F484568
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 882 | 317 | 1764 | 380 |
Family's Representative Sequence
| Representative Sequence | 3300053098|Ga0500650_0096784|Ga0500650_0096784_22_1269 |
| Length | 415 |
| Sequence | MEMGLSLARCIQECLYRKYKTGIAHHKRRFQGTNSIMSLQPKYDVAIAGGGLAGLALSIQCARAGYKTVLFEREKYPFHKVCGEYISLESWNFLQDLGLPLSDMQLPIINRLLITTPNGNYIETTLPLGGFGISRYTIDHLLANIARQEGVTVLEETKVMNIVYSNNMFHIFTNNGETEATVVAGAYGKRGNLDIKWKRQFTQVKPNKLNHYIAVKYHIRTHHAGDLIALHNFENGYCGISQIEENKYCLCYLTTAANLRKCRNDISSMEKSILMRNPFLEKIFSNAEFLYDEPLTISRISFNKKTQIENHVLMIGDTAGLIAPLCGNGMSMALHSSKLAFEEINSFLQGRINRYEMEIQYTQQWEKFFARRLQVGRLLQSFFGSAFLSNVLIKLVKPFPKFVAFLIQQTHGKPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 190 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 191 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 200 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 210 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 211 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 212 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 213 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 214 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 215 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 216 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 217 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 218 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 219 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 271 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 272 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 274 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 278 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 279 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 288 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 289 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 290 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 291 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 292 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 293 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 295 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 296 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 297 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 298 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 299 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 301 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 302 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 303 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 304 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 305 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 306 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 307 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 308 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 309 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 310 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 311 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 312 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 313 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 314 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 315 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 316 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 317 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.53 |
| Metatranscriptomes | 0 |
| Isolates | 1.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.46 |
| Nodule | 0 |
| Rhizoplane | 0.57 |
| Rhizosphere | 88.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500650_0096784 | 3300053098 | Unclassified | 1382 |
| 2 | JGI24740J21852_10007864 | 3300001979 | Bacteria | 4301 |
| 3 | JGI24740J21852_10010129 | 3300001979 | Bacteria | 3647 |
| 4 | JGI24739J22299_10006664 | 3300001989 | Bacteria | 4346 |
| 5 | JGI24739J22299_10008192 | 3300001989 | Bacteria | 3901 |
| 6 | JGI24737J22298_10000798 | 3300001990 | Bacteria | 11169 |
| 7 | JGI24735J21928_10000017 | 3300002067 | Bacteria | 114440 |
| 8 | JGI24751J29686_10003416 | 3300002459 | Bacteria | 3201 |
| 9 | JGI25162J39368_1000008 | 3300002737 | Bacteria | 397212 |
| 10 | JGI25154J39366_1000031 | 3300002738 | Bacteria | 190814 |
| 11 | JGI25153J46596_10005563 | 3300003215 | Bacteria | 6586 |
| 12 | JGI25153J46596_10009336 | 3300003215 | Unclassified | 4578 |
| 13 | rootH1_10005434 | 3300003316 | Bacteria | 18233 |
| 14 | rootH1_10013656 | 3300003316 | Bacteria | 3898 |
| 15 | rootH2_10000535 | 3300003320 | Bacteria | 24013 |
| 16 | rootH2_10009334 | 3300003320 | Bacteria | 10166 |
| 17 | rootH2_10060262 | 3300003320 | Bacteria | 3871 |
| 18 | rootH2_10065329 | 3300003320 | Bacteria | 2225 |
| 19 | rootH2_10260519 | 3300003320 | Bacteria | 2661 |
| 20 | rootL2_10047246 | 3300003322 | Bacteria | 7912 |
| 21 | rootL2_10094996 | 3300003322 | Bacteria | 2984 |
| 22 | rootL2_10106246 | 3300003322 | Bacteria | 2239 |
| 23 | rootL2_10171473 | 3300003322 | Bacteria | 1591 |
| 24 | rootL2_10223049 | 3300003322 | Bacteria | 3129 |
| 25 | rootH1_10052201 | 3300003323 | Bacteria | 4665 |
| 26 | rootH1_10057964 | 3300003323 | Bacteria | 14017 |
| 27 | rootH1_10123253 | 3300003323 | Bacteria | 5109 |
| 28 | rootH1_10325136 | 3300003323 | Bacteria | 4537 |
| 29 | rootH1_10384659 | 3300003323 | Bacteria | 1573 |
| 30 | JGI25160J50197_1005634 | 3300003354 | Bacteria | 5184 |
| 31 | JGI25160J50197_1006108 | 3300003354 | Bacteria | 4913 |
| 32 | Ga0055528_1001378 | 3300003790 | Bacteria | 14923 |
| 33 | Ga0055530_10002564 | 3300003791 | Bacteria | 11538 |
| 34 | Ga0055531_10000339 | 3300003794 | Bacteria | 46111 |
| 35 | Ga0065165_1000674 | 3300005262 | Bacteria | 49121 |
| 36 | Ga0065165_1002242 | 3300005262 | Bacteria | 17168 |
| 37 | Ga0065165_1016053 | 3300005262 | Bacteria | 2822 |
| 38 | Ga0065714_10106132 | 3300005288 | Bacteria | 1540 |
| 39 | Ga0065704_10107649 | 3300005289 | Bacteria | 2050 |
| 40 | Ga0065712_10001366 | 3300005290 | Bacteria | 11529 |
| 41 | Ga0065712_10116018 | 3300005290 | Bacteria | 1740 |
| 42 | Ga0065712_10127650 | 3300005290 | Unclassified | 1578 |
| 43 | Ga0065712_10179394 | 3300005290 | Bacteria | 1200 |
| 44 | Ga0065715_10094117 | 3300005293 | Unclassified | 4438 |
| 45 | Ga0065707_10098430 | 3300005295 | Bacteria | 3086 |
| 46 | Ga0070658_10001648 | 3300005327 | Bacteria | 18875 |
| 47 | Ga0070658_10253016 | 3300005327 | Unclassified | 1494 |
| 48 | Ga0070676_10001113 | 3300005328 | Bacteria | 13439 |
| 49 | Ga0070676_10033270 | 3300005328 | Unclassified | 2957 |
| 50 | Ga0070676_10063354 | 3300005328 | Unclassified | 2202 |
| 51 | Ga0070676_10126237 | 3300005328 | Bacteria | 1612 |
| 52 | Ga0070676_10185210 | 3300005328 | Bacteria | 1356 |
| 53 | Ga0070683_100002331 | 3300005329 | Bacteria | 15055 |
| 54 | Ga0070683_100033730 | 3300005329 | Bacteria | 4669 |
| 55 | Ga0070683_100055483 | 3300005329 | Bacteria | 3677 |
| 56 | Ga0070683_100084801 | 3300005329 | Bacteria | 2969 |
| 57 | Ga0070690_100012506 | 3300005330 | Bacteria | 4994 |
| 58 | Ga0070690_100099222 | 3300005330 | Unclassified | 1929 |
| 59 | Ga0070690_100106616 | 3300005330 | Bacteria | 1864 |
| 60 | Ga0070690_100182859 | 3300005330 | Bacteria | 1449 |
| 61 | Ga0070670_100063403 | 3300005331 | Bacteria | 3172 |
| 62 | Ga0070670_100066604 | 3300005331 | Bacteria | 3090 |
| 63 | Ga0070670_100073838 | 3300005331 | Bacteria | 2930 |
| 64 | Ga0070670_100195634 | 3300005331 | Bacteria | 1756 |
| 65 | Ga0070670_100356717 | 3300005331 | Unclassified | 1285 |
| 66 | Ga0070677_10031646 | 3300005333 | Bacteria | 2023 |
| 67 | Ga0068869_100021659 | 3300005334 | Bacteria | 4424 |
| 68 | Ga0068869_100024707 | 3300005334 | Bacteria | 4164 |
| 69 | Ga0068869_100032690 | 3300005334 | Bacteria | 3668 |
| 70 | Ga0068869_100044373 | 3300005334 | Unclassified | 3197 |
| 71 | Ga0068869_100063318 | 3300005334 | Bacteria | 2717 |
| 72 | Ga0068869_100073087 | 3300005334 | Bacteria | 2542 |
| 73 | Ga0068869_100247091 | 3300005334 | Unclassified | 1424 |
| 74 | Ga0070666_10000031 | 3300005335 | Bacteria | 132089 |
| 75 | Ga0070666_10000358 | 3300005335 | Bacteria | 28682 |
| 76 | Ga0070666_10056444 | 3300005335 | Bacteria | 2652 |
| 77 | Ga0070680_100003060 | 3300005336 | Bacteria | 12409 |
| 78 | Ga0070680_100008782 | 3300005336 | Bacteria | 7752 |
| 79 | Ga0070682_100002866 | 3300005337 | Bacteria | 9563 |
| 80 | Ga0070682_100037452 | 3300005337 | Bacteria | 2970 |
| 81 | Ga0070682_100086997 | 3300005337 | Unclassified | 2036 |
| 82 | Ga0068868_100000187 | 3300005338 | Bacteria | 41327 |
| 83 | Ga0068868_100000427 | 3300005338 | Bacteria | 28309 |
| 84 | Ga0068868_100023458 | 3300005338 | Unclassified | 4670 |
| 85 | Ga0068868_100027827 | 3300005338 | Bacteria | 4315 |
| 86 | Ga0068868_100056191 | 3300005338 | Bacteria | 3107 |
| 87 | Ga0068868_100088309 | 3300005338 | Bacteria | 2495 |
| 88 | Ga0068868_100154608 | 3300005338 | Bacteria | 1891 |
| 89 | Ga0070660_100011808 | 3300005339 | Bacteria | 6223 |
| 90 | Ga0070660_100060098 | 3300005339 | Bacteria | 2949 |
| 91 | Ga0070660_100085439 | 3300005339 | Unclassified | 2482 |
| 92 | Ga0070689_100006534 | 3300005340 | Bacteria | 8082 |
| 93 | Ga0070689_100008759 | 3300005340 | Bacteria | 7141 |
| 94 | Ga0070691_10006430 | 3300005341 | Bacteria | 5370 |
| 95 | Ga0070661_100019232 | 3300005344 | Bacteria | 4865 |
| 96 | Ga0070668_100003714 | 3300005347 | Bacteria | 11263 |
| 97 | Ga0070668_100033148 | 3300005347 | Unclassified | 3932 |
| 98 | Ga0070669_100004146 | 3300005353 | Bacteria | 10519 |
| 99 | Ga0070669_100049979 | 3300005353 | Unclassified | 3053 |
| 100 | Ga0070669_100139945 | 3300005353 | Bacteria | 1865 |
| 101 | Ga0070675_100007290 | 3300005354 | Bacteria | 8533 |
| 102 | Ga0070675_100007796 | 3300005354 | Bacteria | 8292 |
| 103 | Ga0070675_100015450 | 3300005354 | Bacteria | 6037 |
| 104 | Ga0070675_100089130 | 3300005354 | Unclassified | 2582 |
| 105 | Ga0070675_100146374 | 3300005354 | Bacteria | 2023 |
| 106 | Ga0070675_100189297 | 3300005354 | Unclassified | 1782 |
| 107 | Ga0070675_100336213 | 3300005354 | Bacteria | 1337 |
| 108 | Ga0070671_100004244 | 3300005355 | Bacteria | 11343 |
| 109 | Ga0070671_100032907 | 3300005355 | Unclassified | 4285 |
| 110 | Ga0070671_100062284 | 3300005355 | Unclassified | 3106 |
| 111 | Ga0070671_100087155 | 3300005355 | Unclassified | 2613 |
| 112 | Ga0070674_100009905 | 3300005356 | Bacteria | 5736 |
| 113 | Ga0070674_100023098 | 3300005356 | Bacteria | 4019 |
| 114 | Ga0070674_100217602 | 3300005356 | Bacteria | 1484 |
| 115 | Ga0070673_100000124 | 3300005364 | Bacteria | 35840 |
| 116 | Ga0070673_100018619 | 3300005364 | Bacteria | 4966 |
| 117 | Ga0070673_100052629 | 3300005364 | Bacteria | 3195 |
| 118 | Ga0070673_100129724 | 3300005364 | Unclassified | 2113 |
| 119 | Ga0070673_100151767 | 3300005364 | Unclassified | 1962 |
| 120 | Ga0070688_100005827 | 3300005365 | Bacteria | 6522 |
| 121 | Ga0070688_100021900 | 3300005365 | Bacteria | 3738 |
| 122 | Ga0070688_100029818 | 3300005365 | Unclassified | 3269 |
| 123 | Ga0070688_100045881 | 3300005365 | Unclassified | 2703 |
| 124 | Ga0070659_100003555 | 3300005366 | Bacteria | 11096 |
| 125 | Ga0070659_100007166 | 3300005366 | Bacteria | 8090 |
| 126 | Ga0070659_100010987 | 3300005366 | Bacteria | 6686 |
| 127 | Ga0070659_100083093 | 3300005366 | Bacteria | 2559 |
| 128 | Ga0070667_100000980 | 3300005367 | Bacteria | 26248 |
| 129 | Ga0070667_100007822 | 3300005367 | Bacteria | 8866 |
| 130 | Ga0070667_100011432 | 3300005367 | Bacteria | 7340 |
| 131 | Ga0070667_100014894 | 3300005367 | Bacteria | 6425 |
| 132 | Ga0070667_100202404 | 3300005367 | Bacteria | 1762 |
| 133 | Ga0070667_100212892 | 3300005367 | Bacteria | 1718 |
| 134 | Ga0070701_10009204 | 3300005438 | Unclassified | 4319 |
| 135 | Ga0070701_10012085 | 3300005438 | Bacteria | 3882 |
| 136 | Ga0070700_100028611 | 3300005441 | Unclassified | 3317 |
| 137 | Ga0070700_100102133 | 3300005441 | Unclassified | 1891 |
| 138 | Ga0070678_100010622 | 3300005456 | Bacteria | 5636 |
| 139 | Ga0070678_100034033 | 3300005456 | Bacteria | 3545 |
| 140 | Ga0070678_100039546 | 3300005456 | Bacteria | 3328 |
| 141 | Ga0070678_100064101 | 3300005456 | Bacteria | 2722 |
| 142 | Ga0070678_100064606 | 3300005456 | Bacteria | 2713 |
| 143 | Ga0070662_100010835 | 3300005457 | Bacteria | 6003 |
| 144 | Ga0070662_100011948 | 3300005457 | Bacteria | 5742 |
| 145 | Ga0070662_100093919 | 3300005457 | Unclassified | 2258 |
| 146 | Ga0070681_10035209 | 3300005458 | Bacteria | 5029 |
| 147 | Ga0070681_10088793 | 3300005458 | Bacteria | 3043 |
| 148 | Ga0068867_100003400 | 3300005459 | Bacteria | 11202 |
| 149 | Ga0068867_100153250 | 3300005459 | Bacteria | 1812 |
| 150 | Ga0070685_10003074 | 3300005466 | Bacteria | 8501 |
| 151 | Ga0070685_10009678 | 3300005466 | Bacteria | 4989 |
| 152 | Ga0070685_10010142 | 3300005466 | Unclassified | 4890 |
| 153 | Ga0070685_10019938 | 3300005466 | Bacteria | 3625 |
| 154 | Ga0070685_10082528 | 3300005466 | Unclassified | 1929 |
| 155 | Ga0070685_10121100 | 3300005466 | Bacteria | 1625 |
| 156 | Ga0070698_100001150 | 3300005471 | Bacteria | 29264 |
| 157 | Ga0070698_100030021 | 3300005471 | Bacteria | 5641 |
| 158 | Ga0070698_100215269 | 3300005471 | Bacteria | 1855 |
| 159 | Ga0070679_100003309 | 3300005530 | Bacteria | 14759 |
| 160 | Ga0070679_100026672 | 3300005530 | Bacteria | 5681 |
| 161 | Ga0070684_100001198 | 3300005535 | Bacteria | 18634 |
| 162 | Ga0070684_100133051 | 3300005535 | Bacteria | 2244 |
| 163 | Ga0068853_100002569 | 3300005539 | Bacteria | 13648 |
| 164 | Ga0068853_100003735 | 3300005539 | Bacteria | 11682 |
| 165 | Ga0068853_100020432 | 3300005539 | Bacteria | 5507 |
| 166 | Ga0068853_100023090 | 3300005539 | Bacteria | 5205 |
| 167 | Ga0068853_100026222 | 3300005539 | Bacteria | 4893 |
| 168 | Ga0068853_100030039 | 3300005539 | Bacteria | 4587 |
| 169 | Ga0068853_100062999 | 3300005539 | Bacteria | 3211 |
| 170 | Ga0068853_100080274 | 3300005539 | Bacteria | 2854 |
| 171 | Ga0070672_100000105 | 3300005543 | Bacteria | 41868 |
| 172 | Ga0070672_100014464 | 3300005543 | Bacteria | 5593 |
| 173 | Ga0070672_100025639 | 3300005543 | Bacteria | 4376 |
| 174 | Ga0070672_100062300 | 3300005543 | Unclassified | 2943 |
| 175 | Ga0070672_100122499 | 3300005543 | Unclassified | 2130 |
| 176 | Ga0070672_100162466 | 3300005543 | Bacteria | 1854 |
| 177 | Ga0070672_100255296 | 3300005543 | Bacteria | 1477 |
| 178 | Ga0070686_100001965 | 3300005544 | Bacteria | 11413 |
| 179 | Ga0070686_100056093 | 3300005544 | Unclassified | 2526 |
| 180 | Ga0070693_100004189 | 3300005547 | Bacteria | 6810 |
| 181 | Ga0070665_100000635 | 3300005548 | Bacteria | 47836 |
| 182 | Ga0070665_100004161 | 3300005548 | Bacteria | 15222 |
| 183 | Ga0070665_100060341 | 3300005548 | Bacteria | 3802 |
| 184 | Ga0070665_100098265 | 3300005548 | Bacteria | 2932 |
| 185 | Ga0068855_100007383 | 3300005563 | Bacteria | 13306 |
| 186 | Ga0068855_100031575 | 3300005563 | Bacteria | 6325 |
| 187 | Ga0068855_100040115 | 3300005563 | Bacteria | 5558 |
| 188 | Ga0068855_100234011 | 3300005563 | Unclassified | 2055 |
| 189 | Ga0068855_100252882 | 3300005563 | Bacteria | 1965 |
| 190 | Ga0068855_100396239 | 3300005563 | Bacteria | 1514 |
| 191 | Ga0068855_100440388 | 3300005563 | Bacteria | 1423 |
| 192 | Ga0070664_100001670 | 3300005564 | Bacteria | 17755 |
| 193 | Ga0070664_100006530 | 3300005564 | Bacteria | 9403 |
| 194 | Ga0070664_100035871 | 3300005564 | Bacteria | 4164 |
| 195 | Ga0070664_100055517 | 3300005564 | Bacteria | 3363 |
| 196 | Ga0070664_100224819 | 3300005564 | Bacteria | 1680 |
| 197 | Ga0068857_100007841 | 3300005577 | Bacteria | 9207 |
| 198 | Ga0068857_100011785 | 3300005577 | Bacteria | 7604 |
| 199 | Ga0068857_100022154 | 3300005577 | Bacteria | 5590 |
| 200 | Ga0068857_100025313 | 3300005577 | Bacteria | 5226 |
| 201 | Ga0068857_100072692 | 3300005577 | Bacteria | 3064 |
| 202 | Ga0068854_100112571 | 3300005578 | Unclassified | 2055 |
| 203 | Ga0068854_100207329 | 3300005578 | Bacteria | 1544 |
| 204 | Ga0068856_100011695 | 3300005614 | Bacteria | 8514 |
| 205 | Ga0068856_100099440 | 3300005614 | Unclassified | 2900 |
| 206 | Ga0070702_100164966 | 3300005615 | Unclassified | 1435 |
| 207 | Ga0068852_100000346 | 3300005616 | Bacteria | 31188 |
| 208 | Ga0068852_100000848 | 3300005616 | Bacteria | 20294 |
| 209 | Ga0068852_100005012 | 3300005616 | Bacteria | 9417 |
| 210 | Ga0068852_100031520 | 3300005616 | Bacteria | 4376 |
| 211 | Ga0068852_100043934 | 3300005616 | Bacteria | 3792 |
| 212 | Ga0068852_100262701 | 3300005616 | Bacteria | 1658 |
| 213 | Ga0068852_100446640 | 3300005616 | Bacteria | 1279 |
| 214 | Ga0068859_100000045 | 3300005617 | Bacteria | 143607 |
| 215 | Ga0068859_100017677 | 3300005617 | Bacteria | 7169 |
| 216 | Ga0068859_100026115 | 3300005617 | Bacteria | 5858 |
| 217 | Ga0068859_100051384 | 3300005617 | Bacteria | 4143 |
| 218 | Ga0068859_100076568 | 3300005617 | Bacteria | 3386 |
| 219 | Ga0068859_100102372 | 3300005617 | Unclassified | 2921 |
| 220 | Ga0068859_100104773 | 3300005617 | Bacteria | 2888 |
| 221 | Ga0068859_100343363 | 3300005617 | Bacteria | 1587 |
| 222 | Ga0068859_100348617 | 3300005617 | Bacteria | 1575 |
| 223 | Ga0068864_100001254 | 3300005618 | Bacteria | 21079 |
| 224 | Ga0068864_100001485 | 3300005618 | Bacteria | 19316 |
| 225 | Ga0068864_100062304 | 3300005618 | Bacteria | 3232 |
| 226 | Ga0068864_100139884 | 3300005618 | Bacteria | 2183 |
| 227 | Ga0068864_100141100 | 3300005618 | Unclassified | 2173 |
| 228 | Ga0068864_100200204 | 3300005618 | Bacteria | 1834 |
| 229 | Ga0068866_10035912 | 3300005718 | Bacteria | 2424 |
| 230 | Ga0068866_10064506 | 3300005718 | Bacteria | 1913 |
| 231 | Ga0068861_100004748 | 3300005719 | Bacteria | 9135 |
| 232 | Ga0068861_100005264 | 3300005719 | Bacteria | 8722 |
| 233 | Ga0068861_100007098 | 3300005719 | Bacteria | 7665 |
| 234 | Ga0068861_100024725 | 3300005719 | Bacteria | 4347 |
| 235 | Ga0068861_100126447 | 3300005719 | Bacteria | 2069 |
| 236 | Ga0068861_100240458 | 3300005719 | Bacteria | 1540 |
| 237 | Ga0068851_10019459 | 3300005834 | Bacteria | 3281 |
| 238 | Ga0068851_10058875 | 3300005834 | Bacteria | 1964 |
| 239 | Ga0068851_10069680 | 3300005834 | Unclassified | 1817 |
| 240 | Ga0068870_10006462 | 3300005840 | Bacteria | 5170 |
| 241 | Ga0068870_10012943 | 3300005840 | Bacteria | 3909 |
| 242 | Ga0068870_10142548 | 3300005840 | Bacteria | 1403 |
| 243 | Ga0068863_100001976 | 3300005841 | Bacteria | 20394 |
| 244 | Ga0068863_100002352 | 3300005841 | Bacteria | 18798 |
| 245 | Ga0068863_100006695 | 3300005841 | Bacteria | 11308 |
| 246 | Ga0068863_100028179 | 3300005841 | Bacteria | 5362 |
| 247 | Ga0068863_100060096 | 3300005841 | Bacteria | 3595 |
| 248 | Ga0068863_100094977 | 3300005841 | Unclassified | 2830 |
| 249 | Ga0068863_100379847 | 3300005841 | Bacteria | 1379 |
| 250 | Ga0068858_100003543 | 3300005842 | Bacteria | 15456 |
| 251 | Ga0068858_100010584 | 3300005842 | Bacteria | 8734 |
| 252 | Ga0068858_100360129 | 3300005842 | Bacteria | 1394 |
| 253 | Ga0068860_100001418 | 3300005843 | Bacteria | 25953 |
| 254 | Ga0068860_100003309 | 3300005843 | Bacteria | 16586 |
| 255 | Ga0068860_100003540 | 3300005843 | Bacteria | 16061 |
| 256 | Ga0068860_100019177 | 3300005843 | Bacteria | 6639 |
| 257 | Ga0068860_100084371 | 3300005843 | Bacteria | 3022 |
| 258 | Ga0068860_100155788 | 3300005843 | Unclassified | 2201 |
| 259 | Ga0068860_100210957 | 3300005843 | Bacteria | 1884 |
| 260 | Ga0068860_100277314 | 3300005843 | Unclassified | 1638 |
| 261 | Ga0081539_10000338 | 3300005985 | Bacteria | 103849 |
| 262 | Ga0070715_10007211 | 3300006163 | Unclassified | 3820 |
| 263 | Ga0075366_10000019 | 3300006195 | Bacteria | 59333 |
| 264 | Ga0075366_10003888 | 3300006195 | Bacteria | 7964 |
| 265 | Ga0097621_100000499 | 3300006237 | Bacteria | 27492 |
| 266 | Ga0097621_100001817 | 3300006237 | Bacteria | 14674 |
| 267 | Ga0097621_100011606 | 3300006237 | Bacteria | 6494 |
| 268 | Ga0097621_100093297 | 3300006237 | Bacteria | 2522 |
| 269 | Ga0097621_100109682 | 3300006237 | Unclassified | 2331 |
| 270 | Ga0097621_100145495 | 3300006237 | Unclassified | 2029 |
| 271 | Ga0097621_100202856 | 3300006237 | Bacteria | 1722 |
| 272 | Ga0097621_100364436 | 3300006237 | Bacteria | 1288 |
| 273 | Ga0068871_100002567 | 3300006358 | Bacteria | 12404 |
| 274 | Ga0068871_100035949 | 3300006358 | Bacteria | 3940 |
| 275 | Ga0068871_100045193 | 3300006358 | Unclassified | 3544 |
| 276 | Ga0068871_100052861 | 3300006358 | Bacteria | 3291 |
| 277 | Ga0068871_100190333 | 3300006358 | Bacteria | 1767 |
| 278 | Ga0075428_100023898 | 3300006844 | Bacteria | 6763 |
| 279 | Ga0075428_100032712 | 3300006844 | Bacteria | 5743 |
| 280 | Ga0075430_100148523 | 3300006846 | Bacteria | 1952 |
| 281 | Ga0075431_100060606 | 3300006847 | Unclassified | 3904 |
| 282 | Ga0075434_100009056 | 3300006871 | Bacteria | 9272 |
| 283 | Ga0075429_100018515 | 3300006880 | Bacteria | 6031 |
| 284 | Ga0068865_100001094 | 3300006881 | Bacteria | 15637 |
| 285 | Ga0068865_100013971 | 3300006881 | Bacteria | 5094 |
| 286 | Ga0068865_100016931 | 3300006881 | Bacteria | 4677 |
| 287 | Ga0097620_100000045 | 3300006931 | Bacteria | 143607 |
| 288 | Ga0097620_100017677 | 3300006931 | Bacteria | 7169 |
| 289 | Ga0097620_100026115 | 3300006931 | Bacteria | 5858 |
| 290 | Ga0097620_100051384 | 3300006931 | Bacteria | 4143 |
| 291 | Ga0097620_100076565 | 3300006931 | Bacteria | 3386 |
| 292 | Ga0097620_100102381 | 3300006931 | Unclassified | 2921 |
| 293 | Ga0097620_100104767 | 3300006931 | Bacteria | 2888 |
| 294 | Ga0097620_100343394 | 3300006931 | Bacteria | 1587 |
| 295 | Ga0097620_100348632 | 3300006931 | Bacteria | 1575 |
| 296 | Ga0105240_10009860 | 3300009093 | Bacteria | 13483 |
| 297 | Ga0105240_10279853 | 3300009093 | Bacteria | 1917 |
| 298 | Ga0105240_10328934 | 3300009093 | Unclassified | 1739 |
| 299 | Ga0111539_10003835 | 3300009094 | Bacteria | 19797 |
| 300 | Ga0111539_10019523 | 3300009094 | Bacteria | 8363 |
| 301 | Ga0111539_10023564 | 3300009094 | Bacteria | 7564 |
| 302 | Ga0111539_10345894 | 3300009094 | Bacteria | 1731 |
| 303 | Ga0111539_10468252 | 3300009094 | Bacteria | 1467 |
| 304 | Ga0105245_10045188 | 3300009098 | Bacteria | 3932 |
| 305 | Ga0105247_10003492 | 3300009101 | Bacteria | 10227 |
| 306 | Ga0105247_10003520 | 3300009101 | Bacteria | 10181 |
| 307 | Ga0114129_10052288 | 3300009147 | Bacteria | 5733 |
| 308 | Ga0114129_10082403 | 3300009147 | Bacteria | 4470 |
| 309 | Ga0105241_10000985 | 3300009174 | Bacteria | 21588 |
| 310 | Ga0105241_10001733 | 3300009174 | Bacteria | 16555 |
| 311 | Ga0105241_10038447 | 3300009174 | Bacteria | 3607 |
| 312 | Ga0105241_10042560 | 3300009174 | Bacteria | 3437 |
| 313 | Ga0105242_10010544 | 3300009176 | Bacteria | 7096 |
| 314 | Ga0105242_10023228 | 3300009176 | Bacteria | 4888 |
| 315 | Ga0105242_10042593 | 3300009176 | Bacteria | 3667 |
| 316 | Ga0105242_10068614 | 3300009176 | Bacteria | 2934 |
| 317 | Ga0105242_10083795 | 3300009176 | Bacteria | 2670 |
| 318 | Ga0105248_10022859 | 3300009177 | Bacteria | 6942 |
| 319 | Ga0105248_10038321 | 3300009177 | Bacteria | 5364 |
| 320 | Ga0105237_10005841 | 3300009545 | Bacteria | 13809 |
| 321 | Ga0105237_10031028 | 3300009545 | Bacteria | 5421 |
| 322 | Ga0105237_10038920 | 3300009545 | Bacteria | 4802 |
| 323 | Ga0105238_10283215 | 3300009551 | Bacteria | 1639 |
| 324 | Ga0105249_10004538 | 3300009553 | Bacteria | 12003 |
| 325 | Ga0105249_10011505 | 3300009553 | Bacteria | 7773 |
| 326 | Ga0105249_10011753 | 3300009553 | Bacteria | 7697 |
| 327 | Ga0105249_10011841 | 3300009553 | Bacteria | 7667 |
| 328 | Ga0105249_10019342 | 3300009553 | Bacteria | 6074 |
| 329 | Ga0105249_10020335 | 3300009553 | Bacteria | 5936 |
| 330 | Ga0105249_10020437 | 3300009553 | Bacteria | 5919 |
| 331 | Ga0105249_10028339 | 3300009553 | Bacteria | 5055 |
| 332 | Ga0105249_10028806 | 3300009553 | Bacteria | 5013 |
| 333 | Ga0105249_10055784 | 3300009553 | Unclassified | 3616 |
| 334 | Ga0105249_10089921 | 3300009553 | Bacteria | 2870 |
| 335 | Ga0105249_10180151 | 3300009553 | Bacteria | 2055 |
| 336 | Ga0105249_10286489 | 3300009553 | Bacteria | 1647 |
| 337 | Ga0105239_10000912 | 3300010375 | Bacteria | 41956 |
| 338 | Ga0105239_10026168 | 3300010375 | Bacteria | 6422 |
| 339 | Ga0105239_10034551 | 3300010375 | Bacteria | 5552 |
| 340 | Ga0105239_10073498 | 3300010375 | Bacteria | 3759 |
| 341 | Ga0105239_10119273 | 3300010375 | Unclassified | 2928 |
| 342 | Ga0105246_10029025 | 3300011119 | Bacteria | 3638 |
| 343 | Ga0157373_10005810 | 3300013100 | Bacteria | 9235 |
| 344 | Ga0157373_10014805 | 3300013100 | Bacteria | 5714 |
| 345 | Ga0157373_10017113 | 3300013100 | Bacteria | 5279 |
| 346 | Ga0157373_10033068 | 3300013100 | Bacteria | 3722 |
| 347 | Ga0157371_10000284 | 3300013102 | Bacteria | 68549 |
| 348 | Ga0157371_10000725 | 3300013102 | Bacteria | 38633 |
| 349 | Ga0157371_10002541 | 3300013102 | Bacteria | 17330 |
| 350 | Ga0157371_10006439 | 3300013102 | Bacteria | 9687 |
| 351 | Ga0157371_10015828 | 3300013102 | Bacteria | 5642 |
| 352 | Ga0157371_10018851 | 3300013102 | Bacteria | 5097 |
| 353 | Ga0157371_10020967 | 3300013102 | Bacteria | 4804 |
| 354 | Ga0157371_10033620 | 3300013102 | Bacteria | 3683 |
| 355 | Ga0157371_10045630 | 3300013102 | Bacteria | 3118 |
| 356 | Ga0157371_10091942 | 3300013102 | Unclassified | 2149 |
| 357 | Ga0157371_10126626 | 3300013102 | Unclassified | 1817 |
| 358 | Ga0157371_10146305 | 3300013102 | Bacteria | 1684 |
| 359 | Ga0157370_10001924 | 3300013104 | Bacteria | 25541 |
| 360 | Ga0157370_10004751 | 3300013104 | Bacteria | 15462 |
| 361 | Ga0157370_10021147 | 3300013104 | Bacteria | 6488 |
| 362 | Ga0157370_10025275 | 3300013104 | Bacteria | 5879 |
| 363 | Ga0157370_10157833 | 3300013104 | Bacteria | 2110 |
| 364 | Ga0157369_10000101 | 3300013105 | Bacteria | 118683 |
| 365 | Ga0157369_10020421 | 3300013105 | Bacteria | 7403 |
| 366 | Ga0157369_10198558 | 3300013105 | Bacteria | 2106 |
| 367 | Ga0157369_10261390 | 3300013105 | Bacteria | 1805 |
| 368 | Ga0157374_10000025 | 3300013296 | Bacteria | 245131 |
| 369 | Ga0157374_10000260 | 3300013296 | Bacteria | 48732 |
| 370 | Ga0157374_10002980 | 3300013296 | Bacteria | 14179 |
| 371 | Ga0157374_10020690 | 3300013296 | Bacteria | 5842 |
| 372 | Ga0157374_10027083 | 3300013296 | Bacteria | 5166 |
| 373 | Ga0157374_10043533 | 3300013296 | Bacteria | 4148 |
| 374 | Ga0157374_10165320 | 3300013296 | Bacteria | 2156 |
| 375 | Ga0157374_10264534 | 3300013296 | Unclassified | 1695 |
| 376 | Ga0157378_10003039 | 3300013297 | Bacteria | 14913 |
| 377 | Ga0157378_10013251 | 3300013297 | Bacteria | 7209 |
| 378 | Ga0157378_10014666 | 3300013297 | Bacteria | 6863 |
| 379 | Ga0157378_10023246 | 3300013297 | Bacteria | 5455 |
| 380 | Ga0157378_10023750 | 3300013297 | Bacteria | 5394 |
| 381 | Ga0157378_10136186 | 3300013297 | Bacteria | 2277 |
| 382 | Ga0157378_10147537 | 3300013297 | Bacteria | 2189 |
| 383 | Ga0157378_10208511 | 3300013297 | Bacteria | 1852 |
| 384 | Ga0163162_10000312 | 3300013306 | Bacteria | 45022 |
| 385 | Ga0163162_10001523 | 3300013306 | Bacteria | 21599 |
| 386 | Ga0163162_10002647 | 3300013306 | Bacteria | 16974 |
| 387 | Ga0163162_10004060 | 3300013306 | Bacteria | 14047 |
| 388 | Ga0163162_10004258 | 3300013306 | Bacteria | 13763 |
| 389 | Ga0163162_10007829 | 3300013306 | Bacteria | 10415 |
| 390 | Ga0163162_10010039 | 3300013306 | Bacteria | 9207 |
| 391 | Ga0163162_10022439 | 3300013306 | Bacteria | 6218 |
| 392 | Ga0163162_10027004 | 3300013306 | Bacteria | 5677 |
| 393 | Ga0163162_10069905 | 3300013306 | Unclassified | 3563 |
| 394 | Ga0163162_10076787 | 3300013306 | Unclassified | 3403 |
| 395 | Ga0163162_10179217 | 3300013306 | Unclassified | 2245 |
| 396 | Ga0163162_10241612 | 3300013306 | Bacteria | 1937 |
| 397 | Ga0163162_10317583 | 3300013306 | Unclassified | 1690 |
| 398 | Ga0157372_10000041 | 3300013307 | Bacteria | 158494 |
| 399 | Ga0157372_10004075 | 3300013307 | Bacteria | 15665 |
| 400 | Ga0157372_10009342 | 3300013307 | Bacteria | 10434 |
| 401 | Ga0157372_10018758 | 3300013307 | Bacteria | 7443 |
| 402 | Ga0157372_10023974 | 3300013307 | Bacteria | 6620 |
| 403 | Ga0157372_10025872 | 3300013307 | Bacteria | 6382 |
| 404 | Ga0157372_10038600 | 3300013307 | Bacteria | 5270 |
| 405 | Ga0157372_10091463 | 3300013307 | Bacteria | 3460 |
| 406 | Ga0157372_10154083 | 3300013307 | Bacteria | 2654 |
| 407 | Ga0157372_10233398 | 3300013307 | Bacteria | 2133 |
| 408 | Ga0157372_10254266 | 3300013307 | Bacteria | 2040 |
| 409 | Ga0157372_10336238 | 3300013307 | Bacteria | 1759 |
| 410 | Ga0157372_10338989 | 3300013307 | Unclassified | 1751 |
| 411 | Ga0157372_10432189 | 3300013307 | Unclassified | 1535 |
| 412 | Ga0157375_10000686 | 3300013308 | Bacteria | 29989 |
| 413 | Ga0157375_10002871 | 3300013308 | Bacteria | 14932 |
| 414 | Ga0157375_10010009 | 3300013308 | Bacteria | 8337 |
| 415 | Ga0157375_10027553 | 3300013308 | Bacteria | 5312 |
| 416 | Ga0157375_10048720 | 3300013308 | Unclassified | 4146 |
| 417 | Ga0157375_10068834 | 3300013308 | Bacteria | 3543 |
| 418 | Ga0157375_10167958 | 3300013308 | Unclassified | 2340 |
| 419 | Ga0157375_10172169 | 3300013308 | Unclassified | 2313 |
| 420 | Ga0157375_10220697 | 3300013308 | Bacteria | 2054 |
| 421 | Ga0157375_10237935 | 3300013308 | Bacteria | 1980 |
| 422 | Ga0157375_10382797 | 3300013308 | Bacteria | 1573 |
| 423 | Ga0163163_10000279 | 3300014325 | Bacteria | 50882 |
| 424 | Ga0163163_10000344 | 3300014325 | Bacteria | 44689 |
| 425 | Ga0163163_10000346 | 3300014325 | Bacteria | 44619 |
| 426 | Ga0163163_10012583 | 3300014325 | Bacteria | 7718 |
| 427 | Ga0157380_10003974 | 3300014326 | Bacteria | 10206 |
| 428 | Ga0157380_10017475 | 3300014326 | Bacteria | 5307 |
| 429 | Ga0157380_10093099 | 3300014326 | Bacteria | 2492 |
| 430 | Ga0157380_10144080 | 3300014326 | Unclassified | 2051 |
| 431 | Ga0157380_10198731 | 3300014326 | Bacteria | 1777 |
| 432 | Ga0157380_10408648 | 3300014326 | Bacteria | 1290 |
| 433 | Ga0157377_10001633 | 3300014745 | Bacteria | 9771 |
| 434 | Ga0157377_10007473 | 3300014745 | Bacteria | 5280 |
| 435 | Ga0157377_10008716 | 3300014745 | Bacteria | 4957 |
| 436 | Ga0157377_10076132 | 3300014745 | Bacteria | 1951 |
| 437 | Ga0157377_10087828 | 3300014745 | Bacteria | 1830 |
| 438 | Ga0157377_10162705 | 3300014745 | Unclassified | 1389 |
| 439 | Ga0157379_10000242 | 3300014968 | Bacteria | 42795 |
| 440 | Ga0157379_10011127 | 3300014968 | Bacteria | 7844 |
| 441 | Ga0157379_10116865 | 3300014968 | Unclassified | 2399 |
| 442 | Ga0157379_10119903 | 3300014968 | Unclassified | 2366 |
| 443 | Ga0157379_10121227 | 3300014968 | Bacteria | 2352 |
| 444 | Ga0157379_10342037 | 3300014968 | Bacteria | 1368 |
| 445 | Ga0157376_10001139 | 3300014969 | Bacteria | 17447 |
| 446 | Ga0157376_10002821 | 3300014969 | Bacteria | 11880 |
| 447 | Ga0157376_10004535 | 3300014969 | Bacteria | 9671 |
| 448 | Ga0157376_10007029 | 3300014969 | Bacteria | 7989 |
| 449 | Ga0157376_10053690 | 3300014969 | Unclassified | 3356 |
| 450 | Ga0157376_10058402 | 3300014969 | Bacteria | 3231 |
| 451 | Ga0157376_10062238 | 3300014969 | Bacteria | 3140 |
| 452 | Ga0157376_10092562 | 3300014969 | Unclassified | 2621 |
| 453 | Ga0157376_10242124 | 3300014969 | Bacteria | 1681 |
| 454 | Ga0163161_10005088 | 3300017792 | Bacteria | 9153 |
| 455 | Ga0163161_10006224 | 3300017792 | Bacteria | 8270 |
| 456 | Ga0163161_10014267 | 3300017792 | Bacteria | 5533 |
| 457 | Ga0163161_10018549 | 3300017792 | Bacteria | 4875 |
| 458 | Ga0163161_10045337 | 3300017792 | Bacteria | 3170 |
| 459 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 460 | Ga0209646_1000009 | 3300025246 | Bacteria | 652154 |
| 461 | Ga0209026_1000396 | 3300025250 | Bacteria | 38774 |
| 462 | Ga0209129_1018752 | 3300025258 | Bacteria | 1323 |
| 463 | Ga0209673_1000016 | 3300025273 | Bacteria | 506202 |
| 464 | Ga0209564_1004934 | 3300025295 | Bacteria | 7886 |
| 465 | Ga0209564_1027372 | 3300025295 | Unclassified | 1853 |
| 466 | Ga0209758_1010285 | 3300025297 | Bacteria | 5627 |
| 467 | Ga0209758_1020363 | 3300025297 | Unclassified | 3142 |
| 468 | Ga0209050_1000124 | 3300025298 | Bacteria | 194022 |
| 469 | Ga0207426_1000339 | 3300025302 | Bacteria | 87978 |
| 470 | Ga0207426_1000520 | 3300025302 | Bacteria | 56091 |
| 471 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 472 | Ga0209257_1000658 | 3300025304 | Bacteria | 54552 |
| 473 | Ga0207656_10056650 | 3300025321 | Unclassified | 1709 |
| 474 | Ga0207682_10086308 | 3300025893 | Bacteria | 1353 |
| 475 | Ga0207710_10002713 | 3300025900 | Bacteria | 8106 |
| 476 | Ga0207710_10014697 | 3300025900 | Bacteria | 3304 |
| 477 | Ga0207688_10043312 | 3300025901 | Bacteria | 2506 |
| 478 | Ga0207680_10000141 | 3300025903 | Bacteria | 34433 |
| 479 | Ga0207680_10003927 | 3300025903 | Bacteria | 7016 |
| 480 | Ga0207647_10000017 | 3300025904 | Bacteria | 129999 |
| 481 | Ga0207647_10001876 | 3300025904 | Bacteria | 16095 |
| 482 | Ga0207647_10061601 | 3300025904 | Bacteria | 2288 |
| 483 | Ga0207645_10001794 | 3300025907 | Bacteria | 17325 |
| 484 | Ga0207645_10019981 | 3300025907 | Unclassified | 4384 |
| 485 | Ga0207645_10085980 | 3300025907 | Bacteria | 2020 |
| 486 | Ga0207643_10009744 | 3300025908 | Bacteria | 5155 |
| 487 | Ga0207643_10011999 | 3300025908 | Bacteria | 4679 |
| 488 | Ga0207643_10030872 | 3300025908 | Unclassified | 2985 |
| 489 | Ga0207705_10011048 | 3300025909 | Bacteria | 6547 |
| 490 | Ga0207705_10012513 | 3300025909 | Bacteria | 6127 |
| 491 | Ga0207705_10017600 | 3300025909 | Bacteria | 5114 |
| 492 | Ga0207654_10003695 | 3300025911 | Bacteria | 7718 |
| 493 | Ga0207654_10006489 | 3300025911 | Bacteria | 5888 |
| 494 | Ga0207654_10026732 | 3300025911 | Unclassified | 3129 |
| 495 | Ga0207654_10051192 | 3300025911 | Unclassified | 2376 |
| 496 | Ga0207707_10003504 | 3300025912 | Bacteria | 13893 |
| 497 | Ga0207707_10069683 | 3300025912 | Bacteria | 3065 |
| 498 | Ga0207707_10121299 | 3300025912 | Bacteria | 2286 |
| 499 | Ga0207695_10004070 | 3300025913 | Bacteria | 20110 |
| 500 | Ga0207695_10186606 | 3300025913 | Bacteria | 1992 |
| 501 | Ga0207671_10009957 | 3300025914 | Bacteria | 7899 |
| 502 | Ga0207671_10022002 | 3300025914 | Bacteria | 4829 |
| 503 | Ga0207671_10026640 | 3300025914 | Bacteria | 4329 |
| 504 | Ga0207660_10005510 | 3300025917 | Bacteria | 8222 |
| 505 | Ga0207660_10138805 | 3300025917 | Bacteria | 1857 |
| 506 | Ga0207660_10303350 | 3300025917 | Bacteria | 1272 |
| 507 | Ga0207662_10021541 | 3300025918 | Bacteria | 3686 |
| 508 | Ga0207657_10009181 | 3300025919 | Bacteria | 9972 |
| 509 | Ga0207657_10018805 | 3300025919 | Bacteria | 6580 |
| 510 | Ga0207657_10023896 | 3300025919 | Bacteria | 5676 |
| 511 | Ga0207657_10084500 | 3300025919 | Unclassified | 2660 |
| 512 | Ga0207649_10061049 | 3300025920 | Bacteria | 2371 |
| 513 | Ga0207652_10000045 | 3300025921 | Bacteria | 125343 |
| 514 | Ga0207652_10000819 | 3300025921 | Bacteria | 29643 |
| 515 | Ga0207652_10008710 | 3300025921 | Bacteria | 8165 |
| 516 | Ga0207652_10016246 | 3300025921 | Bacteria | 6073 |
| 517 | Ga0207681_10001974 | 3300025923 | Bacteria | 13164 |
| 518 | Ga0207681_10216315 | 3300025923 | Bacteria | 1480 |
| 519 | Ga0207650_10002954 | 3300025925 | Bacteria | 11729 |
| 520 | Ga0207650_10024003 | 3300025925 | Unclassified | 4330 |
| 521 | Ga0207650_10046246 | 3300025925 | Bacteria | 3205 |
| 522 | Ga0207650_10071885 | 3300025925 | Bacteria | 2603 |
| 523 | Ga0207650_10128871 | 3300025925 | Bacteria | 1978 |
| 524 | Ga0207659_10156743 | 3300025926 | Unclassified | 1784 |
| 525 | Ga0207644_10008911 | 3300025931 | Bacteria | 6573 |
| 526 | Ga0207644_10051636 | 3300025931 | Unclassified | 2952 |
| 527 | Ga0207644_10194649 | 3300025931 | Bacteria | 1596 |
| 528 | Ga0207690_10005074 | 3300025932 | Bacteria | 7777 |
| 529 | Ga0207690_10011163 | 3300025932 | Bacteria | 5361 |
| 530 | Ga0207706_10003994 | 3300025933 | Bacteria | 13976 |
| 531 | Ga0207706_10007275 | 3300025933 | Bacteria | 10234 |
| 532 | Ga0207706_10031804 | 3300025933 | Bacteria | 4699 |
| 533 | Ga0207706_10069185 | 3300025933 | Bacteria | 3105 |
| 534 | Ga0207686_10024411 | 3300025934 | Bacteria | 3503 |
| 535 | Ga0207686_10094005 | 3300025934 | Unclassified | 1986 |
| 536 | Ga0207686_10100281 | 3300025934 | Unclassified | 1932 |
| 537 | Ga0207670_10006784 | 3300025936 | Bacteria | 6368 |
| 538 | Ga0207670_10013543 | 3300025936 | Bacteria | 4814 |
| 539 | Ga0207670_10018759 | 3300025936 | Bacteria | 4213 |
| 540 | Ga0207669_10044918 | 3300025937 | Bacteria | 2600 |
| 541 | Ga0207669_10099177 | 3300025937 | Bacteria | 1920 |
| 542 | Ga0207704_10009869 | 3300025938 | Bacteria | 4628 |
| 543 | Ga0207704_10082330 | 3300025938 | Bacteria | 2085 |
| 544 | Ga0207691_10000012 | 3300025940 | Bacteria | 147942 |
| 545 | Ga0207691_10004759 | 3300025940 | Bacteria | 13125 |
| 546 | Ga0207691_10025875 | 3300025940 | Bacteria | 5507 |
| 547 | Ga0207691_10039568 | 3300025940 | Bacteria | 4361 |
| 548 | Ga0207691_10049190 | 3300025940 | Unclassified | 3863 |
| 549 | Ga0207691_10158279 | 3300025940 | Bacteria | 1988 |
| 550 | Ga0207689_10008936 | 3300025942 | Bacteria | 8687 |
| 551 | Ga0207689_10008992 | 3300025942 | Bacteria | 8653 |
| 552 | Ga0207689_10017516 | 3300025942 | Bacteria | 6060 |
| 553 | Ga0207689_10018137 | 3300025942 | Bacteria | 5944 |
| 554 | Ga0207689_10029050 | 3300025942 | Unclassified | 4621 |
| 555 | Ga0207689_10044379 | 3300025942 | Bacteria | 3676 |
| 556 | Ga0207689_10063876 | 3300025942 | Unclassified | 3029 |
| 557 | Ga0207689_10072143 | 3300025942 | Bacteria | 2836 |
| 558 | Ga0207689_10092711 | 3300025942 | Unclassified | 2481 |
| 559 | Ga0207689_10190714 | 3300025942 | Bacteria | 1691 |
| 560 | Ga0207661_10003108 | 3300025944 | Bacteria | 11489 |
| 561 | Ga0207661_10034774 | 3300025944 | Bacteria | 3922 |
| 562 | Ga0207661_10110823 | 3300025944 | Bacteria | 2321 |
| 563 | Ga0207679_10004210 | 3300025945 | Bacteria | 8939 |
| 564 | Ga0207679_10012502 | 3300025945 | Bacteria | 5535 |
| 565 | Ga0207679_10017260 | 3300025945 | Unclassified | 4811 |
| 566 | Ga0207679_10124715 | 3300025945 | Bacteria | 2056 |
| 567 | Ga0207667_10016855 | 3300025949 | Bacteria | 8241 |
| 568 | Ga0207667_10026076 | 3300025949 | Bacteria | 6391 |
| 569 | Ga0207667_10033422 | 3300025949 | Bacteria | 5529 |
| 570 | Ga0207667_10034450 | 3300025949 | Bacteria | 5437 |
| 571 | Ga0207667_10038329 | 3300025949 | Bacteria | 5120 |
| 572 | Ga0207667_10073195 | 3300025949 | Bacteria | 3561 |
| 573 | Ga0207667_10247632 | 3300025949 | Bacteria | 1823 |
| 574 | Ga0207651_10000216 | 3300025960 | Bacteria | 24808 |
| 575 | Ga0207651_10005231 | 3300025960 | Bacteria | 6633 |
| 576 | Ga0207651_10191831 | 3300025960 | Bacteria | 1630 |
| 577 | Ga0207651_10232295 | 3300025960 | Bacteria | 1498 |
| 578 | Ga0207651_10306359 | 3300025960 | Bacteria | 1323 |
| 579 | Ga0207712_10000976 | 3300025961 | Bacteria | 20527 |
| 580 | Ga0207712_10007162 | 3300025961 | Bacteria | 7035 |
| 581 | Ga0207712_10010440 | 3300025961 | Bacteria | 5896 |
| 582 | Ga0207712_10022982 | 3300025961 | Bacteria | 4111 |
| 583 | Ga0207712_10025198 | 3300025961 | Bacteria | 3950 |
| 584 | Ga0207712_10039279 | 3300025961 | Unclassified | 3242 |
| 585 | Ga0207712_10071369 | 3300025961 | Bacteria | 2497 |
| 586 | Ga0207712_10148236 | 3300025961 | Bacteria | 1809 |
| 587 | Ga0207712_10234090 | 3300025961 | Unclassified | 1476 |
| 588 | Ga0207668_10001361 | 3300025972 | Bacteria | 14445 |
| 589 | Ga0207668_10085311 | 3300025972 | Bacteria | 2304 |
| 590 | Ga0207658_10000374 | 3300025986 | Bacteria | 43784 |
| 591 | Ga0207658_10008025 | 3300025986 | Bacteria | 7193 |
| 592 | Ga0207658_10011120 | 3300025986 | Bacteria | 6129 |
| 593 | Ga0207658_10011371 | 3300025986 | Bacteria | 6057 |
| 594 | Ga0207658_10113347 | 3300025986 | Bacteria | 2148 |
| 595 | Ga0207677_10000984 | 3300026023 | Bacteria | 15691 |
| 596 | Ga0207677_10006012 | 3300026023 | Bacteria | 6614 |
| 597 | Ga0207677_10018387 | 3300026023 | Unclassified | 4193 |
| 598 | Ga0207677_10116904 | 3300026023 | Bacteria | 1998 |
| 599 | Ga0207703_10009315 | 3300026035 | Bacteria | 7717 |
| 600 | Ga0207703_10019138 | 3300026035 | Bacteria | 5348 |
| 601 | Ga0207703_10079753 | 3300026035 | Unclassified | 2725 |
| 602 | Ga0207703_10275967 | 3300026035 | Bacteria | 1525 |
| 603 | Ga0207639_10016498 | 3300026041 | Bacteria | 5229 |
| 604 | Ga0207639_10021770 | 3300026041 | Bacteria | 4608 |
| 605 | Ga0207639_10029603 | 3300026041 | Bacteria | 4011 |
| 606 | Ga0207639_10032242 | 3300026041 | Unclassified | 3856 |
| 607 | Ga0207639_10066918 | 3300026041 | Bacteria | 2794 |
| 608 | Ga0207639_10066998 | 3300026041 | Bacteria | 2793 |
| 609 | Ga0207678_10013503 | 3300026067 | Bacteria | 7170 |
| 610 | Ga0207678_10031808 | 3300026067 | Unclassified | 4601 |
| 611 | Ga0207708_10034032 | 3300026075 | Unclassified | 3875 |
| 612 | Ga0207708_10051340 | 3300026075 | Bacteria | 3139 |
| 613 | Ga0207708_10105301 | 3300026075 | Unclassified | 2186 |
| 614 | Ga0207702_10026475 | 3300026078 | Bacteria | 4814 |
| 615 | Ga0207702_10091342 | 3300026078 | Bacteria | 2666 |
| 616 | Ga0207641_10000146 | 3300026088 | Bacteria | 100666 |
| 617 | Ga0207641_10000947 | 3300026088 | Bacteria | 29805 |
| 618 | Ga0207641_10007761 | 3300026088 | Bacteria | 8917 |
| 619 | Ga0207641_10040757 | 3300026088 | Unclassified | 3890 |
| 620 | Ga0207641_10073253 | 3300026088 | Bacteria | 2951 |
| 621 | Ga0207641_10104865 | 3300026088 | Unclassified | 2496 |
| 622 | Ga0207641_10110213 | 3300026088 | Bacteria | 2439 |
| 623 | Ga0207641_10184962 | 3300026088 | Bacteria | 1911 |
| 624 | Ga0207648_10001615 | 3300026089 | Bacteria | 24715 |
| 625 | Ga0207648_10010253 | 3300026089 | Bacteria | 8899 |
| 626 | Ga0207648_10018048 | 3300026089 | Bacteria | 6394 |
| 627 | Ga0207648_10020364 | 3300026089 | Bacteria | 5974 |
| 628 | Ga0207648_10048905 | 3300026089 | Bacteria | 3702 |
| 629 | Ga0207648_10056374 | 3300026089 | Bacteria | 3430 |
| 630 | Ga0207648_10064755 | 3300026089 | Bacteria | 3186 |
| 631 | Ga0207648_10122109 | 3300026089 | Bacteria | 2290 |
| 632 | Ga0207648_10173460 | 3300026089 | Bacteria | 1907 |
| 633 | Ga0207676_10000697 | 3300026095 | Bacteria | 26479 |
| 634 | Ga0207676_10003591 | 3300026095 | Bacteria | 10965 |
| 635 | Ga0207676_10005018 | 3300026095 | Bacteria | 9372 |
| 636 | Ga0207676_10077658 | 3300026095 | Unclassified | 2687 |
| 637 | Ga0207676_10111982 | 3300026095 | Bacteria | 2286 |
| 638 | Ga0207676_10202536 | 3300026095 | Bacteria | 1755 |
| 639 | Ga0207676_10257722 | 3300026095 | Bacteria | 1573 |
| 640 | Ga0207674_10004031 | 3300026116 | Bacteria | 17828 |
| 641 | Ga0207674_10010211 | 3300026116 | Bacteria | 10664 |
| 642 | Ga0207674_10014867 | 3300026116 | Bacteria | 8583 |
| 643 | Ga0207674_10033271 | 3300026116 | Bacteria | 5399 |
| 644 | Ga0207674_10070579 | 3300026116 | Bacteria | 3512 |
| 645 | Ga0207674_10095119 | 3300026116 | Bacteria | 2965 |
| 646 | Ga0207674_10271928 | 3300026116 | Bacteria | 1642 |
| 647 | Ga0207675_100001183 | 3300026118 | Bacteria | 25978 |
| 648 | Ga0207675_100005430 | 3300026118 | Bacteria | 12213 |
| 649 | Ga0207675_100034881 | 3300026118 | Bacteria | 4691 |
| 650 | Ga0207675_100139304 | 3300026118 | Bacteria | 2304 |
| 651 | Ga0207675_100219101 | 3300026118 | Bacteria | 1833 |
| 652 | Ga0207683_10000943 | 3300026121 | Bacteria | 26669 |
| 653 | Ga0207683_10017143 | 3300026121 | Bacteria | 6166 |
| 654 | Ga0207683_10020984 | 3300026121 | Bacteria | 5591 |
| 655 | Ga0207683_10025629 | 3300026121 | Bacteria | 5088 |
| 656 | Ga0207683_10070461 | 3300026121 | Unclassified | 3089 |
| 657 | Ga0207683_10138987 | 3300026121 | Bacteria | 2188 |
| 658 | Ga0207698_10003512 | 3300026142 | Bacteria | 9452 |
| 659 | Ga0207698_10009340 | 3300026142 | Bacteria | 6249 |
| 660 | Ga0207428_10006992 | 3300027907 | Bacteria | 10334 |
| 661 | Ga0207428_10012094 | 3300027907 | Bacteria | 7596 |
| 662 | Ga0268266_10005379 | 3300028379 | Bacteria | 11960 |
| 663 | Ga0268266_10019071 | 3300028379 | Bacteria | 5842 |
| 664 | Ga0268266_10035267 | 3300028379 | Unclassified | 4255 |
| 665 | Ga0268265_10009351 | 3300028380 | Bacteria | 6624 |
| 666 | Ga0268265_10011180 | 3300028380 | Bacteria | 6066 |
| 667 | Ga0268264_10003975 | 3300028381 | Bacteria | 12651 |
| 668 | Ga0268264_10006744 | 3300028381 | Bacteria | 9649 |
| 669 | Ga0268264_10008474 | 3300028381 | Bacteria | 8550 |
| 670 | Ga0268264_10046760 | 3300028381 | Unclassified | 3595 |
| 671 | Ga0268264_10050397 | 3300028381 | Bacteria | 3467 |
| 672 | Ga0268264_10102312 | 3300028381 | Unclassified | 2493 |
| 673 | Ga0307515_10000012 | 3300028794 | Bacteria | 582232 |
| 674 | Ga0307515_10000077 | 3300028794 | Bacteria | 228162 |
| 675 | Ga0307515_10012976 | 3300028794 | Bacteria | 15612 |
| 676 | Ga0307515_10063170 | 3300028794 | Bacteria | 5210 |
| 677 | Ga0307515_10078481 | 3300028794 | Bacteria | 4341 |
| 678 | Ga0265340_10086342 | 3300031247 | Unclassified | 1472 |
| 679 | Ga0265327_10000759 | 3300031251 | Bacteria | 50085 |
| 680 | Ga0307513_10235444 | 3300031456 | Bacteria | 1641 |
| 681 | Ga0307509_10020532 | 3300031507 | Bacteria | 7491 |
| 682 | Ga0307509_10083480 | 3300031507 | Bacteria | 3293 |
| 683 | Ga0307509_10205242 | 3300031507 | Unclassified | 1802 |
| 684 | Ga0307509_10221519 | 3300031507 | Unclassified | 1704 |
| 685 | Ga0307408_100000332 | 3300031548 | Bacteria | 45065 |
| 686 | Ga0307408_100000341 | 3300031548 | Bacteria | 43952 |
| 687 | Ga0307408_100000410 | 3300031548 | Bacteria | 38631 |
| 688 | Ga0307408_100016173 | 3300031548 | Unclassified | 4975 |
| 689 | Ga0307508_10001024 | 3300031616 | Bacteria | 32462 |
| 690 | Ga0307514_10051315 | 3300031649 | Bacteria | 3197 |
| 691 | Ga0307516_10243084 | 3300031730 | Bacteria | 1498 |
| 692 | Ga0307405_10005405 | 3300031731 | Bacteria | 6160 |
| 693 | Ga0307405_10112520 | 3300031731 | Bacteria | 1847 |
| 694 | Ga0307413_10008468 | 3300031824 | Bacteria | 4858 |
| 695 | Ga0307413_10156833 | 3300031824 | Bacteria | 1594 |
| 696 | Ga0307412_10012107 | 3300031911 | Bacteria | 5015 |
| 697 | Ga0307416_100032160 | 3300032002 | Unclassified | 3960 |
| 698 | Ga0307414_10000059 | 3300032004 | Bacteria | 112136 |
| 699 | Ga0307414_10018672 | 3300032004 | Unclassified | 4277 |
| 700 | Ga0307411_10106252 | 3300032005 | Unclassified | 1998 |
| 701 | Ga0307415_100117466 | 3300032126 | Bacteria | 1987 |
| 702 | Ga0307507_10000143 | 3300033179 | Bacteria | 124248 |
| 703 | Ga0373924_0022664 | 3300035410 | Unclassified | 2456 |
| 704 | Ga0373947_0055487 | 3300035725 | Unclassified | 2393 |
| 705 | Ga0373947_0062781 | 3300035725 | Bacteria | 2262 |
| 706 | Ga0373937_0006671 | 3300036401 | Bacteria | 9965 |
| 707 | Ga0373937_0214143 | 3300036401 | Bacteria | 1813 |
| 708 | Ga0373937_0338191 | 3300036401 | Bacteria | 1425 |
| 709 | Ga0395899_0000024 | 3300037312 | Bacteria | 357402 |
| 710 | Ga0395899_0008398 | 3300037312 | Bacteria | 7952 |
| 711 | Ga0395900_0008499 | 3300037418 | Bacteria | 10554 |
| 712 | Ga0395900_0126322 | 3300037418 | Bacteria | 2623 |
| 713 | Ga0395900_0222896 | 3300037418 | Bacteria | 1900 |
| 714 | Ga0395898_0003718 | 3300037466 | Bacteria | 16922 |
| 715 | Ga0395898_0013466 | 3300037466 | Bacteria | 8421 |
| 716 | Ga0395905_0009765 | 3300037471 | Bacteria | 9359 |
| 717 | Ga0395905_0306613 | 3300037471 | Bacteria | 1476 |
| 718 | Ga0395901_0005062 | 3300038443 | Bacteria | 13315 |
| 719 | Ga0395901_0012431 | 3300038443 | Bacteria | 8638 |
| 720 | Ga0395901_0045981 | 3300038443 | Bacteria | 4532 |
| 721 | Ga0436365_0603123 | 3300039437 | Bacteria | 11515 |
| 722 | Ga0439436_0007478 | 3300041404 | Bacteria | 3361 |
| 723 | Ga0439457_000930 | 3300042014 | Bacteria | 8796 |
| 724 | Ga0450898_000889 | 3300042134 | Bacteria | 3737 |
| 725 | Ga0439434_0009601 | 3300042435 | Bacteria | 2847 |
| 726 | Ga0451577_0005791 | 3300042876 | Bacteria | 12520 |
| 727 | Ga0451577_0249649 | 3300042876 | Bacteria | 1606 |
| 728 | Ga0466969_0000004 | 3300044656 | Bacteria | 168068 |
| 729 | Ga0466972_0000016 | 3300044658 | Bacteria | 208802 |
| 730 | Ga0466972_0000017 | 3300044658 | Bacteria | 199884 |
| 731 | Ga0466972_0015930 | 3300044658 | Bacteria | 3759 |
| 732 | Ga0453683_0005930 | 3300044673 | Bacteria | 8435 |
| 733 | Ga0466965_0068862 | 3300044683 | Bacteria | 1777 |
| 734 | Ga0466966_0000295 | 3300044684 | Bacteria | 32723 |
| 735 | Ga0466966_0087727 | 3300044684 | Bacteria | 1933 |
| 736 | Ga0466961_0002760 | 3300044693 | Bacteria | 10928 |
| 737 | Ga0466961_0014977 | 3300044693 | Unclassified | 4979 |
| 738 | Ga0453684_0001190 | 3300044712 | Bacteria | 80396 |
| 739 | Ga0466971_0011031 | 3300044719 | Unclassified | 3956 |
| 740 | Ga0466968_0002708 | 3300044735 | Bacteria | 6538 |
| 741 | Ga0466970_0003015 | 3300044765 | Bacteria | 8162 |
| 742 | Ga0466970_0055835 | 3300044765 | Bacteria | 2110 |
| 743 | Ga0466957_0000367 | 3300044842 | Bacteria | 22106 |
| 744 | Ga0466959_0000004 | 3300045049 | Bacteria | 216815 |
| 745 | Ga0466959_0000819 | 3300045049 | Bacteria | 18344 |
| 746 | Ga0451576_0029084 | 3300045051 | Bacteria | 5914 |
| 747 | Ga0466967_0204488 | 3300045976 | Unclassified | 1871 |
| 748 | Ga0495592_0049965 | 3300046454 | Unclassified | 3108 |
| 749 | Ga0495651_0024770 | 3300046462 | Bacteria | 4669 |
| 750 | Ga0495650_0000050 | 3300046471 | Bacteria | 318894 |
| 751 | Ga0495582_0041520 | 3300046473 | Bacteria | 2535 |
| 752 | Ga0495585_0001264 | 3300046492 | Bacteria | 20274 |
| 753 | Ga0495585_0002275 | 3300046492 | Bacteria | 13869 |
| 754 | Ga0495583_0009815 | 3300046506 | Bacteria | 5674 |
| 755 | Ga0495583_0061182 | 3300046506 | Unclassified | 1681 |
| 756 | Ga0495606_0000505 | 3300046507 | Bacteria | 63449 |
| 757 | Ga0495606_0005343 | 3300046507 | Bacteria | 12344 |
| 758 | Ga0495606_0018126 | 3300046507 | Bacteria | 5292 |
| 759 | Ga0495616_0000296 | 3300046513 | Bacteria | 40157 |
| 760 | Ga0495616_0015185 | 3300046513 | Bacteria | 4285 |
| 761 | Ga0495628_0022064 | 3300046516 | Bacteria | 5233 |
| 762 | Ga0495643_0031267 | 3300046522 | Unclassified | 2964 |
| 763 | Ga0495648_0052548 | 3300046524 | Bacteria | 2474 |
| 764 | Ga0495587_0025753 | 3300046536 | Bacteria | 3594 |
| 765 | Ga0495609_0085194 | 3300046538 | Bacteria | 1378 |
| 766 | Ga0495622_0041649 | 3300046557 | Bacteria | 2135 |
| 767 | Ga0495633_0000083 | 3300046558 | Bacteria | 125035 |
| 768 | Ga0495633_0003455 | 3300046558 | Bacteria | 10505 |
| 769 | Ga0495668_0000055 | 3300046616 | Bacteria | 199412 |
| 770 | Ga0495668_0001051 | 3300046616 | Bacteria | 29297 |
| 771 | Ga0495668_0001697 | 3300046616 | Bacteria | 20372 |
| 772 | Ga0495634_0030013 | 3300046642 | Bacteria | 3759 |
| 773 | Ga0495625_0000077 | 3300046660 | Bacteria | 163166 |
| 774 | Ga0495625_0001180 | 3300046660 | Bacteria | 33548 |
| 775 | Ga0495625_0001973 | 3300046660 | Bacteria | 23152 |
| 776 | Ga0495625_0012157 | 3300046660 | Bacteria | 6985 |
| 777 | Ga0495625_0016508 | 3300046660 | Bacteria | 5807 |
| 778 | Ga0495625_0043549 | 3300046660 | Unclassified | 3255 |
| 779 | Ga0495625_0064780 | 3300046660 | Bacteria | 2577 |
| 780 | Ga0495625_0067222 | 3300046660 | Bacteria | 2523 |
| 781 | Ga0495657_0059670 | 3300046675 | Unclassified | 2530 |
| 782 | Ga0495599_0152229 | 3300046678 | Unclassified | 1432 |
| 783 | Ga0495658_0015521 | 3300046683 | Bacteria | 3908 |
| 784 | Ga0495649_0000011 | 3300046694 | Bacteria | 416695 |
| 785 | Ga0495660_0028644 | 3300046810 | Bacteria | 3145 |
| 786 | Ga0495636_0000184 | 3300047318 | Bacteria | 24852 |
| 787 | Ga0495674_0034710 | 3300047319 | Unclassified | 4558 |
| 788 | Ga0495674_0223611 | 3300047319 | Unclassified | 1555 |
| 789 | Ga0495672_0014585 | 3300047320 | Bacteria | 5374 |
| 790 | Ga0495672_0031224 | 3300047320 | Bacteria | 3328 |
| 791 | Ga0495687_001849 | 3300047443 | Bacteria | 18503 |
| 792 | Ga0495684_0211125 | 3300047471 | Unclassified | 1427 |
| 793 | Ga0495686_0000541 | 3300047472 | Bacteria | 54075 |
| 794 | Ga0495686_0007680 | 3300047472 | Bacteria | 8052 |
| 795 | Ga0495686_0134383 | 3300047472 | Bacteria | 1464 |
| 796 | Ga0496102_0132636 | 3300048905 | Unclassified | 2333 |
| 797 | Ga0496109_0057555 | 3300048912 | Bacteria | 3549 |
| 798 | Ga0496114_0086210 | 3300048917 | Unclassified | 2661 |
| 799 | Ga0496114_0267206 | 3300048917 | Bacteria | 1507 |
| 800 | Ga0495678_005798 | 3300049459 | Bacteria | 6706 |
| 801 | Ga0501034_0000017 | 3300049571 | Bacteria | 285938 |
| 802 | Ga0501034_0037661 | 3300049571 | Bacteria | 4898 |
| 803 | Ga0501036_0180266 | 3300049572 | Bacteria | 1778 |
| 804 | Ga0501037_0052248 | 3300049573 | Bacteria | 2989 |
| 805 | Ga0501037_0138142 | 3300049573 | Bacteria | 1745 |
| 806 | Ga0501037_0231519 | 3300049573 | Bacteria | 1297 |
| 807 | Ga0501039_0029118 | 3300049575 | Bacteria | 4253 |
| 808 | Ga0501043_0003072 | 3300049579 | Bacteria | 13875 |
| 809 | Ga0501047_0010118 | 3300049581 | Bacteria | 8917 |
| 810 | Ga0501047_0015825 | 3300049581 | Bacteria | 7187 |
| 811 | Ga0501047_0085882 | 3300049581 | Unclassified | 3023 |
| 812 | Ga0501070_0246253 | 3300049586 | Bacteria | 1463 |
| 813 | Ga0501072_0101159 | 3300049588 | Bacteria | 2291 |
| 814 | Ga0501073_0123309 | 3300049589 | Bacteria | 1796 |
| 815 | Ga0501202_000471 | 3300049652 | Bacteria | 5744 |
| 816 | Ga0501217_001989 | 3300049661 | Unclassified | 3942 |
| 817 | Ga0501223_000325 | 3300049663 | Bacteria | 11849 |
| 818 | Ga0501257_019911 | 3300049686 | Bacteria | 1572 |
| 819 | Ga0501219_000159 | 3300049703 | Bacteria | 12350 |
| 820 | Ga0501035_0015963 | 3300049822 | Bacteria | 6931 |
| 821 | Ga0501044_0006478 | 3300049823 | Bacteria | 12931 |
| 822 | Ga0501044_0016594 | 3300049823 | Bacteria | 7904 |
| 823 | Ga0501044_0091409 | 3300049823 | Unclassified | 3070 |
| 824 | Ga0501044_0321461 | 3300049823 | Unclassified | 1472 |
| 825 | Ga0501212_006926 | 3300049851 | Bacteria | 1541 |
| 826 | Ga0501284_00018 | 3300050005 | Bacteria | 93729 |
| 827 | nmdc:mga0k408_101260_c1 | 3300050493 | Bacteria | 1698 |
| 828 | nmdc:mga0k408_14692_c1 | 3300050493 | Bacteria | 4319 |
| 829 | nmdc:mga0k408_30625_c1 | 3300050493 | Bacteria | 3068 |
| 830 | nmdc:mga0k408_3871_c1 | 3300050493 | Bacteria | 7933 |
| 831 | nmdc:mga0k408_44_c1 | 3300050493 | Bacteria | 32015 |
| 832 | nmdc:mga05p37_2793_c1 | 3300050507 | Bacteria | 20304 |
| 833 | nmdc:mga09592_28816_c1 | 3300050508 | Bacteria | 4616 |
| 834 | nmdc:mga0qj67_111525_c1 | 3300050509 | Unclassified | 2209 |
| 835 | nmdc:mga0qj67_136660_c1 | 3300050509 | Bacteria | 1986 |
| 836 | nmdc:mga06r32_81629_c1 | 3300050510 | Unclassified | 3149 |
| 837 | nmdc:mga08y16_1505_c1 | 3300050511 | Bacteria | 23452 |
| 838 | nmdc:mga08y16_449504_c1 | 3300050511 | Bacteria | 1314 |
| 839 | nmdc:mga08y16_80441_c1 | 3300050511 | Bacteria | 3397 |
| 840 | nmdc:mga08y16_88358_c1 | 3300050511 | Bacteria | 3230 |
| 841 | nmdc:mga0n895_10170_c1 | 3300050512 | Bacteria | 8285 |
| 842 | Ga0495619_0036987 | 3300053085 | Bacteria | 3180 |
| 843 | Ga0500578_0000037 | 3300053086 | Bacteria | 134901 |
| 844 | Ga0500578_0023352 | 3300053086 | Bacteria | 3971 |
| 845 | Ga0500646_0014285 | 3300053090 | Bacteria | 2060 |
| 846 | Ga0500583_0000068 | 3300053092 | Bacteria | 64748 |
| 847 | Ga0500583_0001499 | 3300053092 | Bacteria | 6719 |
| 848 | Ga0500594_0027888 | 3300053118 | Bacteria | 1465 |
| 849 | Ga0500608_005654 | 3300053122 | Bacteria | 4995 |
| 850 | Ga0500614_010366 | 3300053123 | Bacteria | 2001 |
| 851 | Ga0500618_000006 | 3300053125 | Bacteria | 239188 |
| 852 | Ga0500618_002095 | 3300053125 | Bacteria | 7929 |
| 853 | Ga0500652_005744 | 3300053131 | Bacteria | 3936 |
| 854 | Ga0500652_062495 | 3300053131 | Bacteria | 1535 |
| 855 | Ga0500568_0000429 | 3300053139 | Bacteria | 31597 |
| 856 | Ga0500573_0034974 | 3300053140 | Bacteria | 2898 |
| 857 | Ga0500588_0012568 | 3300053146 | Bacteria | 2103 |
| 858 | Ga0500604_0003205 | 3300053151 | Bacteria | 4398 |
| 859 | Ga0500604_0004013 | 3300053151 | Bacteria | 3927 |
| 860 | Ga0500616_0006698 | 3300053153 | Bacteria | 7477 |
| 861 | Ga0500616_0008154 | 3300053153 | Bacteria | 6542 |
| 862 | Ga0500622_0000049 | 3300053156 | Bacteria | 145793 |
| 863 | Ga0500622_0000056 | 3300053156 | Bacteria | 142254 |
| 864 | Ga0500622_0000291 | 3300053156 | Bacteria | 51275 |
| 865 | Ga0500624_001580 | 3300053157 | Bacteria | 3488 |
| 866 | Ga0500611_000006 | 3300053727 | Bacteria | 226069 |
| 867 | Ga0500611_006068 | 3300053727 | Bacteria | 1740 |
| 868 | Ga0500587_003459 | 3300053739 | Bacteria | 2207 |
| 869 | Ga0466962_0008097 | 3300061719 | Bacteria | 5040 |
| 870 | 2599480694 | 2599185184 | Bacteria | 6430550 |
| 871 | 2738724512 | 2738541278 | Bacteria | 9755573 |
| 872 | 2740031724 | 2739367866 | Bacteria | 4215900 |
| 873 | 2839990309 | 2839989709 | Bacteria | 3773432 |
| 874 | 2910250004 | 2910245624 | Bacteria | 6935613 |
| 875 | 2911142645 | 2911138879 | Bacteria | 5811561 |
| 876 | 2919439831 | 2919437846 | Bacteria | 6199444 |
| 877 | 2919693756 | 2919692658 | Bacteria | 5943958 |
| 878 | 2928081587 | 2928078545 | Bacteria | 6534839 |
| 879 | 2928150384 | 2928147474 | Bacteria | 6512076 |
| 880 | 2929924485 | 2929921140 | Bacteria | 8649150 |
| 881 | 2932085208 | 2932082852 | Bacteria | 6563563 |
| 882 | 8003156871 | 8003151029 | Bacteria | 8187759 |
| 883 | Ga0500650_0096784 | |||
| 884 | JGI24740J21852_10007864 | |||
| 885 | JGI24740J21852_10010129 | |||
| 886 | JGI24739J22299_10006664 | |||
| 887 | JGI24739J22299_10008192 | |||
| 888 | JGI24737J22298_10000798 | |||
| 889 | JGI24735J21928_10000017 | |||
| 890 | JGI24751J29686_10003416 | |||
| 891 | JGI25162J39368_1000008 | |||
| 892 | JGI25154J39366_1000031 | |||
| 893 | JGI25153J46596_10005563 | |||
| 894 | JGI25153J46596_10009336 | |||
| 895 | rootH1_10005434 | |||
| 896 | rootH1_10013656 | |||
| 897 | rootH2_10000535 | |||
| 898 | rootH2_10009334 | |||
| 899 | rootH2_10060262 | |||
| 900 | rootH2_10065329 | |||
| 901 | rootH2_10260519 | |||
| 902 | rootL2_10047246 | |||
| 903 | rootL2_10094996 | |||
| 904 | rootL2_10106246 | |||
| 905 | rootL2_10171473 | |||
| 906 | rootL2_10223049 | |||
| 907 | rootH1_10052201 | |||
| 908 | rootH1_10057964 | |||
| 909 | rootH1_10123253 | |||
| 910 | rootH1_10325136 | |||
| 911 | rootH1_10384659 | |||
| 912 | JGI25160J50197_1005634 | |||
| 913 | JGI25160J50197_1006108 | |||
| 914 | Ga0055528_1001378 | |||
| 915 | Ga0055530_10002564 | |||
| 916 | Ga0055531_10000339 | |||
| 917 | Ga0065165_1000674 | |||
| 918 | Ga0065165_1002242 | |||
| 919 | Ga0065165_1016053 | |||
| 920 | Ga0065714_10106132 | |||
| 921 | Ga0065704_10107649 | |||
| 922 | Ga0065712_10001366 | |||
| 923 | Ga0065712_10116018 | |||
| 924 | Ga0065712_10127650 | |||
| 925 | Ga0065712_10179394 | |||
| 926 | Ga0065715_10094117 | |||
| 927 | Ga0065707_10098430 | |||
| 928 | Ga0070658_10001648 | |||
| 929 | Ga0070658_10253016 | |||
| 930 | Ga0070676_10001113 | |||
| 931 | Ga0070676_10033270 | |||
| 932 | Ga0070676_10063354 | |||
| 933 | Ga0070676_10126237 | |||
| 934 | Ga0070676_10185210 | |||
| 935 | Ga0070683_100002331 | |||
| 936 | Ga0070683_100033730 | |||
| 937 | Ga0070683_100055483 | |||
| 938 | Ga0070683_100084801 | |||
| 939 | Ga0070690_100012506 | |||
| 940 | Ga0070690_100099222 | |||
| 941 | Ga0070690_100106616 | |||
| 942 | Ga0070690_100182859 | |||
| 943 | Ga0070670_100063403 | |||
| 944 | Ga0070670_100066604 | |||
| 945 | Ga0070670_100073838 | |||
| 946 | Ga0070670_100195634 | |||
| 947 | Ga0070670_100356717 | |||
| 948 | Ga0070677_10031646 | |||
| 949 | Ga0068869_100021659 | |||
| 950 | Ga0068869_100024707 | |||
| 951 | Ga0068869_100032690 | |||
| 952 | Ga0068869_100044373 | |||
| 953 | Ga0068869_100063318 | |||
| 954 | Ga0068869_100073087 | |||
| 955 | Ga0068869_100247091 | |||
| 956 | Ga0070666_10000031 | |||
| 957 | Ga0070666_10000358 | |||
| 958 | Ga0070666_10056444 | |||
| 959 | Ga0070680_100003060 | |||
| 960 | Ga0070680_100008782 | |||
| 961 | Ga0070682_100002866 | |||
| 962 | Ga0070682_100037452 | |||
| 963 | Ga0070682_100086997 | |||
| 964 | Ga0068868_100000187 | |||
| 965 | Ga0068868_100000427 | |||
| 966 | Ga0068868_100023458 | |||
| 967 | Ga0068868_100027827 | |||
| 968 | Ga0068868_100056191 | |||
| 969 | Ga0068868_100088309 | |||
| 970 | Ga0068868_100154608 | |||
| 971 | Ga0070660_100011808 | |||
| 972 | Ga0070660_100060098 | |||
| 973 | Ga0070660_100085439 | |||
| 974 | Ga0070689_100006534 | |||
| 975 | Ga0070689_100008759 | |||
| 976 | Ga0070691_10006430 | |||
| 977 | Ga0070661_100019232 | |||
| 978 | Ga0070668_100003714 | |||
| 979 | Ga0070668_100033148 | |||
| 980 | Ga0070669_100004146 | |||
| 981 | Ga0070669_100049979 | |||
| 982 | Ga0070669_100139945 | |||
| 983 | Ga0070675_100007290 | |||
| 984 | Ga0070675_100007796 | |||
| 985 | Ga0070675_100015450 | |||
| 986 | Ga0070675_100089130 | |||
| 987 | Ga0070675_100146374 | |||
| 988 | Ga0070675_100189297 | |||
| 989 | Ga0070675_100336213 | |||
| 990 | Ga0070671_100004244 | |||
| 991 | Ga0070671_100032907 | |||
| 992 | Ga0070671_100062284 | |||
| 993 | Ga0070671_100087155 | |||
| 994 | Ga0070674_100009905 | |||
| 995 | Ga0070674_100023098 | |||
| 996 | Ga0070674_100217602 | |||
| 997 | Ga0070673_100000124 | |||
| 998 | Ga0070673_100018619 | |||
| 999 | Ga0070673_100052629 | |||
| 1000 | Ga0070673_100129724 | |||
| 1001 | Ga0070673_100151767 | |||
| 1002 | Ga0070688_100005827 | |||
| 1003 | Ga0070688_100021900 | |||
| 1004 | Ga0070688_100029818 | |||
| 1005 | Ga0070688_100045881 | |||
| 1006 | Ga0070659_100003555 | |||
| 1007 | Ga0070659_100007166 | |||
| 1008 | Ga0070659_100010987 | |||
| 1009 | Ga0070659_100083093 | |||
| 1010 | Ga0070667_100000980 | |||
| 1011 | Ga0070667_100007822 | |||
| 1012 | Ga0070667_100011432 | |||
| 1013 | Ga0070667_100014894 | |||
| 1014 | Ga0070667_100202404 | |||
| 1015 | Ga0070667_100212892 | |||
| 1016 | Ga0070701_10009204 | |||
| 1017 | Ga0070701_10012085 | |||
| 1018 | Ga0070700_100028611 | |||
| 1019 | Ga0070700_100102133 | |||
| 1020 | Ga0070678_100010622 | |||
| 1021 | Ga0070678_100034033 | |||
| 1022 | Ga0070678_100039546 | |||
| 1023 | Ga0070678_100064101 | |||
| 1024 | Ga0070678_100064606 | |||
| 1025 | Ga0070662_100010835 | |||
| 1026 | Ga0070662_100011948 | |||
| 1027 | Ga0070662_100093919 | |||
| 1028 | Ga0070681_10035209 | |||
| 1029 | Ga0070681_10088793 | |||
| 1030 | Ga0068867_100003400 | |||
| 1031 | Ga0068867_100153250 | |||
| 1032 | Ga0070685_10003074 | |||
| 1033 | Ga0070685_10009678 | |||
| 1034 | Ga0070685_10010142 | |||
| 1035 | Ga0070685_10019938 | |||
| 1036 | Ga0070685_10082528 | |||
| 1037 | Ga0070685_10121100 | |||
| 1038 | Ga0070698_100001150 | |||
| 1039 | Ga0070698_100030021 | |||
| 1040 | Ga0070698_100215269 | |||
| 1041 | Ga0070679_100003309 | |||
| 1042 | Ga0070679_100026672 | |||
| 1043 | Ga0070684_100001198 | |||
| 1044 | Ga0070684_100133051 | |||
| 1045 | Ga0068853_100002569 | |||
| 1046 | Ga0068853_100003735 | |||
| 1047 | Ga0068853_100020432 | |||
| 1048 | Ga0068853_100023090 | |||
| 1049 | Ga0068853_100026222 | |||
| 1050 | Ga0068853_100030039 | |||
| 1051 | Ga0068853_100062999 | |||
| 1052 | Ga0068853_100080274 | |||
| 1053 | Ga0070672_100000105 | |||
| 1054 | Ga0070672_100014464 | |||
| 1055 | Ga0070672_100025639 | |||
| 1056 | Ga0070672_100062300 | |||
| 1057 | Ga0070672_100122499 | |||
| 1058 | Ga0070672_100162466 | |||
| 1059 | Ga0070672_100255296 | |||
| 1060 | Ga0070686_100001965 | |||
| 1061 | Ga0070686_100056093 | |||
| 1062 | Ga0070693_100004189 | |||
| 1063 | Ga0070665_100000635 | |||
| 1064 | Ga0070665_100004161 | |||
| 1065 | Ga0070665_100060341 | |||
| 1066 | Ga0070665_100098265 | |||
| 1067 | Ga0068855_100007383 | |||
| 1068 | Ga0068855_100031575 | |||
| 1069 | Ga0068855_100040115 | |||
| 1070 | Ga0068855_100234011 | |||
| 1071 | Ga0068855_100252882 | |||
| 1072 | Ga0068855_100396239 | |||
| 1073 | Ga0068855_100440388 | |||
| 1074 | Ga0070664_100001670 | |||
| 1075 | Ga0070664_100006530 | |||
| 1076 | Ga0070664_100035871 | |||
| 1077 | Ga0070664_100055517 | |||
| 1078 | Ga0070664_100224819 | |||
| 1079 | Ga0068857_100007841 | |||
| 1080 | Ga0068857_100011785 | |||
| 1081 | Ga0068857_100022154 | |||
| 1082 | Ga0068857_100025313 | |||
| 1083 | Ga0068857_100072692 | |||
| 1084 | Ga0068854_100112571 | |||
| 1085 | Ga0068854_100207329 | |||
| 1086 | Ga0068856_100011695 | |||
| 1087 | Ga0068856_100099440 | |||
| 1088 | Ga0070702_100164966 | |||
| 1089 | Ga0068852_100000346 | |||
| 1090 | Ga0068852_100000848 | |||
| 1091 | Ga0068852_100005012 | |||
| 1092 | Ga0068852_100031520 | |||
| 1093 | Ga0068852_100043934 | |||
| 1094 | Ga0068852_100262701 | |||
| 1095 | Ga0068852_100446640 | |||
| 1096 | Ga0068859_100000045 | |||
| 1097 | Ga0068859_100017677 | |||
| 1098 | Ga0068859_100026115 | |||
| 1099 | Ga0068859_100051384 | |||
| 1100 | Ga0068859_100076568 | |||
| 1101 | Ga0068859_100102372 | |||
| 1102 | Ga0068859_100104773 | |||
| 1103 | Ga0068859_100343363 | |||
| 1104 | Ga0068859_100348617 | |||
| 1105 | Ga0068864_100001254 | |||
| 1106 | Ga0068864_100001485 | |||
| 1107 | Ga0068864_100062304 | |||
| 1108 | Ga0068864_100139884 | |||
| 1109 | Ga0068864_100141100 | |||
| 1110 | Ga0068864_100200204 | |||
| 1111 | Ga0068866_10035912 | |||
| 1112 | Ga0068866_10064506 | |||
| 1113 | Ga0068861_100004748 | |||
| 1114 | Ga0068861_100005264 | |||
| 1115 | Ga0068861_100007098 | |||
| 1116 | Ga0068861_100024725 | |||
| 1117 | Ga0068861_100126447 | |||
| 1118 | Ga0068861_100240458 | |||
| 1119 | Ga0068851_10019459 | |||
| 1120 | Ga0068851_10058875 | |||
| 1121 | Ga0068851_10069680 | |||
| 1122 | Ga0068870_10006462 | |||
| 1123 | Ga0068870_10012943 | |||
| 1124 | Ga0068870_10142548 | |||
| 1125 | Ga0068863_100001976 | |||
| 1126 | Ga0068863_100002352 | |||
| 1127 | Ga0068863_100006695 | |||
| 1128 | Ga0068863_100028179 | |||
| 1129 | Ga0068863_100060096 | |||
| 1130 | Ga0068863_100094977 | |||
| 1131 | Ga0068863_100379847 | |||
| 1132 | Ga0068858_100003543 | |||
| 1133 | Ga0068858_100010584 | |||
| 1134 | Ga0068858_100360129 | |||
| 1135 | Ga0068860_100001418 | |||
| 1136 | Ga0068860_100003309 | |||
| 1137 | Ga0068860_100003540 | |||
| 1138 | Ga0068860_100019177 | |||
| 1139 | Ga0068860_100084371 | |||
| 1140 | Ga0068860_100155788 | |||
| 1141 | Ga0068860_100210957 | |||
| 1142 | Ga0068860_100277314 | |||
| 1143 | Ga0081539_10000338 | |||
| 1144 | Ga0070715_10007211 | |||
| 1145 | Ga0075366_10000019 | |||
| 1146 | Ga0075366_10003888 | |||
| 1147 | Ga0097621_100000499 | |||
| 1148 | Ga0097621_100001817 | |||
| 1149 | Ga0097621_100011606 | |||
| 1150 | Ga0097621_100093297 | |||
| 1151 | Ga0097621_100109682 | |||
| 1152 | Ga0097621_100145495 | |||
| 1153 | Ga0097621_100202856 | |||
| 1154 | Ga0097621_100364436 | |||
| 1155 | Ga0068871_100002567 | |||
| 1156 | Ga0068871_100035949 | |||
| 1157 | Ga0068871_100045193 | |||
| 1158 | Ga0068871_100052861 | |||
| 1159 | Ga0068871_100190333 | |||
| 1160 | Ga0075428_100023898 | |||
| 1161 | Ga0075428_100032712 | |||
| 1162 | Ga0075430_100148523 | |||
| 1163 | Ga0075431_100060606 | |||
| 1164 | Ga0075434_100009056 | |||
| 1165 | Ga0075429_100018515 | |||
| 1166 | Ga0068865_100001094 | |||
| 1167 | Ga0068865_100013971 | |||
| 1168 | Ga0068865_100016931 | |||
| 1169 | Ga0097620_100000045 | |||
| 1170 | Ga0097620_100017677 | |||
| 1171 | Ga0097620_100026115 | |||
| 1172 | Ga0097620_100051384 | |||
| 1173 | Ga0097620_100076565 | |||
| 1174 | Ga0097620_100102381 | |||
| 1175 | Ga0097620_100104767 | |||
| 1176 | Ga0097620_100343394 | |||
| 1177 | Ga0097620_100348632 | |||
| 1178 | Ga0105240_10009860 | |||
| 1179 | Ga0105240_10279853 | |||
| 1180 | Ga0105240_10328934 | |||
| 1181 | Ga0111539_10003835 | |||
| 1182 | Ga0111539_10019523 | |||
| 1183 | Ga0111539_10023564 | |||
| 1184 | Ga0111539_10345894 | |||
| 1185 | Ga0111539_10468252 | |||
| 1186 | Ga0105245_10045188 | |||
| 1187 | Ga0105247_10003492 | |||
| 1188 | Ga0105247_10003520 | |||
| 1189 | Ga0114129_10052288 | |||
| 1190 | Ga0114129_10082403 | |||
| 1191 | Ga0105241_10000985 | |||
| 1192 | Ga0105241_10001733 | |||
| 1193 | Ga0105241_10038447 | |||
| 1194 | Ga0105241_10042560 | |||
| 1195 | Ga0105242_10010544 | |||
| 1196 | Ga0105242_10023228 | |||
| 1197 | Ga0105242_10042593 | |||
| 1198 | Ga0105242_10068614 | |||
| 1199 | Ga0105242_10083795 | |||
| 1200 | Ga0105248_10022859 | |||
| 1201 | Ga0105248_10038321 | |||
| 1202 | Ga0105237_10005841 | |||
| 1203 | Ga0105237_10031028 | |||
| 1204 | Ga0105237_10038920 | |||
| 1205 | Ga0105238_10283215 | |||
| 1206 | Ga0105249_10004538 | |||
| 1207 | Ga0105249_10011505 | |||
| 1208 | Ga0105249_10011753 | |||
| 1209 | Ga0105249_10011841 | |||
| 1210 | Ga0105249_10019342 | |||
| 1211 | Ga0105249_10020335 | |||
| 1212 | Ga0105249_10020437 | |||
| 1213 | Ga0105249_10028339 | |||
| 1214 | Ga0105249_10028806 | |||
| 1215 | Ga0105249_10055784 | |||
| 1216 | Ga0105249_10089921 | |||
| 1217 | Ga0105249_10180151 | |||
| 1218 | Ga0105249_10286489 | |||
| 1219 | Ga0105239_10000912 | |||
| 1220 | Ga0105239_10026168 | |||
| 1221 | Ga0105239_10034551 | |||
| 1222 | Ga0105239_10073498 | |||
| 1223 | Ga0105239_10119273 | |||
| 1224 | Ga0105246_10029025 | |||
| 1225 | Ga0157373_10005810 | |||
| 1226 | Ga0157373_10014805 | |||
| 1227 | Ga0157373_10017113 | |||
| 1228 | Ga0157373_10033068 | |||
| 1229 | Ga0157371_10000284 | |||
| 1230 | Ga0157371_10000725 | |||
| 1231 | Ga0157371_10002541 | |||
| 1232 | Ga0157371_10006439 | |||
| 1233 | Ga0157371_10015828 | |||
| 1234 | Ga0157371_10018851 | |||
| 1235 | Ga0157371_10020967 | |||
| 1236 | Ga0157371_10033620 | |||
| 1237 | Ga0157371_10045630 | |||
| 1238 | Ga0157371_10091942 | |||
| 1239 | Ga0157371_10126626 | |||
| 1240 | Ga0157371_10146305 | |||
| 1241 | Ga0157370_10001924 | |||
| 1242 | Ga0157370_10004751 | |||
| 1243 | Ga0157370_10021147 | |||
| 1244 | Ga0157370_10025275 | |||
| 1245 | Ga0157370_10157833 | |||
| 1246 | Ga0157369_10000101 | |||
| 1247 | Ga0157369_10020421 | |||
| 1248 | Ga0157369_10198558 | |||
| 1249 | Ga0157369_10261390 | |||
| 1250 | Ga0157374_10000025 | |||
| 1251 | Ga0157374_10000260 | |||
| 1252 | Ga0157374_10002980 | |||
| 1253 | Ga0157374_10020690 | |||
| 1254 | Ga0157374_10027083 | |||
| 1255 | Ga0157374_10043533 | |||
| 1256 | Ga0157374_10165320 | |||
| 1257 | Ga0157374_10264534 | |||
| 1258 | Ga0157378_10003039 | |||
| 1259 | Ga0157378_10013251 | |||
| 1260 | Ga0157378_10014666 | |||
| 1261 | Ga0157378_10023246 | |||
| 1262 | Ga0157378_10023750 | |||
| 1263 | Ga0157378_10136186 | |||
| 1264 | Ga0157378_10147537 | |||
| 1265 | Ga0157378_10208511 | |||
| 1266 | Ga0163162_10000312 | |||
| 1267 | Ga0163162_10001523 | |||
| 1268 | Ga0163162_10002647 | |||
| 1269 | Ga0163162_10004060 | |||
| 1270 | Ga0163162_10004258 | |||
| 1271 | Ga0163162_10007829 | |||
| 1272 | Ga0163162_10010039 | |||
| 1273 | Ga0163162_10022439 | |||
| 1274 | Ga0163162_10027004 | |||
| 1275 | Ga0163162_10069905 | |||
| 1276 | Ga0163162_10076787 | |||
| 1277 | Ga0163162_10179217 | |||
| 1278 | Ga0163162_10241612 | |||
| 1279 | Ga0163162_10317583 | |||
| 1280 | Ga0157372_10000041 | |||
| 1281 | Ga0157372_10004075 | |||
| 1282 | Ga0157372_10009342 | |||
| 1283 | Ga0157372_10018758 | |||
| 1284 | Ga0157372_10023974 | |||
| 1285 | Ga0157372_10025872 | |||
| 1286 | Ga0157372_10038600 | |||
| 1287 | Ga0157372_10091463 | |||
| 1288 | Ga0157372_10154083 | |||
| 1289 | Ga0157372_10233398 | |||
| 1290 | Ga0157372_10254266 | |||
| 1291 | Ga0157372_10336238 | |||
| 1292 | Ga0157372_10338989 | |||
| 1293 | Ga0157372_10432189 | |||
| 1294 | Ga0157375_10000686 | |||
| 1295 | Ga0157375_10002871 | |||
| 1296 | Ga0157375_10010009 | |||
| 1297 | Ga0157375_10027553 | |||
| 1298 | Ga0157375_10048720 | |||
| 1299 | Ga0157375_10068834 | |||
| 1300 | Ga0157375_10167958 | |||
| 1301 | Ga0157375_10172169 | |||
| 1302 | Ga0157375_10220697 | |||
| 1303 | Ga0157375_10237935 | |||
| 1304 | Ga0157375_10382797 | |||
| 1305 | Ga0163163_10000279 | |||
| 1306 | Ga0163163_10000344 | |||
| 1307 | Ga0163163_10000346 | |||
| 1308 | Ga0163163_10012583 | |||
| 1309 | Ga0157380_10003974 | |||
| 1310 | Ga0157380_10017475 | |||
| 1311 | Ga0157380_10093099 | |||
| 1312 | Ga0157380_10144080 | |||
| 1313 | Ga0157380_10198731 | |||
| 1314 | Ga0157380_10408648 | |||
| 1315 | Ga0157377_10001633 | |||
| 1316 | Ga0157377_10007473 | |||
| 1317 | Ga0157377_10008716 | |||
| 1318 | Ga0157377_10076132 | |||
| 1319 | Ga0157377_10087828 | |||
| 1320 | Ga0157377_10162705 | |||
| 1321 | Ga0157379_10000242 | |||
| 1322 | Ga0157379_10011127 | |||
| 1323 | Ga0157379_10116865 | |||
| 1324 | Ga0157379_10119903 | |||
| 1325 | Ga0157379_10121227 | |||
| 1326 | Ga0157379_10342037 | |||
| 1327 | Ga0157376_10001139 | |||
| 1328 | Ga0157376_10002821 | |||
| 1329 | Ga0157376_10004535 | |||
| 1330 | Ga0157376_10007029 | |||
| 1331 | Ga0157376_10053690 | |||
| 1332 | Ga0157376_10058402 | |||
| 1333 | Ga0157376_10062238 | |||
| 1334 | Ga0157376_10092562 | |||
| 1335 | Ga0157376_10242124 | |||
| 1336 | Ga0163161_10005088 | |||
| 1337 | Ga0163161_10006224 | |||
| 1338 | Ga0163161_10014267 | |||
| 1339 | Ga0163161_10018549 | |||
| 1340 | Ga0163161_10045337 | |||
| 1341 | Ga0209437_100030 | |||
| 1342 | Ga0209646_1000009 | |||
| 1343 | Ga0209026_1000396 | |||
| 1344 | Ga0209129_1018752 | |||
| 1345 | Ga0209673_1000016 | |||
| 1346 | Ga0209564_1004934 | |||
| 1347 | Ga0209564_1027372 | |||
| 1348 | Ga0209758_1010285 | |||
| 1349 | Ga0209758_1020363 | |||
| 1350 | Ga0209050_1000124 | |||
| 1351 | Ga0207426_1000339 | |||
| 1352 | Ga0207426_1000520 | |||
| 1353 | Ga0209257_1000007 | |||
| 1354 | Ga0209257_1000658 | |||
| 1355 | Ga0207656_10056650 | |||
| 1356 | Ga0207682_10086308 | |||
| 1357 | Ga0207710_10002713 | |||
| 1358 | Ga0207710_10014697 | |||
| 1359 | Ga0207688_10043312 | |||
| 1360 | Ga0207680_10000141 | |||
| 1361 | Ga0207680_10003927 | |||
| 1362 | Ga0207647_10000017 | |||
| 1363 | Ga0207647_10001876 | |||
| 1364 | Ga0207647_10061601 | |||
| 1365 | Ga0207645_10001794 | |||
| 1366 | Ga0207645_10019981 | |||
| 1367 | Ga0207645_10085980 | |||
| 1368 | Ga0207643_10009744 | |||
| 1369 | Ga0207643_10011999 | |||
| 1370 | Ga0207643_10030872 | |||
| 1371 | Ga0207705_10011048 | |||
| 1372 | Ga0207705_10012513 | |||
| 1373 | Ga0207705_10017600 | |||
| 1374 | Ga0207654_10003695 | |||
| 1375 | Ga0207654_10006489 | |||
| 1376 | Ga0207654_10026732 | |||
| 1377 | Ga0207654_10051192 | |||
| 1378 | Ga0207707_10003504 | |||
| 1379 | Ga0207707_10069683 | |||
| 1380 | Ga0207707_10121299 | |||
| 1381 | Ga0207695_10004070 | |||
| 1382 | Ga0207695_10186606 | |||
| 1383 | Ga0207671_10009957 | |||
| 1384 | Ga0207671_10022002 | |||
| 1385 | Ga0207671_10026640 | |||
| 1386 | Ga0207660_10005510 | |||
| 1387 | Ga0207660_10138805 | |||
| 1388 | Ga0207660_10303350 | |||
| 1389 | Ga0207662_10021541 | |||
| 1390 | Ga0207657_10009181 | |||
| 1391 | Ga0207657_10018805 | |||
| 1392 | Ga0207657_10023896 | |||
| 1393 | Ga0207657_10084500 | |||
| 1394 | Ga0207649_10061049 | |||
| 1395 | Ga0207652_10000045 | |||
| 1396 | Ga0207652_10000819 | |||
| 1397 | Ga0207652_10008710 | |||
| 1398 | Ga0207652_10016246 | |||
| 1399 | Ga0207681_10001974 | |||
| 1400 | Ga0207681_10216315 | |||
| 1401 | Ga0207650_10002954 | |||
| 1402 | Ga0207650_10024003 | |||
| 1403 | Ga0207650_10046246 | |||
| 1404 | Ga0207650_10071885 | |||
| 1405 | Ga0207650_10128871 | |||
| 1406 | Ga0207659_10156743 | |||
| 1407 | Ga0207644_10008911 | |||
| 1408 | Ga0207644_10051636 | |||
| 1409 | Ga0207644_10194649 | |||
| 1410 | Ga0207690_10005074 | |||
| 1411 | Ga0207690_10011163 | |||
| 1412 | Ga0207706_10003994 | |||
| 1413 | Ga0207706_10007275 | |||
| 1414 | Ga0207706_10031804 | |||
| 1415 | Ga0207706_10069185 | |||
| 1416 | Ga0207686_10024411 | |||
| 1417 | Ga0207686_10094005 | |||
| 1418 | Ga0207686_10100281 | |||
| 1419 | Ga0207670_10006784 | |||
| 1420 | Ga0207670_10013543 | |||
| 1421 | Ga0207670_10018759 | |||
| 1422 | Ga0207669_10044918 | |||
| 1423 | Ga0207669_10099177 | |||
| 1424 | Ga0207704_10009869 | |||
| 1425 | Ga0207704_10082330 | |||
| 1426 | Ga0207691_10000012 | |||
| 1427 | Ga0207691_10004759 | |||
| 1428 | Ga0207691_10025875 | |||
| 1429 | Ga0207691_10039568 | |||
| 1430 | Ga0207691_10049190 | |||
| 1431 | Ga0207691_10158279 | |||
| 1432 | Ga0207689_10008936 | |||
| 1433 | Ga0207689_10008992 | |||
| 1434 | Ga0207689_10017516 | |||
| 1435 | Ga0207689_10018137 | |||
| 1436 | Ga0207689_10029050 | |||
| 1437 | Ga0207689_10044379 | |||
| 1438 | Ga0207689_10063876 | |||
| 1439 | Ga0207689_10072143 | |||
| 1440 | Ga0207689_10092711 | |||
| 1441 | Ga0207689_10190714 | |||
| 1442 | Ga0207661_10003108 | |||
| 1443 | Ga0207661_10034774 | |||
| 1444 | Ga0207661_10110823 | |||
| 1445 | Ga0207679_10004210 | |||
| 1446 | Ga0207679_10012502 | |||
| 1447 | Ga0207679_10017260 | |||
| 1448 | Ga0207679_10124715 | |||
| 1449 | Ga0207667_10016855 | |||
| 1450 | Ga0207667_10026076 | |||
| 1451 | Ga0207667_10033422 | |||
| 1452 | Ga0207667_10034450 | |||
| 1453 | Ga0207667_10038329 | |||
| 1454 | Ga0207667_10073195 | |||
| 1455 | Ga0207667_10247632 | |||
| 1456 | Ga0207651_10000216 | |||
| 1457 | Ga0207651_10005231 | |||
| 1458 | Ga0207651_10191831 | |||
| 1459 | Ga0207651_10232295 | |||
| 1460 | Ga0207651_10306359 | |||
| 1461 | Ga0207712_10000976 | |||
| 1462 | Ga0207712_10007162 | |||
| 1463 | Ga0207712_10010440 | |||
| 1464 | Ga0207712_10022982 | |||
| 1465 | Ga0207712_10025198 | |||
| 1466 | Ga0207712_10039279 | |||
| 1467 | Ga0207712_10071369 | |||
| 1468 | Ga0207712_10148236 | |||
| 1469 | Ga0207712_10234090 | |||
| 1470 | Ga0207668_10001361 | |||
| 1471 | Ga0207668_10085311 | |||
| 1472 | Ga0207658_10000374 | |||
| 1473 | Ga0207658_10008025 | |||
| 1474 | Ga0207658_10011120 | |||
| 1475 | Ga0207658_10011371 | |||
| 1476 | Ga0207658_10113347 | |||
| 1477 | Ga0207677_10000984 | |||
| 1478 | Ga0207677_10006012 | |||
| 1479 | Ga0207677_10018387 | |||
| 1480 | Ga0207677_10116904 | |||
| 1481 | Ga0207703_10009315 | |||
| 1482 | Ga0207703_10019138 | |||
| 1483 | Ga0207703_10079753 | |||
| 1484 | Ga0207703_10275967 | |||
| 1485 | Ga0207639_10016498 | |||
| 1486 | Ga0207639_10021770 | |||
| 1487 | Ga0207639_10029603 | |||
| 1488 | Ga0207639_10032242 | |||
| 1489 | Ga0207639_10066918 | |||
| 1490 | Ga0207639_10066998 | |||
| 1491 | Ga0207678_10013503 | |||
| 1492 | Ga0207678_10031808 | |||
| 1493 | Ga0207708_10034032 | |||
| 1494 | Ga0207708_10051340 | |||
| 1495 | Ga0207708_10105301 | |||
| 1496 | Ga0207702_10026475 | |||
| 1497 | Ga0207702_10091342 | |||
| 1498 | Ga0207641_10000146 | |||
| 1499 | Ga0207641_10000947 | |||
| 1500 | Ga0207641_10007761 | |||
| 1501 | Ga0207641_10040757 | |||
| 1502 | Ga0207641_10073253 | |||
| 1503 | Ga0207641_10104865 | |||
| 1504 | Ga0207641_10110213 | |||
| 1505 | Ga0207641_10184962 | |||
| 1506 | Ga0207648_10001615 | |||
| 1507 | Ga0207648_10010253 | |||
| 1508 | Ga0207648_10018048 | |||
| 1509 | Ga0207648_10020364 | |||
| 1510 | Ga0207648_10048905 | |||
| 1511 | Ga0207648_10056374 | |||
| 1512 | Ga0207648_10064755 | |||
| 1513 | Ga0207648_10122109 | |||
| 1514 | Ga0207648_10173460 | |||
| 1515 | Ga0207676_10000697 | |||
| 1516 | Ga0207676_10003591 | |||
| 1517 | Ga0207676_10005018 | |||
| 1518 | Ga0207676_10077658 | |||
| 1519 | Ga0207676_10111982 | |||
| 1520 | Ga0207676_10202536 | |||
| 1521 | Ga0207676_10257722 | |||
| 1522 | Ga0207674_10004031 | |||
| 1523 | Ga0207674_10010211 | |||
| 1524 | Ga0207674_10014867 | |||
| 1525 | Ga0207674_10033271 | |||
| 1526 | Ga0207674_10070579 | |||
| 1527 | Ga0207674_10095119 | |||
| 1528 | Ga0207674_10271928 | |||
| 1529 | Ga0207675_100001183 | |||
| 1530 | Ga0207675_100005430 | |||
| 1531 | Ga0207675_100034881 | |||
| 1532 | Ga0207675_100139304 | |||
| 1533 | Ga0207675_100219101 | |||
| 1534 | Ga0207683_10000943 | |||
| 1535 | Ga0207683_10017143 | |||
| 1536 | Ga0207683_10020984 | |||
| 1537 | Ga0207683_10025629 | |||
| 1538 | Ga0207683_10070461 | |||
| 1539 | Ga0207683_10138987 | |||
| 1540 | Ga0207698_10003512 | |||
| 1541 | Ga0207698_10009340 | |||
| 1542 | Ga0207428_10006992 | |||
| 1543 | Ga0207428_10012094 | |||
| 1544 | Ga0268266_10005379 | |||
| 1545 | Ga0268266_10019071 | |||
| 1546 | Ga0268266_10035267 | |||
| 1547 | Ga0268265_10009351 | |||
| 1548 | Ga0268265_10011180 | |||
| 1549 | Ga0268264_10003975 | |||
| 1550 | Ga0268264_10006744 | |||
| 1551 | Ga0268264_10008474 | |||
| 1552 | Ga0268264_10046760 | |||
| 1553 | Ga0268264_10050397 | |||
| 1554 | Ga0268264_10102312 | |||
| 1555 | Ga0307515_10000012 | |||
| 1556 | Ga0307515_10000077 | |||
| 1557 | Ga0307515_10012976 | |||
| 1558 | Ga0307515_10063170 | |||
| 1559 | Ga0307515_10078481 | |||
| 1560 | Ga0265340_10086342 | |||
| 1561 | Ga0265327_10000759 | |||
| 1562 | Ga0307513_10235444 | |||
| 1563 | Ga0307509_10020532 | |||
| 1564 | Ga0307509_10083480 | |||
| 1565 | Ga0307509_10205242 | |||
| 1566 | Ga0307509_10221519 | |||
| 1567 | Ga0307408_100000332 | |||
| 1568 | Ga0307408_100000341 | |||
| 1569 | Ga0307408_100000410 | |||
| 1570 | Ga0307408_100016173 | |||
| 1571 | Ga0307508_10001024 | |||
| 1572 | Ga0307514_10051315 | |||
| 1573 | Ga0307516_10243084 | |||
| 1574 | Ga0307405_10005405 | |||
| 1575 | Ga0307405_10112520 | |||
| 1576 | Ga0307413_10008468 | |||
| 1577 | Ga0307413_10156833 | |||
| 1578 | Ga0307412_10012107 | |||
| 1579 | Ga0307416_100032160 | |||
| 1580 | Ga0307414_10000059 | |||
| 1581 | Ga0307414_10018672 | |||
| 1582 | Ga0307411_10106252 | |||
| 1583 | Ga0307415_100117466 | |||
| 1584 | Ga0307507_10000143 | |||
| 1585 | Ga0373924_0022664 | |||
| 1586 | Ga0373947_0055487 | |||
| 1587 | Ga0373947_0062781 | |||
| 1588 | Ga0373937_0006671 | |||
| 1589 | Ga0373937_0214143 | |||
| 1590 | Ga0373937_0338191 | |||
| 1591 | Ga0395899_0000024 | |||
| 1592 | Ga0395899_0008398 | |||
| 1593 | Ga0395900_0008499 | |||
| 1594 | Ga0395900_0126322 | |||
| 1595 | Ga0395900_0222896 | |||
| 1596 | Ga0395898_0003718 | |||
| 1597 | Ga0395898_0013466 | |||
| 1598 | Ga0395905_0009765 | |||
| 1599 | Ga0395905_0306613 | |||
| 1600 | Ga0395901_0005062 | |||
| 1601 | Ga0395901_0012431 | |||
| 1602 | Ga0395901_0045981 | |||
| 1603 | Ga0436365_0603123 | |||
| 1604 | Ga0439436_0007478 | |||
| 1605 | Ga0439457_000930 | |||
| 1606 | Ga0450898_000889 | |||
| 1607 | Ga0439434_0009601 | |||
| 1608 | Ga0451577_0005791 | |||
| 1609 | Ga0451577_0249649 | |||
| 1610 | Ga0466969_0000004 | |||
| 1611 | Ga0466972_0000016 | |||
| 1612 | Ga0466972_0000017 | |||
| 1613 | Ga0466972_0015930 | |||
| 1614 | Ga0453683_0005930 | |||
| 1615 | Ga0466965_0068862 | |||
| 1616 | Ga0466966_0000295 | |||
| 1617 | Ga0466966_0087727 | |||
| 1618 | Ga0466961_0002760 | |||
| 1619 | Ga0466961_0014977 | |||
| 1620 | Ga0453684_0001190 | |||
| 1621 | Ga0466971_0011031 | |||
| 1622 | Ga0466968_0002708 | |||
| 1623 | Ga0466970_0003015 | |||
| 1624 | Ga0466970_0055835 | |||
| 1625 | Ga0466957_0000367 | |||
| 1626 | Ga0466959_0000004 | |||
| 1627 | Ga0466959_0000819 | |||
| 1628 | Ga0451576_0029084 | |||
| 1629 | Ga0466967_0204488 | |||
| 1630 | Ga0495592_0049965 | |||
| 1631 | Ga0495651_0024770 | |||
| 1632 | Ga0495650_0000050 | |||
| 1633 | Ga0495582_0041520 | |||
| 1634 | Ga0495585_0001264 | |||
| 1635 | Ga0495585_0002275 | |||
| 1636 | Ga0495583_0009815 | |||
| 1637 | Ga0495583_0061182 | |||
| 1638 | Ga0495606_0000505 | |||
| 1639 | Ga0495606_0005343 | |||
| 1640 | Ga0495606_0018126 | |||
| 1641 | Ga0495616_0000296 | |||
| 1642 | Ga0495616_0015185 | |||
| 1643 | Ga0495628_0022064 | |||
| 1644 | Ga0495643_0031267 | |||
| 1645 | Ga0495648_0052548 | |||
| 1646 | Ga0495587_0025753 | |||
| 1647 | Ga0495609_0085194 | |||
| 1648 | Ga0495622_0041649 | |||
| 1649 | Ga0495633_0000083 | |||
| 1650 | Ga0495633_0003455 | |||
| 1651 | Ga0495668_0000055 | |||
| 1652 | Ga0495668_0001051 | |||
| 1653 | Ga0495668_0001697 | |||
| 1654 | Ga0495634_0030013 | |||
| 1655 | Ga0495625_0000077 | |||
| 1656 | Ga0495625_0001180 | |||
| 1657 | Ga0495625_0001973 | |||
| 1658 | Ga0495625_0012157 | |||
| 1659 | Ga0495625_0016508 | |||
| 1660 | Ga0495625_0043549 | |||
| 1661 | Ga0495625_0064780 | |||
| 1662 | Ga0495625_0067222 | |||
| 1663 | Ga0495657_0059670 | |||
| 1664 | Ga0495599_0152229 | |||
| 1665 | Ga0495658_0015521 | |||
| 1666 | Ga0495649_0000011 | |||
| 1667 | Ga0495660_0028644 | |||
| 1668 | Ga0495636_0000184 | |||
| 1669 | Ga0495674_0034710 | |||
| 1670 | Ga0495674_0223611 | |||
| 1671 | Ga0495672_0014585 | |||
| 1672 | Ga0495672_0031224 | |||
| 1673 | Ga0495687_001849 | |||
| 1674 | Ga0495684_0211125 | |||
| 1675 | Ga0495686_0000541 | |||
| 1676 | Ga0495686_0007680 | |||
| 1677 | Ga0495686_0134383 | |||
| 1678 | Ga0496102_0132636 | |||
| 1679 | Ga0496109_0057555 | |||
| 1680 | Ga0496114_0086210 | |||
| 1681 | Ga0496114_0267206 | |||
| 1682 | Ga0495678_005798 | |||
| 1683 | Ga0501034_0000017 | |||
| 1684 | Ga0501034_0037661 | |||
| 1685 | Ga0501036_0180266 | |||
| 1686 | Ga0501037_0052248 | |||
| 1687 | Ga0501037_0138142 | |||
| 1688 | Ga0501037_0231519 | |||
| 1689 | Ga0501039_0029118 | |||
| 1690 | Ga0501043_0003072 | |||
| 1691 | Ga0501047_0010118 | |||
| 1692 | Ga0501047_0015825 | |||
| 1693 | Ga0501047_0085882 | |||
| 1694 | Ga0501070_0246253 | |||
| 1695 | Ga0501072_0101159 | |||
| 1696 | Ga0501073_0123309 | |||
| 1697 | Ga0501202_000471 | |||
| 1698 | Ga0501217_001989 | |||
| 1699 | Ga0501223_000325 | |||
| 1700 | Ga0501257_019911 | |||
| 1701 | Ga0501219_000159 | |||
| 1702 | Ga0501035_0015963 | |||
| 1703 | Ga0501044_0006478 | |||
| 1704 | Ga0501044_0016594 | |||
| 1705 | Ga0501044_0091409 | |||
| 1706 | Ga0501044_0321461 | |||
| 1707 | Ga0501212_006926 | |||
| 1708 | Ga0501284_00018 | |||
| 1709 | nmdc:mga0k408_101260_c1 | |||
| 1710 | nmdc:mga0k408_14692_c1 | |||
| 1711 | nmdc:mga0k408_30625_c1 | |||
| 1712 | nmdc:mga0k408_3871_c1 | |||
| 1713 | nmdc:mga0k408_44_c1 | |||
| 1714 | nmdc:mga05p37_2793_c1 | |||
| 1715 | nmdc:mga09592_28816_c1 | |||
| 1716 | nmdc:mga0qj67_111525_c1 | |||
| 1717 | nmdc:mga0qj67_136660_c1 | |||
| 1718 | nmdc:mga06r32_81629_c1 | |||
| 1719 | nmdc:mga08y16_1505_c1 | |||
| 1720 | nmdc:mga08y16_449504_c1 | |||
| 1721 | nmdc:mga08y16_80441_c1 | |||
| 1722 | nmdc:mga08y16_88358_c1 | |||
| 1723 | nmdc:mga0n895_10170_c1 | |||
| 1724 | Ga0495619_0036987 | |||
| 1725 | Ga0500578_0000037 | |||
| 1726 | Ga0500578_0023352 | |||
| 1727 | Ga0500646_0014285 | |||
| 1728 | Ga0500583_0000068 | |||
| 1729 | Ga0500583_0001499 | |||
| 1730 | Ga0500594_0027888 | |||
| 1731 | Ga0500608_005654 | |||
| 1732 | Ga0500614_010366 | |||
| 1733 | Ga0500618_000006 | |||
| 1734 | Ga0500618_002095 | |||
| 1735 | Ga0500652_005744 | |||
| 1736 | Ga0500652_062495 | |||
| 1737 | Ga0500568_0000429 | |||
| 1738 | Ga0500573_0034974 | |||
| 1739 | Ga0500588_0012568 | |||
| 1740 | Ga0500604_0003205 | |||
| 1741 | Ga0500604_0004013 | |||
| 1742 | Ga0500616_0006698 | |||
| 1743 | Ga0500616_0008154 | |||
| 1744 | Ga0500622_0000049 | |||
| 1745 | Ga0500622_0000056 | |||
| 1746 | Ga0500622_0000291 | |||
| 1747 | Ga0500624_001580 | |||
| 1748 | Ga0500611_000006 | |||
| 1749 | Ga0500611_006068 | |||
| 1750 | Ga0500587_003459 | |||
| 1751 | Ga0466962_0008097 | |||
| 1752 | 2599480694 | |||
| 1753 | 2738724512 | |||
| 1754 | 2740031724 | |||
| 1755 | 2839990309 | |||
| 1756 | 2910250004 | |||
| 1757 | 2911142645 | |||
| 1758 | 2919439831 | |||
| 1759 | 2919693756 | |||
| 1760 | 2928081587 | |||
| 1761 | 2928150384 | |||
| 1762 | 2929924485 | |||
| 1763 | 2932085208 | |||
| 1764 | 8003156871 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zn0-assembly2.cif.gz_D | structure of the nadph-dependent thioredoxin reductase from methanosarcina mazei | 0.9389 | 6 | 151 |
| 6fqz-assembly1.cif.gz_B | plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate | 0.9388 | 6 | 36 |
| 4zn0-assembly1.cif.gz_C | structure of the nadph-dependent thioredoxin reductase from methanosarcina mazei | 0.9362 | 5 | 151 |
| 5a9r-assembly1.cif.gz_A | apo form of imine reductase from amycolatopsis orientalis | 0.9343 | 7 | 38 |
| 5a9s-assembly1.cif.gz_B | nadph complex of imine reductase from amycolatopsis orientalis | 0.9337 | 7 | 34 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DU92_1_145_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9654 | 7 | 34 | 3.40.50.720 |
| af_Q4D0X5_1_185_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9568 | 7 | 34 | 3.40.50.720 |
| af_Q9DBM2_291_471_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9561 | 7 | 37 | 3.40.50.720 |
| 6hrdB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9486 | 7 | 36 | 3.40.50.720 |
| 3gpiA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.945 | 6 | 34 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I5XDF5-F1-model_v4 | Dehydrogenase (Flavoprotein) | 0.9846 | 6 | 377 |
GO:0071949
|
| AF-A0A7W1G065-F1-model_v4 | NAD(P)/FAD-dependent oxidoreductase | 0.974 | 1 | 377 |
|
| AF-A0A4Q5UBM7-F1-model_v4 | Pyridine nucleotide-disulfide oxidoreductase | 0.9728 | 62 | 377 |
GO:0016020
|
| AF-A0A1I5XDF5-F1-model_v4 | Dehydrogenase (Flavoprotein) | 0.9716 | 6 | 377 |
GO:0071949
|
| AF-A0A7W1G065-F1-model_v4 | NAD(P)/FAD-dependent oxidoreductase | 0.9714 | 1 | 377 |
|