F484568

General Info

Members Datasets Scaffolds Average Seq Length
882 317 1764 380

Family's Representative Sequence

Representative Sequence 3300053098|Ga0500650_0096784|Ga0500650_0096784_22_1269
Length 415
Sequence MEMGLSLARCIQECLYRKYKTGIAHHKRRFQGTNSIMSLQPKYDVAIAGGGLAGLALSIQCARAGYKTVLFEREKYPFHKVCGEYISLESWNFLQDLGLPLSDMQLPIINRLLITTPNGNYIETTLPLGGFGISRYTIDHLLANIARQEGVTVLEETKVMNIVYSNNMFHIFTNNGETEATVVAGAYGKRGNLDIKWKRQFTQVKPNKLNHYIAVKYHIRTHHAGDLIALHNFENGYCGISQIEENKYCLCYLTTAANLRKCRNDISSMEKSILMRNPFLEKIFSNAEFLYDEPLTISRISFNKKTQIENHVLMIGDTAGLIAPLCGNGMSMALHSSKLAFEEINSFLQGRINRYEMEIQYTQQWEKFFARRLQVGRLLQSFFGSAFLSNVLIKLVKPFPKFVAFLIQQTHGKPF

Samples

Sample ID Description Type Environment
1 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
210 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
211 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
212 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
271 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
272 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
273 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
274 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
278 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
289 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
290 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
291 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
292 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
293 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
294 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
295 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
296 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
297 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
298 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
301 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
302 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
303 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
305 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
306 2738541278 Niastella sp. CF465 Isolate Unclassified
307 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
308 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
309 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
310 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
311 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
312 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
313 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
314 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
315 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
316 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
317 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 0
Rhizoplane 0.57
Rhizosphere 88.21
Stem 0
Stem Tuber 0
Unclassified 15.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500650_0096784 3300053098 Unclassified 1382
2 JGI24740J21852_10007864 3300001979 Bacteria 4301
3 JGI24740J21852_10010129 3300001979 Bacteria 3647
4 JGI24739J22299_10006664 3300001989 Bacteria 4346
5 JGI24739J22299_10008192 3300001989 Bacteria 3901
6 JGI24737J22298_10000798 3300001990 Bacteria 11169
7 JGI24735J21928_10000017 3300002067 Bacteria 114440
8 JGI24751J29686_10003416 3300002459 Bacteria 3201
9 JGI25162J39368_1000008 3300002737 Bacteria 397212
10 JGI25154J39366_1000031 3300002738 Bacteria 190814
11 JGI25153J46596_10005563 3300003215 Bacteria 6586
12 JGI25153J46596_10009336 3300003215 Unclassified 4578
13 rootH1_10005434 3300003316 Bacteria 18233
14 rootH1_10013656 3300003316 Bacteria 3898
15 rootH2_10000535 3300003320 Bacteria 24013
16 rootH2_10009334 3300003320 Bacteria 10166
17 rootH2_10060262 3300003320 Bacteria 3871
18 rootH2_10065329 3300003320 Bacteria 2225
19 rootH2_10260519 3300003320 Bacteria 2661
20 rootL2_10047246 3300003322 Bacteria 7912
21 rootL2_10094996 3300003322 Bacteria 2984
22 rootL2_10106246 3300003322 Bacteria 2239
23 rootL2_10171473 3300003322 Bacteria 1591
24 rootL2_10223049 3300003322 Bacteria 3129
25 rootH1_10052201 3300003323 Bacteria 4665
26 rootH1_10057964 3300003323 Bacteria 14017
27 rootH1_10123253 3300003323 Bacteria 5109
28 rootH1_10325136 3300003323 Bacteria 4537
29 rootH1_10384659 3300003323 Bacteria 1573
30 JGI25160J50197_1005634 3300003354 Bacteria 5184
31 JGI25160J50197_1006108 3300003354 Bacteria 4913
32 Ga0055528_1001378 3300003790 Bacteria 14923
33 Ga0055530_10002564 3300003791 Bacteria 11538
34 Ga0055531_10000339 3300003794 Bacteria 46111
35 Ga0065165_1000674 3300005262 Bacteria 49121
36 Ga0065165_1002242 3300005262 Bacteria 17168
37 Ga0065165_1016053 3300005262 Bacteria 2822
38 Ga0065714_10106132 3300005288 Bacteria 1540
39 Ga0065704_10107649 3300005289 Bacteria 2050
40 Ga0065712_10001366 3300005290 Bacteria 11529
41 Ga0065712_10116018 3300005290 Bacteria 1740
42 Ga0065712_10127650 3300005290 Unclassified 1578
43 Ga0065712_10179394 3300005290 Bacteria 1200
44 Ga0065715_10094117 3300005293 Unclassified 4438
45 Ga0065707_10098430 3300005295 Bacteria 3086
46 Ga0070658_10001648 3300005327 Bacteria 18875
47 Ga0070658_10253016 3300005327 Unclassified 1494
48 Ga0070676_10001113 3300005328 Bacteria 13439
49 Ga0070676_10033270 3300005328 Unclassified 2957
50 Ga0070676_10063354 3300005328 Unclassified 2202
51 Ga0070676_10126237 3300005328 Bacteria 1612
52 Ga0070676_10185210 3300005328 Bacteria 1356
53 Ga0070683_100002331 3300005329 Bacteria 15055
54 Ga0070683_100033730 3300005329 Bacteria 4669
55 Ga0070683_100055483 3300005329 Bacteria 3677
56 Ga0070683_100084801 3300005329 Bacteria 2969
57 Ga0070690_100012506 3300005330 Bacteria 4994
58 Ga0070690_100099222 3300005330 Unclassified 1929
59 Ga0070690_100106616 3300005330 Bacteria 1864
60 Ga0070690_100182859 3300005330 Bacteria 1449
61 Ga0070670_100063403 3300005331 Bacteria 3172
62 Ga0070670_100066604 3300005331 Bacteria 3090
63 Ga0070670_100073838 3300005331 Bacteria 2930
64 Ga0070670_100195634 3300005331 Bacteria 1756
65 Ga0070670_100356717 3300005331 Unclassified 1285
66 Ga0070677_10031646 3300005333 Bacteria 2023
67 Ga0068869_100021659 3300005334 Bacteria 4424
68 Ga0068869_100024707 3300005334 Bacteria 4164
69 Ga0068869_100032690 3300005334 Bacteria 3668
70 Ga0068869_100044373 3300005334 Unclassified 3197
71 Ga0068869_100063318 3300005334 Bacteria 2717
72 Ga0068869_100073087 3300005334 Bacteria 2542
73 Ga0068869_100247091 3300005334 Unclassified 1424
74 Ga0070666_10000031 3300005335 Bacteria 132089
75 Ga0070666_10000358 3300005335 Bacteria 28682
76 Ga0070666_10056444 3300005335 Bacteria 2652
77 Ga0070680_100003060 3300005336 Bacteria 12409
78 Ga0070680_100008782 3300005336 Bacteria 7752
79 Ga0070682_100002866 3300005337 Bacteria 9563
80 Ga0070682_100037452 3300005337 Bacteria 2970
81 Ga0070682_100086997 3300005337 Unclassified 2036
82 Ga0068868_100000187 3300005338 Bacteria 41327
83 Ga0068868_100000427 3300005338 Bacteria 28309
84 Ga0068868_100023458 3300005338 Unclassified 4670
85 Ga0068868_100027827 3300005338 Bacteria 4315
86 Ga0068868_100056191 3300005338 Bacteria 3107
87 Ga0068868_100088309 3300005338 Bacteria 2495
88 Ga0068868_100154608 3300005338 Bacteria 1891
89 Ga0070660_100011808 3300005339 Bacteria 6223
90 Ga0070660_100060098 3300005339 Bacteria 2949
91 Ga0070660_100085439 3300005339 Unclassified 2482
92 Ga0070689_100006534 3300005340 Bacteria 8082
93 Ga0070689_100008759 3300005340 Bacteria 7141
94 Ga0070691_10006430 3300005341 Bacteria 5370
95 Ga0070661_100019232 3300005344 Bacteria 4865
96 Ga0070668_100003714 3300005347 Bacteria 11263
97 Ga0070668_100033148 3300005347 Unclassified 3932
98 Ga0070669_100004146 3300005353 Bacteria 10519
99 Ga0070669_100049979 3300005353 Unclassified 3053
100 Ga0070669_100139945 3300005353 Bacteria 1865
101 Ga0070675_100007290 3300005354 Bacteria 8533
102 Ga0070675_100007796 3300005354 Bacteria 8292
103 Ga0070675_100015450 3300005354 Bacteria 6037
104 Ga0070675_100089130 3300005354 Unclassified 2582
105 Ga0070675_100146374 3300005354 Bacteria 2023
106 Ga0070675_100189297 3300005354 Unclassified 1782
107 Ga0070675_100336213 3300005354 Bacteria 1337
108 Ga0070671_100004244 3300005355 Bacteria 11343
109 Ga0070671_100032907 3300005355 Unclassified 4285
110 Ga0070671_100062284 3300005355 Unclassified 3106
111 Ga0070671_100087155 3300005355 Unclassified 2613
112 Ga0070674_100009905 3300005356 Bacteria 5736
113 Ga0070674_100023098 3300005356 Bacteria 4019
114 Ga0070674_100217602 3300005356 Bacteria 1484
115 Ga0070673_100000124 3300005364 Bacteria 35840
116 Ga0070673_100018619 3300005364 Bacteria 4966
117 Ga0070673_100052629 3300005364 Bacteria 3195
118 Ga0070673_100129724 3300005364 Unclassified 2113
119 Ga0070673_100151767 3300005364 Unclassified 1962
120 Ga0070688_100005827 3300005365 Bacteria 6522
121 Ga0070688_100021900 3300005365 Bacteria 3738
122 Ga0070688_100029818 3300005365 Unclassified 3269
123 Ga0070688_100045881 3300005365 Unclassified 2703
124 Ga0070659_100003555 3300005366 Bacteria 11096
125 Ga0070659_100007166 3300005366 Bacteria 8090
126 Ga0070659_100010987 3300005366 Bacteria 6686
127 Ga0070659_100083093 3300005366 Bacteria 2559
128 Ga0070667_100000980 3300005367 Bacteria 26248
129 Ga0070667_100007822 3300005367 Bacteria 8866
130 Ga0070667_100011432 3300005367 Bacteria 7340
131 Ga0070667_100014894 3300005367 Bacteria 6425
132 Ga0070667_100202404 3300005367 Bacteria 1762
133 Ga0070667_100212892 3300005367 Bacteria 1718
134 Ga0070701_10009204 3300005438 Unclassified 4319
135 Ga0070701_10012085 3300005438 Bacteria 3882
136 Ga0070700_100028611 3300005441 Unclassified 3317
137 Ga0070700_100102133 3300005441 Unclassified 1891
138 Ga0070678_100010622 3300005456 Bacteria 5636
139 Ga0070678_100034033 3300005456 Bacteria 3545
140 Ga0070678_100039546 3300005456 Bacteria 3328
141 Ga0070678_100064101 3300005456 Bacteria 2722
142 Ga0070678_100064606 3300005456 Bacteria 2713
143 Ga0070662_100010835 3300005457 Bacteria 6003
144 Ga0070662_100011948 3300005457 Bacteria 5742
145 Ga0070662_100093919 3300005457 Unclassified 2258
146 Ga0070681_10035209 3300005458 Bacteria 5029
147 Ga0070681_10088793 3300005458 Bacteria 3043
148 Ga0068867_100003400 3300005459 Bacteria 11202
149 Ga0068867_100153250 3300005459 Bacteria 1812
150 Ga0070685_10003074 3300005466 Bacteria 8501
151 Ga0070685_10009678 3300005466 Bacteria 4989
152 Ga0070685_10010142 3300005466 Unclassified 4890
153 Ga0070685_10019938 3300005466 Bacteria 3625
154 Ga0070685_10082528 3300005466 Unclassified 1929
155 Ga0070685_10121100 3300005466 Bacteria 1625
156 Ga0070698_100001150 3300005471 Bacteria 29264
157 Ga0070698_100030021 3300005471 Bacteria 5641
158 Ga0070698_100215269 3300005471 Bacteria 1855
159 Ga0070679_100003309 3300005530 Bacteria 14759
160 Ga0070679_100026672 3300005530 Bacteria 5681
161 Ga0070684_100001198 3300005535 Bacteria 18634
162 Ga0070684_100133051 3300005535 Bacteria 2244
163 Ga0068853_100002569 3300005539 Bacteria 13648
164 Ga0068853_100003735 3300005539 Bacteria 11682
165 Ga0068853_100020432 3300005539 Bacteria 5507
166 Ga0068853_100023090 3300005539 Bacteria 5205
167 Ga0068853_100026222 3300005539 Bacteria 4893
168 Ga0068853_100030039 3300005539 Bacteria 4587
169 Ga0068853_100062999 3300005539 Bacteria 3211
170 Ga0068853_100080274 3300005539 Bacteria 2854
171 Ga0070672_100000105 3300005543 Bacteria 41868
172 Ga0070672_100014464 3300005543 Bacteria 5593
173 Ga0070672_100025639 3300005543 Bacteria 4376
174 Ga0070672_100062300 3300005543 Unclassified 2943
175 Ga0070672_100122499 3300005543 Unclassified 2130
176 Ga0070672_100162466 3300005543 Bacteria 1854
177 Ga0070672_100255296 3300005543 Bacteria 1477
178 Ga0070686_100001965 3300005544 Bacteria 11413
179 Ga0070686_100056093 3300005544 Unclassified 2526
180 Ga0070693_100004189 3300005547 Bacteria 6810
181 Ga0070665_100000635 3300005548 Bacteria 47836
182 Ga0070665_100004161 3300005548 Bacteria 15222
183 Ga0070665_100060341 3300005548 Bacteria 3802
184 Ga0070665_100098265 3300005548 Bacteria 2932
185 Ga0068855_100007383 3300005563 Bacteria 13306
186 Ga0068855_100031575 3300005563 Bacteria 6325
187 Ga0068855_100040115 3300005563 Bacteria 5558
188 Ga0068855_100234011 3300005563 Unclassified 2055
189 Ga0068855_100252882 3300005563 Bacteria 1965
190 Ga0068855_100396239 3300005563 Bacteria 1514
191 Ga0068855_100440388 3300005563 Bacteria 1423
192 Ga0070664_100001670 3300005564 Bacteria 17755
193 Ga0070664_100006530 3300005564 Bacteria 9403
194 Ga0070664_100035871 3300005564 Bacteria 4164
195 Ga0070664_100055517 3300005564 Bacteria 3363
196 Ga0070664_100224819 3300005564 Bacteria 1680
197 Ga0068857_100007841 3300005577 Bacteria 9207
198 Ga0068857_100011785 3300005577 Bacteria 7604
199 Ga0068857_100022154 3300005577 Bacteria 5590
200 Ga0068857_100025313 3300005577 Bacteria 5226
201 Ga0068857_100072692 3300005577 Bacteria 3064
202 Ga0068854_100112571 3300005578 Unclassified 2055
203 Ga0068854_100207329 3300005578 Bacteria 1544
204 Ga0068856_100011695 3300005614 Bacteria 8514
205 Ga0068856_100099440 3300005614 Unclassified 2900
206 Ga0070702_100164966 3300005615 Unclassified 1435
207 Ga0068852_100000346 3300005616 Bacteria 31188
208 Ga0068852_100000848 3300005616 Bacteria 20294
209 Ga0068852_100005012 3300005616 Bacteria 9417
210 Ga0068852_100031520 3300005616 Bacteria 4376
211 Ga0068852_100043934 3300005616 Bacteria 3792
212 Ga0068852_100262701 3300005616 Bacteria 1658
213 Ga0068852_100446640 3300005616 Bacteria 1279
214 Ga0068859_100000045 3300005617 Bacteria 143607
215 Ga0068859_100017677 3300005617 Bacteria 7169
216 Ga0068859_100026115 3300005617 Bacteria 5858
217 Ga0068859_100051384 3300005617 Bacteria 4143
218 Ga0068859_100076568 3300005617 Bacteria 3386
219 Ga0068859_100102372 3300005617 Unclassified 2921
220 Ga0068859_100104773 3300005617 Bacteria 2888
221 Ga0068859_100343363 3300005617 Bacteria 1587
222 Ga0068859_100348617 3300005617 Bacteria 1575
223 Ga0068864_100001254 3300005618 Bacteria 21079
224 Ga0068864_100001485 3300005618 Bacteria 19316
225 Ga0068864_100062304 3300005618 Bacteria 3232
226 Ga0068864_100139884 3300005618 Bacteria 2183
227 Ga0068864_100141100 3300005618 Unclassified 2173
228 Ga0068864_100200204 3300005618 Bacteria 1834
229 Ga0068866_10035912 3300005718 Bacteria 2424
230 Ga0068866_10064506 3300005718 Bacteria 1913
231 Ga0068861_100004748 3300005719 Bacteria 9135
232 Ga0068861_100005264 3300005719 Bacteria 8722
233 Ga0068861_100007098 3300005719 Bacteria 7665
234 Ga0068861_100024725 3300005719 Bacteria 4347
235 Ga0068861_100126447 3300005719 Bacteria 2069
236 Ga0068861_100240458 3300005719 Bacteria 1540
237 Ga0068851_10019459 3300005834 Bacteria 3281
238 Ga0068851_10058875 3300005834 Bacteria 1964
239 Ga0068851_10069680 3300005834 Unclassified 1817
240 Ga0068870_10006462 3300005840 Bacteria 5170
241 Ga0068870_10012943 3300005840 Bacteria 3909
242 Ga0068870_10142548 3300005840 Bacteria 1403
243 Ga0068863_100001976 3300005841 Bacteria 20394
244 Ga0068863_100002352 3300005841 Bacteria 18798
245 Ga0068863_100006695 3300005841 Bacteria 11308
246 Ga0068863_100028179 3300005841 Bacteria 5362
247 Ga0068863_100060096 3300005841 Bacteria 3595
248 Ga0068863_100094977 3300005841 Unclassified 2830
249 Ga0068863_100379847 3300005841 Bacteria 1379
250 Ga0068858_100003543 3300005842 Bacteria 15456
251 Ga0068858_100010584 3300005842 Bacteria 8734
252 Ga0068858_100360129 3300005842 Bacteria 1394
253 Ga0068860_100001418 3300005843 Bacteria 25953
254 Ga0068860_100003309 3300005843 Bacteria 16586
255 Ga0068860_100003540 3300005843 Bacteria 16061
256 Ga0068860_100019177 3300005843 Bacteria 6639
257 Ga0068860_100084371 3300005843 Bacteria 3022
258 Ga0068860_100155788 3300005843 Unclassified 2201
259 Ga0068860_100210957 3300005843 Bacteria 1884
260 Ga0068860_100277314 3300005843 Unclassified 1638
261 Ga0081539_10000338 3300005985 Bacteria 103849
262 Ga0070715_10007211 3300006163 Unclassified 3820
263 Ga0075366_10000019 3300006195 Bacteria 59333
264 Ga0075366_10003888 3300006195 Bacteria 7964
265 Ga0097621_100000499 3300006237 Bacteria 27492
266 Ga0097621_100001817 3300006237 Bacteria 14674
267 Ga0097621_100011606 3300006237 Bacteria 6494
268 Ga0097621_100093297 3300006237 Bacteria 2522
269 Ga0097621_100109682 3300006237 Unclassified 2331
270 Ga0097621_100145495 3300006237 Unclassified 2029
271 Ga0097621_100202856 3300006237 Bacteria 1722
272 Ga0097621_100364436 3300006237 Bacteria 1288
273 Ga0068871_100002567 3300006358 Bacteria 12404
274 Ga0068871_100035949 3300006358 Bacteria 3940
275 Ga0068871_100045193 3300006358 Unclassified 3544
276 Ga0068871_100052861 3300006358 Bacteria 3291
277 Ga0068871_100190333 3300006358 Bacteria 1767
278 Ga0075428_100023898 3300006844 Bacteria 6763
279 Ga0075428_100032712 3300006844 Bacteria 5743
280 Ga0075430_100148523 3300006846 Bacteria 1952
281 Ga0075431_100060606 3300006847 Unclassified 3904
282 Ga0075434_100009056 3300006871 Bacteria 9272
283 Ga0075429_100018515 3300006880 Bacteria 6031
284 Ga0068865_100001094 3300006881 Bacteria 15637
285 Ga0068865_100013971 3300006881 Bacteria 5094
286 Ga0068865_100016931 3300006881 Bacteria 4677
287 Ga0097620_100000045 3300006931 Bacteria 143607
288 Ga0097620_100017677 3300006931 Bacteria 7169
289 Ga0097620_100026115 3300006931 Bacteria 5858
290 Ga0097620_100051384 3300006931 Bacteria 4143
291 Ga0097620_100076565 3300006931 Bacteria 3386
292 Ga0097620_100102381 3300006931 Unclassified 2921
293 Ga0097620_100104767 3300006931 Bacteria 2888
294 Ga0097620_100343394 3300006931 Bacteria 1587
295 Ga0097620_100348632 3300006931 Bacteria 1575
296 Ga0105240_10009860 3300009093 Bacteria 13483
297 Ga0105240_10279853 3300009093 Bacteria 1917
298 Ga0105240_10328934 3300009093 Unclassified 1739
299 Ga0111539_10003835 3300009094 Bacteria 19797
300 Ga0111539_10019523 3300009094 Bacteria 8363
301 Ga0111539_10023564 3300009094 Bacteria 7564
302 Ga0111539_10345894 3300009094 Bacteria 1731
303 Ga0111539_10468252 3300009094 Bacteria 1467
304 Ga0105245_10045188 3300009098 Bacteria 3932
305 Ga0105247_10003492 3300009101 Bacteria 10227
306 Ga0105247_10003520 3300009101 Bacteria 10181
307 Ga0114129_10052288 3300009147 Bacteria 5733
308 Ga0114129_10082403 3300009147 Bacteria 4470
309 Ga0105241_10000985 3300009174 Bacteria 21588
310 Ga0105241_10001733 3300009174 Bacteria 16555
311 Ga0105241_10038447 3300009174 Bacteria 3607
312 Ga0105241_10042560 3300009174 Bacteria 3437
313 Ga0105242_10010544 3300009176 Bacteria 7096
314 Ga0105242_10023228 3300009176 Bacteria 4888
315 Ga0105242_10042593 3300009176 Bacteria 3667
316 Ga0105242_10068614 3300009176 Bacteria 2934
317 Ga0105242_10083795 3300009176 Bacteria 2670
318 Ga0105248_10022859 3300009177 Bacteria 6942
319 Ga0105248_10038321 3300009177 Bacteria 5364
320 Ga0105237_10005841 3300009545 Bacteria 13809
321 Ga0105237_10031028 3300009545 Bacteria 5421
322 Ga0105237_10038920 3300009545 Bacteria 4802
323 Ga0105238_10283215 3300009551 Bacteria 1639
324 Ga0105249_10004538 3300009553 Bacteria 12003
325 Ga0105249_10011505 3300009553 Bacteria 7773
326 Ga0105249_10011753 3300009553 Bacteria 7697
327 Ga0105249_10011841 3300009553 Bacteria 7667
328 Ga0105249_10019342 3300009553 Bacteria 6074
329 Ga0105249_10020335 3300009553 Bacteria 5936
330 Ga0105249_10020437 3300009553 Bacteria 5919
331 Ga0105249_10028339 3300009553 Bacteria 5055
332 Ga0105249_10028806 3300009553 Bacteria 5013
333 Ga0105249_10055784 3300009553 Unclassified 3616
334 Ga0105249_10089921 3300009553 Bacteria 2870
335 Ga0105249_10180151 3300009553 Bacteria 2055
336 Ga0105249_10286489 3300009553 Bacteria 1647
337 Ga0105239_10000912 3300010375 Bacteria 41956
338 Ga0105239_10026168 3300010375 Bacteria 6422
339 Ga0105239_10034551 3300010375 Bacteria 5552
340 Ga0105239_10073498 3300010375 Bacteria 3759
341 Ga0105239_10119273 3300010375 Unclassified 2928
342 Ga0105246_10029025 3300011119 Bacteria 3638
343 Ga0157373_10005810 3300013100 Bacteria 9235
344 Ga0157373_10014805 3300013100 Bacteria 5714
345 Ga0157373_10017113 3300013100 Bacteria 5279
346 Ga0157373_10033068 3300013100 Bacteria 3722
347 Ga0157371_10000284 3300013102 Bacteria 68549
348 Ga0157371_10000725 3300013102 Bacteria 38633
349 Ga0157371_10002541 3300013102 Bacteria 17330
350 Ga0157371_10006439 3300013102 Bacteria 9687
351 Ga0157371_10015828 3300013102 Bacteria 5642
352 Ga0157371_10018851 3300013102 Bacteria 5097
353 Ga0157371_10020967 3300013102 Bacteria 4804
354 Ga0157371_10033620 3300013102 Bacteria 3683
355 Ga0157371_10045630 3300013102 Bacteria 3118
356 Ga0157371_10091942 3300013102 Unclassified 2149
357 Ga0157371_10126626 3300013102 Unclassified 1817
358 Ga0157371_10146305 3300013102 Bacteria 1684
359 Ga0157370_10001924 3300013104 Bacteria 25541
360 Ga0157370_10004751 3300013104 Bacteria 15462
361 Ga0157370_10021147 3300013104 Bacteria 6488
362 Ga0157370_10025275 3300013104 Bacteria 5879
363 Ga0157370_10157833 3300013104 Bacteria 2110
364 Ga0157369_10000101 3300013105 Bacteria 118683
365 Ga0157369_10020421 3300013105 Bacteria 7403
366 Ga0157369_10198558 3300013105 Bacteria 2106
367 Ga0157369_10261390 3300013105 Bacteria 1805
368 Ga0157374_10000025 3300013296 Bacteria 245131
369 Ga0157374_10000260 3300013296 Bacteria 48732
370 Ga0157374_10002980 3300013296 Bacteria 14179
371 Ga0157374_10020690 3300013296 Bacteria 5842
372 Ga0157374_10027083 3300013296 Bacteria 5166
373 Ga0157374_10043533 3300013296 Bacteria 4148
374 Ga0157374_10165320 3300013296 Bacteria 2156
375 Ga0157374_10264534 3300013296 Unclassified 1695
376 Ga0157378_10003039 3300013297 Bacteria 14913
377 Ga0157378_10013251 3300013297 Bacteria 7209
378 Ga0157378_10014666 3300013297 Bacteria 6863
379 Ga0157378_10023246 3300013297 Bacteria 5455
380 Ga0157378_10023750 3300013297 Bacteria 5394
381 Ga0157378_10136186 3300013297 Bacteria 2277
382 Ga0157378_10147537 3300013297 Bacteria 2189
383 Ga0157378_10208511 3300013297 Bacteria 1852
384 Ga0163162_10000312 3300013306 Bacteria 45022
385 Ga0163162_10001523 3300013306 Bacteria 21599
386 Ga0163162_10002647 3300013306 Bacteria 16974
387 Ga0163162_10004060 3300013306 Bacteria 14047
388 Ga0163162_10004258 3300013306 Bacteria 13763
389 Ga0163162_10007829 3300013306 Bacteria 10415
390 Ga0163162_10010039 3300013306 Bacteria 9207
391 Ga0163162_10022439 3300013306 Bacteria 6218
392 Ga0163162_10027004 3300013306 Bacteria 5677
393 Ga0163162_10069905 3300013306 Unclassified 3563
394 Ga0163162_10076787 3300013306 Unclassified 3403
395 Ga0163162_10179217 3300013306 Unclassified 2245
396 Ga0163162_10241612 3300013306 Bacteria 1937
397 Ga0163162_10317583 3300013306 Unclassified 1690
398 Ga0157372_10000041 3300013307 Bacteria 158494
399 Ga0157372_10004075 3300013307 Bacteria 15665
400 Ga0157372_10009342 3300013307 Bacteria 10434
401 Ga0157372_10018758 3300013307 Bacteria 7443
402 Ga0157372_10023974 3300013307 Bacteria 6620
403 Ga0157372_10025872 3300013307 Bacteria 6382
404 Ga0157372_10038600 3300013307 Bacteria 5270
405 Ga0157372_10091463 3300013307 Bacteria 3460
406 Ga0157372_10154083 3300013307 Bacteria 2654
407 Ga0157372_10233398 3300013307 Bacteria 2133
408 Ga0157372_10254266 3300013307 Bacteria 2040
409 Ga0157372_10336238 3300013307 Bacteria 1759
410 Ga0157372_10338989 3300013307 Unclassified 1751
411 Ga0157372_10432189 3300013307 Unclassified 1535
412 Ga0157375_10000686 3300013308 Bacteria 29989
413 Ga0157375_10002871 3300013308 Bacteria 14932
414 Ga0157375_10010009 3300013308 Bacteria 8337
415 Ga0157375_10027553 3300013308 Bacteria 5312
416 Ga0157375_10048720 3300013308 Unclassified 4146
417 Ga0157375_10068834 3300013308 Bacteria 3543
418 Ga0157375_10167958 3300013308 Unclassified 2340
419 Ga0157375_10172169 3300013308 Unclassified 2313
420 Ga0157375_10220697 3300013308 Bacteria 2054
421 Ga0157375_10237935 3300013308 Bacteria 1980
422 Ga0157375_10382797 3300013308 Bacteria 1573
423 Ga0163163_10000279 3300014325 Bacteria 50882
424 Ga0163163_10000344 3300014325 Bacteria 44689
425 Ga0163163_10000346 3300014325 Bacteria 44619
426 Ga0163163_10012583 3300014325 Bacteria 7718
427 Ga0157380_10003974 3300014326 Bacteria 10206
428 Ga0157380_10017475 3300014326 Bacteria 5307
429 Ga0157380_10093099 3300014326 Bacteria 2492
430 Ga0157380_10144080 3300014326 Unclassified 2051
431 Ga0157380_10198731 3300014326 Bacteria 1777
432 Ga0157380_10408648 3300014326 Bacteria 1290
433 Ga0157377_10001633 3300014745 Bacteria 9771
434 Ga0157377_10007473 3300014745 Bacteria 5280
435 Ga0157377_10008716 3300014745 Bacteria 4957
436 Ga0157377_10076132 3300014745 Bacteria 1951
437 Ga0157377_10087828 3300014745 Bacteria 1830
438 Ga0157377_10162705 3300014745 Unclassified 1389
439 Ga0157379_10000242 3300014968 Bacteria 42795
440 Ga0157379_10011127 3300014968 Bacteria 7844
441 Ga0157379_10116865 3300014968 Unclassified 2399
442 Ga0157379_10119903 3300014968 Unclassified 2366
443 Ga0157379_10121227 3300014968 Bacteria 2352
444 Ga0157379_10342037 3300014968 Bacteria 1368
445 Ga0157376_10001139 3300014969 Bacteria 17447
446 Ga0157376_10002821 3300014969 Bacteria 11880
447 Ga0157376_10004535 3300014969 Bacteria 9671
448 Ga0157376_10007029 3300014969 Bacteria 7989
449 Ga0157376_10053690 3300014969 Unclassified 3356
450 Ga0157376_10058402 3300014969 Bacteria 3231
451 Ga0157376_10062238 3300014969 Bacteria 3140
452 Ga0157376_10092562 3300014969 Unclassified 2621
453 Ga0157376_10242124 3300014969 Bacteria 1681
454 Ga0163161_10005088 3300017792 Bacteria 9153
455 Ga0163161_10006224 3300017792 Bacteria 8270
456 Ga0163161_10014267 3300017792 Bacteria 5533
457 Ga0163161_10018549 3300017792 Bacteria 4875
458 Ga0163161_10045337 3300017792 Bacteria 3170
459 Ga0209437_100030 3300025233 Bacteria 532466
460 Ga0209646_1000009 3300025246 Bacteria 652154
461 Ga0209026_1000396 3300025250 Bacteria 38774
462 Ga0209129_1018752 3300025258 Bacteria 1323
463 Ga0209673_1000016 3300025273 Bacteria 506202
464 Ga0209564_1004934 3300025295 Bacteria 7886
465 Ga0209564_1027372 3300025295 Unclassified 1853
466 Ga0209758_1010285 3300025297 Bacteria 5627
467 Ga0209758_1020363 3300025297 Unclassified 3142
468 Ga0209050_1000124 3300025298 Bacteria 194022
469 Ga0207426_1000339 3300025302 Bacteria 87978
470 Ga0207426_1000520 3300025302 Bacteria 56091
471 Ga0209257_1000007 3300025304 Bacteria 1564415
472 Ga0209257_1000658 3300025304 Bacteria 54552
473 Ga0207656_10056650 3300025321 Unclassified 1709
474 Ga0207682_10086308 3300025893 Bacteria 1353
475 Ga0207710_10002713 3300025900 Bacteria 8106
476 Ga0207710_10014697 3300025900 Bacteria 3304
477 Ga0207688_10043312 3300025901 Bacteria 2506
478 Ga0207680_10000141 3300025903 Bacteria 34433
479 Ga0207680_10003927 3300025903 Bacteria 7016
480 Ga0207647_10000017 3300025904 Bacteria 129999
481 Ga0207647_10001876 3300025904 Bacteria 16095
482 Ga0207647_10061601 3300025904 Bacteria 2288
483 Ga0207645_10001794 3300025907 Bacteria 17325
484 Ga0207645_10019981 3300025907 Unclassified 4384
485 Ga0207645_10085980 3300025907 Bacteria 2020
486 Ga0207643_10009744 3300025908 Bacteria 5155
487 Ga0207643_10011999 3300025908 Bacteria 4679
488 Ga0207643_10030872 3300025908 Unclassified 2985
489 Ga0207705_10011048 3300025909 Bacteria 6547
490 Ga0207705_10012513 3300025909 Bacteria 6127
491 Ga0207705_10017600 3300025909 Bacteria 5114
492 Ga0207654_10003695 3300025911 Bacteria 7718
493 Ga0207654_10006489 3300025911 Bacteria 5888
494 Ga0207654_10026732 3300025911 Unclassified 3129
495 Ga0207654_10051192 3300025911 Unclassified 2376
496 Ga0207707_10003504 3300025912 Bacteria 13893
497 Ga0207707_10069683 3300025912 Bacteria 3065
498 Ga0207707_10121299 3300025912 Bacteria 2286
499 Ga0207695_10004070 3300025913 Bacteria 20110
500 Ga0207695_10186606 3300025913 Bacteria 1992
501 Ga0207671_10009957 3300025914 Bacteria 7899
502 Ga0207671_10022002 3300025914 Bacteria 4829
503 Ga0207671_10026640 3300025914 Bacteria 4329
504 Ga0207660_10005510 3300025917 Bacteria 8222
505 Ga0207660_10138805 3300025917 Bacteria 1857
506 Ga0207660_10303350 3300025917 Bacteria 1272
507 Ga0207662_10021541 3300025918 Bacteria 3686
508 Ga0207657_10009181 3300025919 Bacteria 9972
509 Ga0207657_10018805 3300025919 Bacteria 6580
510 Ga0207657_10023896 3300025919 Bacteria 5676
511 Ga0207657_10084500 3300025919 Unclassified 2660
512 Ga0207649_10061049 3300025920 Bacteria 2371
513 Ga0207652_10000045 3300025921 Bacteria 125343
514 Ga0207652_10000819 3300025921 Bacteria 29643
515 Ga0207652_10008710 3300025921 Bacteria 8165
516 Ga0207652_10016246 3300025921 Bacteria 6073
517 Ga0207681_10001974 3300025923 Bacteria 13164
518 Ga0207681_10216315 3300025923 Bacteria 1480
519 Ga0207650_10002954 3300025925 Bacteria 11729
520 Ga0207650_10024003 3300025925 Unclassified 4330
521 Ga0207650_10046246 3300025925 Bacteria 3205
522 Ga0207650_10071885 3300025925 Bacteria 2603
523 Ga0207650_10128871 3300025925 Bacteria 1978
524 Ga0207659_10156743 3300025926 Unclassified 1784
525 Ga0207644_10008911 3300025931 Bacteria 6573
526 Ga0207644_10051636 3300025931 Unclassified 2952
527 Ga0207644_10194649 3300025931 Bacteria 1596
528 Ga0207690_10005074 3300025932 Bacteria 7777
529 Ga0207690_10011163 3300025932 Bacteria 5361
530 Ga0207706_10003994 3300025933 Bacteria 13976
531 Ga0207706_10007275 3300025933 Bacteria 10234
532 Ga0207706_10031804 3300025933 Bacteria 4699
533 Ga0207706_10069185 3300025933 Bacteria 3105
534 Ga0207686_10024411 3300025934 Bacteria 3503
535 Ga0207686_10094005 3300025934 Unclassified 1986
536 Ga0207686_10100281 3300025934 Unclassified 1932
537 Ga0207670_10006784 3300025936 Bacteria 6368
538 Ga0207670_10013543 3300025936 Bacteria 4814
539 Ga0207670_10018759 3300025936 Bacteria 4213
540 Ga0207669_10044918 3300025937 Bacteria 2600
541 Ga0207669_10099177 3300025937 Bacteria 1920
542 Ga0207704_10009869 3300025938 Bacteria 4628
543 Ga0207704_10082330 3300025938 Bacteria 2085
544 Ga0207691_10000012 3300025940 Bacteria 147942
545 Ga0207691_10004759 3300025940 Bacteria 13125
546 Ga0207691_10025875 3300025940 Bacteria 5507
547 Ga0207691_10039568 3300025940 Bacteria 4361
548 Ga0207691_10049190 3300025940 Unclassified 3863
549 Ga0207691_10158279 3300025940 Bacteria 1988
550 Ga0207689_10008936 3300025942 Bacteria 8687
551 Ga0207689_10008992 3300025942 Bacteria 8653
552 Ga0207689_10017516 3300025942 Bacteria 6060
553 Ga0207689_10018137 3300025942 Bacteria 5944
554 Ga0207689_10029050 3300025942 Unclassified 4621
555 Ga0207689_10044379 3300025942 Bacteria 3676
556 Ga0207689_10063876 3300025942 Unclassified 3029
557 Ga0207689_10072143 3300025942 Bacteria 2836
558 Ga0207689_10092711 3300025942 Unclassified 2481
559 Ga0207689_10190714 3300025942 Bacteria 1691
560 Ga0207661_10003108 3300025944 Bacteria 11489
561 Ga0207661_10034774 3300025944 Bacteria 3922
562 Ga0207661_10110823 3300025944 Bacteria 2321
563 Ga0207679_10004210 3300025945 Bacteria 8939
564 Ga0207679_10012502 3300025945 Bacteria 5535
565 Ga0207679_10017260 3300025945 Unclassified 4811
566 Ga0207679_10124715 3300025945 Bacteria 2056
567 Ga0207667_10016855 3300025949 Bacteria 8241
568 Ga0207667_10026076 3300025949 Bacteria 6391
569 Ga0207667_10033422 3300025949 Bacteria 5529
570 Ga0207667_10034450 3300025949 Bacteria 5437
571 Ga0207667_10038329 3300025949 Bacteria 5120
572 Ga0207667_10073195 3300025949 Bacteria 3561
573 Ga0207667_10247632 3300025949 Bacteria 1823
574 Ga0207651_10000216 3300025960 Bacteria 24808
575 Ga0207651_10005231 3300025960 Bacteria 6633
576 Ga0207651_10191831 3300025960 Bacteria 1630
577 Ga0207651_10232295 3300025960 Bacteria 1498
578 Ga0207651_10306359 3300025960 Bacteria 1323
579 Ga0207712_10000976 3300025961 Bacteria 20527
580 Ga0207712_10007162 3300025961 Bacteria 7035
581 Ga0207712_10010440 3300025961 Bacteria 5896
582 Ga0207712_10022982 3300025961 Bacteria 4111
583 Ga0207712_10025198 3300025961 Bacteria 3950
584 Ga0207712_10039279 3300025961 Unclassified 3242
585 Ga0207712_10071369 3300025961 Bacteria 2497
586 Ga0207712_10148236 3300025961 Bacteria 1809
587 Ga0207712_10234090 3300025961 Unclassified 1476
588 Ga0207668_10001361 3300025972 Bacteria 14445
589 Ga0207668_10085311 3300025972 Bacteria 2304
590 Ga0207658_10000374 3300025986 Bacteria 43784
591 Ga0207658_10008025 3300025986 Bacteria 7193
592 Ga0207658_10011120 3300025986 Bacteria 6129
593 Ga0207658_10011371 3300025986 Bacteria 6057
594 Ga0207658_10113347 3300025986 Bacteria 2148
595 Ga0207677_10000984 3300026023 Bacteria 15691
596 Ga0207677_10006012 3300026023 Bacteria 6614
597 Ga0207677_10018387 3300026023 Unclassified 4193
598 Ga0207677_10116904 3300026023 Bacteria 1998
599 Ga0207703_10009315 3300026035 Bacteria 7717
600 Ga0207703_10019138 3300026035 Bacteria 5348
601 Ga0207703_10079753 3300026035 Unclassified 2725
602 Ga0207703_10275967 3300026035 Bacteria 1525
603 Ga0207639_10016498 3300026041 Bacteria 5229
604 Ga0207639_10021770 3300026041 Bacteria 4608
605 Ga0207639_10029603 3300026041 Bacteria 4011
606 Ga0207639_10032242 3300026041 Unclassified 3856
607 Ga0207639_10066918 3300026041 Bacteria 2794
608 Ga0207639_10066998 3300026041 Bacteria 2793
609 Ga0207678_10013503 3300026067 Bacteria 7170
610 Ga0207678_10031808 3300026067 Unclassified 4601
611 Ga0207708_10034032 3300026075 Unclassified 3875
612 Ga0207708_10051340 3300026075 Bacteria 3139
613 Ga0207708_10105301 3300026075 Unclassified 2186
614 Ga0207702_10026475 3300026078 Bacteria 4814
615 Ga0207702_10091342 3300026078 Bacteria 2666
616 Ga0207641_10000146 3300026088 Bacteria 100666
617 Ga0207641_10000947 3300026088 Bacteria 29805
618 Ga0207641_10007761 3300026088 Bacteria 8917
619 Ga0207641_10040757 3300026088 Unclassified 3890
620 Ga0207641_10073253 3300026088 Bacteria 2951
621 Ga0207641_10104865 3300026088 Unclassified 2496
622 Ga0207641_10110213 3300026088 Bacteria 2439
623 Ga0207641_10184962 3300026088 Bacteria 1911
624 Ga0207648_10001615 3300026089 Bacteria 24715
625 Ga0207648_10010253 3300026089 Bacteria 8899
626 Ga0207648_10018048 3300026089 Bacteria 6394
627 Ga0207648_10020364 3300026089 Bacteria 5974
628 Ga0207648_10048905 3300026089 Bacteria 3702
629 Ga0207648_10056374 3300026089 Bacteria 3430
630 Ga0207648_10064755 3300026089 Bacteria 3186
631 Ga0207648_10122109 3300026089 Bacteria 2290
632 Ga0207648_10173460 3300026089 Bacteria 1907
633 Ga0207676_10000697 3300026095 Bacteria 26479
634 Ga0207676_10003591 3300026095 Bacteria 10965
635 Ga0207676_10005018 3300026095 Bacteria 9372
636 Ga0207676_10077658 3300026095 Unclassified 2687
637 Ga0207676_10111982 3300026095 Bacteria 2286
638 Ga0207676_10202536 3300026095 Bacteria 1755
639 Ga0207676_10257722 3300026095 Bacteria 1573
640 Ga0207674_10004031 3300026116 Bacteria 17828
641 Ga0207674_10010211 3300026116 Bacteria 10664
642 Ga0207674_10014867 3300026116 Bacteria 8583
643 Ga0207674_10033271 3300026116 Bacteria 5399
644 Ga0207674_10070579 3300026116 Bacteria 3512
645 Ga0207674_10095119 3300026116 Bacteria 2965
646 Ga0207674_10271928 3300026116 Bacteria 1642
647 Ga0207675_100001183 3300026118 Bacteria 25978
648 Ga0207675_100005430 3300026118 Bacteria 12213
649 Ga0207675_100034881 3300026118 Bacteria 4691
650 Ga0207675_100139304 3300026118 Bacteria 2304
651 Ga0207675_100219101 3300026118 Bacteria 1833
652 Ga0207683_10000943 3300026121 Bacteria 26669
653 Ga0207683_10017143 3300026121 Bacteria 6166
654 Ga0207683_10020984 3300026121 Bacteria 5591
655 Ga0207683_10025629 3300026121 Bacteria 5088
656 Ga0207683_10070461 3300026121 Unclassified 3089
657 Ga0207683_10138987 3300026121 Bacteria 2188
658 Ga0207698_10003512 3300026142 Bacteria 9452
659 Ga0207698_10009340 3300026142 Bacteria 6249
660 Ga0207428_10006992 3300027907 Bacteria 10334
661 Ga0207428_10012094 3300027907 Bacteria 7596
662 Ga0268266_10005379 3300028379 Bacteria 11960
663 Ga0268266_10019071 3300028379 Bacteria 5842
664 Ga0268266_10035267 3300028379 Unclassified 4255
665 Ga0268265_10009351 3300028380 Bacteria 6624
666 Ga0268265_10011180 3300028380 Bacteria 6066
667 Ga0268264_10003975 3300028381 Bacteria 12651
668 Ga0268264_10006744 3300028381 Bacteria 9649
669 Ga0268264_10008474 3300028381 Bacteria 8550
670 Ga0268264_10046760 3300028381 Unclassified 3595
671 Ga0268264_10050397 3300028381 Bacteria 3467
672 Ga0268264_10102312 3300028381 Unclassified 2493
673 Ga0307515_10000012 3300028794 Bacteria 582232
674 Ga0307515_10000077 3300028794 Bacteria 228162
675 Ga0307515_10012976 3300028794 Bacteria 15612
676 Ga0307515_10063170 3300028794 Bacteria 5210
677 Ga0307515_10078481 3300028794 Bacteria 4341
678 Ga0265340_10086342 3300031247 Unclassified 1472
679 Ga0265327_10000759 3300031251 Bacteria 50085
680 Ga0307513_10235444 3300031456 Bacteria 1641
681 Ga0307509_10020532 3300031507 Bacteria 7491
682 Ga0307509_10083480 3300031507 Bacteria 3293
683 Ga0307509_10205242 3300031507 Unclassified 1802
684 Ga0307509_10221519 3300031507 Unclassified 1704
685 Ga0307408_100000332 3300031548 Bacteria 45065
686 Ga0307408_100000341 3300031548 Bacteria 43952
687 Ga0307408_100000410 3300031548 Bacteria 38631
688 Ga0307408_100016173 3300031548 Unclassified 4975
689 Ga0307508_10001024 3300031616 Bacteria 32462
690 Ga0307514_10051315 3300031649 Bacteria 3197
691 Ga0307516_10243084 3300031730 Bacteria 1498
692 Ga0307405_10005405 3300031731 Bacteria 6160
693 Ga0307405_10112520 3300031731 Bacteria 1847
694 Ga0307413_10008468 3300031824 Bacteria 4858
695 Ga0307413_10156833 3300031824 Bacteria 1594
696 Ga0307412_10012107 3300031911 Bacteria 5015
697 Ga0307416_100032160 3300032002 Unclassified 3960
698 Ga0307414_10000059 3300032004 Bacteria 112136
699 Ga0307414_10018672 3300032004 Unclassified 4277
700 Ga0307411_10106252 3300032005 Unclassified 1998
701 Ga0307415_100117466 3300032126 Bacteria 1987
702 Ga0307507_10000143 3300033179 Bacteria 124248
703 Ga0373924_0022664 3300035410 Unclassified 2456
704 Ga0373947_0055487 3300035725 Unclassified 2393
705 Ga0373947_0062781 3300035725 Bacteria 2262
706 Ga0373937_0006671 3300036401 Bacteria 9965
707 Ga0373937_0214143 3300036401 Bacteria 1813
708 Ga0373937_0338191 3300036401 Bacteria 1425
709 Ga0395899_0000024 3300037312 Bacteria 357402
710 Ga0395899_0008398 3300037312 Bacteria 7952
711 Ga0395900_0008499 3300037418 Bacteria 10554
712 Ga0395900_0126322 3300037418 Bacteria 2623
713 Ga0395900_0222896 3300037418 Bacteria 1900
714 Ga0395898_0003718 3300037466 Bacteria 16922
715 Ga0395898_0013466 3300037466 Bacteria 8421
716 Ga0395905_0009765 3300037471 Bacteria 9359
717 Ga0395905_0306613 3300037471 Bacteria 1476
718 Ga0395901_0005062 3300038443 Bacteria 13315
719 Ga0395901_0012431 3300038443 Bacteria 8638
720 Ga0395901_0045981 3300038443 Bacteria 4532
721 Ga0436365_0603123 3300039437 Bacteria 11515
722 Ga0439436_0007478 3300041404 Bacteria 3361
723 Ga0439457_000930 3300042014 Bacteria 8796
724 Ga0450898_000889 3300042134 Bacteria 3737
725 Ga0439434_0009601 3300042435 Bacteria 2847
726 Ga0451577_0005791 3300042876 Bacteria 12520
727 Ga0451577_0249649 3300042876 Bacteria 1606
728 Ga0466969_0000004 3300044656 Bacteria 168068
729 Ga0466972_0000016 3300044658 Bacteria 208802
730 Ga0466972_0000017 3300044658 Bacteria 199884
731 Ga0466972_0015930 3300044658 Bacteria 3759
732 Ga0453683_0005930 3300044673 Bacteria 8435
733 Ga0466965_0068862 3300044683 Bacteria 1777
734 Ga0466966_0000295 3300044684 Bacteria 32723
735 Ga0466966_0087727 3300044684 Bacteria 1933
736 Ga0466961_0002760 3300044693 Bacteria 10928
737 Ga0466961_0014977 3300044693 Unclassified 4979
738 Ga0453684_0001190 3300044712 Bacteria 80396
739 Ga0466971_0011031 3300044719 Unclassified 3956
740 Ga0466968_0002708 3300044735 Bacteria 6538
741 Ga0466970_0003015 3300044765 Bacteria 8162
742 Ga0466970_0055835 3300044765 Bacteria 2110
743 Ga0466957_0000367 3300044842 Bacteria 22106
744 Ga0466959_0000004 3300045049 Bacteria 216815
745 Ga0466959_0000819 3300045049 Bacteria 18344
746 Ga0451576_0029084 3300045051 Bacteria 5914
747 Ga0466967_0204488 3300045976 Unclassified 1871
748 Ga0495592_0049965 3300046454 Unclassified 3108
749 Ga0495651_0024770 3300046462 Bacteria 4669
750 Ga0495650_0000050 3300046471 Bacteria 318894
751 Ga0495582_0041520 3300046473 Bacteria 2535
752 Ga0495585_0001264 3300046492 Bacteria 20274
753 Ga0495585_0002275 3300046492 Bacteria 13869
754 Ga0495583_0009815 3300046506 Bacteria 5674
755 Ga0495583_0061182 3300046506 Unclassified 1681
756 Ga0495606_0000505 3300046507 Bacteria 63449
757 Ga0495606_0005343 3300046507 Bacteria 12344
758 Ga0495606_0018126 3300046507 Bacteria 5292
759 Ga0495616_0000296 3300046513 Bacteria 40157
760 Ga0495616_0015185 3300046513 Bacteria 4285
761 Ga0495628_0022064 3300046516 Bacteria 5233
762 Ga0495643_0031267 3300046522 Unclassified 2964
763 Ga0495648_0052548 3300046524 Bacteria 2474
764 Ga0495587_0025753 3300046536 Bacteria 3594
765 Ga0495609_0085194 3300046538 Bacteria 1378
766 Ga0495622_0041649 3300046557 Bacteria 2135
767 Ga0495633_0000083 3300046558 Bacteria 125035
768 Ga0495633_0003455 3300046558 Bacteria 10505
769 Ga0495668_0000055 3300046616 Bacteria 199412
770 Ga0495668_0001051 3300046616 Bacteria 29297
771 Ga0495668_0001697 3300046616 Bacteria 20372
772 Ga0495634_0030013 3300046642 Bacteria 3759
773 Ga0495625_0000077 3300046660 Bacteria 163166
774 Ga0495625_0001180 3300046660 Bacteria 33548
775 Ga0495625_0001973 3300046660 Bacteria 23152
776 Ga0495625_0012157 3300046660 Bacteria 6985
777 Ga0495625_0016508 3300046660 Bacteria 5807
778 Ga0495625_0043549 3300046660 Unclassified 3255
779 Ga0495625_0064780 3300046660 Bacteria 2577
780 Ga0495625_0067222 3300046660 Bacteria 2523
781 Ga0495657_0059670 3300046675 Unclassified 2530
782 Ga0495599_0152229 3300046678 Unclassified 1432
783 Ga0495658_0015521 3300046683 Bacteria 3908
784 Ga0495649_0000011 3300046694 Bacteria 416695
785 Ga0495660_0028644 3300046810 Bacteria 3145
786 Ga0495636_0000184 3300047318 Bacteria 24852
787 Ga0495674_0034710 3300047319 Unclassified 4558
788 Ga0495674_0223611 3300047319 Unclassified 1555
789 Ga0495672_0014585 3300047320 Bacteria 5374
790 Ga0495672_0031224 3300047320 Bacteria 3328
791 Ga0495687_001849 3300047443 Bacteria 18503
792 Ga0495684_0211125 3300047471 Unclassified 1427
793 Ga0495686_0000541 3300047472 Bacteria 54075
794 Ga0495686_0007680 3300047472 Bacteria 8052
795 Ga0495686_0134383 3300047472 Bacteria 1464
796 Ga0496102_0132636 3300048905 Unclassified 2333
797 Ga0496109_0057555 3300048912 Bacteria 3549
798 Ga0496114_0086210 3300048917 Unclassified 2661
799 Ga0496114_0267206 3300048917 Bacteria 1507
800 Ga0495678_005798 3300049459 Bacteria 6706
801 Ga0501034_0000017 3300049571 Bacteria 285938
802 Ga0501034_0037661 3300049571 Bacteria 4898
803 Ga0501036_0180266 3300049572 Bacteria 1778
804 Ga0501037_0052248 3300049573 Bacteria 2989
805 Ga0501037_0138142 3300049573 Bacteria 1745
806 Ga0501037_0231519 3300049573 Bacteria 1297
807 Ga0501039_0029118 3300049575 Bacteria 4253
808 Ga0501043_0003072 3300049579 Bacteria 13875
809 Ga0501047_0010118 3300049581 Bacteria 8917
810 Ga0501047_0015825 3300049581 Bacteria 7187
811 Ga0501047_0085882 3300049581 Unclassified 3023
812 Ga0501070_0246253 3300049586 Bacteria 1463
813 Ga0501072_0101159 3300049588 Bacteria 2291
814 Ga0501073_0123309 3300049589 Bacteria 1796
815 Ga0501202_000471 3300049652 Bacteria 5744
816 Ga0501217_001989 3300049661 Unclassified 3942
817 Ga0501223_000325 3300049663 Bacteria 11849
818 Ga0501257_019911 3300049686 Bacteria 1572
819 Ga0501219_000159 3300049703 Bacteria 12350
820 Ga0501035_0015963 3300049822 Bacteria 6931
821 Ga0501044_0006478 3300049823 Bacteria 12931
822 Ga0501044_0016594 3300049823 Bacteria 7904
823 Ga0501044_0091409 3300049823 Unclassified 3070
824 Ga0501044_0321461 3300049823 Unclassified 1472
825 Ga0501212_006926 3300049851 Bacteria 1541
826 Ga0501284_00018 3300050005 Bacteria 93729
827 nmdc:mga0k408_101260_c1 3300050493 Bacteria 1698
828 nmdc:mga0k408_14692_c1 3300050493 Bacteria 4319
829 nmdc:mga0k408_30625_c1 3300050493 Bacteria 3068
830 nmdc:mga0k408_3871_c1 3300050493 Bacteria 7933
831 nmdc:mga0k408_44_c1 3300050493 Bacteria 32015
832 nmdc:mga05p37_2793_c1 3300050507 Bacteria 20304
833 nmdc:mga09592_28816_c1 3300050508 Bacteria 4616
834 nmdc:mga0qj67_111525_c1 3300050509 Unclassified 2209
835 nmdc:mga0qj67_136660_c1 3300050509 Bacteria 1986
836 nmdc:mga06r32_81629_c1 3300050510 Unclassified 3149
837 nmdc:mga08y16_1505_c1 3300050511 Bacteria 23452
838 nmdc:mga08y16_449504_c1 3300050511 Bacteria 1314
839 nmdc:mga08y16_80441_c1 3300050511 Bacteria 3397
840 nmdc:mga08y16_88358_c1 3300050511 Bacteria 3230
841 nmdc:mga0n895_10170_c1 3300050512 Bacteria 8285
842 Ga0495619_0036987 3300053085 Bacteria 3180
843 Ga0500578_0000037 3300053086 Bacteria 134901
844 Ga0500578_0023352 3300053086 Bacteria 3971
845 Ga0500646_0014285 3300053090 Bacteria 2060
846 Ga0500583_0000068 3300053092 Bacteria 64748
847 Ga0500583_0001499 3300053092 Bacteria 6719
848 Ga0500594_0027888 3300053118 Bacteria 1465
849 Ga0500608_005654 3300053122 Bacteria 4995
850 Ga0500614_010366 3300053123 Bacteria 2001
851 Ga0500618_000006 3300053125 Bacteria 239188
852 Ga0500618_002095 3300053125 Bacteria 7929
853 Ga0500652_005744 3300053131 Bacteria 3936
854 Ga0500652_062495 3300053131 Bacteria 1535
855 Ga0500568_0000429 3300053139 Bacteria 31597
856 Ga0500573_0034974 3300053140 Bacteria 2898
857 Ga0500588_0012568 3300053146 Bacteria 2103
858 Ga0500604_0003205 3300053151 Bacteria 4398
859 Ga0500604_0004013 3300053151 Bacteria 3927
860 Ga0500616_0006698 3300053153 Bacteria 7477
861 Ga0500616_0008154 3300053153 Bacteria 6542
862 Ga0500622_0000049 3300053156 Bacteria 145793
863 Ga0500622_0000056 3300053156 Bacteria 142254
864 Ga0500622_0000291 3300053156 Bacteria 51275
865 Ga0500624_001580 3300053157 Bacteria 3488
866 Ga0500611_000006 3300053727 Bacteria 226069
867 Ga0500611_006068 3300053727 Bacteria 1740
868 Ga0500587_003459 3300053739 Bacteria 2207
869 Ga0466962_0008097 3300061719 Bacteria 5040
870 2599480694 2599185184 Bacteria 6430550
871 2738724512 2738541278 Bacteria 9755573
872 2740031724 2739367866 Bacteria 4215900
873 2839990309 2839989709 Bacteria 3773432
874 2910250004 2910245624 Bacteria 6935613
875 2911142645 2911138879 Bacteria 5811561
876 2919439831 2919437846 Bacteria 6199444
877 2919693756 2919692658 Bacteria 5943958
878 2928081587 2928078545 Bacteria 6534839
879 2928150384 2928147474 Bacteria 6512076
880 2929924485 2929921140 Bacteria 8649150
881 2932085208 2932082852 Bacteria 6563563
882 8003156871 8003151029 Bacteria 8187759
883 Ga0500650_0096784
884 JGI24740J21852_10007864
885 JGI24740J21852_10010129
886 JGI24739J22299_10006664
887 JGI24739J22299_10008192
888 JGI24737J22298_10000798
889 JGI24735J21928_10000017
890 JGI24751J29686_10003416
891 JGI25162J39368_1000008
892 JGI25154J39366_1000031
893 JGI25153J46596_10005563
894 JGI25153J46596_10009336
895 rootH1_10005434
896 rootH1_10013656
897 rootH2_10000535
898 rootH2_10009334
899 rootH2_10060262
900 rootH2_10065329
901 rootH2_10260519
902 rootL2_10047246
903 rootL2_10094996
904 rootL2_10106246
905 rootL2_10171473
906 rootL2_10223049
907 rootH1_10052201
908 rootH1_10057964
909 rootH1_10123253
910 rootH1_10325136
911 rootH1_10384659
912 JGI25160J50197_1005634
913 JGI25160J50197_1006108
914 Ga0055528_1001378
915 Ga0055530_10002564
916 Ga0055531_10000339
917 Ga0065165_1000674
918 Ga0065165_1002242
919 Ga0065165_1016053
920 Ga0065714_10106132
921 Ga0065704_10107649
922 Ga0065712_10001366
923 Ga0065712_10116018
924 Ga0065712_10127650
925 Ga0065712_10179394
926 Ga0065715_10094117
927 Ga0065707_10098430
928 Ga0070658_10001648
929 Ga0070658_10253016
930 Ga0070676_10001113
931 Ga0070676_10033270
932 Ga0070676_10063354
933 Ga0070676_10126237
934 Ga0070676_10185210
935 Ga0070683_100002331
936 Ga0070683_100033730
937 Ga0070683_100055483
938 Ga0070683_100084801
939 Ga0070690_100012506
940 Ga0070690_100099222
941 Ga0070690_100106616
942 Ga0070690_100182859
943 Ga0070670_100063403
944 Ga0070670_100066604
945 Ga0070670_100073838
946 Ga0070670_100195634
947 Ga0070670_100356717
948 Ga0070677_10031646
949 Ga0068869_100021659
950 Ga0068869_100024707
951 Ga0068869_100032690
952 Ga0068869_100044373
953 Ga0068869_100063318
954 Ga0068869_100073087
955 Ga0068869_100247091
956 Ga0070666_10000031
957 Ga0070666_10000358
958 Ga0070666_10056444
959 Ga0070680_100003060
960 Ga0070680_100008782
961 Ga0070682_100002866
962 Ga0070682_100037452
963 Ga0070682_100086997
964 Ga0068868_100000187
965 Ga0068868_100000427
966 Ga0068868_100023458
967 Ga0068868_100027827
968 Ga0068868_100056191
969 Ga0068868_100088309
970 Ga0068868_100154608
971 Ga0070660_100011808
972 Ga0070660_100060098
973 Ga0070660_100085439
974 Ga0070689_100006534
975 Ga0070689_100008759
976 Ga0070691_10006430
977 Ga0070661_100019232
978 Ga0070668_100003714
979 Ga0070668_100033148
980 Ga0070669_100004146
981 Ga0070669_100049979
982 Ga0070669_100139945
983 Ga0070675_100007290
984 Ga0070675_100007796
985 Ga0070675_100015450
986 Ga0070675_100089130
987 Ga0070675_100146374
988 Ga0070675_100189297
989 Ga0070675_100336213
990 Ga0070671_100004244
991 Ga0070671_100032907
992 Ga0070671_100062284
993 Ga0070671_100087155
994 Ga0070674_100009905
995 Ga0070674_100023098
996 Ga0070674_100217602
997 Ga0070673_100000124
998 Ga0070673_100018619
999 Ga0070673_100052629
1000 Ga0070673_100129724
1001 Ga0070673_100151767
1002 Ga0070688_100005827
1003 Ga0070688_100021900
1004 Ga0070688_100029818
1005 Ga0070688_100045881
1006 Ga0070659_100003555
1007 Ga0070659_100007166
1008 Ga0070659_100010987
1009 Ga0070659_100083093
1010 Ga0070667_100000980
1011 Ga0070667_100007822
1012 Ga0070667_100011432
1013 Ga0070667_100014894
1014 Ga0070667_100202404
1015 Ga0070667_100212892
1016 Ga0070701_10009204
1017 Ga0070701_10012085
1018 Ga0070700_100028611
1019 Ga0070700_100102133
1020 Ga0070678_100010622
1021 Ga0070678_100034033
1022 Ga0070678_100039546
1023 Ga0070678_100064101
1024 Ga0070678_100064606
1025 Ga0070662_100010835
1026 Ga0070662_100011948
1027 Ga0070662_100093919
1028 Ga0070681_10035209
1029 Ga0070681_10088793
1030 Ga0068867_100003400
1031 Ga0068867_100153250
1032 Ga0070685_10003074
1033 Ga0070685_10009678
1034 Ga0070685_10010142
1035 Ga0070685_10019938
1036 Ga0070685_10082528
1037 Ga0070685_10121100
1038 Ga0070698_100001150
1039 Ga0070698_100030021
1040 Ga0070698_100215269
1041 Ga0070679_100003309
1042 Ga0070679_100026672
1043 Ga0070684_100001198
1044 Ga0070684_100133051
1045 Ga0068853_100002569
1046 Ga0068853_100003735
1047 Ga0068853_100020432
1048 Ga0068853_100023090
1049 Ga0068853_100026222
1050 Ga0068853_100030039
1051 Ga0068853_100062999
1052 Ga0068853_100080274
1053 Ga0070672_100000105
1054 Ga0070672_100014464
1055 Ga0070672_100025639
1056 Ga0070672_100062300
1057 Ga0070672_100122499
1058 Ga0070672_100162466
1059 Ga0070672_100255296
1060 Ga0070686_100001965
1061 Ga0070686_100056093
1062 Ga0070693_100004189
1063 Ga0070665_100000635
1064 Ga0070665_100004161
1065 Ga0070665_100060341
1066 Ga0070665_100098265
1067 Ga0068855_100007383
1068 Ga0068855_100031575
1069 Ga0068855_100040115
1070 Ga0068855_100234011
1071 Ga0068855_100252882
1072 Ga0068855_100396239
1073 Ga0068855_100440388
1074 Ga0070664_100001670
1075 Ga0070664_100006530
1076 Ga0070664_100035871
1077 Ga0070664_100055517
1078 Ga0070664_100224819
1079 Ga0068857_100007841
1080 Ga0068857_100011785
1081 Ga0068857_100022154
1082 Ga0068857_100025313
1083 Ga0068857_100072692
1084 Ga0068854_100112571
1085 Ga0068854_100207329
1086 Ga0068856_100011695
1087 Ga0068856_100099440
1088 Ga0070702_100164966
1089 Ga0068852_100000346
1090 Ga0068852_100000848
1091 Ga0068852_100005012
1092 Ga0068852_100031520
1093 Ga0068852_100043934
1094 Ga0068852_100262701
1095 Ga0068852_100446640
1096 Ga0068859_100000045
1097 Ga0068859_100017677
1098 Ga0068859_100026115
1099 Ga0068859_100051384
1100 Ga0068859_100076568
1101 Ga0068859_100102372
1102 Ga0068859_100104773
1103 Ga0068859_100343363
1104 Ga0068859_100348617
1105 Ga0068864_100001254
1106 Ga0068864_100001485
1107 Ga0068864_100062304
1108 Ga0068864_100139884
1109 Ga0068864_100141100
1110 Ga0068864_100200204
1111 Ga0068866_10035912
1112 Ga0068866_10064506
1113 Ga0068861_100004748
1114 Ga0068861_100005264
1115 Ga0068861_100007098
1116 Ga0068861_100024725
1117 Ga0068861_100126447
1118 Ga0068861_100240458
1119 Ga0068851_10019459
1120 Ga0068851_10058875
1121 Ga0068851_10069680
1122 Ga0068870_10006462
1123 Ga0068870_10012943
1124 Ga0068870_10142548
1125 Ga0068863_100001976
1126 Ga0068863_100002352
1127 Ga0068863_100006695
1128 Ga0068863_100028179
1129 Ga0068863_100060096
1130 Ga0068863_100094977
1131 Ga0068863_100379847
1132 Ga0068858_100003543
1133 Ga0068858_100010584
1134 Ga0068858_100360129
1135 Ga0068860_100001418
1136 Ga0068860_100003309
1137 Ga0068860_100003540
1138 Ga0068860_100019177
1139 Ga0068860_100084371
1140 Ga0068860_100155788
1141 Ga0068860_100210957
1142 Ga0068860_100277314
1143 Ga0081539_10000338
1144 Ga0070715_10007211
1145 Ga0075366_10000019
1146 Ga0075366_10003888
1147 Ga0097621_100000499
1148 Ga0097621_100001817
1149 Ga0097621_100011606
1150 Ga0097621_100093297
1151 Ga0097621_100109682
1152 Ga0097621_100145495
1153 Ga0097621_100202856
1154 Ga0097621_100364436
1155 Ga0068871_100002567
1156 Ga0068871_100035949
1157 Ga0068871_100045193
1158 Ga0068871_100052861
1159 Ga0068871_100190333
1160 Ga0075428_100023898
1161 Ga0075428_100032712
1162 Ga0075430_100148523
1163 Ga0075431_100060606
1164 Ga0075434_100009056
1165 Ga0075429_100018515
1166 Ga0068865_100001094
1167 Ga0068865_100013971
1168 Ga0068865_100016931
1169 Ga0097620_100000045
1170 Ga0097620_100017677
1171 Ga0097620_100026115
1172 Ga0097620_100051384
1173 Ga0097620_100076565
1174 Ga0097620_100102381
1175 Ga0097620_100104767
1176 Ga0097620_100343394
1177 Ga0097620_100348632
1178 Ga0105240_10009860
1179 Ga0105240_10279853
1180 Ga0105240_10328934
1181 Ga0111539_10003835
1182 Ga0111539_10019523
1183 Ga0111539_10023564
1184 Ga0111539_10345894
1185 Ga0111539_10468252
1186 Ga0105245_10045188
1187 Ga0105247_10003492
1188 Ga0105247_10003520
1189 Ga0114129_10052288
1190 Ga0114129_10082403
1191 Ga0105241_10000985
1192 Ga0105241_10001733
1193 Ga0105241_10038447
1194 Ga0105241_10042560
1195 Ga0105242_10010544
1196 Ga0105242_10023228
1197 Ga0105242_10042593
1198 Ga0105242_10068614
1199 Ga0105242_10083795
1200 Ga0105248_10022859
1201 Ga0105248_10038321
1202 Ga0105237_10005841
1203 Ga0105237_10031028
1204 Ga0105237_10038920
1205 Ga0105238_10283215
1206 Ga0105249_10004538
1207 Ga0105249_10011505
1208 Ga0105249_10011753
1209 Ga0105249_10011841
1210 Ga0105249_10019342
1211 Ga0105249_10020335
1212 Ga0105249_10020437
1213 Ga0105249_10028339
1214 Ga0105249_10028806
1215 Ga0105249_10055784
1216 Ga0105249_10089921
1217 Ga0105249_10180151
1218 Ga0105249_10286489
1219 Ga0105239_10000912
1220 Ga0105239_10026168
1221 Ga0105239_10034551
1222 Ga0105239_10073498
1223 Ga0105239_10119273
1224 Ga0105246_10029025
1225 Ga0157373_10005810
1226 Ga0157373_10014805
1227 Ga0157373_10017113
1228 Ga0157373_10033068
1229 Ga0157371_10000284
1230 Ga0157371_10000725
1231 Ga0157371_10002541
1232 Ga0157371_10006439
1233 Ga0157371_10015828
1234 Ga0157371_10018851
1235 Ga0157371_10020967
1236 Ga0157371_10033620
1237 Ga0157371_10045630
1238 Ga0157371_10091942
1239 Ga0157371_10126626
1240 Ga0157371_10146305
1241 Ga0157370_10001924
1242 Ga0157370_10004751
1243 Ga0157370_10021147
1244 Ga0157370_10025275
1245 Ga0157370_10157833
1246 Ga0157369_10000101
1247 Ga0157369_10020421
1248 Ga0157369_10198558
1249 Ga0157369_10261390
1250 Ga0157374_10000025
1251 Ga0157374_10000260
1252 Ga0157374_10002980
1253 Ga0157374_10020690
1254 Ga0157374_10027083
1255 Ga0157374_10043533
1256 Ga0157374_10165320
1257 Ga0157374_10264534
1258 Ga0157378_10003039
1259 Ga0157378_10013251
1260 Ga0157378_10014666
1261 Ga0157378_10023246
1262 Ga0157378_10023750
1263 Ga0157378_10136186
1264 Ga0157378_10147537
1265 Ga0157378_10208511
1266 Ga0163162_10000312
1267 Ga0163162_10001523
1268 Ga0163162_10002647
1269 Ga0163162_10004060
1270 Ga0163162_10004258
1271 Ga0163162_10007829
1272 Ga0163162_10010039
1273 Ga0163162_10022439
1274 Ga0163162_10027004
1275 Ga0163162_10069905
1276 Ga0163162_10076787
1277 Ga0163162_10179217
1278 Ga0163162_10241612
1279 Ga0163162_10317583
1280 Ga0157372_10000041
1281 Ga0157372_10004075
1282 Ga0157372_10009342
1283 Ga0157372_10018758
1284 Ga0157372_10023974
1285 Ga0157372_10025872
1286 Ga0157372_10038600
1287 Ga0157372_10091463
1288 Ga0157372_10154083
1289 Ga0157372_10233398
1290 Ga0157372_10254266
1291 Ga0157372_10336238
1292 Ga0157372_10338989
1293 Ga0157372_10432189
1294 Ga0157375_10000686
1295 Ga0157375_10002871
1296 Ga0157375_10010009
1297 Ga0157375_10027553
1298 Ga0157375_10048720
1299 Ga0157375_10068834
1300 Ga0157375_10167958
1301 Ga0157375_10172169
1302 Ga0157375_10220697
1303 Ga0157375_10237935
1304 Ga0157375_10382797
1305 Ga0163163_10000279
1306 Ga0163163_10000344
1307 Ga0163163_10000346
1308 Ga0163163_10012583
1309 Ga0157380_10003974
1310 Ga0157380_10017475
1311 Ga0157380_10093099
1312 Ga0157380_10144080
1313 Ga0157380_10198731
1314 Ga0157380_10408648
1315 Ga0157377_10001633
1316 Ga0157377_10007473
1317 Ga0157377_10008716
1318 Ga0157377_10076132
1319 Ga0157377_10087828
1320 Ga0157377_10162705
1321 Ga0157379_10000242
1322 Ga0157379_10011127
1323 Ga0157379_10116865
1324 Ga0157379_10119903
1325 Ga0157379_10121227
1326 Ga0157379_10342037
1327 Ga0157376_10001139
1328 Ga0157376_10002821
1329 Ga0157376_10004535
1330 Ga0157376_10007029
1331 Ga0157376_10053690
1332 Ga0157376_10058402
1333 Ga0157376_10062238
1334 Ga0157376_10092562
1335 Ga0157376_10242124
1336 Ga0163161_10005088
1337 Ga0163161_10006224
1338 Ga0163161_10014267
1339 Ga0163161_10018549
1340 Ga0163161_10045337
1341 Ga0209437_100030
1342 Ga0209646_1000009
1343 Ga0209026_1000396
1344 Ga0209129_1018752
1345 Ga0209673_1000016
1346 Ga0209564_1004934
1347 Ga0209564_1027372
1348 Ga0209758_1010285
1349 Ga0209758_1020363
1350 Ga0209050_1000124
1351 Ga0207426_1000339
1352 Ga0207426_1000520
1353 Ga0209257_1000007
1354 Ga0209257_1000658
1355 Ga0207656_10056650
1356 Ga0207682_10086308
1357 Ga0207710_10002713
1358 Ga0207710_10014697
1359 Ga0207688_10043312
1360 Ga0207680_10000141
1361 Ga0207680_10003927
1362 Ga0207647_10000017
1363 Ga0207647_10001876
1364 Ga0207647_10061601
1365 Ga0207645_10001794
1366 Ga0207645_10019981
1367 Ga0207645_10085980
1368 Ga0207643_10009744
1369 Ga0207643_10011999
1370 Ga0207643_10030872
1371 Ga0207705_10011048
1372 Ga0207705_10012513
1373 Ga0207705_10017600
1374 Ga0207654_10003695
1375 Ga0207654_10006489
1376 Ga0207654_10026732
1377 Ga0207654_10051192
1378 Ga0207707_10003504
1379 Ga0207707_10069683
1380 Ga0207707_10121299
1381 Ga0207695_10004070
1382 Ga0207695_10186606
1383 Ga0207671_10009957
1384 Ga0207671_10022002
1385 Ga0207671_10026640
1386 Ga0207660_10005510
1387 Ga0207660_10138805
1388 Ga0207660_10303350
1389 Ga0207662_10021541
1390 Ga0207657_10009181
1391 Ga0207657_10018805
1392 Ga0207657_10023896
1393 Ga0207657_10084500
1394 Ga0207649_10061049
1395 Ga0207652_10000045
1396 Ga0207652_10000819
1397 Ga0207652_10008710
1398 Ga0207652_10016246
1399 Ga0207681_10001974
1400 Ga0207681_10216315
1401 Ga0207650_10002954
1402 Ga0207650_10024003
1403 Ga0207650_10046246
1404 Ga0207650_10071885
1405 Ga0207650_10128871
1406 Ga0207659_10156743
1407 Ga0207644_10008911
1408 Ga0207644_10051636
1409 Ga0207644_10194649
1410 Ga0207690_10005074
1411 Ga0207690_10011163
1412 Ga0207706_10003994
1413 Ga0207706_10007275
1414 Ga0207706_10031804
1415 Ga0207706_10069185
1416 Ga0207686_10024411
1417 Ga0207686_10094005
1418 Ga0207686_10100281
1419 Ga0207670_10006784
1420 Ga0207670_10013543
1421 Ga0207670_10018759
1422 Ga0207669_10044918
1423 Ga0207669_10099177
1424 Ga0207704_10009869
1425 Ga0207704_10082330
1426 Ga0207691_10000012
1427 Ga0207691_10004759
1428 Ga0207691_10025875
1429 Ga0207691_10039568
1430 Ga0207691_10049190
1431 Ga0207691_10158279
1432 Ga0207689_10008936
1433 Ga0207689_10008992
1434 Ga0207689_10017516
1435 Ga0207689_10018137
1436 Ga0207689_10029050
1437 Ga0207689_10044379
1438 Ga0207689_10063876
1439 Ga0207689_10072143
1440 Ga0207689_10092711
1441 Ga0207689_10190714
1442 Ga0207661_10003108
1443 Ga0207661_10034774
1444 Ga0207661_10110823
1445 Ga0207679_10004210
1446 Ga0207679_10012502
1447 Ga0207679_10017260
1448 Ga0207679_10124715
1449 Ga0207667_10016855
1450 Ga0207667_10026076
1451 Ga0207667_10033422
1452 Ga0207667_10034450
1453 Ga0207667_10038329
1454 Ga0207667_10073195
1455 Ga0207667_10247632
1456 Ga0207651_10000216
1457 Ga0207651_10005231
1458 Ga0207651_10191831
1459 Ga0207651_10232295
1460 Ga0207651_10306359
1461 Ga0207712_10000976
1462 Ga0207712_10007162
1463 Ga0207712_10010440
1464 Ga0207712_10022982
1465 Ga0207712_10025198
1466 Ga0207712_10039279
1467 Ga0207712_10071369
1468 Ga0207712_10148236
1469 Ga0207712_10234090
1470 Ga0207668_10001361
1471 Ga0207668_10085311
1472 Ga0207658_10000374
1473 Ga0207658_10008025
1474 Ga0207658_10011120
1475 Ga0207658_10011371
1476 Ga0207658_10113347
1477 Ga0207677_10000984
1478 Ga0207677_10006012
1479 Ga0207677_10018387
1480 Ga0207677_10116904
1481 Ga0207703_10009315
1482 Ga0207703_10019138
1483 Ga0207703_10079753
1484 Ga0207703_10275967
1485 Ga0207639_10016498
1486 Ga0207639_10021770
1487 Ga0207639_10029603
1488 Ga0207639_10032242
1489 Ga0207639_10066918
1490 Ga0207639_10066998
1491 Ga0207678_10013503
1492 Ga0207678_10031808
1493 Ga0207708_10034032
1494 Ga0207708_10051340
1495 Ga0207708_10105301
1496 Ga0207702_10026475
1497 Ga0207702_10091342
1498 Ga0207641_10000146
1499 Ga0207641_10000947
1500 Ga0207641_10007761
1501 Ga0207641_10040757
1502 Ga0207641_10073253
1503 Ga0207641_10104865
1504 Ga0207641_10110213
1505 Ga0207641_10184962
1506 Ga0207648_10001615
1507 Ga0207648_10010253
1508 Ga0207648_10018048
1509 Ga0207648_10020364
1510 Ga0207648_10048905
1511 Ga0207648_10056374
1512 Ga0207648_10064755
1513 Ga0207648_10122109
1514 Ga0207648_10173460
1515 Ga0207676_10000697
1516 Ga0207676_10003591
1517 Ga0207676_10005018
1518 Ga0207676_10077658
1519 Ga0207676_10111982
1520 Ga0207676_10202536
1521 Ga0207676_10257722
1522 Ga0207674_10004031
1523 Ga0207674_10010211
1524 Ga0207674_10014867
1525 Ga0207674_10033271
1526 Ga0207674_10070579
1527 Ga0207674_10095119
1528 Ga0207674_10271928
1529 Ga0207675_100001183
1530 Ga0207675_100005430
1531 Ga0207675_100034881
1532 Ga0207675_100139304
1533 Ga0207675_100219101
1534 Ga0207683_10000943
1535 Ga0207683_10017143
1536 Ga0207683_10020984
1537 Ga0207683_10025629
1538 Ga0207683_10070461
1539 Ga0207683_10138987
1540 Ga0207698_10003512
1541 Ga0207698_10009340
1542 Ga0207428_10006992
1543 Ga0207428_10012094
1544 Ga0268266_10005379
1545 Ga0268266_10019071
1546 Ga0268266_10035267
1547 Ga0268265_10009351
1548 Ga0268265_10011180
1549 Ga0268264_10003975
1550 Ga0268264_10006744
1551 Ga0268264_10008474
1552 Ga0268264_10046760
1553 Ga0268264_10050397
1554 Ga0268264_10102312
1555 Ga0307515_10000012
1556 Ga0307515_10000077
1557 Ga0307515_10012976
1558 Ga0307515_10063170
1559 Ga0307515_10078481
1560 Ga0265340_10086342
1561 Ga0265327_10000759
1562 Ga0307513_10235444
1563 Ga0307509_10020532
1564 Ga0307509_10083480
1565 Ga0307509_10205242
1566 Ga0307509_10221519
1567 Ga0307408_100000332
1568 Ga0307408_100000341
1569 Ga0307408_100000410
1570 Ga0307408_100016173
1571 Ga0307508_10001024
1572 Ga0307514_10051315
1573 Ga0307516_10243084
1574 Ga0307405_10005405
1575 Ga0307405_10112520
1576 Ga0307413_10008468
1577 Ga0307413_10156833
1578 Ga0307412_10012107
1579 Ga0307416_100032160
1580 Ga0307414_10000059
1581 Ga0307414_10018672
1582 Ga0307411_10106252
1583 Ga0307415_100117466
1584 Ga0307507_10000143
1585 Ga0373924_0022664
1586 Ga0373947_0055487
1587 Ga0373947_0062781
1588 Ga0373937_0006671
1589 Ga0373937_0214143
1590 Ga0373937_0338191
1591 Ga0395899_0000024
1592 Ga0395899_0008398
1593 Ga0395900_0008499
1594 Ga0395900_0126322
1595 Ga0395900_0222896
1596 Ga0395898_0003718
1597 Ga0395898_0013466
1598 Ga0395905_0009765
1599 Ga0395905_0306613
1600 Ga0395901_0005062
1601 Ga0395901_0012431
1602 Ga0395901_0045981
1603 Ga0436365_0603123
1604 Ga0439436_0007478
1605 Ga0439457_000930
1606 Ga0450898_000889
1607 Ga0439434_0009601
1608 Ga0451577_0005791
1609 Ga0451577_0249649
1610 Ga0466969_0000004
1611 Ga0466972_0000016
1612 Ga0466972_0000017
1613 Ga0466972_0015930
1614 Ga0453683_0005930
1615 Ga0466965_0068862
1616 Ga0466966_0000295
1617 Ga0466966_0087727
1618 Ga0466961_0002760
1619 Ga0466961_0014977
1620 Ga0453684_0001190
1621 Ga0466971_0011031
1622 Ga0466968_0002708
1623 Ga0466970_0003015
1624 Ga0466970_0055835
1625 Ga0466957_0000367
1626 Ga0466959_0000004
1627 Ga0466959_0000819
1628 Ga0451576_0029084
1629 Ga0466967_0204488
1630 Ga0495592_0049965
1631 Ga0495651_0024770
1632 Ga0495650_0000050
1633 Ga0495582_0041520
1634 Ga0495585_0001264
1635 Ga0495585_0002275
1636 Ga0495583_0009815
1637 Ga0495583_0061182
1638 Ga0495606_0000505
1639 Ga0495606_0005343
1640 Ga0495606_0018126
1641 Ga0495616_0000296
1642 Ga0495616_0015185
1643 Ga0495628_0022064
1644 Ga0495643_0031267
1645 Ga0495648_0052548
1646 Ga0495587_0025753
1647 Ga0495609_0085194
1648 Ga0495622_0041649
1649 Ga0495633_0000083
1650 Ga0495633_0003455
1651 Ga0495668_0000055
1652 Ga0495668_0001051
1653 Ga0495668_0001697
1654 Ga0495634_0030013
1655 Ga0495625_0000077
1656 Ga0495625_0001180
1657 Ga0495625_0001973
1658 Ga0495625_0012157
1659 Ga0495625_0016508
1660 Ga0495625_0043549
1661 Ga0495625_0064780
1662 Ga0495625_0067222
1663 Ga0495657_0059670
1664 Ga0495599_0152229
1665 Ga0495658_0015521
1666 Ga0495649_0000011
1667 Ga0495660_0028644
1668 Ga0495636_0000184
1669 Ga0495674_0034710
1670 Ga0495674_0223611
1671 Ga0495672_0014585
1672 Ga0495672_0031224
1673 Ga0495687_001849
1674 Ga0495684_0211125
1675 Ga0495686_0000541
1676 Ga0495686_0007680
1677 Ga0495686_0134383
1678 Ga0496102_0132636
1679 Ga0496109_0057555
1680 Ga0496114_0086210
1681 Ga0496114_0267206
1682 Ga0495678_005798
1683 Ga0501034_0000017
1684 Ga0501034_0037661
1685 Ga0501036_0180266
1686 Ga0501037_0052248
1687 Ga0501037_0138142
1688 Ga0501037_0231519
1689 Ga0501039_0029118
1690 Ga0501043_0003072
1691 Ga0501047_0010118
1692 Ga0501047_0015825
1693 Ga0501047_0085882
1694 Ga0501070_0246253
1695 Ga0501072_0101159
1696 Ga0501073_0123309
1697 Ga0501202_000471
1698 Ga0501217_001989
1699 Ga0501223_000325
1700 Ga0501257_019911
1701 Ga0501219_000159
1702 Ga0501035_0015963
1703 Ga0501044_0006478
1704 Ga0501044_0016594
1705 Ga0501044_0091409
1706 Ga0501044_0321461
1707 Ga0501212_006926
1708 Ga0501284_00018
1709 nmdc:mga0k408_101260_c1
1710 nmdc:mga0k408_14692_c1
1711 nmdc:mga0k408_30625_c1
1712 nmdc:mga0k408_3871_c1
1713 nmdc:mga0k408_44_c1
1714 nmdc:mga05p37_2793_c1
1715 nmdc:mga09592_28816_c1
1716 nmdc:mga0qj67_111525_c1
1717 nmdc:mga0qj67_136660_c1
1718 nmdc:mga06r32_81629_c1
1719 nmdc:mga08y16_1505_c1
1720 nmdc:mga08y16_449504_c1
1721 nmdc:mga08y16_80441_c1
1722 nmdc:mga08y16_88358_c1
1723 nmdc:mga0n895_10170_c1
1724 Ga0495619_0036987
1725 Ga0500578_0000037
1726 Ga0500578_0023352
1727 Ga0500646_0014285
1728 Ga0500583_0000068
1729 Ga0500583_0001499
1730 Ga0500594_0027888
1731 Ga0500608_005654
1732 Ga0500614_010366
1733 Ga0500618_000006
1734 Ga0500618_002095
1735 Ga0500652_005744
1736 Ga0500652_062495
1737 Ga0500568_0000429
1738 Ga0500573_0034974
1739 Ga0500588_0012568
1740 Ga0500604_0003205
1741 Ga0500604_0004013
1742 Ga0500616_0006698
1743 Ga0500616_0008154
1744 Ga0500622_0000049
1745 Ga0500622_0000056
1746 Ga0500622_0000291
1747 Ga0500624_001580
1748 Ga0500611_000006
1749 Ga0500611_006068
1750 Ga0500587_003459
1751 Ga0466962_0008097
1752 2599480694
1753 2738724512
1754 2740031724
1755 2839990309
1756 2910250004
1757 2911142645
1758 2919439831
1759 2919693756
1760 2928081587
1761 2928150384
1762 2929924485
1763 2932085208
1764 8003156871

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

44

79

0.95

PF01494

FAD_binding_3

FAD binding domain

42

368

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zn0-assembly2.cif.gz_D structure of the nadph-dependent thioredoxin reductase from methanosarcina mazei 0.9389 6 151
6fqz-assembly1.cif.gz_B plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate 0.9388 6 36
4zn0-assembly1.cif.gz_C structure of the nadph-dependent thioredoxin reductase from methanosarcina mazei 0.9362 5 151
5a9r-assembly1.cif.gz_A apo form of imine reductase from amycolatopsis orientalis 0.9343 7 38
5a9s-assembly1.cif.gz_B nadph complex of imine reductase from amycolatopsis orientalis 0.9337 7 34
ID Description Score Start End Superfamily
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9654 7 34 3.40.50.720
af_Q4D0X5_1_185_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9568 7 34 3.40.50.720
af_Q9DBM2_291_471_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9561 7 37 3.40.50.720
6hrdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9486 7 36 3.40.50.720
3gpiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.945 6 34 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1I5XDF5-F1-model_v4 Dehydrogenase (Flavoprotein) 0.9846 6 377 GO:0071949
AF-A0A7W1G065-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.974 1 377
AF-A0A4Q5UBM7-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9728 62 377 GO:0016020
AF-A0A1I5XDF5-F1-model_v4 Dehydrogenase (Flavoprotein) 0.9716 6 377 GO:0071949
AF-A0A7W1G065-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9714 1 377

Map