaffolds Average Seq Length
882 501 766 296

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_1349070|Ga0451793_1349070_12_1076
Length 354
Sequence MLDSLSDNHNNPAVGADLAATTTAADTAGRRKTVDRKYRPQDQEGAPVTGSRDREETMAGEILGVIGTGRMGGPMAGRLIDAGYSLVIYDTQSEATQPLVKRGAQLCKSPADVASSADIVLASLPTPDIVKAVTLGQDGISSGSRAKIVIDLSTSGPGAAKIVAEGLKAKGMTLVDAPVSGGIKGAVNGTLAVMVSCPQATYETVQPILKTFGKLFYTGDKPGVAQTAKLANNLMAAAALVITSEAVAMGVKGGVNAKVLIDIINASSGRNSASEDKFPRAVLPGTFDFGFTTGLSYKDVRLCVDEAEAMGVPMVCGAVVRQMLAITNAKYGAASDFTSIAKVLEEWAGVEMRG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
6 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
7 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
8 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
9 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
10 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
11 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
12 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
13 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
14 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
15 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
16 2791355199
17 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
18 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
19 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
20 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
21 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
22 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
23 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
24 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
25 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
26 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
27 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
28 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
29 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
30 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
31 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
32 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
33 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
34 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
35 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
36 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
37 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
38 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
39 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
40 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
41 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
42 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
43 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
44 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
45 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
46 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
47 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
48 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
49 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
50 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
51 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
52 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
53 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
54 2922368715
55 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
56 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
57 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
58 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
59 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
60 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
61 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
62 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
63 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
64 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
65 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
66 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
67 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
68 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
69 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
70 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
71 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
72 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
73 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
74 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
75 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
76 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
77 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
78 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
79 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
80 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
81 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
82 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
83 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
84 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
85 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
86 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
87 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
88 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
89 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
90 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
91 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
92 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
93 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
94 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
95 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
96 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
97 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
98 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
99 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
100 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
101 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
103 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
104 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
105 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
106 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
107 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
108 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
109 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
110 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
111 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
112 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
113 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
114 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
115 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
116 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
117 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
118 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
119 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
120 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
121 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
122 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
123 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
124 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
125 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
126 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
127 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
128 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
129 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
130 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
131 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
132 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
133 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
134 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
135 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
136 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
137 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
138 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
139 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
140 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
141 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
142 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
143 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
144 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
145 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
146 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
147 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
148 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
149 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
150 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
151 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
152 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
153 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
154 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
155 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
156 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
157 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
158 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
159 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
160 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
161 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
162 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
163 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
164 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
165 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
166 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
167 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
168 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
169 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
170 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
171 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
172 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
173 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
174 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
175 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
176 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
177 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
178 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
179 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
180 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
181 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
182 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
183 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
184 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
185 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
186 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
187 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
188 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
189 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
190 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
191 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
192 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
193 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
194 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
195 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
196 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
197 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
198 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
199 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
200 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
201 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
202 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
203 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
204 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
205 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
206 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
207 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
208 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
211 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
213 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
215 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
265 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
270 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
271 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
272 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
273 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
274 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
275 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
276 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
277 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
278 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
279 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
280 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
281 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
282 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
283 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
284 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
285 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
286 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
287 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
288 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
289 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
290 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
291 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
292 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
293 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
294 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
295 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
305 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
306 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
307 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
308 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
309 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
310 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
311 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
312 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
313 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
314 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
315 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
316 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
317 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
318 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
319 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
320 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
321 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
322 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
323 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
324 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
325 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
326 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
327 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
328 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
329 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
330 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
331 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
332 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
333 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
334 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
335 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
336 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
339 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
340 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
341 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
342 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
343 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
344 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
345 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
346 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
347 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
348 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
349 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
350 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
351 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
352 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
353 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
354 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
355 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
356 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
357 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
358 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
359 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
362 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
363 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
364 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
365 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
366 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
367 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
368 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
369 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
370 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
371 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
372 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
373 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
374 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
375 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
376 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
377 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
383 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
384 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
385 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
386 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
387 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
388 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
389 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
390 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
391 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
392 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
393 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
394 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
395 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
396 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
397 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
413 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
414 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
415 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
416 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
417 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
418 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
419 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
420 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
421 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
422 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
423 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
424 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
425 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
426 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
427 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
430 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
431 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
432 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
433 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
434 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
435 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
436 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
437 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
438 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
439 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
440 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
441 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
442 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
443 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
444 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
445 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
446 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
447 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
448 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
449 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
450 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
451 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
452 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
453 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
454 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
455 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
456 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
457 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
458 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
459 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
460 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
461 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
462 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
463 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
464 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
465 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
466 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
467 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
468 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
469 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
470 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
471 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
472 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
473 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
474 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
475 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
476 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
477 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
478 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
479 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
480 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
481 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
482 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
483 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
484 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
485 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
486 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
487 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
488 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
489 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
490 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
491 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
492 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
493 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
494 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
495 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
496 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
497 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
498 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
499 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
500 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
501 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.05
Metatranscriptomes 0
Isolates 12.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 10.54
Rhizoplane 5.9
Rhizosphere 64.4
Stem 0
Stem Tuber 0
Unclassified 7.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10046505 3300001990 Bacteria 1324
2 JGI24744J21845_10003865 3300002077 Bacteria 3097
3 JGI24742J22300_10010062 3300002244 Bacteria 1562
4 JGI25165J46597_1005887 3300003214 Bacteria 2265
5 JGI25153J46596_10000341 3300003215 Bacteria 33151
6 JGI25153J46596_10001379 3300003215 Bacteria 14528
7 JGI25160J50197_1004593 3300003354 Bacteria 5942
8 JGI25404J52841_10005401 3300003659 Bacteria 2640
9 JGI25404J52841_10037932 3300003659 Bacteria 1023
10 Ga0055531_10002463 3300003794 Bacteria 12370
11 Ga0065165_1000681 3300005262 Bacteria 48693
12 Ga0065165_1001931 3300005262 Bacteria 19753
13 Ga0065712_10000969 3300005290 Bacteria 13044
14 Ga0065707_10098857 3300005295 Bacteria 3051
15 Ga0065707_10123114 3300005295 Bacteria 2073
16 Ga0070683_100014586 3300005329 Bacteria 6880
17 Ga0070683_100053245 3300005329 Bacteria 3750
18 Ga0070683_100401525 3300005329 Bacteria 1307
19 Ga0070670_100142419 3300005331 Bacteria 2073
20 Ga0068869_100065065 3300005334 Bacteria 2683
21 Ga0068869_100196482 3300005334 Bacteria 1589
22 Ga0068869_100252231 3300005334 Bacteria 1410
23 Ga0070666_10017187 3300005335 Bacteria 4635
24 Ga0070682_100045771 3300005337 Bacteria 2714
25 Ga0068868_100059914 3300005338 Bacteria 3012
26 Ga0068868_100105923 3300005338 Bacteria 2281
27 Ga0070660_100381183 3300005339 Bacteria 1164
28 Ga0070660_100493188 3300005339 Bacteria 1019
29 Ga0070691_10027132 3300005341 Bacteria 2672
30 Ga0070668_100046351 3300005347 Bacteria 3337
31 Ga0070668_100272572 3300005347 Bacteria 1411
32 Ga0070669_100204884 3300005353 Bacteria 1554
33 Ga0070675_100002481 3300005354 Bacteria 13808
34 Ga0070675_100007488 3300005354 Bacteria 8435
35 Ga0070675_100115357 3300005354 Bacteria 2277
36 Ga0070675_100628698 3300005354 Unclassified 975
37 Ga0070671_100038177 3300005355 Bacteria 3987
38 Ga0070674_100000476 3300005356 Bacteria 20221
39 Ga0070673_100139861 3300005364 Bacteria 2041
40 Ga0070673_100144247 3300005364 Bacteria 2011
41 Ga0070673_100152920 3300005364 Bacteria 1956
42 Ga0070688_100004755 3300005365 Bacteria 7095
43 Ga0070688_100076067 3300005365 Bacteria 2160
44 Ga0070709_10023794 3300005434 Bacteria 3602
45 Ga0070709_10045339 3300005434 Bacteria 2728
46 Ga0070714_100090614 3300005435 Bacteria 2678
47 Ga0070713_100002518 3300005436 Bacteria 11977
48 Ga0070713_100004557 3300005436 Bacteria 9341
49 Ga0070705_100097358 3300005440 Bacteria 1849
50 Ga0070700_100006999 3300005441 Bacteria 6056
51 Ga0070694_100289830 3300005444 Bacteria 1251
52 Ga0070663_100041871 3300005455 Bacteria 3215
53 Ga0070663_100170576 3300005455 Bacteria 1682
54 Ga0070663_100185209 3300005455 Bacteria 1617
55 Ga0070678_100004606 3300005456 Bacteria 7834
56 Ga0070662_100003416 3300005457 Bacteria 9898
57 Ga0070681_10212549 3300005458 Bacteria 1850
58 Ga0070681_10259776 3300005458 Bacteria 1649
59 Ga0068867_100009428 3300005459 Bacteria 6885
60 Ga0068867_100016586 3300005459 Bacteria 5231
61 Ga0068867_100079412 3300005459 Bacteria 2469
62 Ga0068867_100234624 3300005459 Bacteria 1485
63 Ga0070685_10057775 3300005466 Bacteria 2259
64 Ga0070685_10224171 3300005466 Bacteria 1233
65 Ga0070698_100072429 3300005471 Bacteria 3453
66 Ga0070679_100091967 3300005530 Bacteria 3021
67 Ga0070684_100003344 3300005535 Bacteria 12011
68 Ga0068853_100040533 3300005539 Bacteria 3974
69 Ga0068853_100249941 3300005539 Bacteria 1627
70 Ga0068853_100291834 3300005539 Bacteria 1505
71 Ga0070672_100004181 3300005543 Bacteria 9424
72 Ga0070672_100261007 3300005543 Bacteria 1461
73 Ga0070686_100013061 3300005544 Bacteria 4742
74 Ga0070696_100206695 3300005546 Bacteria 1468
75 Ga0070665_100010542 3300005548 Bacteria 9354
76 Ga0070665_100014654 3300005548 Bacteria 7868
77 Ga0070665_100015537 3300005548 Bacteria 7648
78 Ga0070665_100054790 3300005548 Bacteria 3999
79 Ga0070665_100099492 3300005548 Bacteria 2912
80 Ga0070665_100191829 3300005548 Bacteria 2044
81 Ga0070665_100430454 3300005548 Bacteria 1328
82 Ga0068855_100408197 3300005563 Bacteria 1487
83 Ga0070664_100137467 3300005564 Bacteria 2149
84 Ga0070664_100452694 3300005564 Bacteria 1179
85 Ga0068857_100467611 3300005577 Bacteria 1181
86 Ga0068856_100126146 3300005614 Bacteria 2563
87 Ga0068856_100284916 3300005614 Bacteria 1669
88 Ga0070702_100022851 3300005615 Bacteria 3314
89 Ga0068852_100046626 3300005616 Bacteria 3694
90 Ga0068859_100039799 3300005617 Bacteria 4717
91 Ga0068859_100104055 3300005617 Bacteria 2897
92 Ga0068859_100717491 3300005617 Bacteria 1090
93 Ga0068866_10001504 3300005718 Bacteria 9932
94 Ga0068866_10202575 3300005718 Bacteria 1187
95 Ga0068861_100001410 3300005719 Bacteria 15121
96 Ga0068863_100040352 3300005841 Bacteria 4438
97 Ga0068863_100069326 3300005841 Bacteria 3334
98 Ga0068863_100203163 3300005841 Bacteria 1907
99 Ga0068863_100689477 3300005841 Bacteria 1015
100 Ga0068858_100016595 3300005842 Bacteria 6917
101 Ga0068858_100162579 3300005842 Bacteria 2102
102 Ga0068858_100227507 3300005842 Bacteria 1767
103 Ga0068858_100315006 3300005842 Bacteria 1494
104 Ga0068860_100159038 3300005843 Bacteria 2178
105 Ga0068860_100213300 3300005843 Unclassified 1873
106 Ga0068862_100010210 3300005844 Bacteria 7748
107 Ga0068862_100103972 3300005844 Bacteria 2488
108 Ga0081455_10004131 3300005937 Bacteria 16419
109 Ga0081455_10069578 3300005937 Bacteria 2926
110 Ga0081455_10129860 3300005937 Bacteria 1972
111 Ga0081538_10054512 3300005981 Bacteria 2364
112 Ga0081540_1000494 3300005983 Bacteria 38779
113 Ga0081540_1002879 3300005983 Bacteria 13900
114 Ga0081540_1005426 3300005983 Bacteria 9517
115 Ga0081540_1026431 3300005983 Bacteria 3313
116 Ga0081540_1034536 3300005983 Bacteria 2725
117 Ga0081540_1065405 3300005983 Bacteria 1710
118 Ga0081540_1075439 3300005983 Bacteria 1541
119 Ga0081539_10012193 3300005985 Bacteria 6669
120 Ga0081539_10046386 3300005985 Bacteria 2490
121 Ga0081539_10078029 3300005985 Bacteria 1749
122 Ga0070717_10007444 3300006028 Bacteria 8134
123 Ga0075365_10012757 3300006038 Bacteria 5002
124 Ga0075365_10019095 3300006038 Bacteria 4224
125 Ga0075365_10043906 3300006038 Bacteria 2928
126 Ga0075368_10009316 3300006042 Bacteria 3530
127 Ga0075368_10086559 3300006042 Bacteria 1279
128 Ga0075368_10091661 3300006042 Bacteria 1243
129 Ga0075363_100004237 3300006048 Bacteria 6235
130 Ga0075363_100133668 3300006048 Bacteria 1393
131 Ga0075364_10007969 3300006051 Bacteria 6313
132 Ga0075364_10009844 3300006051 Bacteria 5750
133 Ga0075364_10078115 3300006051 Bacteria 2186
134 Ga0070715_10029979 3300006163 Bacteria 2195
135 Ga0070712_100320600 3300006175 Bacteria 1260
136 Ga0075362_10066182 3300006177 Bacteria 1642
137 Ga0075362_10136223 3300006177 Bacteria 1171
138 Ga0075367_10007456 3300006178 Bacteria 5602
139 Ga0075367_10055500 3300006178 Bacteria 2351
140 Ga0075367_10075720 3300006178 Bacteria 2030
141 Ga0075367_10098202 3300006178 Bacteria 1787
142 Ga0075367_10307675 3300006178 Bacteria 998
143 Ga0075369_10053199 3300006186 Bacteria 1756
144 Ga0075366_10236535 3300006195 Bacteria 1113
145 Ga0097621_100034319 3300006237 Bacteria 4047
146 Ga0097621_100078541 3300006237 Bacteria 2742
147 Ga0097621_100094426 3300006237 Bacteria 2507
148 Ga0097621_100109020 3300006237 Bacteria 2338
149 Ga0075370_10120071 3300006353 Bacteria 1530
150 Ga0068871_100012180 3300006358 Bacteria 6331
151 Ga0068871_100073101 3300006358 Bacteria 2826
152 Ga0075428_100017758 3300006844 Bacteria 7861
153 Ga0075428_100028955 3300006844 Bacteria 6129
154 Ga0075428_100037086 3300006844 Bacteria 5368
155 Ga0075428_100322219 3300006844 Bacteria 1661
156 Ga0075430_100013136 3300006846 Bacteria 7056
157 Ga0075430_100231422 3300006846 Bacteria 1532
158 Ga0075430_100325466 3300006846 Bacteria 1270
159 Ga0075431_100005928 3300006847 Bacteria 12089
160 Ga0075431_100076409 3300006847 Bacteria 3456
161 Ga0075433_10000751 3300006852 Bacteria 22250
162 Ga0075433_10008110 3300006852 Bacteria 8364
163 Ga0075433_10502666 3300006852 Bacteria 1067
164 Ga0075434_100000015 3300006871 Bacteria 79201
165 Ga0075434_100119043 3300006871 Bacteria 2655
166 Ga0075434_100610672 3300006871 Bacteria 1110
167 Ga0075429_100206885 3300006880 Bacteria 1719
168 Ga0068865_100004843 3300006881 Bacteria 8138
169 Ga0068865_100029307 3300006881 Bacteria 3651
170 Ga0068865_100317973 3300006881 Bacteria 1251
171 Ga0097620_100039801 3300006931 Bacteria 4717
172 Ga0097620_100104058 3300006931 Bacteria 2897
173 Ga0097620_100717479 3300006931 Bacteria 1090
174 Ga0099794_10011208 3300007265 Bacteria 3833
175 Ga0099794_10051459 3300007265 Bacteria 1983
176 Ga0099794_10154249 3300007265 Bacteria 1166
177 Ga0111539_10008593 3300009094 Bacteria 12967
178 Ga0111539_10020952 3300009094 Bacteria 8049
179 Ga0111539_10038369 3300009094 Bacteria 5778
180 Ga0105245_10012507 3300009098 Bacteria 7386
181 Ga0105245_10317629 3300009098 Bacteria 1533
182 Ga0105247_10055321 3300009101 Bacteria 2449
183 Ga0114129_10032874 3300009147 Bacteria 7330
184 Ga0114129_10105595 3300009147 Bacteria 3892
185 Ga0114129_10273534 3300009147 Bacteria 2259
186 Ga0105243_10004917 3300009148 Bacteria 10472
187 Ga0105243_10490050 3300009148 Bacteria 1162
188 Ga0105243_10616313 3300009148 Bacteria 1047
189 Ga0105241_10003092 3300009174 Bacteria 12399
190 Ga0105242_10013357 3300009176 Bacteria 6344
191 Ga0105242_10031421 3300009176 Bacteria 4241
192 Ga0105242_10058772 3300009176 Bacteria 3154
193 Ga0105248_10044214 3300009177 Bacteria 4995
194 Ga0105248_10084363 3300009177 Bacteria 3573
195 Ga0105248_10158011 3300009177 Bacteria 2558
196 Ga0105248_10305401 3300009177 Bacteria 1792
197 Ga0105248_10695653 3300009177 Bacteria 1147
198 Ga0105237_10179566 3300009545 Bacteria 2117
199 Ga0105237_10412606 3300009545 Bacteria 1355
200 Ga0105238_10092844 3300009551 Bacteria 3006
201 Ga0105238_10158849 3300009551 Bacteria 2236
202 Ga0105238_10168008 3300009551 Bacteria 2169
203 Ga0105238_10195644 3300009551 Bacteria 1997
204 Ga0105249_10059920 3300009553 Bacteria 3492
205 Ga0105249_10263949 3300009553 Bacteria 1712
206 Ga0099796_10054208 3300010159 Bacteria 1401
207 Ga0105239_10011901 3300010375 Bacteria 9706
208 Ga0105239_10048076 3300010375 Bacteria 4677
209 Ga0157369_10057570 3300013105 Bacteria 4193
210 Ga0157374_10150853 3300013296 Bacteria 2260
211 Ga0157374_10551221 3300013296 Bacteria 1161
212 Ga0163162_10019957 3300013306 Bacteria 6583
213 Ga0163162_10067469 3300013306 Bacteria 3627
214 Ga0157375_10055760 3300013308 Bacteria 3898
215 Ga0157375_10079426 3300013308 Bacteria 3316
216 Ga0157375_10969536 3300013308 Bacteria 991
217 Ga0163163_10099598 3300014325 Bacteria 2928
218 Ga0163163_10793163 3300014325 Bacteria 1010
219 Ga0157380_10038666 3300014326 Bacteria 3706
220 Ga0157380_10339241 3300014326 Bacteria 1401
221 Ga0157380_10344966 3300014326 Bacteria 1391
222 Ga0157377_10034746 3300014745 Bacteria 2759
223 Ga0157376_10004946 3300014969 Bacteria 9294
224 Ga0157376_10023747 3300014969 Bacteria 4804
225 Ga0157376_10300846 3300014969 Bacteria 1518
226 Ga0163161_10015817 3300017792 Bacteria 5261
227 Ga0214544_1000035 3300021320 Bacteria 146874
228 Ga0214542_1000790 3300021321 Bacteria 60657
229 Ga0214545_1000555 3300021324 Bacteria 60657
230 Ga0214543_1003298 3300021327 Bacteria 31425
231 Ga0213876_10081432 3300021384 Bacteria 1712
232 Ga0213876_10168603 3300021384 Bacteria 1165
233 Ga0209563_107917 3300025230 Bacteria 1710
234 Ga0209677_110833 3300025253 Bacteria 1479
235 Ga0209233_1002259 3300025261 Bacteria 7186
236 Ga0209233_1002359 3300025261 Bacteria 7025
237 Ga0209455_1002310 3300025272 Bacteria 7469
238 Ga0209758_1000024 3300025297 Bacteria 591966
239 Ga0209758_1012317 3300025297 Bacteria 4801
240 Ga0209758_1013367 3300025297 Bacteria 4482
241 Ga0209256_1000102 3300025299 Bacteria 199097
242 Ga0209256_1028393 3300025299 Bacteria 1579
243 Ga0207426_1001374 3300025302 Bacteria 20609
244 Ga0207426_1004107 3300025302 Bacteria 7328
245 Ga0207426_1010826 3300025302 Bacteria 3517
246 Ga0209257_1002165 3300025304 Bacteria 20381
247 Ga0207697_10045610 3300025315 Bacteria 1804
248 Ga0207642_10007566 3300025899 Bacteria 3676
249 Ga0207710_10028112 3300025900 Bacteria 2440
250 Ga0207710_10051727 3300025900 Bacteria 1845
251 Ga0207710_10154427 3300025900 Bacteria 1115
252 Ga0207688_10028649 3300025901 Bacteria 3064
253 Ga0207699_10018860 3300025906 Bacteria 3664
254 Ga0207699_10060858 3300025906 Bacteria 2269
255 Ga0207645_10029591 3300025907 Bacteria 3530
256 Ga0207645_10033987 3300025907 Bacteria 3276
257 Ga0207643_10085268 3300025908 Bacteria 1834
258 Ga0207684_10038351 3300025910 Bacteria 4065
259 Ga0207707_10000649 3300025912 Bacteria 34391
260 Ga0207707_10036776 3300025912 Bacteria 4279
261 Ga0207671_10136370 3300025914 Bacteria 1887
262 Ga0207660_10029357 3300025917 Bacteria 3772
263 Ga0207660_10036967 3300025917 Bacteria 3398
264 Ga0207662_10133265 3300025918 Bacteria 1568
265 Ga0207652_10196162 3300025921 Bacteria 1816
266 Ga0207652_10196241 3300025921 Bacteria 1816
267 Ga0207681_10072192 3300025923 Bacteria 2410
268 Ga0207650_10013724 3300025925 Bacteria 5615
269 Ga0207650_10428368 3300025925 Bacteria 1098
270 Ga0207659_10001287 3300025926 Bacteria 14997
271 Ga0207659_10060823 3300025926 Bacteria 2720
272 Ga0207687_10012540 3300025927 Bacteria 5537
273 Ga0207687_10049582 3300025927 Bacteria 2920
274 Ga0207700_10013427 3300025928 Bacteria 5329
275 Ga0207664_10329188 3300025929 Bacteria 1349
276 Ga0207644_10029613 3300025931 Bacteria 3800
277 Ga0207644_10212297 3300025931 Bacteria 1531
278 Ga0207644_10237084 3300025931 Bacteria 1451
279 Ga0207644_10275925 3300025931 Unclassified 1349
280 Ga0207706_10004694 3300025933 Bacteria 12807
281 Ga0207706_10032619 3300025933 Bacteria 4637
282 Ga0207706_10081680 3300025933 Bacteria 2840
283 Ga0207686_10013513 3300025934 Bacteria 4519
284 Ga0207709_10002562 3300025935 Bacteria 11319
285 Ga0207670_10025512 3300025936 Bacteria 3711
286 Ga0207670_10034830 3300025936 Bacteria 3259
287 Ga0207669_10000452 3300025937 Bacteria 17877
288 Ga0207669_10099892 3300025937 Bacteria 1915
289 Ga0207704_10036095 3300025938 Bacteria 2841
290 Ga0207704_10045309 3300025938 Bacteria 2612
291 Ga0207704_10114931 3300025938 Bacteria 1828
292 Ga0207704_10285556 3300025938 Bacteria 1256
293 Ga0207704_10366587 3300025938 Bacteria 1126
294 Ga0207691_10026786 3300025940 Bacteria 5410
295 Ga0207691_10064280 3300025940 Bacteria 3325
296 Ga0207691_10345323 3300025940 Bacteria 1274
297 Ga0207711_10170500 3300025941 Bacteria 1975
298 Ga0207711_10355200 3300025941 Bacteria 1357
299 Ga0207689_10002068 3300025942 Bacteria 18937
300 Ga0207689_10071215 3300025942 Bacteria 2856
301 Ga0207689_10115778 3300025942 Bacteria 2204
302 Ga0207689_10298320 3300025942 Bacteria 1336
303 Ga0207661_10003739 3300025944 Bacteria 10602
304 Ga0207661_10353298 3300025944 Bacteria 1326
305 Ga0207679_10254039 3300025945 Bacteria 1496
306 Ga0207667_10044937 3300025949 Bacteria 4678
307 Ga0207651_10015098 3300025960 Bacteria 4479
308 Ga0207651_10027631 3300025960 Bacteria 3567
309 Ga0207651_10047969 3300025960 Bacteria 2884
310 Ga0207651_10084156 3300025960 Bacteria 2303
311 Ga0207712_10013735 3300025961 Bacteria 5194
312 Ga0207668_10014694 3300025972 Bacteria 4849
313 Ga0207668_10101281 3300025972 Bacteria 2140
314 Ga0207668_10227130 3300025972 Bacteria 1503
315 Ga0207668_10232776 3300025972 Bacteria 1486
316 Ga0207677_10089057 3300026023 Bacteria 2239
317 Ga0207677_10117746 3300026023 Bacteria 1992
318 Ga0207703_10109503 3300026035 Bacteria 2354
319 Ga0207703_10221990 3300026035 Bacteria 1690
320 Ga0207639_10279591 3300026041 Bacteria 1467
321 Ga0207678_10006581 3300026067 Bacteria 10303
322 Ga0207678_10037870 3300026067 Bacteria 4194
323 Ga0207678_10127749 3300026067 Bacteria 2168
324 Ga0207678_10307375 3300026067 Bacteria 1363
325 Ga0207708_10016103 3300026075 Bacteria 5616
326 Ga0207702_10519753 3300026078 Bacteria 1162
327 Ga0207641_10027234 3300026088 Bacteria 4721
328 Ga0207641_10536916 3300026088 Bacteria 1139
329 Ga0207648_10012533 3300026089 Bacteria 7934
330 Ga0207648_10040939 3300026089 Bacteria 4069
331 Ga0207648_10042029 3300026089 Bacteria 4013
332 Ga0207648_10141395 3300026089 Bacteria 2121
333 Ga0207648_10283304 3300026089 Bacteria 1482
334 Ga0207674_10117826 3300026116 Bacteria 2626
335 Ga0207675_100006604 3300026118 Bacteria 10974
336 Ga0207675_100157190 3300026118 Bacteria 2167
337 Ga0207675_100683940 3300026118 Bacteria 1034
338 Ga0207683_10010731 3300026121 Bacteria 7811
339 Ga0207683_10039677 3300026121 Bacteria 4108
340 Ga0207683_10099993 3300026121 Bacteria 2589
341 Ga0207683_10163485 3300026121 Bacteria 2014
342 Ga0207698_10045879 3300026142 Bacteria 3296
343 Ga0207698_10222425 3300026142 Bacteria 1707
344 Ga0209588_1014464 3300027671 Bacteria 2416
345 Ga0209813_10001412 3300027866 Bacteria 5425
346 Ga0209813_10064194 3300027866 Bacteria 1179
347 Ga0207428_10018760 3300027907 Bacteria 5903
348 Ga0207428_10067764 3300027907 Bacteria 2810
349 Ga0268266_10002702 3300028379 Bacteria 18611
350 Ga0268266_10018025 3300028379 Bacteria 6019
351 Ga0268266_10018984 3300028379 Bacteria 5857
352 Ga0268266_10033303 3300028379 Bacteria 4380
353 Ga0268266_10068401 3300028379 Bacteria 3075
354 Ga0268266_10129753 3300028379 Bacteria 2253
355 Ga0268266_10164981 3300028379 Bacteria 2006
356 Ga0268266_10381714 3300028379 Bacteria 1329
357 Ga0268265_10103808 3300028380 Bacteria 2303
358 Ga0268265_10155806 3300028380 Bacteria 1933
359 Ga0268265_10206983 3300028380 Bacteria 1706
360 Ga0268265_10438855 3300028380 Bacteria 1216
361 Ga0268264_10040954 3300028381 Bacteria 3829
362 Ga0268264_10056810 3300028381 Unclassified 3272
363 Ga0268264_10124992 3300028381 Bacteria 2272
364 Ga0268264_10299292 3300028381 Bacteria 1514
365 Ga0268264_10356987 3300028381 Bacteria 1393
366 Ga0307515_10251724 3300028794 Bacteria 1518
367 Ga0265325_10076910 3300031241 Bacteria 1665
368 Ga0265340_10016235 3300031247 Bacteria 3859
369 Ga0265339_10151886 3300031249 Bacteria 1170
370 Ga0307408_100349165 3300031548 Bacteria 1255
371 Ga0265313_10058494 3300031595 Bacteria 1816
372 Ga0265313_10075685 3300031595 Bacteria 1540
373 Ga0307508_10000003 3300031616 Bacteria 321602
374 Ga0307508_10137047 3300031616 Bacteria 2051
375 Ga0265314_10039828 3300031711 Bacteria 3380
376 Ga0265314_10230147 3300031711 Bacteria 1076
377 Ga0265342_10019858 3300031712 Bacteria 4322
378 Ga0307405_10100554 3300031731 Bacteria 1938
379 Ga0307416_100363432 3300032002 Bacteria 1470
380 Ga0307414_10014979 3300032004 Bacteria 4669
381 Ga0307411_10054265 3300032005 Bacteria 2630
382 Ga0307411_10103069 3300032005 Bacteria 2023
383 Ga0307415_100036378 3300032126 Bacteria 3225
384 Ga0307415_100282304 3300032126 Bacteria 1366
385 Ga0307510_10003141 3300033180 Bacteria 19142
386 Ga0307510_10005841 3300033180 Bacteria 14674
387 Ga0373930_0003359 3300034816 Bacteria 2533
388 Ga0373934_0121459 3300035086 Bacteria 1063
389 Ga0373944_0037620 3300035089 Bacteria 1483
390 Ga0373923_0012719 3300035111 Bacteria 3120
391 Ga0373923_0070628 3300035111 Bacteria 1499
392 Ga0373936_0014305 3300035113 Bacteria 3031
393 Ga0373936_0040510 3300035113 Bacteria 1866
394 Ga0373941_0056353 3300035115 Bacteria 1266
395 Ga0373953_0009862 3300035117 Bacteria 3306
396 Ga0373953_0122071 3300035117 Bacteria 1107
397 Ga0373954_0057619 3300035118 Bacteria 1830
398 Ga0373943_0014517 3300035170 Bacteria 3568
399 Ga0373943_0074471 3300035170 Bacteria 1726
400 Ga0373946_0009162 3300035171 Bacteria 3643
401 Ga0373946_0048645 3300035171 Bacteria 1766
402 Ga0373946_0128812 3300035171 Bacteria 1162
403 Ga0373955_0025059 3300035172 Bacteria 3059
404 Ga0373955_0061865 3300035172 Bacteria 2069
405 Ga0373924_0103477 3300035410 Bacteria 1226
406 Ga0373935_0031246 3300035692 Bacteria 3304
407 Ga0373927_0000954 3300035695 Bacteria 22032
408 Ga0373927_0035464 3300035695 Bacteria 3244
409 Ga0373933_0023593 3300035724 Bacteria 3516
410 Ga0373933_0164535 3300035724 Bacteria 1410
411 Ga0373947_0009391 3300035725 Bacteria 5617
412 Ga0373947_0012457 3300035725 Bacteria 4874
413 Ga0373937_0009087 3300036401 Bacteria 8626
414 Ga0373937_0321978 3300036401 Bacteria 1463
415 Ga0373925_0010072 3300037068 Bacteria 6866
416 Ga0373925_0016266 3300037068 Bacteria 5385
417 Ga0373925_0023854 3300037068 Bacteria 4462
418 Ga0373925_0418241 3300037068 Bacteria 1095
419 Ga0395900_0456615 3300037418 Unclassified 1233
420 Ga0395898_0157520 3300037466 Bacteria 2172
421 Ga0395905_0191162 3300037471 Bacteria 1920
422 Ga0436364_1433595 3300037853 Bacteria 6375
423 Ga0395901_0279105 3300038443 Bacteria 1736
424 Ga0395901_0292590 3300038443 Bacteria 1690
425 Ga0436365_0087400 3300039437 Bacteria 4523
426 Ga0436365_0165134 3300039437 Bacteria 2422
427 Ga0436365_0624315 3300039437 Bacteria 3936
428 Ga0436365_1215759 3300039437 Bacteria 2848
429 Ga0436365_1444558 3300039437 Bacteria 1110
430 Ga0436365_1895007 3300039437 Bacteria 2926
431 Ga0436360_0566741 3300039438 Bacteria 2833
432 Ga0436360_1164509 3300039438 Bacteria 5103
433 Ga0436361_0271360 3300039447 Bacteria 1812
434 Ga0436361_0322180 3300039447 Bacteria 2988
435 Ga0436363_0474007 3300039450 Bacteria 2071
436 Ga0436363_0547163 3300039450 Bacteria 1713
437 Ga0436362_0719252 3300039453 Bacteria 2532
438 Ga0439465_0014088 3300041413 Bacteria 2490
439 Ga0451793_1349070 3300041452 Bacteria 1216
440 Ga0439435_0022761 3300042436 Unclassified 1638
441 Ga0466969_0126182 3300044656 Bacteria 1189
442 Ga0466957_0041755 3300044842 Bacteria 2774
443 Ga0466960_0186864 3300044901 Bacteria 1126
444 Ga0495592_0003549 3300046454 Bacteria 11204
445 Ga0495592_0010029 3300046454 Bacteria 7137
446 Ga0495603_0063913 3300046455 Bacteria 2170
447 Ga0495603_0076090 3300046455 Bacteria 1970
448 Ga0495603_0140592 3300046455 Bacteria 1404
449 Ga0495629_0001147 3300046459 Bacteria 20928
450 Ga0495638_0094057 3300046460 Bacteria 1802
451 Ga0495641_0002236 3300046461 Bacteria 15439
452 Ga0495641_0161677 3300046461 Bacteria 1001
453 Ga0495653_0170097 3300046463 Bacteria 1505
454 Ga0495582_0008262 3300046473 Bacteria 5745
455 Ga0495582_0071543 3300046473 Bacteria 1919
456 Ga0495582_0176517 3300046473 Bacteria 1217
457 Ga0495639_0000398 3300046475 Bacteria 20606
458 Ga0495639_0003550 3300046475 Bacteria 6734
459 Ga0495639_0080012 3300046475 Bacteria 1521
460 Ga0495664_0007541 3300046477 Bacteria 6048
461 Ga0495584_0038133 3300046491 Bacteria 2429
462 Ga0495584_0054732 3300046491 Bacteria 2008
463 Ga0495594_0041616 3300046499 Bacteria 2515
464 Ga0495607_0142905 3300046501 Bacteria 1233
465 Ga0495607_0209006 3300046501 Bacteria 961
466 Ga0495618_0042727 3300046514 Bacteria 2858
467 Ga0495628_0050962 3300046516 Bacteria 3273
468 Ga0495628_0186902 3300046516 Bacteria 1565
469 Ga0495630_0075520 3300046517 Bacteria 2539
470 Ga0495630_0108732 3300046517 Bacteria 2100
471 Ga0495631_0019556 3300046518 Bacteria 3174
472 Ga0495632_0033888 3300046519 Bacteria 2618
473 Ga0495632_0062345 3300046519 Bacteria 1808
474 Ga0495644_0004762 3300046523 Bacteria 5329
475 Ga0495666_0031920 3300046526 Bacteria 2580
476 Ga0495652_0254883 3300046529 Bacteria 1298
477 Ga0495665_0014316 3300046531 Bacteria 4279
478 Ga0495640_0013759 3300046533 Bacteria 6149
479 Ga0495640_0034920 3300046533 Bacteria 3561
480 Ga0495587_0018953 3300046536 Bacteria 4265
481 Ga0495609_0063453 3300046538 Bacteria 1630
482 Ga0495621_0039119 3300046539 Bacteria 1658
483 Ga0495645_0223769 3300046543 Bacteria 1264
484 Ga0495622_0084889 3300046557 Bacteria 1456
485 Ga0495633_0100997 3300046558 Bacteria 1339
486 Ga0495667_0004349 3300046559 Bacteria 9563
487 Ga0495656_0004072 3300046615 Bacteria 4978
488 Ga0495656_0038921 3300046615 Bacteria 1972
489 Ga0495656_0044048 3300046615 Bacteria 1877
490 Ga0495668_0140046 3300046616 Bacteria 1324
491 Ga0495668_0187209 3300046616 Bacteria 1134
492 Ga0495634_0001733 3300046642 Bacteria 18896
493 Ga0495625_0282933 3300046660 Bacteria 1066
494 Ga0495635_0001081 3300046663 Bacteria 18078
495 Ga0495635_0085052 3300046663 Bacteria 2164
496 Ga0495661_0155655 3300046665 Bacteria 1231
497 Ga0495588_0050611 3300046674 Bacteria 2138
498 Ga0495599_0105725 3300046678 Bacteria 1753
499 Ga0495623_0188135 3300046679 Bacteria 1195
500 Ga0495646_0042421 3300046680 Bacteria 2792
501 Ga0495647_0001006 3300046681 Bacteria 8574
502 Ga0495658_0056309 3300046683 Unclassified 2242
503 Ga0495658_0154521 3300046683 Bacteria 1411
504 Ga0495658_0167506 3300046683 Bacteria 1358
505 Ga0495669_0008165 3300046684 Bacteria 4393
506 Ga0495624_0002089 3300046690 Bacteria 15229
507 Ga0495624_0108558 3300046690 Bacteria 1707
508 Ga0495624_0151832 3300046690 Bacteria 1417
509 Ga0495670_0128162 3300046691 Bacteria 1322
510 Ga0495671_0041056 3300046692 Bacteria 2331
511 Ga0495671_0122735 3300046692 Bacteria 1267
512 Ga0495589_0057881 3300046794 Bacteria 1906
513 Ga0495581_0134378 3300047315 Bacteria 1442
514 Ga0495604_0047759 3300047317 Bacteria 3333
515 Ga0495604_0102507 3300047317 Bacteria 2101
516 Ga0495674_0001446 3300047319 Bacteria 23283
517 Ga0495674_0008442 3300047319 Bacteria 9814
518 Ga0495674_0101329 3300047319 Bacteria 2449
519 Ga0495672_0028166 3300047320 Bacteria 3559
520 Ga0495676_0127611 3300047321 Bacteria 1841
521 Ga0495684_0000087 3300047471 Bacteria 64920
522 Ga0495686_0130577 3300047472 Bacteria 1490
523 Ga0495593_0002136 3300047673 Bacteria 11813
524 Ga0495593_0033169 3300047673 Bacteria 2813
525 Ga0495602_0308477 3300048088 Bacteria 1156
526 Ga0495614_0004768 3300048089 Bacteria 6121
527 Ga0496100_0035251 3300048903 Bacteria 3146
528 Ga0496100_0189035 3300048903 Bacteria 1494
529 Ga0496100_0205027 3300048903 Bacteria 1439
530 Ga0496100_0341693 3300048903 Bacteria 1129
531 Ga0496101_0001189 3300048904 Bacteria 15572
532 Ga0496101_0048707 3300048904 Bacteria 3046
533 Ga0496101_0094496 3300048904 Bacteria 2228
534 Ga0496102_0084164 3300048905 Bacteria 2935
535 Ga0496102_0446369 3300048905 Bacteria 1214
536 Ga0496102_0487707 3300048905 Bacteria 1154
537 Ga0496103_0194200 3300048906 Bacteria 1305
538 Ga0496104_0002386 3300048907 Bacteria 16182
539 Ga0496104_0014562 3300048907 Bacteria 7105
540 Ga0496104_0077658 3300048907 Bacteria 3163
541 Ga0496104_0384724 3300048907 Bacteria 1315
542 Ga0496104_0464594 3300048907 Bacteria 1177
543 Ga0496105_0017371 3300048908 Bacteria 5766
544 Ga0496105_0110092 3300048908 Bacteria 2273
545 Ga0496105_0120437 3300048908 Bacteria 2164
546 Ga0496105_0166548 3300048908 Bacteria 1808
547 Ga0496106_0036302 3300048909 Bacteria 3687
548 Ga0496106_0040858 3300048909 Bacteria 3475
549 Ga0496107_0107396 3300048910 Bacteria 2050
550 Ga0496108_0000487 3300048911 Bacteria 31765
551 Ga0496108_0106252 3300048911 Bacteria 2397
552 Ga0496108_0276783 3300048911 Bacteria 1461
553 Ga0496109_0009661 3300048912 Bacteria 8229
554 Ga0496109_0148262 3300048912 Bacteria 2196
555 Ga0496109_0282311 3300048912 Bacteria 1565
556 Ga0496109_0525448 3300048912 Bacteria 1117
557 Ga0496110_0003734 3300048913 Bacteria 11729
558 Ga0496110_0149967 3300048913 Bacteria 2111
559 Ga0496111_0135726 3300048914 Bacteria 1822
560 Ga0496111_0145085 3300048914 Bacteria 1759
561 Ga0496112_0011293 3300048915 Bacteria 8148
562 Ga0496112_0042693 3300048915 Bacteria 4437
563 Ga0496112_0053589 3300048915 Bacteria 3962
564 Ga0496112_0164440 3300048915 Bacteria 2185
565 Ga0496114_0009568 3300048917 Bacteria 7695
566 Ga0496114_0029704 3300048917 Bacteria 4494
567 Ga0496114_0134194 3300048917 Bacteria 2139
568 Ga0496114_0214453 3300048917 Bacteria 1689
569 Ga0496114_0410185 3300048917 Bacteria 1200
570 Ga0496114_0449639 3300048917 Bacteria 1141
571 Ga0496115_0036316 3300048918 Bacteria 3901
572 Ga0496115_0074383 3300048918 Bacteria 2758
573 Ga0496115_0210135 3300048918 Bacteria 1607
574 Ga0496115_0257217 3300048918 Bacteria 1436
575 Ga0496115_0305696 3300048918 Bacteria 1303
576 Ga0496115_0370002 3300048918 Bacteria 1167
577 Ga0496115_0401612 3300048918 Bacteria 1112
578 Ga0496116_0084615 3300048919 Bacteria 1953
579 Ga0496118_0042192 3300048921 Bacteria 3601
580 Ga0496118_0208721 3300048921 Bacteria 1148
581 Ga0496119_0056311 3300048922 Bacteria 2383
582 Ga0496120_0016686 3300048923 Bacteria 4791
583 Ga0496120_0175714 3300048923 Bacteria 1056
584 Ga0496121_0000287 3300048924 Bacteria 104774
585 Ga0496121_0011898 3300048924 Bacteria 9580
586 Ga0496121_0016703 3300048924 Bacteria 7553
587 Ga0496121_0028576 3300048924 Bacteria 5188
588 Ga0496121_0028747 3300048924 Bacteria 5166
589 Ga0496121_0229726 3300048924 Bacteria 1300
590 Ga0496124_0054828 3300048927 Bacteria 3372
591 Ga0496124_0103910 3300048927 Bacteria 2298
592 Ga0496125_0052927 3300048928 Bacteria 3334
593 Ga0496126_0009399 3300048929 Bacteria 10387
594 Ga0496126_0050865 3300048929 Bacteria 3775
595 Ga0496126_0051576 3300048929 Bacteria 3744
596 Ga0496126_0055696 3300048929 Bacteria 3576
597 Ga0496126_0057522 3300048929 Bacteria 3509
598 Ga0496126_0077632 3300048929 Bacteria 2944
599 Ga0501031_0008853 3300049568 Bacteria 6543
600 Ga0501032_0224688 3300049569 Bacteria 1221
601 Ga0501033_0071054 3300049570 Bacteria 2557
602 Ga0501033_0377595 3300049570 Bacteria 990
603 Ga0501034_0001115 3300049571 Bacteria 37686
604 Ga0501034_0014439 3300049571 Bacteria 8132
605 Ga0501034_0325337 3300049571 Bacteria 1469
606 Ga0501034_0550428 3300049571 Bacteria 1063
607 Ga0501036_0014922 3300049572 Bacteria 6481
608 Ga0501036_0034435 3300049572 Bacteria 4284
609 Ga0501036_0128424 3300049572 Bacteria 2140
610 Ga0501036_0281509 3300049572 Bacteria 1392
611 Ga0501036_0352064 3300049572 Bacteria 1230
612 Ga0501037_0101158 3300049573 Bacteria 2080
613 Ga0501037_0146564 3300049573 Bacteria 1688
614 Ga0501037_0176383 3300049573 Bacteria 1518
615 Ga0501037_0331821 3300049573 Bacteria 1052
616 Ga0501038_0017526 3300049574 Bacteria 6474
617 Ga0501038_0043637 3300049574 Bacteria 3898
618 Ga0501038_0175825 3300049574 Bacteria 1730
619 Ga0501039_0039064 3300049575 Bacteria 3666
620 Ga0501039_0046288 3300049575 Bacteria 3360
621 Ga0501039_0336270 3300049575 Bacteria 1187
622 Ga0501040_0005197 3300049576 Bacteria 8414
623 Ga0501040_0010518 3300049576 Bacteria 6052
624 Ga0501041_0004345 3300049577 Bacteria 8197
625 Ga0501042_0000606 3300049578 Bacteria 19118
626 Ga0501042_0008468 3300049578 Bacteria 6790
627 Ga0501042_0069043 3300049578 Bacteria 2527
628 Ga0501043_0090953 3300049579 Bacteria 2399
629 Ga0501043_0100698 3300049579 Bacteria 2271
630 Ga0501043_0259740 3300049579 Bacteria 1336
631 Ga0501046_0039758 3300049580 Bacteria 3764
632 Ga0501046_0042471 3300049580 Bacteria 3625
633 Ga0501046_0052868 3300049580 Bacteria 3200
634 Ga0501046_0135788 3300049580 Bacteria 1863
635 Ga0501047_0123496 3300049581 Bacteria 2469
636 Ga0501047_0164650 3300049581 Bacteria 2088
637 Ga0501047_0173782 3300049581 Bacteria 2023
638 Ga0501048_0018986 3300049582 Bacteria 5052
639 Ga0501048_0029428 3300049582 Bacteria 3984
640 Ga0501067_0080831 3300049583 Bacteria 1802
641 Ga0501068_0002049 3300049584 Bacteria 10756
642 Ga0501068_0050825 3300049584 Bacteria 2506
643 Ga0501070_0128861 3300049586 Bacteria 2090
644 Ga0501071_0002448 3300049587 Bacteria 11270
645 Ga0501071_0313770 3300049587 Bacteria 1190
646 Ga0501072_0004722 3300049588 Bacteria 10380
647 Ga0501072_0014293 3300049588 Bacteria 6083
648 Ga0501072_0033994 3300049588 Bacteria 3994
649 Ga0501073_0004143 3300049589 Bacteria 10874
650 Ga0501073_0033961 3300049589 Bacteria 3631
651 Ga0501073_0206562 3300049589 Bacteria 1357
652 Ga0501074_0014467 3300049590 Bacteria 5741
653 Ga0501074_0022553 3300049590 Bacteria 4575
654 Ga0501075_0013838 3300049591 Bacteria 5769
655 Ga0501075_0052265 3300049591 Bacteria 3072
656 Ga0501075_0058505 3300049591 Bacteria 2903
657 Ga0501076_0007157 3300049592 Bacteria 8109
658 Ga0501076_0029573 3300049592 Bacteria 4261
659 Ga0501076_0146209 3300049592 Bacteria 1922
660 Ga0501077_0006507 3300049593 Bacteria 7172
661 Ga0501077_0027356 3300049593 Bacteria 3622
662 Ga0501249_006593 3300049679 Bacteria 2388
663 Ga0501079_0011233 3300049741 Bacteria 6830
664 Ga0501079_0067682 3300049741 Bacteria 2756
665 Ga0501080_0021685 3300049742 Bacteria 5948
666 Ga0501080_0110258 3300049742 Bacteria 2551
667 Ga0501081_0008229 3300049743 Bacteria 6772
668 Ga0501081_0023430 3300049743 Bacteria 4138
669 Ga0501083_0011038 3300049744 Bacteria 6348
670 Ga0501083_0061035 3300049744 Bacteria 2518
671 Ga0501035_0049191 3300049822 Bacteria 3779
672 Ga0501035_0063851 3300049822 Bacteria 3274
673 Ga0501035_0079849 3300049822 Bacteria 2889
674 Ga0501035_0195281 3300049822 Bacteria 1738
675 Ga0501035_0250703 3300049822 Bacteria 1503
676 Ga0501044_0257107 3300049823 Bacteria 1685
677 Ga0501045_0003294 3300049824 Bacteria 11030
678 Ga0501045_0010114 3300049824 Bacteria 6600
679 Ga0501045_0116367 3300049824 Bacteria 1984
680 nmdc:mga03n38_70583_c1 3300050490 Bacteria 1616
681 nmdc:mga00v17_199736_c1 3300050491 Bacteria 1292
682 nmdc:mga0yw44_1320_c1 3300050492 Bacteria 9797
683 nmdc:mga0yw44_323142_c1 3300050492 Bacteria 1036
684 nmdc:mga0yw44_4374_c1 3300050492 Bacteria 6468
685 nmdc:mga0yw44_7609_c1 3300050492 Bacteria 5341
686 nmdc:mga0k408_64800_c1 3300050493 Bacteria 2126
687 nmdc:mga06z11_17970_c1 3300050494 Bacteria 3222
688 nmdc:mga06z11_205413_c1 3300050494 Bacteria 1146
689 nmdc:mga06z11_264361_c1 3300050494 Bacteria 1016
690 nmdc:mga06z11_274648_c1 3300050494 Bacteria 997
691 nmdc:mga06z11_36290_c1 3300050494 Bacteria 2433
692 nmdc:mga06z11_38703_c1 3300050494 Bacteria 2369
693 nmdc:mga06z11_5816_c1 3300050494 Bacteria 4975
694 nmdc:mga04h51_3563_c1 3300050495 Bacteria 3793
695 nmdc:mga04h51_52736_c1 3300050495 Bacteria 1370
696 nmdc:mga04h51_69258_c1 3300050495 Bacteria 1228
697 nmdc:mga04h51_76836_c1 3300050495 Bacteria 1177
698 nmdc:mga04h51_8925_c1 3300050495 Bacteria 2697
699 nmdc:mga07m45_116012_c1 3300050496 Bacteria 1544
700 nmdc:mga07m45_48021_c1 3300050496 Bacteria 2400
701 nmdc:mga05p37_173982_c1 3300050507 Bacteria 2624
702 nmdc:mga05p37_336870_c1 3300050507 Bacteria 1780
703 nmdc:mga05p37_427910_c1 3300050507 Bacteria 1539
704 nmdc:mga09592_149729_c1 3300050508 Bacteria 2013
705 nmdc:mga0qj67_67142_c1 3300050509 Bacteria 2857
706 nmdc:mga06r32_287845_c1 3300050510 Bacteria 1630
707 nmdc:mga06r32_445057_c1 3300050510 Bacteria 1276
708 nmdc:mga08y16_167184_c1 3300050511 Bacteria 2285
709 nmdc:mga08y16_19214_c1 3300050511 Bacteria 7200
710 nmdc:mga08y16_461_c1 3300050511 Bacteria 37939
711 nmdc:mga08y16_591969_c1 3300050511 Bacteria 1119
712 nmdc:mga0n895_14047_c1 3300050512 Bacteria 7257
713 nmdc:mga0n895_26092_c1 3300050512 Bacteria 5528
714 nmdc:mga0rr50_338750_c1 3300050513 Bacteria 1263
715 nmdc:mga0rr50_9358_c1 3300050513 Bacteria 6154
716 nmdc:mga0a205_153235_c1 3300050515 Bacteria 2203
717 nmdc:mga0a205_2511_c1 3300050515 Bacteria 16177
718 nmdc:mga0sz30_73562_c1 3300050516 Bacteria 1473
719 Ga0495595_0225129 3300053084 Bacteria 936
720 Ga0495619_0022988 3300053085 Bacteria 3992
721 Ga0500643_000007 3300053087 Bacteria 462836
722 Ga0500647_0007502 3300053091 Bacteria 4693
723 Ga0500583_0023491 3300053092 Bacteria 2599
724 Ga0500651_0228723 3300053093 Bacteria 1088
725 Ga0500566_0000912 3300053094 Bacteria 16891
726 Ga0500640_007970 3300053095 Bacteria 4161
727 Ga0500641_0008663 3300053096 Bacteria 3637
728 Ga0500641_0057897 3300053096 Bacteria 1608
729 Ga0500554_003644 3300053102 Bacteria 3173
730 Ga0500555_007192 3300053103 Bacteria 3163
731 Ga0500557_000023 3300053105 Bacteria 87584
732 Ga0500562_001060 3300053108 Bacteria 6754
733 Ga0500572_000379 3300053111 Bacteria 15820
734 Ga0500572_001201 3300053111 Bacteria 7376
735 Ga0500594_0051339 3300053118 Bacteria 1162
736 Ga0500595_001438 3300053119 Bacteria 12739
737 Ga0500595_007343 3300053119 Bacteria 4577
738 Ga0500597_121606 3300053120 Bacteria 1131
739 Ga0500608_065877 3300053122 Bacteria 1728
740 Ga0500621_089712 3300053126 Bacteria 1224
741 Ga0500652_052692 3300053131 Bacteria 1664
742 Ga0500559_0002580 3300053136 Bacteria 9258
743 Ga0500559_0031781 3300053136 Bacteria 2264
744 Ga0500568_0039126 3300053139 Bacteria 1916
745 Ga0500568_0108698 3300053139 Bacteria 1037
746 Ga0500589_090047 3300053147 Bacteria 1353
747 Ga0500616_0002343 3300053153 Bacteria 15954
748 Ga0500616_0020755 3300053153 Bacteria 3689
749 Ga0500622_0005077 3300053156 Bacteria 8007
750 Ga0500638_000192 3300053162 Bacteria 12519
751 Ga0500636_0000014 3300053177 Bacteria 124740
752 Ga0500636_0026790 3300053177 Bacteria 3405
753 Ga0500637_0000348 3300053178 Bacteria 17544
754 Ga0500637_0013269 3300053178 Bacteria 4316
755 Ga0500637_0111149 3300053178 Bacteria 1589
756 Ga0500625_007283 3300053729 Bacteria 4794
757 Ga0500599_002250 3300053736 Bacteria 2298
758 Ga0500601_000005 3300053737 Bacteria 67360
759 Ga0501084_0006451 3300054114 Bacteria 9646
760 Ga0501084_0015976 3300054114 Bacteria 6230
761 Ga0500661_002368 3300055283 Bacteria 3553
762 Ga0501082_0006643 3300060353 Bacteria 10009
763 Ga0501082_0015150 3300060353 Bacteria 6643
764 Ga0501082_0325098 3300060353 Bacteria 1340
765 Ga0530510_0006181 3300061734 Bacteria 8322
766 Ga0530510_0413932 3300061734 Bacteria 1017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016557553 8016563686 270
2 3300021384 Ga0213876_10081432 Ga0213876_100814322 273
3 3300039437 Ga0436365_1215759 Ga0436365_1215759_1057_1911 277
4 3300049581 Ga0501047_0173782 Ga0501047_0173782_1085_1969 277
5 3300049570 Ga0501033_0377595 Ga0501033_0377595_46_942 278
6 3300049572 Ga0501036_0034435 Ga0501036_0034435_512_1408 278
7 3300049573 Ga0501037_0146564 Ga0501037_0146564_436_1332 278
8 3300049574 Ga0501038_0043637 Ga0501038_0043637_2838_3734 278
9 3300049579 Ga0501043_0259740 Ga0501043_0259740_404_1300 278
10 3300049583 Ga0501067_0080831 Ga0501067_0080831_875_1771 278
11 3300049589 Ga0501073_0033961 Ga0501073_0033961_389_1285 278
12 3300049822 Ga0501035_0250703 Ga0501035_0250703_27_923 278
13 3300049823 Ga0501044_0257107 Ga0501044_0257107_375_1271 278
14 3300013296 Ga0157374_10150853 Ga0157374_101508533 279
15 3300031595 Ga0265313_10075685 Ga0265313_100756852 280
16 3300046455 Ga0495603_0076090 Ga0495603_0076090_362_1264 282
17 3300005290 Ga0065712_10000969 Ga0065712_100009696 283
18 3300005354 Ga0070675_100115357 Ga0070675_1001153572 283
19 3300005841 Ga0068863_100689477 Ga0068863_1006894771 283
20 3300014745 Ga0157377_10034746 Ga0157377_100347462 283
21 3300046499 Ga0495594_0041616 Ga0495594_0041616_1470_2372 283
22 3300049568 Ga0501031_0008853 Ga0501031_0008853_3446_4345 283
23 3300049570 Ga0501033_0071054 Ga0501033_0071054_284_1183 283
24 3300049572 Ga0501036_0014922 Ga0501036_0014922_112_1011 283
25 3300049574 Ga0501038_0017526 Ga0501038_0017526_3446_4345 283
26 3300049575 Ga0501039_0046288 Ga0501039_0046288_2291_3190 283
27 3300049576 Ga0501040_0005197 Ga0501040_0005197_5557_6456 283
28 3300049578 Ga0501042_0008468 Ga0501042_0008468_3497_4396 283
29 3300049580 Ga0501046_0042471 Ga0501046_0042471_1783_2682 283
30 3300049582 Ga0501048_0029428 Ga0501048_0029428_2817_3716 283
31 3300049587 Ga0501071_0002448 Ga0501071_0002448_9333_10232 283
32 3300049588 Ga0501072_0014293 Ga0501072_0014293_2361_3260 283
33 3300049590 Ga0501074_0014467 Ga0501074_0014467_2971_3870 283
34 3300049591 Ga0501075_0052265 Ga0501075_0052265_1826_2725 283
35 3300049592 Ga0501076_0029573 Ga0501076_0029573_1474_2373 283
36 3300049593 Ga0501077_0006507 Ga0501077_0006507_4131_5030 283
37 3300049741 Ga0501079_0067682 Ga0501079_0067682_122_1021 283
38 3300049742 Ga0501080_0021685 Ga0501080_0021685_2998_3897 283
39 3300049743 Ga0501081_0023430 Ga0501081_0023430_348_1247 283
40 3300049744 Ga0501083_0061035 Ga0501083_0061035_234_1133 283
41 3300049822 Ga0501035_0079849 Ga0501035_0079849_1586_2485 283
42 3300049824 Ga0501045_0003294 Ga0501045_0003294_7025_7924 283
43 3300054114 Ga0501084_0015976 Ga0501084_0015976_2668_3567 283
44 3300060353 Ga0501082_0015150 Ga0501082_0015150_3687_4586 283
45 3300061734 Ga0530510_0006181 Ga0530510_0006181_5525_6424 283
46 3300005295 Ga0065707_10098857 Ga0065707_100988573 284
47 3300005466 Ga0070685_10224171 Ga0070685_102241712 284
48 3300005841 Ga0068863_100069326 Ga0068863_1000693263 284
49 3300005985 Ga0081539_10046386 Ga0081539_100463863 284
50 3300006844 Ga0075428_100037086 Ga0075428_1000370863 284
51 3300014326 Ga0157380_10344966 Ga0157380_103449662 284
52 3300028380 Ga0268265_10103808 Ga0268265_101038083 284
53 3300035086 Ga0373934_0121459 Ga0373934_0121459_31_885 284
54 3300035089 Ga0373944_0037620 Ga0373944_0037620_394_1254 284
55 3300035171 Ga0373946_0048645 Ga0373946_0048645_890_1753 284
56 3300035725 Ga0373947_0012457 Ga0373947_0012457_2922_3782 284
57 3300038443 Ga0395901_0292590 Ga0395901_0292590_351_1205 284
58 3300046519 Ga0495632_0033888 Ga0495632_0033888_17_871 284
59 3300046539 Ga0495621_0039119 Ga0495621_0039119_429_1319 284
60 3300046615 Ga0495656_0004072 Ga0495656_0004072_890_1780 284
61 3300046660 Ga0495625_0282933 Ga0495625_0282933_195_1049 284
62 3300046683 Ga0495658_0167506 Ga0495658_0167506_482_1345 284
63 3300048905 Ga0496102_0487707 Ga0496102_0487707_259_1113 284
64 3300049571 Ga0501034_0550428 Ga0501034_0550428_135_1001 284
65 3300049679 Ga0501249_006593 Ga0501249_006593_698_1552 284
66 3300050492 nmdc:mga0yw44_323142_c1 nmdc:mga0yw44_323142_c1_163_1020 284
67 3300053084 Ga0495595_0225129 Ga0495595_0225129_41_904 284
68 3300005354 Ga0070675_100002481 Ga0070675_10000248113 285
69 3300005459 Ga0068867_100234624 Ga0068867_1002346242 285
70 3300006846 Ga0075430_100231422 Ga0075430_1002314221 285
71 3300009094 Ga0111539_10020952 Ga0111539_100209527 285
72 3300014325 Ga0163163_10793163 Ga0163163_107931631 285
73 3300025926 Ga0207659_10001287 Ga0207659_100012872 285
74 3300025942 Ga0207689_10298320 Ga0207689_102983202 285
75 3300026118 Ga0207675_100683940 Ga0207675_1006839401 285
76 3300039437 Ga0436365_0624315 Ga0436365_0624315_1621_2514 285
77 3300050511 nmdc:mga08y16_591969_c1 nmdc:mga08y16_591969_c1_110_1003 285
78 3300009147 Ga0114129_10273534 Ga0114129_102735342 288
79 3300039437 Ga0436365_1444558 Ga0436365_1444558_108_1001 289
80 3300005937 Ga0081455_10129860 Ga0081455_101298603 291
81 3300006852 Ga0075433_10000751 Ga0075433_1000075112 291
82 3300006871 Ga0075434_100000015 Ga0075434_10000001527 291
83 3300049580 Ga0501046_0039758 Ga0501046_0039758_357_1232 291
84 3300050512 nmdc:mga0n895_14047_c1 nmdc:mga0n895_14047_c1_5887_6780 291
85 3300050513 nmdc:mga0rr50_9358_c1 nmdc:mga0rr50_9358_c1_1080_1973 291
86 3300050515 nmdc:mga0a205_2511_c1 nmdc:mga0a205_2511_c1_13441_14334 291
87 3300025931 Ga0207644_10275925 Ga0207644_102759252 292
88 iso_pu_bacteria 2869162929 2869163061 292
89 3300053139 Ga0500568_0039126 Ga0500568_0039126_582_1469 293
90 iso_pu_bacteria 2508501128 2509149448 293
91 iso_pu_bacteria 2513237092 2513626588 293
92 iso_pu_bacteria 2513237098 2513674525 293
93 iso_pu_bacteria 2513237101 2513692981 293
94 iso_pu_bacteria 2513237139 2513875346 293
95 iso_pu_bacteria 2513237161 2514016142 293
96 iso_pu_bacteria 2524023205 2524440213 293
97 iso_pu_bacteria 2524023210 2524463746 293
98 iso_pu_bacteria 2528768022 2528849322 293
99 iso_pu_bacteria 2617270735 2617349132 293
100 iso_pu_bacteria 2617270741 2617375228 293
101 iso_pu_bacteria 2617270741 2617377533 293
102 iso_pu_bacteria 2721755755 2723847704 293
103 iso_pu_bacteria 2744054633 2745078074 293
104 iso_pu_bacteria 2756170246 2756672568 293
105 iso_pu_bacteria 2791355196 2793060411 293
106 iso_pu_bacteria 2791355199 2793077750 293
107 iso_pu_bacteria 2802429603 2805921974 293
108 iso_pu_bacteria 2824600985 2824601744 293
109 iso_pu_bacteria 2824609381 2824611349 293
110 iso_pu_bacteria 2824653114 2824653366 293
111 iso_pu_bacteria 2824661429 2824667528 293
112 iso_pu_bacteria 2824671348 2824676300 293
113 iso_pu_bacteria 2824687955 2824692677 293
114 iso_pu_bacteria 2824696289 2824700701 293
115 iso_pu_bacteria 2824704595 2824706935 293
116 iso_pu_bacteria 2824732956 2824734496 293
117 iso_pu_bacteria 2824746037 2824748733 293
118 iso_pu_bacteria 2824753945 2824755215 293
119 iso_pu_bacteria 2824763712 2824764355 293
120 iso_pu_bacteria 2824773399 2824773881 293
121 iso_pu_bacteria 2838122688 2838128779 293
122 iso_pu_bacteria 2841941048 2841941085 293
123 iso_pu_bacteria 2841949485 2841956467 293
124 iso_pu_bacteria 2841966195 2841967239 293
125 iso_pu_bacteria 2841974524 2841979365 293
126 iso_pu_bacteria 2841983080 2841989840 293
127 iso_pu_bacteria 2844002411 2844005022 293
128 iso_pu_bacteria 2847939898 2847945554 293
129 iso_pu_bacteria 2857509624 2857516791 293
130 iso_pu_bacteria 2874604998 2874612323 293
131 iso_pu_bacteria 2874612657 2874613229 293
132 iso_pu_bacteria 2874628541 2874635509 293
133 iso_pu_bacteria 2876761206 2876767903 293
134 iso_pu_bacteria 2879099564 2879106137 293
135 iso_pu_bacteria 2879110137 2879110478 293
136 iso_pu_bacteria 2885383462 2885383501 293
137 iso_pu_bacteria 2888388044 2888388858 293
138 iso_pu_bacteria 2888419890 2888422343 293
139 iso_pu_bacteria 2903768456 2903769382 293
140 iso_pu_bacteria 2904711408 2904712710 293
141 iso_pu_bacteria 2908775508 2908782421 293
142 iso_pu_bacteria 2922361189 2922362774 293
143 iso_pu_bacteria 2922368715 2922372852 293
144 iso_pu_bacteria 2922386360 2922387746 293
145 iso_pu_bacteria 2924710171 2924716613 293
146 iso_pu_bacteria 2929615660 2929620672 293
147 iso_pu_bacteria 2929624759 2929626565 293
148 iso_pu_bacteria 2932784394 2932784570 293
149 iso_pu_bacteria 2932809354 2932809550 293
150 iso_pu_bacteria 2932818245 2932818707 293
151 iso_pu_bacteria 2932828146 2932828338 293
152 iso_pu_bacteria 2933577622 2933582587 293
153 iso_pu_bacteria 2935616580 2935617311 293
154 iso_pu_bacteria 2935638405 2935639207 293
155 iso_pu_bacteria 2935665750 2935665941 293
156 iso_pu_bacteria 2935675223 2935675588 293
157 iso_pu_bacteria 2935684952 2935685402 293
158 iso_pu_bacteria 2935694250 2935698651 293
159 iso_pu_bacteria 2935703347 2935704214 293
160 iso_pu_bacteria 2935713505 2935713955 293
161 iso_pu_bacteria 2935722832 2935724574 293
162 iso_pu_bacteria 2935732158 2935733068 293
163 iso_pu_bacteria 2935741537 2935742447 293
164 iso_pu_bacteria 2935750917 2935751367 293
165 iso_pu_bacteria 2935760218 2935765861 293
166 iso_pu_bacteria 2935769743 2935771253 293
167 iso_pu_bacteria 2935777560 2935780913 293
168 iso_pu_bacteria 2935785616 2935786046 293
169 iso_pu_bacteria 2935793552 2935797771 293
170 iso_pu_bacteria 2935801545 2935802297 293
171 iso_pu_bacteria 2935810662 2935811121 293
172 iso_pu_bacteria 2935827899 2935828702 293
173 iso_pu_bacteria 2935837841 2935840078 293
174 iso_pu_bacteria 2935855204 2935855936 293
175 iso_pu_bacteria 2935864058 2935866120 293
176 iso_pu_bacteria 2935873716 2935877555 293
177 iso_pu_bacteria 2935992306 2935992499 293
178 iso_pu_bacteria 2936002035 2936002371 293
179 iso_pu_bacteria 2936037263 2936037459 293
180 iso_pu_bacteria 2940556831 2940557831 293
181 iso_pu_bacteria 2941538514 2941540582 293
182 iso_pu_bacteria 2977898635 2977906263 293
183 iso_pu_bacteria 3005506211 3005507505 293
184 iso_pu_bacteria 8004312739 8004317830 293
185 iso_pu_bacteria 8016511872 8016521184 293
186 iso_pu_bacteria 8016522445 8016528413 293
187 iso_pu_bacteria 8016530956 8016533563 293
188 iso_pu_bacteria 8016539877 8016546793 293
189 iso_pu_bacteria 8016575299 8016576109 293
190 iso_pu_bacteria 8016603502 8016609013 293
191 iso_pu_bacteria 8016613128 8016615886 293
192 iso_pu_bacteria 8016622563 8016625343 293
193 iso_pu_bacteria 8017057580 8017064426 293
194 iso_pu_bacteria 8019530166 8019533353 293
195 iso_pu_bacteria 8019538911 8019546315 293
196 iso_pu_bacteria 8019576017 8019583777 293
197 iso_pu_bacteria 8019586578 8019591592 293
198 iso_pu_bacteria 8019597564 8019599741 293
199 iso_pu_bacteria 8019608314 8019618801 293
200 iso_pu_bacteria 8055742211 8055745534 293
201 iso_pu_bacteria 8056673599 8056676727 293
202 iso_pu_bacteria 8056681323 8056685664 293
203 3300031241 Ga0265325_10076910 Ga0265325_100769102 294
204 3300031247 Ga0265340_10016235 Ga0265340_100162353 294
205 3300031249 Ga0265339_10151886 Ga0265339_101518862 294
206 3300031595 Ga0265313_10058494 Ga0265313_100584943 294
207 3300031711 Ga0265314_10230147 Ga0265314_102301471 294
208 3300031712 Ga0265342_10019858 Ga0265342_100198582 294
209 3300048923 Ga0496120_0175714 Ga0496120_0175714_158_1042 294
210 3300049569 Ga0501032_0224688 Ga0501032_0224688_160_1044 294
211 3300049572 Ga0501036_0128424 Ga0501036_0128424_1112_1996 294
212 3300049573 Ga0501037_0101158 Ga0501037_0101158_1135_2019 294
213 3300049575 Ga0501039_0039064 Ga0501039_0039064_1397_2281 294
214 3300049581 Ga0501047_0123496 Ga0501047_0123496_1538_2422 294
215 3300049822 Ga0501035_0049191 Ga0501035_0049191_1761_2645 294
216 iso_pu_bacteria 8006984368 8006984770 294
217 3300005436 Ga0070713_100004557 Ga0070713_1000045573 295
218 3300005548 Ga0070665_100010542 Ga0070665_1000105422 295
219 3300005937 Ga0081455_10069578 Ga0081455_100695783 295
220 3300006846 Ga0075430_100325466 Ga0075430_1003254661 295
221 3300006847 Ga0075431_100076409 Ga0075431_1000764091 295
222 3300021384 Ga0213876_10168603 Ga0213876_101686031 295
223 3300025299 Ga0209256_1000102 Ga0209256_100010260 295
224 3300025906 Ga0207699_10060858 Ga0207699_100608582 295
225 3300025928 Ga0207700_10013427 Ga0207700_100134273 295
226 3300028379 Ga0268266_10002702 Ga0268266_1000270212 295
227 3300037068 Ga0373925_0418241 Ga0373925_0418241_179_1066 295
228 3300039437 Ga0436365_0087400 Ga0436365_0087400_3293_4186 295
229 3300039437 Ga0436365_1895007 Ga0436365_1895007_79_966 295
230 3300046684 Ga0495669_0008165 Ga0495669_0008165_725_1618 295
231 3300048929 Ga0496126_0050865 Ga0496126_0050865_1467_2375 295
232 3300049571 Ga0501034_0325337 Ga0501034_0325337_29_934 295
233 3300049572 Ga0501036_0281509 Ga0501036_0281509_96_986 295
234 3300049573 Ga0501037_0176383 Ga0501037_0176383_476_1366 295
235 3300049579 Ga0501043_0100698 Ga0501043_0100698_1327_2232 295
236 3300049580 Ga0501046_0135788 Ga0501046_0135788_480_1385 295
237 3300049581 Ga0501047_0164650 Ga0501047_0164650_1142_2032 295
238 3300049589 Ga0501073_0206562 Ga0501073_0206562_327_1232 295
239 3300049822 Ga0501035_0195281 Ga0501035_0195281_620_1525 295
240 3300050509 nmdc:mga0qj67_67142_c1 nmdc:mga0qj67_67142_c1_751_1638 295
241 3300050510 nmdc:mga06r32_287845_c1 nmdc:mga06r32_287845_c1_64_951 295
242 3300005347 Ga0070668_100272572 Ga0070668_1002725721 296
243 3300005365 Ga0070688_100004755 Ga0070688_1000047557 296
244 3300005444 Ga0070694_100289830 Ga0070694_1002898301 296
245 3300005543 Ga0070672_100261007 Ga0070672_1002610072 296
246 3300005842 Ga0068858_100227507 Ga0068858_1002275072 296
247 3300005843 Ga0068860_100159038 Ga0068860_1001590381 296
248 3300006038 Ga0075365_10012757 Ga0075365_100127573 296
249 3300006042 Ga0075368_10009316 Ga0075368_100093161 296
250 3300006048 Ga0075363_100004237 Ga0075363_1000042373 296
251 3300006051 Ga0075364_10007969 Ga0075364_100079691 296
252 3300006178 Ga0075367_10007456 Ga0075367_100074561 296
253 3300006847 Ga0075431_100005928 Ga0075431_1000059284 296
254 3300006880 Ga0075429_100206885 Ga0075429_1002068852 296
255 3300009147 Ga0114129_10032874 Ga0114129_100328744 296
256 3300010159 Ga0099796_10054208 Ga0099796_100542082 296
257 3300025918 Ga0207662_10133265 Ga0207662_101332652 296
258 3300025926 Ga0207659_10060823 Ga0207659_100608232 296
259 3300025931 Ga0207644_10212297 Ga0207644_102122972 296
260 3300025933 Ga0207706_10081680 Ga0207706_100816802 296
261 3300025936 Ga0207670_10025512 Ga0207670_100255122 296
262 3300025936 Ga0207670_10034830 Ga0207670_100348302 296
263 3300025960 Ga0207651_10027631 Ga0207651_100276313 296
264 3300025960 Ga0207651_10047969 Ga0207651_100479693 296
265 3300025972 Ga0207668_10227130 Ga0207668_102271302 296
266 3300025972 Ga0207668_10232776 Ga0207668_102327762 296
267 3300026035 Ga0207703_10221990 Ga0207703_102219903 296
268 3300027866 Ga0209813_10001412 Ga0209813_100014122 296
269 3300028381 Ga0268264_10299292 Ga0268264_102992922 296
270 3300049572 Ga0501036_0352064 Ga0501036_0352064_142_1032 296
271 3300049578 Ga0501042_0000606 Ga0501042_0000606_13851_14741 296
272 3300049587 Ga0501071_0313770 Ga0501071_0313770_134_1024 296
273 3300049588 Ga0501072_0033994 Ga0501072_0033994_1664_2554 296
274 3300049591 Ga0501075_0058505 Ga0501075_0058505_302_1192 296
275 3300049824 Ga0501045_0116367 Ga0501045_0116367_999_1889 296
276 3300050490 nmdc:mga03n38_70583_c1 nmdc:mga03n38_70583_c1_188_1111 296
277 3300050492 nmdc:mga0yw44_7609_c1 nmdc:mga0yw44_7609_c1_1533_2456 296
278 3300050494 nmdc:mga06z11_36290_c1 nmdc:mga06z11_36290_c1_492_1415 296
279 3300050494 nmdc:mga06z11_5816_c1 nmdc:mga06z11_5816_c1_1597_2520 296
280 3300050495 nmdc:mga04h51_3563_c1 nmdc:mga04h51_3563_c1_1791_2714 296
281 3300050495 nmdc:mga04h51_69258_c1 nmdc:mga04h51_69258_c1_54_977 296
282 3300050495 nmdc:mga04h51_8925_c1 nmdc:mga04h51_8925_c1_640_1575 296
283 3300050507 nmdc:mga05p37_173982_c1 nmdc:mga05p37_173982_c1_764_1687 296
284 3300050508 nmdc:mga09592_149729_c1 nmdc:mga09592_149729_c1_842_1765 296
285 3300050511 nmdc:mga08y16_461_c1 nmdc:mga08y16_461_c1_14450_15340 296
286 3300054114 Ga0501084_0006451 Ga0501084_0006451_6977_7867 296
287 3300001990 JGI24737J22298_10046505 JGI24737J22298_100465052 297
288 3300002077 JGI24744J21845_10003865 JGI24744J21845_100038651 297
289 3300002244 JGI24742J22300_10010062 JGI24742J22300_100100621 297
290 3300003214 JGI25165J46597_1005887 JGI25165J46597_10058871 297
291 3300003215 JGI25153J46596_10000341 JGI25153J46596_1000034116 297
292 3300003215 JGI25153J46596_10001379 JGI25153J46596_1000137911 297
293 3300003354 JGI25160J50197_1004593 JGI25160J50197_10045933 297
294 3300003659 JGI25404J52841_10005401 JGI25404J52841_100054014 297
295 3300003659 JGI25404J52841_10037932 JGI25404J52841_100379321 297
296 3300003794 Ga0055531_10002463 Ga0055531_100024636 297
297 3300005262 Ga0065165_1000681 Ga0065165_100068137 297
298 3300005262 Ga0065165_1001931 Ga0065165_100193111 297
299 3300005295 Ga0065707_10123114 Ga0065707_101231142 297
300 3300005329 Ga0070683_100014586 Ga0070683_1000145862 297
301 3300005329 Ga0070683_100053245 Ga0070683_1000532452 297
302 3300005329 Ga0070683_100401525 Ga0070683_1004015252 297
303 3300005331 Ga0070670_100142419 Ga0070670_1001424192 297
304 3300005334 Ga0068869_100065065 Ga0068869_1000650652 297
305 3300005334 Ga0068869_100196482 Ga0068869_1001964821 297
306 3300005334 Ga0068869_100252231 Ga0068869_1002522312 297
307 3300005335 Ga0070666_10017187 Ga0070666_100171874 297
308 3300005337 Ga0070682_100045771 Ga0070682_1000457714 297
309 3300005338 Ga0068868_100059914 Ga0068868_1000599143 297
310 3300005338 Ga0068868_100105923 Ga0068868_1001059232 297
311 3300005339 Ga0070660_100381183 Ga0070660_1003811832 297
312 3300005339 Ga0070660_100493188 Ga0070660_1004931881 297
313 3300005341 Ga0070691_10027132 Ga0070691_100271323 297
314 3300005347 Ga0070668_100046351 Ga0070668_1000463512 297
315 3300005353 Ga0070669_100204884 Ga0070669_1002048842 297
316 3300005354 Ga0070675_100007488 Ga0070675_1000074882 297
317 3300005354 Ga0070675_100628698 Ga0070675_1006286981 297
318 3300005355 Ga0070671_100038177 Ga0070671_1000381772 297
319 3300005356 Ga0070674_100000476 Ga0070674_1000004766 297
320 3300005364 Ga0070673_100139861 Ga0070673_1001398612 297
321 3300005364 Ga0070673_100144247 Ga0070673_1001442472 297
322 3300005364 Ga0070673_100152920 Ga0070673_1001529202 297
323 3300005365 Ga0070688_100076067 Ga0070688_1000760671 297
324 3300005434 Ga0070709_10023794 Ga0070709_100237944 297
325 3300005434 Ga0070709_10045339 Ga0070709_100453392 297
326 3300005435 Ga0070714_100090614 Ga0070714_1000906143 297
327 3300005436 Ga0070713_100002518 Ga0070713_10000251814 297
328 3300005440 Ga0070705_100097358 Ga0070705_1000973582 297
329 3300005441 Ga0070700_100006999 Ga0070700_1000069991 297
330 3300005455 Ga0070663_100041871 Ga0070663_1000418712 297
331 3300005455 Ga0070663_100170576 Ga0070663_1001705762 297
332 3300005455 Ga0070663_100185209 Ga0070663_1001852091 297
333 3300005456 Ga0070678_100004606 Ga0070678_1000046063 297
334 3300005457 Ga0070662_100003416 Ga0070662_1000034162 297
335 3300005458 Ga0070681_10212549 Ga0070681_102125493 297
336 3300005458 Ga0070681_10259776 Ga0070681_102597762 297
337 3300005459 Ga0068867_100009428 Ga0068867_1000094284 297
338 3300005459 Ga0068867_100016586 Ga0068867_1000165864 297
339 3300005459 Ga0068867_100079412 Ga0068867_1000794122 297
340 3300005466 Ga0070685_10057775 Ga0070685_100577752 297
341 3300005471 Ga0070698_100072429 Ga0070698_1000724293 297
342 3300005530 Ga0070679_100091967 Ga0070679_1000919672 297
343 3300005535 Ga0070684_100003344 Ga0070684_10000334412 297
344 3300005539 Ga0068853_100040533 Ga0068853_1000405332 297
345 3300005539 Ga0068853_100249941 Ga0068853_1002499412 297
346 3300005539 Ga0068853_100291834 Ga0068853_1002918342 297
347 3300005543 Ga0070672_100004181 Ga0070672_1000041814 297
348 3300005544 Ga0070686_100013061 Ga0070686_1000130615 297
349 3300005546 Ga0070696_100206695 Ga0070696_1002066951 297
350 3300005548 Ga0070665_100014654 Ga0070665_1000146543 297
351 3300005548 Ga0070665_100015537 Ga0070665_1000155375 297
352 3300005548 Ga0070665_100054790 Ga0070665_1000547903 297
353 3300005548 Ga0070665_100099492 Ga0070665_1000994923 297
354 3300005548 Ga0070665_100191829 Ga0070665_1001918292 297
355 3300005548 Ga0070665_100430454 Ga0070665_1004304542 297
356 3300005563 Ga0068855_100408197 Ga0068855_1004081972 297
357 3300005564 Ga0070664_100137467 Ga0070664_1001374672 297
358 3300005564 Ga0070664_100452694 Ga0070664_1004526941 297
359 3300005577 Ga0068857_100467611 Ga0068857_1004676112 297
360 3300005614 Ga0068856_100126146 Ga0068856_1001261462 297
361 3300005614 Ga0068856_100284916 Ga0068856_1002849161 297
362 3300005615 Ga0070702_100022851 Ga0070702_1000228511 297
363 3300005616 Ga0068852_100046626 Ga0068852_1000466263 297
364 3300005617 Ga0068859_100039799 Ga0068859_1000397992 297
365 3300005617 Ga0068859_100104055 Ga0068859_1001040552 297
366 3300005617 Ga0068859_100717491 Ga0068859_1007174912 297
367 3300005718 Ga0068866_10001504 Ga0068866_100015046 297
368 3300005718 Ga0068866_10202575 Ga0068866_102025751 297
369 3300005719 Ga0068861_100001410 Ga0068861_10000141011 297
370 3300005841 Ga0068863_100040352 Ga0068863_1000403524 297
371 3300005841 Ga0068863_100203163 Ga0068863_1002031631 297
372 3300005842 Ga0068858_100016595 Ga0068858_1000165952 297
373 3300005842 Ga0068858_100162579 Ga0068858_1001625792 297
374 3300005842 Ga0068858_100315006 Ga0068858_1003150062 297
375 3300005843 Ga0068860_100213300 Ga0068860_1002133001 297
376 3300005844 Ga0068862_100010210 Ga0068862_1000102103 297
377 3300005844 Ga0068862_100103972 Ga0068862_1001039722 297
378 3300005937 Ga0081455_10004131 Ga0081455_100041313 297
379 3300005981 Ga0081538_10054512 Ga0081538_100545122 297
380 3300005983 Ga0081540_1000494 Ga0081540_100049436 297
381 3300005983 Ga0081540_1002879 Ga0081540_10028794 297
382 3300005983 Ga0081540_1005426 Ga0081540_10054266 297
383 3300005983 Ga0081540_1026431 Ga0081540_10264312 297
384 3300005983 Ga0081540_1034536 Ga0081540_10345364 297
385 3300005983 Ga0081540_1065405 Ga0081540_10654052 297
386 3300005983 Ga0081540_1075439 Ga0081540_10754392 297
387 3300005985 Ga0081539_10012193 Ga0081539_100121933 297
388 3300005985 Ga0081539_10078029 Ga0081539_100780291 297
389 3300006028 Ga0070717_10007444 Ga0070717_100074446 297
390 3300006038 Ga0075365_10019095 Ga0075365_100190953 297
391 3300006038 Ga0075365_10043906 Ga0075365_100439062 297
392 3300006042 Ga0075368_10086559 Ga0075368_100865592 297
393 3300006042 Ga0075368_10091661 Ga0075368_100916611 297
394 3300006048 Ga0075363_100133668 Ga0075363_1001336681 297
395 3300006051 Ga0075364_10009844 Ga0075364_100098443 297
396 3300006051 Ga0075364_10078115 Ga0075364_100781151 297
397 3300006163 Ga0070715_10029979 Ga0070715_100299792 297
398 3300006175 Ga0070712_100320600 Ga0070712_1003206002 297
399 3300006177 Ga0075362_10066182 Ga0075362_100661822 297
400 3300006177 Ga0075362_10136223 Ga0075362_101362232 297
401 3300006178 Ga0075367_10055500 Ga0075367_100555002 297
402 3300006178 Ga0075367_10075720 Ga0075367_100757202 297
403 3300006178 Ga0075367_10098202 Ga0075367_100982022 297
404 3300006178 Ga0075367_10307675 Ga0075367_103076751 297
405 3300006186 Ga0075369_10053199 Ga0075369_100531991 297
406 3300006195 Ga0075366_10236535 Ga0075366_102365352 297
407 3300006237 Ga0097621_100034319 Ga0097621_1000343192 297
408 3300006237 Ga0097621_100078541 Ga0097621_1000785413 297
409 3300006237 Ga0097621_100094426 Ga0097621_1000944262 297
410 3300006237 Ga0097621_100109020 Ga0097621_1001090203 297
411 3300006353 Ga0075370_10120071 Ga0075370_101200712 297
412 3300006358 Ga0068871_100012180 Ga0068871_1000121803 297
413 3300006358 Ga0068871_100073101 Ga0068871_1000731013 297
414 3300006844 Ga0075428_100017758 Ga0075428_1000177584 297
415 3300006844 Ga0075428_100028955 Ga0075428_1000289557 297
416 3300006844 Ga0075428_100322219 Ga0075428_1003222191 297
417 3300006846 Ga0075430_100013136 Ga0075430_1000131363 297
418 3300006852 Ga0075433_10008110 Ga0075433_100081109 297
419 3300006852 Ga0075433_10502666 Ga0075433_105026661 297
420 3300006871 Ga0075434_100119043 Ga0075434_1001190433 297
421 3300006871 Ga0075434_100610672 Ga0075434_1006106721 297
422 3300006881 Ga0068865_100004843 Ga0068865_1000048431 297
423 3300006881 Ga0068865_100029307 Ga0068865_1000293071 297
424 3300006881 Ga0068865_100317973 Ga0068865_1003179731 297
425 3300006931 Ga0097620_100039801 Ga0097620_1000398012 297
426 3300006931 Ga0097620_100104058 Ga0097620_1001040582 297
427 3300006931 Ga0097620_100717479 Ga0097620_1007174792 297
428 3300007265 Ga0099794_10011208 Ga0099794_100112082 297
429 3300007265 Ga0099794_10051459 Ga0099794_100514592 297
430 3300007265 Ga0099794_10154249 Ga0099794_101542491 297
431 3300009094 Ga0111539_10008593 Ga0111539_100085933 297
432 3300009094 Ga0111539_10038369 Ga0111539_100383697 297
433 3300009098 Ga0105245_10012507 Ga0105245_100125073 297
434 3300009098 Ga0105245_10317629 Ga0105245_103176292 297
435 3300009101 Ga0105247_10055321 Ga0105247_100553211 297
436 3300009147 Ga0114129_10105595 Ga0114129_101055953 297
437 3300009148 Ga0105243_10004917 Ga0105243_100049177 297
438 3300009148 Ga0105243_10490050 Ga0105243_104900502 297
439 3300009148 Ga0105243_10616313 Ga0105243_106163131 297
440 3300009174 Ga0105241_10003092 Ga0105241_100030923 297
441 3300009176 Ga0105242_10013357 Ga0105242_100133572 297
442 3300009176 Ga0105242_10031421 Ga0105242_100314214 297
443 3300009176 Ga0105242_10058772 Ga0105242_100587721 297
444 3300009177 Ga0105248_10044214 Ga0105248_100442141 297
445 3300009177 Ga0105248_10084363 Ga0105248_100843633 297
446 3300009177 Ga0105248_10158011 Ga0105248_101580112 297
447 3300009177 Ga0105248_10305401 Ga0105248_103054011 297
448 3300009177 Ga0105248_10695653 Ga0105248_106956531 297
449 3300009545 Ga0105237_10179566 Ga0105237_101795663 297
450 3300009545 Ga0105237_10412606 Ga0105237_104126062 297
451 3300009551 Ga0105238_10092844 Ga0105238_100928442 297
452 3300009551 Ga0105238_10158849 Ga0105238_101588493 297
453 3300009551 Ga0105238_10168008 Ga0105238_101680082 297
454 3300009551 Ga0105238_10195644 Ga0105238_101956442 297
455 3300009553 Ga0105249_10059920 Ga0105249_100599203 297
456 3300009553 Ga0105249_10263949 Ga0105249_102639492 297
457 3300010375 Ga0105239_10011901 Ga0105239_100119014 297
458 3300010375 Ga0105239_10048076 Ga0105239_100480762 297
459 3300013105 Ga0157369_10057570 Ga0157369_100575705 297
460 3300013296 Ga0157374_10551221 Ga0157374_105512211 297
461 3300013306 Ga0163162_10019957 Ga0163162_100199577 297
462 3300013306 Ga0163162_10067469 Ga0163162_100674694 297
463 3300013308 Ga0157375_10055760 Ga0157375_100557602 297
464 3300013308 Ga0157375_10079426 Ga0157375_100794262 297
465 3300013308 Ga0157375_10969536 Ga0157375_109695361 297
466 3300014325 Ga0163163_10099598 Ga0163163_100995983 297
467 3300014326 Ga0157380_10038666 Ga0157380_100386664 297
468 3300014326 Ga0157380_10339241 Ga0157380_103392412 297
469 3300014969 Ga0157376_10004946 Ga0157376_100049468 297
470 3300014969 Ga0157376_10023747 Ga0157376_100237472 297
471 3300014969 Ga0157376_10300846 Ga0157376_103008461 297
472 3300017792 Ga0163161_10015817 Ga0163161_100158175 297
473 3300021320 Ga0214544_1000035 Ga0214544_1000035119 297
474 3300021321 Ga0214542_1000790 Ga0214542_100079027 297
475 3300021324 Ga0214545_1000555 Ga0214545_100055534 297
476 3300021327 Ga0214543_1003298 Ga0214543_100329812 297
477 3300025230 Ga0209563_107917 Ga0209563_1079172 297
478 3300025253 Ga0209677_110833 Ga0209677_1108332 297
479 3300025261 Ga0209233_1002259 Ga0209233_10022595 297
480 3300025261 Ga0209233_1002359 Ga0209233_10023595 297
481 3300025272 Ga0209455_1002310 Ga0209455_10023108 297
482 3300025297 Ga0209758_1000024 Ga0209758_1000024372 297
483 3300025297 Ga0209758_1012317 Ga0209758_10123174 297
484 3300025297 Ga0209758_1013367 Ga0209758_10133672 297
485 3300025299 Ga0209256_1028393 Ga0209256_10283932 297
486 3300025302 Ga0207426_1001374 Ga0207426_10013747 297
487 3300025302 Ga0207426_1004107 Ga0207426_10041072 297
488 3300025302 Ga0207426_1010826 Ga0207426_10108262 297
489 3300025304 Ga0209257_1002165 Ga0209257_100216510 297
490 3300025315 Ga0207697_10045610 Ga0207697_100456102 297
491 3300025899 Ga0207642_10007566 Ga0207642_100075661 297
492 3300025900 Ga0207710_10028112 Ga0207710_100281123 297
493 3300025900 Ga0207710_10051727 Ga0207710_100517272 297
494 3300025900 Ga0207710_10154427 Ga0207710_101544271 297
495 3300025901 Ga0207688_10028649 Ga0207688_100286492 297
496 3300025906 Ga0207699_10018860 Ga0207699_100188602 297
497 3300025907 Ga0207645_10029591 Ga0207645_100295912 297
498 3300025907 Ga0207645_10033987 Ga0207645_100339873 297
499 3300025908 Ga0207643_10085268 Ga0207643_100852681 297
500 3300025910 Ga0207684_10038351 Ga0207684_100383512 297
501 3300025912 Ga0207707_10000649 Ga0207707_100006498 297
502 3300025912 Ga0207707_10036776 Ga0207707_100367765 297
503 3300025914 Ga0207671_10136370 Ga0207671_101363702 297
504 3300025917 Ga0207660_10029357 Ga0207660_100293572 297
505 3300025917 Ga0207660_10036967 Ga0207660_100369672 297
506 3300025921 Ga0207652_10196162 Ga0207652_101961623 297
507 3300025921 Ga0207652_10196241 Ga0207652_101962411 297
508 3300025923 Ga0207681_10072192 Ga0207681_100721923 297
509 3300025925 Ga0207650_10013724 Ga0207650_100137244 297
510 3300025925 Ga0207650_10428368 Ga0207650_104283681 297
511 3300025927 Ga0207687_10012540 Ga0207687_100125404 297
512 3300025927 Ga0207687_10049582 Ga0207687_100495822 297
513 3300025929 Ga0207664_10329188 Ga0207664_103291882 297
514 3300025931 Ga0207644_10029613 Ga0207644_100296133 297
515 3300025931 Ga0207644_10237084 Ga0207644_102370842 297
516 3300025933 Ga0207706_10004694 Ga0207706_100046946 297
517 3300025933 Ga0207706_10032619 Ga0207706_100326194 297
518 3300025934 Ga0207686_10013513 Ga0207686_100135133 297
519 3300025935 Ga0207709_10002562 Ga0207709_100025628 297
520 3300025937 Ga0207669_10000452 Ga0207669_1000045215 297
521 3300025937 Ga0207669_10099892 Ga0207669_100998922 297
522 3300025938 Ga0207704_10036095 Ga0207704_100360953 297
523 3300025938 Ga0207704_10045309 Ga0207704_100453092 297
524 3300025938 Ga0207704_10114931 Ga0207704_101149312 297
525 3300025938 Ga0207704_10285556 Ga0207704_102855561 297
526 3300025938 Ga0207704_10366587 Ga0207704_103665872 297
527 3300025940 Ga0207691_10026786 Ga0207691_100267862 297
528 3300025940 Ga0207691_10064280 Ga0207691_100642802 297
529 3300025940 Ga0207691_10345323 Ga0207691_103453231 297
530 3300025941 Ga0207711_10170500 Ga0207711_101705002 297
531 3300025941 Ga0207711_10355200 Ga0207711_103552002 297
532 3300025942 Ga0207689_10002068 Ga0207689_1000206818 297
533 3300025942 Ga0207689_10071215 Ga0207689_100712153 297
534 3300025942 Ga0207689_10115778 Ga0207689_101157782 297
535 3300025944 Ga0207661_10003739 Ga0207661_100037398 297
536 3300025944 Ga0207661_10353298 Ga0207661_103532982 297
537 3300025945 Ga0207679_10254039 Ga0207679_102540392 297
538 3300025949 Ga0207667_10044937 Ga0207667_100449374 297
539 3300025960 Ga0207651_10015098 Ga0207651_100150984 297
540 3300025960 Ga0207651_10084156 Ga0207651_100841562 297
541 3300025961 Ga0207712_10013735 Ga0207712_100137354 297
542 3300025972 Ga0207668_10014694 Ga0207668_100146942 297
543 3300025972 Ga0207668_10101281 Ga0207668_101012812 297
544 3300026023 Ga0207677_10089057 Ga0207677_100890572 297
545 3300026023 Ga0207677_10117746 Ga0207677_101177462 297
546 3300026035 Ga0207703_10109503 Ga0207703_101095032 297
547 3300026041 Ga0207639_10279591 Ga0207639_102795911 297
548 3300026067 Ga0207678_10006581 Ga0207678_100065819 297
549 3300026067 Ga0207678_10037870 Ga0207678_100378702 297
550 3300026067 Ga0207678_10127749 Ga0207678_101277492 297
551 3300026067 Ga0207678_10307375 Ga0207678_103073751 297
552 3300026075 Ga0207708_10016103 Ga0207708_100161035 297
553 3300026078 Ga0207702_10519753 Ga0207702_105197531 297
554 3300026088 Ga0207641_10027234 Ga0207641_100272343 297
555 3300026088 Ga0207641_10536916 Ga0207641_105369162 297
556 3300026089 Ga0207648_10012533 Ga0207648_100125336 297
557 3300026089 Ga0207648_10040939 Ga0207648_100409391 297
558 3300026089 Ga0207648_10042029 Ga0207648_100420292 297
559 3300026089 Ga0207648_10141395 Ga0207648_101413953 297
560 3300026089 Ga0207648_10283304 Ga0207648_102833042 297
561 3300026116 Ga0207674_10117826 Ga0207674_101178264 297
562 3300026118 Ga0207675_100006604 Ga0207675_1000066044 297
563 3300026118 Ga0207675_100157190 Ga0207675_1001571902 297
564 3300026121 Ga0207683_10010731 Ga0207683_100107316 297
565 3300026121 Ga0207683_10039677 Ga0207683_100396774 297
566 3300026121 Ga0207683_10099993 Ga0207683_100999932 297
567 3300026121 Ga0207683_10163485 Ga0207683_101634852 297
568 3300026142 Ga0207698_10045879 Ga0207698_100458792 297
569 3300026142 Ga0207698_10222425 Ga0207698_102224252 297
570 3300027671 Ga0209588_1014464 Ga0209588_10144642 297
571 3300027866 Ga0209813_10064194 Ga0209813_100641942 297
572 3300027907 Ga0207428_10018760 Ga0207428_100187606 297
573 3300027907 Ga0207428_10067764 Ga0207428_100677642 297
574 3300028379 Ga0268266_10018025 Ga0268266_100180253 297
575 3300028379 Ga0268266_10018984 Ga0268266_100189841 297
576 3300028379 Ga0268266_10033303 Ga0268266_100333032 297
577 3300028379 Ga0268266_10068401 Ga0268266_100684012 297
578 3300028379 Ga0268266_10129753 Ga0268266_101297532 297
579 3300028379 Ga0268266_10164981 Ga0268266_101649812 297
580 3300028379 Ga0268266_10381714 Ga0268266_103817142 297
581 3300028380 Ga0268265_10155806 Ga0268265_101558062 297
582 3300028380 Ga0268265_10206983 Ga0268265_102069831 297
583 3300028380 Ga0268265_10438855 Ga0268265_104388552 297
584 3300028381 Ga0268264_10040954 Ga0268264_100409542 297
585 3300028381 Ga0268264_10056810 Ga0268264_100568104 297
586 3300028381 Ga0268264_10124992 Ga0268264_101249921 297
587 3300028381 Ga0268264_10356987 Ga0268264_103569871 297
588 3300028794 Ga0307515_10251724 Ga0307515_102517242 297
589 3300031548 Ga0307408_100349165 Ga0307408_1003491651 297
590 3300031616 Ga0307508_10000003 Ga0307508_1000000362 297
591 3300031616 Ga0307508_10137047 Ga0307508_101370473 297
592 3300031711 Ga0265314_10039828 Ga0265314_100398283 297
593 3300031731 Ga0307405_10100554 Ga0307405_101005542 297
594 3300032002 Ga0307416_100363432 Ga0307416_1003634322 297
595 3300032004 Ga0307414_10014979 Ga0307414_100149792 297
596 3300032005 Ga0307411_10054265 Ga0307411_100542652 297
597 3300032005 Ga0307411_10103069 Ga0307411_101030692 297
598 3300032126 Ga0307415_100036378 Ga0307415_1000363782 297
599 3300032126 Ga0307415_100282304 Ga0307415_1002823041 297
600 3300033180 Ga0307510_10003141 Ga0307510_1000314118 297
601 3300033180 Ga0307510_10005841 Ga0307510_100058414 297
602 3300034816 Ga0373930_0003359 Ga0373930_0003359_635_1528 297
603 3300035111 Ga0373923_0012719 Ga0373923_0012719_85_978 297
604 3300035111 Ga0373923_0070628 Ga0373923_0070628_80_973 297
605 3300035113 Ga0373936_0014305 Ga0373936_0014305_2078_2971 297
606 3300035113 Ga0373936_0040510 Ga0373936_0040510_85_978 297
607 3300035115 Ga0373941_0056353 Ga0373941_0056353_127_1020 297
608 3300035117 Ga0373953_0009862 Ga0373953_0009862_923_1816 297
609 3300035117 Ga0373953_0122071 Ga0373953_0122071_137_1030 297
610 3300035118 Ga0373954_0057619 Ga0373954_0057619_867_1760 297
611 3300035170 Ga0373943_0014517 Ga0373943_0014517_1668_2567 297
612 3300035170 Ga0373943_0074471 Ga0373943_0074471_256_1149 297
613 3300035171 Ga0373946_0009162 Ga0373946_0009162_395_1294 297
614 3300035171 Ga0373946_0128812 Ga0373946_0128812_230_1123 297
615 3300035172 Ga0373955_0025059 Ga0373955_0025059_448_1341 297
616 3300035172 Ga0373955_0061865 Ga0373955_0061865_840_1739 297
617 3300035410 Ga0373924_0103477 Ga0373924_0103477_217_1110 297
618 3300035692 Ga0373935_0031246 Ga0373935_0031246_544_1443 297
619 3300035695 Ga0373927_0000954 Ga0373927_0000954_16928_17821 297
620 3300035695 Ga0373927_0035464 Ga0373927_0035464_1095_1988 297
621 3300035724 Ga0373933_0023593 Ga0373933_0023593_2171_3064 297
622 3300035724 Ga0373933_0164535 Ga0373933_0164535_137_1030 297
623 3300035725 Ga0373947_0009391 Ga0373947_0009391_574_1467 297
624 3300036401 Ga0373937_0009087 Ga0373937_0009087_2638_3531 297
625 3300036401 Ga0373937_0321978 Ga0373937_0321978_55_954 297
626 3300037068 Ga0373925_0010072 Ga0373925_0010072_756_1649 297
627 3300037068 Ga0373925_0016266 Ga0373925_0016266_1919_2812 297
628 3300037068 Ga0373925_0023854 Ga0373925_0023854_1234_2133 297
629 3300037418 Ga0395900_0456615 Ga0395900_0456615_128_1021 297
630 3300037466 Ga0395898_0157520 Ga0395898_0157520_1010_1903 297
631 3300037471 Ga0395905_0191162 Ga0395905_0191162_329_1222 297
632 3300037853 Ga0436364_1433595 Ga0436364_1433595_1586_2479 297
633 3300038443 Ga0395901_0279105 Ga0395901_0279105_24_917 297
634 3300039437 Ga0436365_0165134 Ga0436365_0165134_1366_2259 297
635 3300039438 Ga0436360_0566741 Ga0436360_0566741_1626_2519 297
636 3300039438 Ga0436360_1164509 Ga0436360_1164509_4084_4977 297
637 3300039447 Ga0436361_0271360 Ga0436361_0271360_311_1204 297
638 3300039447 Ga0436361_0322180 Ga0436361_0322180_1892_2785 297
639 3300039450 Ga0436363_0474007 Ga0436363_0474007_1158_2051 297
640 3300039450 Ga0436363_0547163 Ga0436363_0547163_187_1080 297
641 3300039453 Ga0436362_0719252 Ga0436362_0719252_1453_2346 297
642 3300041413 Ga0439465_0014088 Ga0439465_0014088_54_947 297
643 3300041452 Ga0451793_1349070 Ga0451793_1349070_12_1076 297
644 3300042436 Ga0439435_0022761 Ga0439435_0022761_183_1076 297
645 3300044656 Ga0466969_0126182 Ga0466969_0126182_286_1179 297
646 3300044842 Ga0466957_0041755 Ga0466957_0041755_1152_2045 297
647 3300044901 Ga0466960_0186864 Ga0466960_0186864_47_940 297
648 3300046454 Ga0495592_0003549 Ga0495592_0003549_8462_9364 297
649 3300046454 Ga0495592_0010029 Ga0495592_0010029_1917_2810 297
650 3300046455 Ga0495603_0063913 Ga0495603_0063913_953_1846 297
651 3300046455 Ga0495603_0140592 Ga0495603_0140592_497_1390 297
652 3300046459 Ga0495629_0001147 Ga0495629_0001147_4818_5711 297
653 3300046460 Ga0495638_0094057 Ga0495638_0094057_105_998 297
654 3300046461 Ga0495641_0002236 Ga0495641_0002236_4647_5540 297
655 3300046461 Ga0495641_0161677 Ga0495641_0161677_22_915 297
656 3300046463 Ga0495653_0170097 Ga0495653_0170097_224_1117 297
657 3300046473 Ga0495582_0008262 Ga0495582_0008262_71_964 297
658 3300046473 Ga0495582_0071543 Ga0495582_0071543_415_1308 297
659 3300046473 Ga0495582_0176517 Ga0495582_0176517_220_1113 297
660 3300046475 Ga0495639_0000398 Ga0495639_0000398_15059_15952 297
661 3300046475 Ga0495639_0003550 Ga0495639_0003550_3430_4323 297
662 3300046475 Ga0495639_0080012 Ga0495639_0080012_370_1269 297
663 3300046477 Ga0495664_0007541 Ga0495664_0007541_4160_5053 297
664 3300046491 Ga0495584_0038133 Ga0495584_0038133_248_1141 297
665 3300046491 Ga0495584_0054732 Ga0495584_0054732_195_1088 297
666 3300046501 Ga0495607_0142905 Ga0495607_0142905_35_928 297
667 3300046501 Ga0495607_0209006 Ga0495607_0209006_52_945 297
668 3300046514 Ga0495618_0042727 Ga0495618_0042727_568_1461 297
669 3300046516 Ga0495628_0050962 Ga0495628_0050962_476_1378 297
670 3300046516 Ga0495628_0186902 Ga0495628_0186902_274_1167 297
671 3300046517 Ga0495630_0075520 Ga0495630_0075520_1590_2483 297
672 3300046517 Ga0495630_0108732 Ga0495630_0108732_675_1568 297
673 3300046518 Ga0495631_0019556 Ga0495631_0019556_1584_2477 297
674 3300046519 Ga0495632_0062345 Ga0495632_0062345_137_1030 297
675 3300046523 Ga0495644_0004762 Ga0495644_0004762_1835_2728 297
676 3300046526 Ga0495666_0031920 Ga0495666_0031920_1572_2465 297
677 3300046529 Ga0495652_0254883 Ga0495652_0254883_139_1032 297
678 3300046531 Ga0495665_0014316 Ga0495665_0014316_3328_4221 297
679 3300046533 Ga0495640_0013759 Ga0495640_0013759_601_1494 297
680 3300046533 Ga0495640_0034920 Ga0495640_0034920_2278_3171 297
681 3300046536 Ga0495587_0018953 Ga0495587_0018953_1563_2465 297
682 3300046538 Ga0495609_0063453 Ga0495609_0063453_693_1586 297
683 3300046543 Ga0495645_0223769 Ga0495645_0223769_142_1035 297
684 3300046557 Ga0495622_0084889 Ga0495622_0084889_253_1233 297
685 3300046558 Ga0495633_0100997 Ga0495633_0100997_265_1158 297
686 3300046559 Ga0495667_0004349 Ga0495667_0004349_8422_9315 297
687 3300046615 Ga0495656_0038921 Ga0495656_0038921_144_1037 297
688 3300046615 Ga0495656_0044048 Ga0495656_0044048_739_1632 297
689 3300046616 Ga0495668_0140046 Ga0495668_0140046_219_1112 297
690 3300046616 Ga0495668_0187209 Ga0495668_0187209_196_1089 297
691 3300046642 Ga0495634_0001733 Ga0495634_0001733_5627_6520 297
692 3300046663 Ga0495635_0001081 Ga0495635_0001081_12563_13456 297
693 3300046663 Ga0495635_0085052 Ga0495635_0085052_522_1415 297
694 3300046665 Ga0495661_0155655 Ga0495661_0155655_90_983 297
695 3300046674 Ga0495588_0050611 Ga0495588_0050611_923_1816 297
696 3300046678 Ga0495599_0105725 Ga0495599_0105725_428_1321 297
697 3300046679 Ga0495623_0188135 Ga0495623_0188135_67_969 297
698 3300046680 Ga0495646_0042421 Ga0495646_0042421_1627_2520 297
699 3300046681 Ga0495647_0001006 Ga0495647_0001006_210_1103 297
700 3300046683 Ga0495658_0056309 Ga0495658_0056309_1309_2211 297
701 3300046683 Ga0495658_0154521 Ga0495658_0154521_75_968 297
702 3300046690 Ga0495624_0002089 Ga0495624_0002089_4734_5627 297
703 3300046690 Ga0495624_0108558 Ga0495624_0108558_512_1405 297
704 3300046690 Ga0495624_0151832 Ga0495624_0151832_432_1325 297
705 3300046691 Ga0495670_0128162 Ga0495670_0128162_300_1193 297
706 3300046692 Ga0495671_0041056 Ga0495671_0041056_1159_2052 297
707 3300046692 Ga0495671_0122735 Ga0495671_0122735_15_908 297
708 3300046794 Ga0495589_0057881 Ga0495589_0057881_250_1227 297
709 3300047315 Ga0495581_0134378 Ga0495581_0134378_23_916 297
710 3300047317 Ga0495604_0047759 Ga0495604_0047759_175_1077 297
711 3300047317 Ga0495604_0102507 Ga0495604_0102507_117_1010 297
712 3300047319 Ga0495674_0001446 Ga0495674_0001446_20424_21317 297
713 3300047319 Ga0495674_0008442 Ga0495674_0008442_4152_5054 297
714 3300047319 Ga0495674_0101329 Ga0495674_0101329_276_1169 297
715 3300047320 Ga0495672_0028166 Ga0495672_0028166_2087_2980 297
716 3300047321 Ga0495676_0127611 Ga0495676_0127611_870_1763 297
717 3300047471 Ga0495684_0000087 Ga0495684_0000087_53486_54388 297
718 3300047472 Ga0495686_0130577 Ga0495686_0130577_318_1211 297
719 3300047673 Ga0495593_0002136 Ga0495593_0002136_2953_3846 297
720 3300047673 Ga0495593_0033169 Ga0495593_0033169_1664_2557 297
721 3300048088 Ga0495602_0308477 Ga0495602_0308477_130_1023 297
722 3300048089 Ga0495614_0004768 Ga0495614_0004768_2760_3653 297
723 3300048903 Ga0496100_0035251 Ga0496100_0035251_132_1034 297
724 3300048903 Ga0496100_0189035 Ga0496100_0189035_472_1365 297
725 3300048903 Ga0496100_0205027 Ga0496100_0205027_370_1263 297
726 3300048903 Ga0496100_0341693 Ga0496100_0341693_56_949 297
727 3300048904 Ga0496101_0001189 Ga0496101_0001189_48_950 297
728 3300048904 Ga0496101_0048707 Ga0496101_0048707_676_1569 297
729 3300048904 Ga0496101_0094496 Ga0496101_0094496_1128_2021 297
730 3300048905 Ga0496102_0084164 Ga0496102_0084164_1014_1907 297
731 3300048905 Ga0496102_0446369 Ga0496102_0446369_20_913 297
732 3300048906 Ga0496103_0194200 Ga0496103_0194200_175_1068 297
733 3300048907 Ga0496104_0002386 Ga0496104_0002386_10817_11755 297
734 3300048907 Ga0496104_0014562 Ga0496104_0014562_1664_2566 297
735 3300048907 Ga0496104_0077658 Ga0496104_0077658_987_1880 297
736 3300048907 Ga0496104_0384724 Ga0496104_0384724_267_1160 297
737 3300048907 Ga0496104_0464594 Ga0496104_0464594_132_1025 297
738 3300048908 Ga0496105_0017371 Ga0496105_0017371_616_1554 297
739 3300048908 Ga0496105_0110092 Ga0496105_0110092_1101_1994 297
740 3300048908 Ga0496105_0120437 Ga0496105_0120437_951_1853 297
741 3300048908 Ga0496105_0166548 Ga0496105_0166548_148_1041 297
742 3300048909 Ga0496106_0036302 Ga0496106_0036302_1678_2571 297
743 3300048909 Ga0496106_0040858 Ga0496106_0040858_1848_2741 297
744 3300048910 Ga0496107_0107396 Ga0496107_0107396_112_1005 297
745 3300048911 Ga0496108_0000487 Ga0496108_0000487_19930_20868 297
746 3300048911 Ga0496108_0106252 Ga0496108_0106252_875_1768 297
747 3300048911 Ga0496108_0276783 Ga0496108_0276783_514_1407 297
748 3300048912 Ga0496109_0009661 Ga0496109_0009661_2853_3791 297
749 3300048912 Ga0496109_0148262 Ga0496109_0148262_1128_2021 297
750 3300048912 Ga0496109_0282311 Ga0496109_0282311_630_1523 297
751 3300048912 Ga0496109_0525448 Ga0496109_0525448_105_998 297
752 3300048913 Ga0496110_0003734 Ga0496110_0003734_2206_3144 297
753 3300048913 Ga0496110_0149967 Ga0496110_0149967_1181_2074 297
754 3300048914 Ga0496111_0135726 Ga0496111_0135726_309_1247 297
755 3300048914 Ga0496111_0145085 Ga0496111_0145085_783_1676 297
756 3300048915 Ga0496112_0011293 Ga0496112_0011293_2153_3091 297
757 3300048915 Ga0496112_0042693 Ga0496112_0042693_2088_2981 297
758 3300048915 Ga0496112_0053589 Ga0496112_0053589_1889_2782 297
759 3300048915 Ga0496112_0164440 Ga0496112_0164440_930_1922 297
760 3300048917 Ga0496114_0009568 Ga0496114_0009568_5601_6503 297
761 3300048917 Ga0496114_0029704 Ga0496114_0029704_2436_3329 297
762 3300048917 Ga0496114_0134194 Ga0496114_0134194_472_1365 297
763 3300048917 Ga0496114_0214453 Ga0496114_0214453_665_1561 297
764 3300048917 Ga0496114_0410185 Ga0496114_0410185_236_1129 297
765 3300048917 Ga0496114_0449639 Ga0496114_0449639_104_1003 297
766 3300048918 Ga0496115_0036316 Ga0496115_0036316_1668_2570 297
767 3300048918 Ga0496115_0074383 Ga0496115_0074383_1137_2030 297
768 3300048918 Ga0496115_0210135 Ga0496115_0210135_249_1145 297
769 3300048918 Ga0496115_0257217 Ga0496115_0257217_408_1301 297
770 3300048918 Ga0496115_0305696 Ga0496115_0305696_298_1191 297
771 3300048918 Ga0496115_0370002 Ga0496115_0370002_81_974 297
772 3300048918 Ga0496115_0401612 Ga0496115_0401612_156_1055 297
773 3300048919 Ga0496116_0084615 Ga0496116_0084615_159_1052 297
774 3300048921 Ga0496118_0042192 Ga0496118_0042192_1117_2010 297
775 3300048921 Ga0496118_0208721 Ga0496118_0208721_188_1081 297
776 3300048922 Ga0496119_0056311 Ga0496119_0056311_736_1629 297
777 3300048923 Ga0496120_0016686 Ga0496120_0016686_46_939 297
778 3300048924 Ga0496121_0000287 Ga0496121_0000287_100450_101343 297
779 3300048924 Ga0496121_0011898 Ga0496121_0011898_4844_5737 297
780 3300048924 Ga0496121_0016703 Ga0496121_0016703_4779_5672 297
781 3300048924 Ga0496121_0028576 Ga0496121_0028576_2550_3443 297
782 3300048924 Ga0496121_0028747 Ga0496121_0028747_3957_4850 297
783 3300048924 Ga0496121_0229726 Ga0496121_0229726_73_966 297
784 3300048927 Ga0496124_0054828 Ga0496124_0054828_830_1723 297
785 3300048927 Ga0496124_0103910 Ga0496124_0103910_591_1514 297
786 3300048928 Ga0496125_0052927 Ga0496125_0052927_370_1263 297
787 3300048929 Ga0496126_0009399 Ga0496126_0009399_1705_2598 297
788 3300048929 Ga0496126_0051576 Ga0496126_0051576_2346_3242 297
789 3300048929 Ga0496126_0055696 Ga0496126_0055696_2383_3276 297
790 3300048929 Ga0496126_0057522 Ga0496126_0057522_1084_1977 297
791 3300048929 Ga0496126_0077632 Ga0496126_0077632_1344_2237 297
792 3300049571 Ga0501034_0001115 Ga0501034_0001115_13944_14837 297
793 3300049571 Ga0501034_0014439 Ga0501034_0014439_4859_5752 297
794 3300049573 Ga0501037_0331821 Ga0501037_0331821_36_929 297
795 3300049574 Ga0501038_0175825 Ga0501038_0175825_335_1228 297
796 3300049575 Ga0501039_0336270 Ga0501039_0336270_123_1016 297
797 3300049576 Ga0501040_0010518 Ga0501040_0010518_2205_3098 297
798 3300049577 Ga0501041_0004345 Ga0501041_0004345_6178_7071 297
799 3300049578 Ga0501042_0069043 Ga0501042_0069043_585_1478 297
800 3300049579 Ga0501043_0090953 Ga0501043_0090953_215_1108 297
801 3300049580 Ga0501046_0052868 Ga0501046_0052868_1299_2192 297
802 3300049582 Ga0501048_0018986 Ga0501048_0018986_3060_3953 297
803 3300049584 Ga0501068_0002049 Ga0501068_0002049_3699_4592 297
804 3300049584 Ga0501068_0050825 Ga0501068_0050825_453_1346 297
805 3300049586 Ga0501070_0128861 Ga0501070_0128861_313_1206 297
806 3300049588 Ga0501072_0004722 Ga0501072_0004722_8145_9038 297
807 3300049589 Ga0501073_0004143 Ga0501073_0004143_6721_7614 297
808 3300049590 Ga0501074_0022553 Ga0501074_0022553_2767_3660 297
809 3300049591 Ga0501075_0013838 Ga0501075_0013838_215_1108 297
810 3300049592 Ga0501076_0007157 Ga0501076_0007157_975_1868 297
811 3300049592 Ga0501076_0146209 Ga0501076_0146209_47_1048 297
812 3300049593 Ga0501077_0027356 Ga0501077_0027356_628_1521 297
813 3300049741 Ga0501079_0011233 Ga0501079_0011233_4945_5838 297
814 3300049742 Ga0501080_0110258 Ga0501080_0110258_1003_1896 297
815 3300049743 Ga0501081_0008229 Ga0501081_0008229_3863_4756 297
816 3300049744 Ga0501083_0011038 Ga0501083_0011038_5236_6129 297
817 3300049822 Ga0501035_0063851 Ga0501035_0063851_1985_2878 297
818 3300049824 Ga0501045_0010114 Ga0501045_0010114_859_1752 297
819 3300050491 nmdc:mga00v17_199736_c1 nmdc:mga00v17_199736_c1_204_1097 297
820 3300050492 nmdc:mga0yw44_1320_c1 nmdc:mga0yw44_1320_c1_7903_8826 297
821 3300050492 nmdc:mga0yw44_4374_c1 nmdc:mga0yw44_4374_c1_1684_2577 297
822 3300050493 nmdc:mga0k408_64800_c1 nmdc:mga0k408_64800_c1_360_1253 297
823 3300050494 nmdc:mga06z11_17970_c1 nmdc:mga06z11_17970_c1_1686_2579 297
824 3300050494 nmdc:mga06z11_205413_c1 nmdc:mga06z11_205413_c1_103_996 297
825 3300050494 nmdc:mga06z11_264361_c1 nmdc:mga06z11_264361_c1_51_944 297
826 3300050494 nmdc:mga06z11_274648_c1 nmdc:mga06z11_274648_c1_45_941 297
827 3300050494 nmdc:mga06z11_38703_c1 nmdc:mga06z11_38703_c1_1008_1988 297
828 3300050495 nmdc:mga04h51_52736_c1 nmdc:mga04h51_52736_c1_340_1233 297
829 3300050495 nmdc:mga04h51_76836_c1 nmdc:mga04h51_76836_c1_62_1042 297
830 3300050496 nmdc:mga07m45_116012_c1 nmdc:mga07m45_116012_c1_537_1430 297
831 3300050496 nmdc:mga07m45_48021_c1 nmdc:mga07m45_48021_c1_1447_2340 297
832 3300050507 nmdc:mga05p37_336870_c1 nmdc:mga05p37_336870_c1_727_1668 297
833 3300050507 nmdc:mga05p37_427910_c1 nmdc:mga05p37_427910_c1_299_1192 297
834 3300050510 nmdc:mga06r32_445057_c1 nmdc:mga06r32_445057_c1_36_929 297
835 3300050511 nmdc:mga08y16_167184_c1 nmdc:mga08y16_167184_c1_1139_2032 297
836 3300050511 nmdc:mga08y16_19214_c1 nmdc:mga08y16_19214_c1_2629_3522 297
837 3300050512 nmdc:mga0n895_26092_c1 nmdc:mga0n895_26092_c1_3990_4883 297
838 3300050513 nmdc:mga0rr50_338750_c1 nmdc:mga0rr50_338750_c1_118_1011 297
839 3300050515 nmdc:mga0a205_153235_c1 nmdc:mga0a205_153235_c1_1203_2099 297
840 3300050516 nmdc:mga0sz30_73562_c1 nmdc:mga0sz30_73562_c1_345_1238 297
841 3300053085 Ga0495619_0022988 Ga0495619_0022988_2033_2935 297
842 3300053087 Ga0500643_000007 Ga0500643_000007_341320_342213 297
843 3300053091 Ga0500647_0007502 Ga0500647_0007502_550_1443 297
844 3300053092 Ga0500583_0023491 Ga0500583_0023491_1566_2459 297
845 3300053093 Ga0500651_0228723 Ga0500651_0228723_165_1058 297
846 3300053094 Ga0500566_0000912 Ga0500566_0000912_10022_10918 297
847 3300053095 Ga0500640_007970 Ga0500640_007970_2366_3259 297
848 3300053096 Ga0500641_0008663 Ga0500641_0008663_728_1783 297
849 3300053096 Ga0500641_0057897 Ga0500641_0057897_561_1454 297
850 3300053102 Ga0500554_003644 Ga0500554_003644_891_1784 297
851 3300053103 Ga0500555_007192 Ga0500555_007192_1917_2810 297
852 3300053105 Ga0500557_000023 Ga0500557_000023_12893_13786 297
853 3300053108 Ga0500562_001060 Ga0500562_001060_2806_3699 297
854 3300053111 Ga0500572_000379 Ga0500572_000379_8871_9764 297
855 3300053111 Ga0500572_001201 Ga0500572_001201_4203_5096 297
856 3300053118 Ga0500594_0051339 Ga0500594_0051339_170_1063 297
857 3300053119 Ga0500595_001438 Ga0500595_001438_8591_9484 297
858 3300053119 Ga0500595_007343 Ga0500595_007343_162_1055 297
859 3300053120 Ga0500597_121606 Ga0500597_121606_38_931 297
860 3300053122 Ga0500608_065877 Ga0500608_065877_165_1058 297
861 3300053126 Ga0500621_089712 Ga0500621_089712_21_914 297
862 3300053131 Ga0500652_052692 Ga0500652_052692_96_989 297
863 3300053136 Ga0500559_0002580 Ga0500559_0002580_1363_2256 297
864 3300053136 Ga0500559_0031781 Ga0500559_0031781_210_1103 297
865 3300053139 Ga0500568_0108698 Ga0500568_0108698_129_1022 297
866 3300053147 Ga0500589_090047 Ga0500589_090047_127_1020 297
867 3300053153 Ga0500616_0002343 Ga0500616_0002343_3098_3994 297
868 3300053153 Ga0500616_0020755 Ga0500616_0020755_164_1057 297
869 3300053156 Ga0500622_0005077 Ga0500622_0005077_157_1050 297
870 3300053162 Ga0500638_000192 Ga0500638_000192_3713_4606 297
871 3300053177 Ga0500636_0000014 Ga0500636_0000014_99115_100008 297
872 3300053177 Ga0500636_0026790 Ga0500636_0026790_909_1802 297
873 3300053178 Ga0500637_0000348 Ga0500637_0000348_13751_14644 297
874 3300053178 Ga0500637_0013269 Ga0500637_0013269_1723_2616 297
875 3300053178 Ga0500637_0111149 Ga0500637_0111149_451_1344 297
876 3300053729 Ga0500625_007283 Ga0500625_007283_2263_3156 297
877 3300053736 Ga0500599_002250 Ga0500599_002250_745_1638 297
878 3300053737 Ga0500601_000005 Ga0500601_000005_58508_59401 297
879 3300055283 Ga0500661_002368 Ga0500661_002368_1071_1964 297
880 3300060353 Ga0501082_0006643 Ga0501082_0006643_6274_7167 297
881 3300060353 Ga0501082_0325098 Ga0501082_0325098_139_1032 297
882 3300061734 Ga0530510_0413932 Ga0530510_0413932_35_928 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

223

344

0.99

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

62

219

0.96

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

62

155

0.9

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

27

139

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpd-assembly1.cif.gz_A x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] 0.9155 5 297
3obb-assembly1.cif.gz_A crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 0.9142 3 287
2uyy-assembly1.cif.gz_D structure of the cytokine-like nuclear factor n-pac 0.914 4 285
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.9135 3 288
3q3c-assembly1.cif.gz_A crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with nad 0.9118 4 287
ID Description Score Start End Superfamily
af_Q9XTI0_3_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9683 6 162 3.40.50.720
af_Q4DFE2_2_165_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9592 3 163 3.40.50.720
af_P0A9V8_1_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9574 3 159 3.40.50.720
af_Q9C991_11_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9531 1 162 3.40.50.720
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9523 1 164 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7K0D7A5-F1-model_v4 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) 0.9861 5 136 GO:0008679
GO:0050661
AF-A0A850IM32-F1-model_v4 deleted 0.9791 3 175
AF-A0A534H702-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9735 5 163 GO:0006574
GO:0008442
GO:0050661
AF-A0A351CZ77-F1-model_v4 6-phosphogluconate dehydrogenase 0.9734 5 209 GO:0016054
GO:0050661
GO:0051287
AF-A0A382L6B5-F1-model_v4 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein 0.9732 5 86 GO:0016616
GO:0050661

Feature Viewer

pLDDT pTM Quality
84.58 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map