F484569
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 882 | 326 | 865 | 555 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221678|2644438961 |
| Length | 604 |
| Sequence | RLRAVPGIRAVSTYRREWLVKDLVAGVVLTTLLVPQGMAYAELAGLPAITGLYTSILCLLGYAVCGPSRVLVLGPDSSLGPMIAATVLPLVVADGDPDRAVALASVLALMVAAVMILASVAKLGFIADLISKPTMIGYMNGLALTILIGQLPKLLGFKVEADNLIGECAGLVRKLADGAAVPAAATVGGCGIVLILVLQRLLPKIPAVLVMVVLAIAATAVFDLGAHGVDLVGELPEGFPPFTVPDVRLADLAPLFGGALGIALVSLADTISNASAFAARSGQEVRGNQEMAGVGAANLAAGLFQGFPVSASGSRTAVAERAGARSQLTGVVGAALIVLMLVLVPGLFRDLPQPALAAVVITASLSLADIPGAVRLWRQRRAEFLLCLAAFVGVALLGVLPGIAVAVALSVLNVFRRAWWPYNTVLGRVQDLEGYHDVRSYPQARQLPGLVIHRFDAPLIFANAKAFRDEIRRLADVDPRPTWIVIAAEPITDVDTTAADVLQELDENLNAQGVHLVFAELKDPVRRKIERYELTRTIDPRHFFPTVEAAVDAFRLRTGAEWAPRRPPPDIAPPPADTAPPPLDIASPPPADDGHHDGAEDRTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 2 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 3 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 4 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 5 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 6 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 7 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 8 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 9 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 10 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 11 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 12 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 13 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 14 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 15 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 200 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 213 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 214 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 215 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 216 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 217 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 323 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 325 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 326 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.85 |
| Metatranscriptomes | 0.23 |
| Isolates | 1.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.57 |
| Nodule | 0.23 |
| Rhizoplane | 9.52 |
| Rhizosphere | 88.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10002594 | 3300002075 | Bacteria | 4675 |
| 2 | JGI24738J21930_10007244 | 3300002075 | Bacteria | 2570 |
| 3 | JGI24744J21845_10000361 | 3300002077 | Bacteria | 7757 |
| 4 | JGI25406J46586_10001317 | 3300003203 | Bacteria | 11674 |
| 5 | Ga0070658_10149849 | 3300005327 | Bacteria | 1952 |
| 6 | Ga0070683_100004234 | 3300005329 | Bacteria | 11763 |
| 7 | Ga0070683_100012321 | 3300005329 | Bacteria | 7428 |
| 8 | Ga0070683_100039924 | 3300005329 | Bacteria | 4312 |
| 9 | Ga0070683_100040738 | 3300005329 | Bacteria | 4271 |
| 10 | Ga0070683_100060608 | 3300005329 | Bacteria | 3517 |
| 11 | Ga0070683_100129725 | 3300005329 | Bacteria | 2385 |
| 12 | Ga0070683_100177975 | 3300005329 | Bacteria | 2019 |
| 13 | Ga0070670_100011377 | 3300005331 | Bacteria | 7608 |
| 14 | Ga0068869_100000672 | 3300005334 | Bacteria | 19319 |
| 15 | Ga0068869_100035330 | 3300005334 | Bacteria | 3541 |
| 16 | Ga0070680_100000135 | 3300005336 | Bacteria | 44656 |
| 17 | Ga0070680_100005054 | 3300005336 | Bacteria | 9949 |
| 18 | Ga0070680_100030659 | 3300005336 | Bacteria | 4321 |
| 19 | Ga0070680_100061964 | 3300005336 | Bacteria | 3062 |
| 20 | Ga0070680_100080356 | 3300005336 | Unclassified | 2688 |
| 21 | Ga0070682_100001129 | 3300005337 | Bacteria | 15254 |
| 22 | Ga0070682_100006989 | 3300005337 | Bacteria | 6347 |
| 23 | Ga0070682_100021497 | 3300005337 | Bacteria | 3808 |
| 24 | Ga0068868_100007548 | 3300005338 | Bacteria | 7747 |
| 25 | Ga0068868_100034361 | 3300005338 | Bacteria | 3914 |
| 26 | Ga0068868_100105593 | 3300005338 | Bacteria | 2284 |
| 27 | Ga0068868_100117303 | 3300005338 | Bacteria | 2168 |
| 28 | Ga0070660_100009909 | 3300005339 | Bacteria | 6721 |
| 29 | Ga0070689_100004510 | 3300005340 | Bacteria | 9430 |
| 30 | Ga0070689_100102416 | 3300005340 | Bacteria | 2268 |
| 31 | Ga0070687_100021220 | 3300005343 | Bacteria | 3049 |
| 32 | Ga0070661_100101541 | 3300005344 | Bacteria | 2140 |
| 33 | Ga0070692_10001374 | 3300005345 | Bacteria | 8788 |
| 34 | Ga0070692_10005242 | 3300005345 | Bacteria | 5500 |
| 35 | Ga0070671_100005326 | 3300005355 | Bacteria | 10264 |
| 36 | Ga0070671_100012639 | 3300005355 | Bacteria | 6803 |
| 37 | Ga0070674_100005664 | 3300005356 | Bacteria | 7238 |
| 38 | Ga0070673_100024595 | 3300005364 | Bacteria | 4420 |
| 39 | Ga0070659_100013914 | 3300005366 | Bacteria | 6004 |
| 40 | Ga0070659_100049618 | 3300005366 | Bacteria | 3301 |
| 41 | Ga0070659_100049664 | 3300005366 | Bacteria | 3299 |
| 42 | Ga0070709_10005337 | 3300005434 | Bacteria | 6960 |
| 43 | Ga0070709_10022372 | 3300005434 | Bacteria | 3696 |
| 44 | Ga0070714_100000974 | 3300005435 | Bacteria | 20448 |
| 45 | Ga0070714_100002168 | 3300005435 | Bacteria | 14424 |
| 46 | Ga0070714_100002616 | 3300005435 | Bacteria | 13269 |
| 47 | Ga0070714_100007815 | 3300005435 | Bacteria | 8332 |
| 48 | Ga0070714_100013040 | 3300005435 | Bacteria | 6650 |
| 49 | Ga0070714_100017478 | 3300005435 | Bacteria | 5809 |
| 50 | Ga0070714_100046678 | 3300005435 | Unclassified | 3676 |
| 51 | Ga0070714_100068894 | 3300005435 | Bacteria | 3054 |
| 52 | Ga0070714_100101202 | 3300005435 | Bacteria | 2539 |
| 53 | Ga0070713_100003754 | 3300005436 | Bacteria | 10050 |
| 54 | Ga0070713_100023202 | 3300005436 | Bacteria | 4811 |
| 55 | Ga0070713_100029057 | 3300005436 | Bacteria | 4372 |
| 56 | Ga0070713_100041203 | 3300005436 | Bacteria | 3761 |
| 57 | Ga0070713_100061707 | 3300005436 | Bacteria | 3137 |
| 58 | Ga0070713_100085957 | 3300005436 | Bacteria | 2695 |
| 59 | Ga0070710_10007083 | 3300005437 | Bacteria | 5414 |
| 60 | Ga0070710_10020055 | 3300005437 | Bacteria | 3464 |
| 61 | Ga0070710_10032808 | 3300005437 | Bacteria | 2815 |
| 62 | Ga0070701_10005335 | 3300005438 | Bacteria | 5296 |
| 63 | Ga0070701_10013604 | 3300005438 | Bacteria | 3707 |
| 64 | Ga0070701_10023749 | 3300005438 | Bacteria | 2958 |
| 65 | Ga0070711_100007610 | 3300005439 | Bacteria | 6594 |
| 66 | Ga0070711_100020370 | 3300005439 | Bacteria | 4274 |
| 67 | Ga0070711_100042360 | 3300005439 | Bacteria | 3077 |
| 68 | Ga0070711_100071560 | 3300005439 | Bacteria | 2444 |
| 69 | Ga0070700_100004148 | 3300005441 | Bacteria | 7557 |
| 70 | Ga0070700_100007174 | 3300005441 | Bacteria | 6002 |
| 71 | Ga0070700_100012601 | 3300005441 | Bacteria | 4725 |
| 72 | Ga0070700_100021607 | 3300005441 | Bacteria | 3742 |
| 73 | Ga0070694_100006385 | 3300005444 | Bacteria | 7152 |
| 74 | Ga0070663_100029447 | 3300005455 | Bacteria | 3753 |
| 75 | Ga0070663_100029835 | 3300005455 | Bacteria | 3731 |
| 76 | Ga0070678_100003700 | 3300005456 | Bacteria | 8557 |
| 77 | Ga0070662_100017767 | 3300005457 | Bacteria | 4799 |
| 78 | Ga0070681_10000020 | 3300005458 | Bacteria | 123918 |
| 79 | Ga0070681_10026083 | 3300005458 | Bacteria | 5876 |
| 80 | Ga0070681_10032436 | 3300005458 | Bacteria | 5242 |
| 81 | Ga0070681_10036883 | 3300005458 | Bacteria | 4907 |
| 82 | Ga0070681_10055574 | 3300005458 | Bacteria | 3941 |
| 83 | Ga0068867_100019015 | 3300005459 | Bacteria | 4891 |
| 84 | Ga0068867_100021874 | 3300005459 | Bacteria | 4566 |
| 85 | Ga0068867_100044464 | 3300005459 | Bacteria | 3254 |
| 86 | Ga0070685_10002662 | 3300005466 | Bacteria | 9150 |
| 87 | Ga0070706_100004208 | 3300005467 | Bacteria | 13977 |
| 88 | Ga0070706_100012140 | 3300005467 | Bacteria | 7990 |
| 89 | Ga0070707_100012396 | 3300005468 | Bacteria | 7960 |
| 90 | Ga0070707_100080485 | 3300005468 | Unclassified | 3144 |
| 91 | Ga0070698_100104833 | 3300005471 | Bacteria | 2797 |
| 92 | Ga0070699_100002823 | 3300005518 | Bacteria | 15504 |
| 93 | Ga0070679_100000044 | 3300005530 | Bacteria | 94029 |
| 94 | Ga0070679_100033742 | 3300005530 | Bacteria | 5068 |
| 95 | Ga0070679_100037668 | 3300005530 | Bacteria | 4805 |
| 96 | Ga0070679_100085799 | 3300005530 | Bacteria | 3135 |
| 97 | Ga0070679_100102225 | 3300005530 | Bacteria | 2852 |
| 98 | Ga0070679_100167816 | 3300005530 | Bacteria | 2168 |
| 99 | Ga0070684_100000622 | 3300005535 | Bacteria | 24475 |
| 100 | Ga0070684_100020042 | 3300005535 | Bacteria | 5544 |
| 101 | Ga0070684_100022148 | 3300005535 | Bacteria | 5296 |
| 102 | Ga0070684_100037755 | 3300005535 | Bacteria | 4146 |
| 103 | Ga0070684_100049238 | 3300005535 | Bacteria | 3657 |
| 104 | Ga0070684_100055477 | 3300005535 | Bacteria | 3454 |
| 105 | Ga0070697_100005200 | 3300005536 | Bacteria | 9996 |
| 106 | Ga0070672_100039743 | 3300005543 | Bacteria | 3605 |
| 107 | Ga0070672_100072106 | 3300005543 | Bacteria | 2750 |
| 108 | Ga0070672_100120348 | 3300005543 | Bacteria | 2148 |
| 109 | Ga0070686_100122995 | 3300005544 | Bacteria | 1784 |
| 110 | Ga0070693_100010163 | 3300005547 | Bacteria | 4704 |
| 111 | Ga0070693_100060028 | 3300005547 | Bacteria | 2206 |
| 112 | Ga0070665_100012542 | 3300005548 | Bacteria | 8537 |
| 113 | Ga0070665_100042412 | 3300005548 | Bacteria | 4573 |
| 114 | Ga0070665_100062706 | 3300005548 | Bacteria | 3727 |
| 115 | Ga0070665_100126293 | 3300005548 | Bacteria | 2560 |
| 116 | Ga0068855_100002117 | 3300005563 | Bacteria | 24552 |
| 117 | Ga0068855_100005045 | 3300005563 | Bacteria | 16111 |
| 118 | Ga0068855_100181217 | 3300005563 | Bacteria | 2381 |
| 119 | Ga0070664_100034953 | 3300005564 | Bacteria | 4217 |
| 120 | Ga0070664_100054431 | 3300005564 | Bacteria | 3394 |
| 121 | Ga0068857_100005707 | 3300005577 | Bacteria | 10644 |
| 122 | Ga0068857_100022308 | 3300005577 | Bacteria | 5570 |
| 123 | Ga0068857_100140635 | 3300005577 | Bacteria | 2181 |
| 124 | Ga0068854_100002147 | 3300005578 | Bacteria | 12110 |
| 125 | Ga0068856_100006035 | 3300005614 | Bacteria | 11916 |
| 126 | Ga0068856_100013804 | 3300005614 | Bacteria | 7809 |
| 127 | Ga0068856_100076180 | 3300005614 | Bacteria | 3323 |
| 128 | Ga0068856_100136322 | 3300005614 | Bacteria | 2460 |
| 129 | Ga0070702_100005662 | 3300005615 | Bacteria | 5848 |
| 130 | Ga0070702_100009743 | 3300005615 | Bacteria | 4711 |
| 131 | Ga0070702_100059838 | 3300005615 | Bacteria | 2212 |
| 132 | Ga0070702_100092737 | 3300005615 | Bacteria | 1835 |
| 133 | Ga0068852_100005875 | 3300005616 | Bacteria | 8820 |
| 134 | Ga0068852_100009233 | 3300005616 | Bacteria | 7306 |
| 135 | Ga0068852_100037992 | 3300005616 | Bacteria | 4043 |
| 136 | Ga0068852_100084755 | 3300005616 | Bacteria | 2821 |
| 137 | Ga0068852_100110271 | 3300005616 | Bacteria | 2500 |
| 138 | Ga0068859_100046929 | 3300005617 | Bacteria | 4338 |
| 139 | Ga0068859_100082194 | 3300005617 | Bacteria | 3264 |
| 140 | Ga0068864_100003975 | 3300005618 | Bacteria | 12171 |
| 141 | Ga0068866_10025248 | 3300005718 | Bacteria | 2791 |
| 142 | Ga0068861_100002408 | 3300005719 | Bacteria | 12180 |
| 143 | Ga0068851_10012207 | 3300005834 | Bacteria | 4045 |
| 144 | Ga0068851_10020541 | 3300005834 | Bacteria | 3199 |
| 145 | Ga0068870_10003481 | 3300005840 | Bacteria | 6675 |
| 146 | Ga0068863_100006471 | 3300005841 | Bacteria | 11485 |
| 147 | Ga0068863_100081257 | 3300005841 | Bacteria | 3070 |
| 148 | Ga0068858_100068777 | 3300005842 | Bacteria | 3282 |
| 149 | Ga0068860_100045967 | 3300005843 | Bacteria | 4164 |
| 150 | Ga0081455_10000123 | 3300005937 | Bacteria | 89254 |
| 151 | Ga0081455_10001506 | 3300005937 | Bacteria | 28768 |
| 152 | Ga0081539_10000919 | 3300005985 | Bacteria | 55491 |
| 153 | Ga0070717_10011176 | 3300006028 | Bacteria | 6805 |
| 154 | Ga0070717_10013777 | 3300006028 | Bacteria | 6205 |
| 155 | Ga0070717_10025313 | 3300006028 | Bacteria | 4718 |
| 156 | Ga0070717_10041275 | 3300006028 | Bacteria | 3762 |
| 157 | Ga0070717_10047747 | 3300006028 | Bacteria | 3509 |
| 158 | Ga0070717_10084741 | 3300006028 | Bacteria | 2666 |
| 159 | Ga0075365_10013836 | 3300006038 | Bacteria | 4840 |
| 160 | Ga0075368_10006845 | 3300006042 | Bacteria | 4005 |
| 161 | Ga0075363_100025841 | 3300006048 | Bacteria | 2999 |
| 162 | Ga0070715_10001284 | 3300006163 | Bacteria | 7195 |
| 163 | Ga0070716_100004409 | 3300006173 | Bacteria | 6728 |
| 164 | Ga0070716_100012672 | 3300006173 | Bacteria | 4279 |
| 165 | Ga0070716_100046609 | 3300006173 | Bacteria | 2440 |
| 166 | Ga0070716_100074208 | 3300006173 | Bacteria | 2009 |
| 167 | Ga0070712_100012909 | 3300006175 | Bacteria | 5322 |
| 168 | Ga0070712_100017813 | 3300006175 | Bacteria | 4601 |
| 169 | Ga0070712_100031738 | 3300006175 | Bacteria | 3561 |
| 170 | Ga0070712_100042643 | 3300006175 | Bacteria | 3121 |
| 171 | Ga0070712_100046323 | 3300006175 | Bacteria | 3006 |
| 172 | Ga0070712_100055682 | 3300006175 | Bacteria | 2770 |
| 173 | Ga0097621_100007462 | 3300006237 | Bacteria | 7822 |
| 174 | Ga0097621_100117148 | 3300006237 | Bacteria | 2256 |
| 175 | Ga0068871_100009216 | 3300006358 | Bacteria | 7139 |
| 176 | Ga0068871_100075614 | 3300006358 | Bacteria | 2781 |
| 177 | Ga0075428_100134410 | 3300006844 | Bacteria | 2689 |
| 178 | Ga0075428_100167834 | 3300006844 | Bacteria | 2380 |
| 179 | Ga0075431_100025422 | 3300006847 | Bacteria | 6069 |
| 180 | Ga0075431_100085037 | 3300006847 | Bacteria | 3265 |
| 181 | Ga0075431_100097074 | 3300006847 | Bacteria | 3042 |
| 182 | Ga0075433_10011613 | 3300006852 | Bacteria | 7095 |
| 183 | Ga0075433_10024336 | 3300006852 | Bacteria | 5108 |
| 184 | Ga0075433_10025055 | 3300006852 | Bacteria | 5042 |
| 185 | Ga0075433_10038978 | 3300006852 | Bacteria | 4106 |
| 186 | Ga0075433_10105672 | 3300006852 | Bacteria | 2495 |
| 187 | Ga0075434_100012332 | 3300006871 | Bacteria | 8098 |
| 188 | Ga0075434_100026109 | 3300006871 | Bacteria | 5721 |
| 189 | Ga0075434_100084553 | 3300006871 | Bacteria | 3172 |
| 190 | Ga0075434_100119422 | 3300006871 | Bacteria | 2650 |
| 191 | Ga0075434_100180303 | 3300006871 | Bacteria | 2132 |
| 192 | Ga0075429_100047159 | 3300006880 | Bacteria | 3749 |
| 193 | Ga0075429_100082607 | 3300006880 | Bacteria | 2800 |
| 194 | Ga0068865_100003709 | 3300006881 | Bacteria | 9176 |
| 195 | Ga0068865_100031231 | 3300006881 | Bacteria | 3551 |
| 196 | Ga0068865_100066120 | 3300006881 | Bacteria | 2550 |
| 197 | Ga0075436_100010143 | 3300006914 | Bacteria | 6450 |
| 198 | Ga0075436_100017185 | 3300006914 | Bacteria | 4951 |
| 199 | Ga0075436_100049588 | 3300006914 | Bacteria | 2897 |
| 200 | Ga0097620_100046929 | 3300006931 | Bacteria | 4338 |
| 201 | Ga0097620_100082193 | 3300006931 | Bacteria | 3264 |
| 202 | Ga0075435_100000523 | 3300007076 | Bacteria | 23542 |
| 203 | Ga0075435_100005298 | 3300007076 | Bacteria | 8981 |
| 204 | Ga0075435_100058051 | 3300007076 | Bacteria | 3133 |
| 205 | Ga0105251_10016259 | 3300009011 | Bacteria | 4028 |
| 206 | Ga0105240_10015709 | 3300009093 | Bacteria | 10273 |
| 207 | Ga0105240_10072227 | 3300009093 | Bacteria | 4265 |
| 208 | Ga0105240_10094129 | 3300009093 | Bacteria | 3655 |
| 209 | Ga0105240_10114985 | 3300009093 | Bacteria | 3249 |
| 210 | Ga0111539_10019426 | 3300009094 | Bacteria | 8387 |
| 211 | Ga0111539_10148357 | 3300009094 | Bacteria | 2746 |
| 212 | Ga0111539_10178312 | 3300009094 | Bacteria | 2482 |
| 213 | Ga0111539_10234046 | 3300009094 | Bacteria | 2139 |
| 214 | Ga0105245_10005589 | 3300009098 | Bacteria | 11043 |
| 215 | Ga0105245_10011825 | 3300009098 | Bacteria | 7592 |
| 216 | Ga0105245_10036074 | 3300009098 | Bacteria | 4390 |
| 217 | Ga0105245_10125346 | 3300009098 | Bacteria | 2404 |
| 218 | Ga0105247_10009645 | 3300009101 | Bacteria | 5857 |
| 219 | Ga0105247_10039178 | 3300009101 | Bacteria | 2895 |
| 220 | Ga0114129_10015764 | 3300009147 | Bacteria | 10745 |
| 221 | Ga0114129_10040454 | 3300009147 | Bacteria | 6571 |
| 222 | Ga0114129_10046739 | 3300009147 | Bacteria | 6083 |
| 223 | Ga0114129_10055068 | 3300009147 | Bacteria | 5575 |
| 224 | Ga0114129_10314640 | 3300009147 | Bacteria | 2083 |
| 225 | Ga0105243_10002387 | 3300009148 | Bacteria | 15737 |
| 226 | Ga0105243_10009903 | 3300009148 | Bacteria | 7248 |
| 227 | Ga0105243_10094380 | 3300009148 | Bacteria | 2470 |
| 228 | Ga0105241_10001988 | 3300009174 | Bacteria | 15474 |
| 229 | Ga0105241_10005381 | 3300009174 | Bacteria | 9465 |
| 230 | Ga0105241_10019360 | 3300009174 | Bacteria | 5019 |
| 231 | Ga0105242_10027713 | 3300009176 | Bacteria | 4503 |
| 232 | Ga0105248_10067072 | 3300009177 | Bacteria | 4029 |
| 233 | Ga0105248_10068314 | 3300009177 | Bacteria | 3990 |
| 234 | Ga0105237_10008550 | 3300009545 | Bacteria | 11066 |
| 235 | Ga0105237_10021863 | 3300009545 | Bacteria | 6570 |
| 236 | Ga0105238_10004485 | 3300009551 | Bacteria | 13832 |
| 237 | Ga0105238_10013378 | 3300009551 | Bacteria | 8281 |
| 238 | Ga0105238_10015810 | 3300009551 | Bacteria | 7638 |
| 239 | Ga0105238_10030996 | 3300009551 | Bacteria | 5443 |
| 240 | Ga0105238_10044458 | 3300009551 | Bacteria | 4489 |
| 241 | Ga0105249_10008050 | 3300009553 | Bacteria | 9190 |
| 242 | Ga0105249_10010209 | 3300009553 | Bacteria | 8248 |
| 243 | Ga0105249_10036681 | 3300009553 | Bacteria | 4448 |
| 244 | Ga0105249_10046632 | 3300009553 | Bacteria | 3945 |
| 245 | Ga0105249_10055325 | 3300009553 | Bacteria | 3629 |
| 246 | Ga0105239_10028892 | 3300010375 | Bacteria | 6095 |
| 247 | Ga0105239_10032423 | 3300010375 | Bacteria | 5741 |
| 248 | Ga0105239_10041232 | 3300010375 | Bacteria | 5059 |
| 249 | Ga0105239_10054291 | 3300010375 | Bacteria | 4394 |
| 250 | Ga0105239_10081713 | 3300010375 | Bacteria | 3557 |
| 251 | Ga0105246_10002583 | 3300011119 | Bacteria | 10949 |
| 252 | Ga0105246_10010935 | 3300011119 | Bacteria | 5626 |
| 253 | Ga0105246_10017620 | 3300011119 | Bacteria | 4543 |
| 254 | Ga0105246_10038000 | 3300011119 | Bacteria | 3233 |
| 255 | Ga0105246_10050252 | 3300011119 | Bacteria | 2859 |
| 256 | Ga0105246_10050500 | 3300011119 | Bacteria | 2853 |
| 257 | Ga0157373_10047373 | 3300013100 | Bacteria | 3066 |
| 258 | Ga0157369_10001889 | 3300013105 | Bacteria | 25266 |
| 259 | Ga0157369_10011108 | 3300013105 | Bacteria | 10244 |
| 260 | Ga0157369_10018141 | 3300013105 | Bacteria | 7893 |
| 261 | Ga0157369_10157007 | 3300013105 | Bacteria | 2402 |
| 262 | Ga0157369_10250643 | 3300013105 | Bacteria | 1848 |
| 263 | Ga0157374_10008821 | 3300013296 | Bacteria | 8631 |
| 264 | Ga0157374_10040301 | 3300013296 | Bacteria | 4301 |
| 265 | Ga0157374_10094403 | 3300013296 | Bacteria | 2858 |
| 266 | Ga0163162_10033665 | 3300013306 | Bacteria | 5092 |
| 267 | Ga0163162_10068450 | 3300013306 | Bacteria | 3602 |
| 268 | Ga0157372_10017094 | 3300013307 | Bacteria | 7786 |
| 269 | Ga0157372_10077393 | 3300013307 | Bacteria | 3757 |
| 270 | Ga0157372_10112101 | 3300013307 | Bacteria | 3125 |
| 271 | Ga0157372_10129147 | 3300013307 | Bacteria | 2907 |
| 272 | Ga0157372_10209447 | 3300013307 | Bacteria | 2259 |
| 273 | Ga0157375_10030166 | 3300013308 | Bacteria | 5110 |
| 274 | Ga0157375_10042902 | 3300013308 | Bacteria | 4382 |
| 275 | Ga0157375_10134302 | 3300013308 | Bacteria | 2596 |
| 276 | Ga0163163_10009952 | 3300014325 | Bacteria | 8526 |
| 277 | Ga0163163_10061935 | 3300014325 | Bacteria | 3707 |
| 278 | Ga0163163_10115834 | 3300014325 | Bacteria | 2711 |
| 279 | Ga0157380_10009185 | 3300014326 | Bacteria | 7072 |
| 280 | Ga0157380_10038542 | 3300014326 | Bacteria | 3712 |
| 281 | Ga0182008_10025926 | 3300014497 | Bacteria | 2974 |
| 282 | Ga0157377_10009848 | 3300014745 | Bacteria | 4708 |
| 283 | Ga0157377_10010375 | 3300014745 | Bacteria | 4606 |
| 284 | Ga0157377_10014394 | 3300014745 | Bacteria | 4025 |
| 285 | Ga0157376_10017650 | 3300014969 | Bacteria | 5450 |
| 286 | Ga0157376_10022075 | 3300014969 | Bacteria | 4954 |
| 287 | Ga0206353_11878011 | 3300020082 | Bacteria | 5824 |
| 288 | Ga0224712_10025006 | 3300022467 | Bacteria | 2094 |
| 289 | Ga0224572_1002365 | 3300024225 | Bacteria | 3028 |
| 290 | Ga0207656_10012516 | 3300025321 | Bacteria | 3227 |
| 291 | Ga0207656_10021898 | 3300025321 | Bacteria | 2559 |
| 292 | Ga0207692_10006172 | 3300025898 | Bacteria | 4853 |
| 293 | Ga0207692_10042480 | 3300025898 | Bacteria | 2257 |
| 294 | Ga0207642_10012998 | 3300025899 | Bacteria | 3023 |
| 295 | Ga0207710_10006639 | 3300025900 | Bacteria | 4931 |
| 296 | Ga0207688_10000213 | 3300025901 | Bacteria | 25981 |
| 297 | Ga0207688_10002494 | 3300025901 | Bacteria | 9907 |
| 298 | Ga0207688_10044282 | 3300025901 | Bacteria | 2480 |
| 299 | Ga0207647_10005252 | 3300025904 | Bacteria | 9533 |
| 300 | Ga0207699_10000619 | 3300025906 | Bacteria | 17260 |
| 301 | Ga0207699_10001901 | 3300025906 | Bacteria | 9839 |
| 302 | Ga0207699_10004489 | 3300025906 | Bacteria | 6669 |
| 303 | Ga0207699_10004492 | 3300025906 | Bacteria | 6666 |
| 304 | Ga0207645_10044425 | 3300025907 | Bacteria | 2843 |
| 305 | Ga0207643_10000218 | 3300025908 | Bacteria | 40287 |
| 306 | Ga0207643_10007267 | 3300025908 | Bacteria | 5942 |
| 307 | Ga0207643_10007735 | 3300025908 | Bacteria | 5773 |
| 308 | Ga0207705_10037063 | 3300025909 | Bacteria | 3489 |
| 309 | Ga0207684_10001508 | 3300025910 | Bacteria | 24953 |
| 310 | Ga0207684_10005740 | 3300025910 | Bacteria | 11395 |
| 311 | Ga0207654_10003770 | 3300025911 | Bacteria | 7638 |
| 312 | Ga0207707_10000090 | 3300025912 | Bacteria | 90918 |
| 313 | Ga0207707_10007781 | 3300025912 | Bacteria | 9328 |
| 314 | Ga0207707_10035007 | 3300025912 | Bacteria | 4391 |
| 315 | Ga0207695_10002866 | 3300025913 | Bacteria | 25047 |
| 316 | Ga0207671_10003461 | 3300025914 | Bacteria | 15716 |
| 317 | Ga0207671_10035151 | 3300025914 | Bacteria | 3720 |
| 318 | Ga0207693_10010102 | 3300025915 | Bacteria | 7668 |
| 319 | Ga0207693_10027829 | 3300025915 | Bacteria | 4468 |
| 320 | Ga0207693_10081784 | 3300025915 | Bacteria | 2529 |
| 321 | Ga0207663_10035938 | 3300025916 | Bacteria | 2976 |
| 322 | Ga0207663_10122751 | 3300025916 | Bacteria | 1782 |
| 323 | Ga0207660_10000219 | 3300025917 | Bacteria | 36887 |
| 324 | Ga0207660_10043409 | 3300025917 | Bacteria | 3160 |
| 325 | Ga0207660_10059241 | 3300025917 | Bacteria | 2748 |
| 326 | Ga0207662_10016436 | 3300025918 | Bacteria | 4176 |
| 327 | Ga0207657_10008572 | 3300025919 | Bacteria | 10359 |
| 328 | Ga0207657_10010945 | 3300025919 | Bacteria | 9024 |
| 329 | Ga0207657_10013651 | 3300025919 | Bacteria | 7961 |
| 330 | Ga0207657_10102038 | 3300025919 | Bacteria | 2380 |
| 331 | Ga0207649_10007987 | 3300025920 | Bacteria | 5756 |
| 332 | Ga0207652_10000485 | 3300025921 | Bacteria | 40829 |
| 333 | Ga0207652_10016208 | 3300025921 | Bacteria | 6080 |
| 334 | Ga0207646_10012024 | 3300025922 | Bacteria | 8341 |
| 335 | Ga0207694_10000843 | 3300025924 | Bacteria | 27292 |
| 336 | Ga0207694_10114250 | 3300025924 | Bacteria | 2150 |
| 337 | Ga0207650_10009927 | 3300025925 | Bacteria | 6513 |
| 338 | Ga0207687_10000842 | 3300025927 | Bacteria | 20740 |
| 339 | Ga0207687_10031812 | 3300025927 | Bacteria | 3569 |
| 340 | Ga0207700_10004656 | 3300025928 | Bacteria | 8128 |
| 341 | Ga0207700_10008259 | 3300025928 | Bacteria | 6434 |
| 342 | Ga0207700_10011992 | 3300025928 | Bacteria | 5562 |
| 343 | Ga0207700_10024576 | 3300025928 | Bacteria | 4172 |
| 344 | Ga0207700_10025233 | 3300025928 | Bacteria | 4125 |
| 345 | Ga0207700_10035520 | 3300025928 | Bacteria | 3591 |
| 346 | Ga0207700_10048897 | 3300025928 | Bacteria | 3143 |
| 347 | Ga0207700_10058256 | 3300025928 | Bacteria | 2917 |
| 348 | Ga0207700_10066774 | 3300025928 | Bacteria | 2750 |
| 349 | Ga0207700_10072356 | 3300025928 | Bacteria | 2658 |
| 350 | Ga0207664_10003669 | 3300025929 | Bacteria | 10285 |
| 351 | Ga0207664_10003919 | 3300025929 | Bacteria | 10001 |
| 352 | Ga0207664_10004524 | 3300025929 | Bacteria | 9421 |
| 353 | Ga0207664_10010352 | 3300025929 | Bacteria | 6586 |
| 354 | Ga0207664_10017382 | 3300025929 | Bacteria | 5271 |
| 355 | Ga0207664_10025480 | 3300025929 | Bacteria | 4457 |
| 356 | Ga0207664_10026630 | 3300025929 | Unclassified | 4373 |
| 357 | Ga0207664_10039346 | 3300025929 | Bacteria | 3672 |
| 358 | Ga0207644_10008003 | 3300025931 | Bacteria | 6912 |
| 359 | Ga0207644_10012375 | 3300025931 | Bacteria | 5664 |
| 360 | Ga0207690_10004202 | 3300025932 | Bacteria | 8512 |
| 361 | Ga0207690_10090184 | 3300025932 | Bacteria | 2163 |
| 362 | Ga0207706_10076573 | 3300025933 | Bacteria | 2942 |
| 363 | Ga0207706_10106804 | 3300025933 | Bacteria | 2464 |
| 364 | Ga0207709_10008686 | 3300025935 | Bacteria | 5606 |
| 365 | Ga0207709_10029106 | 3300025935 | Bacteria | 3200 |
| 366 | Ga0207670_10097738 | 3300025936 | Bacteria | 2091 |
| 367 | Ga0207669_10105408 | 3300025937 | Bacteria | 1875 |
| 368 | Ga0207704_10056512 | 3300025938 | Bacteria | 2405 |
| 369 | Ga0207665_10000412 | 3300025939 | Bacteria | 29458 |
| 370 | Ga0207665_10004021 | 3300025939 | Bacteria | 9817 |
| 371 | Ga0207665_10008637 | 3300025939 | Bacteria | 6707 |
| 372 | Ga0207665_10023651 | 3300025939 | Bacteria | 4047 |
| 373 | Ga0207691_10013198 | 3300025940 | Bacteria | 7910 |
| 374 | Ga0207691_10022500 | 3300025940 | Bacteria | 5944 |
| 375 | Ga0207691_10107485 | 3300025940 | Bacteria | 2483 |
| 376 | Ga0207689_10002593 | 3300025942 | Bacteria | 16723 |
| 377 | Ga0207689_10029825 | 3300025942 | Bacteria | 4549 |
| 378 | Ga0207661_10002657 | 3300025944 | Bacteria | 12298 |
| 379 | Ga0207661_10006624 | 3300025944 | Bacteria | 8184 |
| 380 | Ga0207661_10044306 | 3300025944 | Bacteria | 3516 |
| 381 | Ga0207661_10065827 | 3300025944 | Bacteria | 2942 |
| 382 | Ga0207661_10088523 | 3300025944 | Bacteria | 2574 |
| 383 | Ga0207661_10133799 | 3300025944 | Bacteria | 2127 |
| 384 | Ga0207679_10010995 | 3300025945 | Bacteria | 5841 |
| 385 | Ga0207679_10060091 | 3300025945 | Bacteria | 2823 |
| 386 | Ga0207679_10106384 | 3300025945 | Bacteria | 2205 |
| 387 | Ga0207667_10004602 | 3300025949 | Bacteria | 16924 |
| 388 | Ga0207667_10015537 | 3300025949 | Bacteria | 8640 |
| 389 | Ga0207651_10118895 | 3300025960 | Bacteria | 2000 |
| 390 | Ga0207651_10121339 | 3300025960 | Bacteria | 1983 |
| 391 | Ga0207668_10017830 | 3300025972 | Bacteria | 4456 |
| 392 | Ga0207640_10004012 | 3300025981 | Bacteria | 7953 |
| 393 | Ga0207677_10004443 | 3300026023 | Bacteria | 7531 |
| 394 | Ga0207677_10029647 | 3300026023 | Bacteria | 3481 |
| 395 | Ga0207677_10062601 | 3300026023 | Bacteria | 2582 |
| 396 | Ga0207677_10081446 | 3300026023 | Bacteria | 2323 |
| 397 | Ga0207703_10123776 | 3300026035 | Bacteria | 2223 |
| 398 | Ga0207639_10057038 | 3300026041 | Bacteria | 2997 |
| 399 | Ga0207639_10057387 | 3300026041 | Bacteria | 2989 |
| 400 | Ga0207678_10011871 | 3300026067 | Bacteria | 7650 |
| 401 | Ga0207678_10078529 | 3300026067 | Bacteria | 2827 |
| 402 | Ga0207678_10096187 | 3300026067 | Bacteria | 2531 |
| 403 | Ga0207708_10000985 | 3300026075 | Bacteria | 21291 |
| 404 | Ga0207708_10002530 | 3300026075 | Bacteria | 13445 |
| 405 | Ga0207708_10006019 | 3300026075 | Bacteria | 8991 |
| 406 | Ga0207708_10032889 | 3300026075 | Bacteria | 3938 |
| 407 | Ga0207708_10033380 | 3300026075 | Bacteria | 3910 |
| 408 | Ga0207708_10045044 | 3300026075 | Bacteria | 3362 |
| 409 | Ga0207708_10071096 | 3300026075 | Bacteria | 2665 |
| 410 | Ga0207702_10002437 | 3300026078 | Bacteria | 17646 |
| 411 | Ga0207702_10009971 | 3300026078 | Bacteria | 7965 |
| 412 | Ga0207702_10114614 | 3300026078 | Bacteria | 2402 |
| 413 | Ga0207648_10001308 | 3300026089 | Bacteria | 27722 |
| 414 | Ga0207648_10004509 | 3300026089 | Bacteria | 14281 |
| 415 | Ga0207648_10017309 | 3300026089 | Bacteria | 6564 |
| 416 | Ga0207648_10029778 | 3300026089 | Bacteria | 4841 |
| 417 | Ga0207676_10003391 | 3300026095 | Bacteria | 11254 |
| 418 | Ga0207676_10016826 | 3300026095 | Bacteria | 5295 |
| 419 | Ga0207676_10033378 | 3300026095 | Bacteria | 3888 |
| 420 | Ga0207674_10000093 | 3300026116 | Bacteria | 99440 |
| 421 | Ga0207674_10014208 | 3300026116 | Bacteria | 8796 |
| 422 | Ga0207674_10017738 | 3300026116 | Bacteria | 7758 |
| 423 | Ga0207674_10084964 | 3300026116 | Bacteria | 3162 |
| 424 | Ga0207674_10107503 | 3300026116 | Bacteria | 2767 |
| 425 | Ga0207675_100003463 | 3300026118 | Bacteria | 15427 |
| 426 | Ga0207683_10000454 | 3300026121 | Bacteria | 38017 |
| 427 | Ga0207683_10009054 | 3300026121 | Bacteria | 8485 |
| 428 | Ga0207683_10106699 | 3300026121 | Bacteria | 2505 |
| 429 | Ga0207683_10154855 | 3300026121 | Bacteria | 2070 |
| 430 | Ga0207698_10004756 | 3300026142 | Bacteria | 8308 |
| 431 | Ga0207698_10046821 | 3300026142 | Bacteria | 3270 |
| 432 | Ga0207428_10115835 | 3300027907 | Bacteria | 2059 |
| 433 | Ga0207428_10133363 | 3300027907 | Bacteria | 1900 |
| 434 | Ga0268266_10054809 | 3300028379 | Bacteria | 3427 |
| 435 | Ga0268266_10094610 | 3300028379 | Bacteria | 2623 |
| 436 | Ga0268265_10108993 | 3300028380 | Bacteria | 2256 |
| 437 | Ga0268265_10122970 | 3300028380 | Bacteria | 2142 |
| 438 | Ga0268264_10039541 | 3300028381 | Bacteria | 3897 |
| 439 | Ga0307513_10019341 | 3300031456 | Bacteria | 8110 |
| 440 | Ga0307406_10076400 | 3300031901 | Bacteria | 2212 |
| 441 | Ga0307409_100027270 | 3300031995 | Bacteria | 4045 |
| 442 | Ga0307416_100005109 | 3300032002 | Bacteria | 8010 |
| 443 | Ga0307416_100090392 | 3300032002 | Bacteria | 2625 |
| 444 | Ga0307416_100114158 | 3300032002 | Bacteria | 2389 |
| 445 | Ga0307411_10016550 | 3300032005 | Bacteria | 4176 |
| 446 | Ga0307415_100037871 | 3300032126 | Bacteria | 3173 |
| 447 | Ga0373926_0001583 | 3300035083 | Bacteria | 6997 |
| 448 | Ga0373934_0001615 | 3300035086 | Bacteria | 8273 |
| 449 | Ga0373944_0001827 | 3300035089 | Bacteria | 5376 |
| 450 | Ga0373936_0003892 | 3300035113 | Bacteria | 5626 |
| 451 | Ga0373945_0000591 | 3300035116 | Bacteria | 10415 |
| 452 | Ga0373953_0009920 | 3300035117 | Bacteria | 3298 |
| 453 | Ga0373954_0042125 | 3300035118 | Bacteria | 2129 |
| 454 | Ga0373956_0001004 | 3300035119 | Bacteria | 11642 |
| 455 | Ga0373957_0008506 | 3300035120 | Bacteria | 3327 |
| 456 | Ga0373957_0019408 | 3300035120 | Bacteria | 2392 |
| 457 | Ga0373943_0001628 | 3300035170 | Bacteria | 10184 |
| 458 | Ga0373955_0000005 | 3300035172 | Bacteria | 108267 |
| 459 | Ga0373924_0008586 | 3300035410 | Bacteria | 3719 |
| 460 | Ga0373927_0016122 | 3300035695 | Bacteria | 4930 |
| 461 | Ga0373927_0019496 | 3300035695 | Bacteria | 4447 |
| 462 | Ga0373933_0000043 | 3300035724 | Bacteria | 78147 |
| 463 | Ga0373933_0022557 | 3300035724 | Bacteria | 3586 |
| 464 | Ga0373933_0039045 | 3300035724 | Bacteria | 2792 |
| 465 | Ga0373933_0049229 | 3300035724 | Bacteria | 2512 |
| 466 | Ga0373933_0081560 | 3300035724 | Bacteria | 1984 |
| 467 | Ga0373947_0004411 | 3300035725 | Bacteria | 8254 |
| 468 | Ga0373947_0019417 | 3300035725 | Bacteria | 3918 |
| 469 | Ga0373937_0000245 | 3300036401 | Bacteria | 53041 |
| 470 | Ga0373937_0003783 | 3300036401 | Bacteria | 12795 |
| 471 | Ga0373937_0040151 | 3300036401 | Bacteria | 4265 |
| 472 | Ga0373937_0063250 | 3300036401 | Bacteria | 3403 |
| 473 | Ga0373937_0063513 | 3300036401 | Bacteria | 3396 |
| 474 | Ga0373937_0084052 | 3300036401 | Bacteria | 2944 |
| 475 | Ga0373937_0096125 | 3300036401 | Bacteria | 2747 |
| 476 | Ga0373937_0179693 | 3300036401 | Bacteria | 1987 |
| 477 | Ga0373925_0000028 | 3300037068 | Bacteria | 149654 |
| 478 | Ga0373925_0001494 | 3300037068 | Bacteria | 20080 |
| 479 | Ga0373925_0001915 | 3300037068 | Bacteria | 17236 |
| 480 | Ga0373925_0007560 | 3300037068 | Bacteria | 7917 |
| 481 | Ga0373925_0109962 | 3300037068 | Bacteria | 2128 |
| 482 | Ga0395900_0143787 | 3300037418 | Bacteria | 2441 |
| 483 | Ga0395898_0179084 | 3300037466 | Bacteria | 2026 |
| 484 | Ga0395905_0059024 | 3300037471 | Bacteria | 3587 |
| 485 | Ga0451853_0174584 | 3300041512 | Bacteria | 2421 |
| 486 | Ga0451853_2073262 | 3300041512 | Bacteria | 3827 |
| 487 | Ga0439448_0007867 | 3300042005 | Bacteria | 3101 |
| 488 | Ga0439448_0008553 | 3300042005 | Bacteria | 3000 |
| 489 | Ga0439463_002716 | 3300042016 | Bacteria | 4473 |
| 490 | Ga0450902_007704 | 3300042137 | Bacteria | 1671 |
| 491 | Ga0439458_0008012 | 3300042157 | Bacteria | 2350 |
| 492 | Ga0439458_0008711 | 3300042157 | Bacteria | 2263 |
| 493 | Ga0439460_0018107 | 3300042461 | Bacteria | 1893 |
| 494 | Ga0466963_0001267 | 3300044694 | Bacteria | 13391 |
| 495 | Ga0466970_0012932 | 3300044765 | Bacteria | 4275 |
| 496 | Ga0466959_0070396 | 3300045049 | Bacteria | 2534 |
| 497 | Ga0466967_0004137 | 3300045976 | Bacteria | 9701 |
| 498 | Ga0466967_0007021 | 3300045976 | Bacteria | 8065 |
| 499 | Ga0466967_0101822 | 3300045976 | Bacteria | 2626 |
| 500 | Ga0495592_0000092 | 3300046454 | Bacteria | 79147 |
| 501 | Ga0495592_0011277 | 3300046454 | Bacteria | 6759 |
| 502 | Ga0495592_0033973 | 3300046454 | Bacteria | 3846 |
| 503 | Ga0495592_0097787 | 3300046454 | Bacteria | 2096 |
| 504 | Ga0495629_0001088 | 3300046459 | Bacteria | 21535 |
| 505 | Ga0495629_0001429 | 3300046459 | Bacteria | 18830 |
| 506 | Ga0495629_0014399 | 3300046459 | Bacteria | 5689 |
| 507 | Ga0495641_0001952 | 3300046461 | Bacteria | 16770 |
| 508 | Ga0495641_0022859 | 3300046461 | Bacteria | 3119 |
| 509 | Ga0495651_0000066 | 3300046462 | Bacteria | 77538 |
| 510 | Ga0495651_0001498 | 3300046462 | Bacteria | 18071 |
| 511 | Ga0495651_0003513 | 3300046462 | Bacteria | 12018 |
| 512 | Ga0495651_0010231 | 3300046462 | Bacteria | 7200 |
| 513 | Ga0495651_0011712 | 3300046462 | Bacteria | 6738 |
| 514 | Ga0495651_0018918 | 3300046462 | Bacteria | 5337 |
| 515 | Ga0495651_0019855 | 3300046462 | Bacteria | 5211 |
| 516 | Ga0495651_0058460 | 3300046462 | Bacteria | 2958 |
| 517 | Ga0495653_0002166 | 3300046463 | Bacteria | 15515 |
| 518 | Ga0495653_0003794 | 3300046463 | Bacteria | 12221 |
| 519 | Ga0495653_0004422 | 3300046463 | Bacteria | 11360 |
| 520 | Ga0495653_0008124 | 3300046463 | Bacteria | 8594 |
| 521 | Ga0495653_0012547 | 3300046463 | Bacteria | 6920 |
| 522 | Ga0495653_0036173 | 3300046463 | Bacteria | 3891 |
| 523 | Ga0495653_0099119 | 3300046463 | Bacteria | 2115 |
| 524 | Ga0495580_0015030 | 3300046472 | Bacteria | 5858 |
| 525 | Ga0495582_0000078 | 3300046473 | Bacteria | 49080 |
| 526 | Ga0495582_0000338 | 3300046473 | Bacteria | 25659 |
| 527 | Ga0495582_0001399 | 3300046473 | Bacteria | 13590 |
| 528 | Ga0495582_0002910 | 3300046473 | Bacteria | 9572 |
| 529 | Ga0495639_0003784 | 3300046475 | Bacteria | 6499 |
| 530 | Ga0495639_0030093 | 3300046475 | Bacteria | 2412 |
| 531 | Ga0495662_0008850 | 3300046476 | Bacteria | 4944 |
| 532 | Ga0495662_0012129 | 3300046476 | Bacteria | 4210 |
| 533 | Ga0495594_0017675 | 3300046499 | Bacteria | 3770 |
| 534 | Ga0495594_0032192 | 3300046499 | Bacteria | 2845 |
| 535 | Ga0495608_0000070 | 3300046511 | Bacteria | 77533 |
| 536 | Ga0495608_0007499 | 3300046511 | Bacteria | 7702 |
| 537 | Ga0495608_0043756 | 3300046511 | Bacteria | 2991 |
| 538 | Ga0495608_0044263 | 3300046511 | Bacteria | 2971 |
| 539 | Ga0495608_0065762 | 3300046511 | Bacteria | 2374 |
| 540 | Ga0495618_0034995 | 3300046514 | Bacteria | 3151 |
| 541 | Ga0495618_0073762 | 3300046514 | Bacteria | 2173 |
| 542 | Ga0495618_0091766 | 3300046514 | Bacteria | 1942 |
| 543 | Ga0495628_0000624 | 3300046516 | Bacteria | 32362 |
| 544 | Ga0495628_0003918 | 3300046516 | Bacteria | 13261 |
| 545 | Ga0495628_0013221 | 3300046516 | Bacteria | 6941 |
| 546 | Ga0495628_0021322 | 3300046516 | Bacteria | 5332 |
| 547 | Ga0495628_0027893 | 3300046516 | Bacteria | 4590 |
| 548 | Ga0495628_0052056 | 3300046516 | Bacteria | 3235 |
| 549 | Ga0495628_0094001 | 3300046516 | Bacteria | 2318 |
| 550 | Ga0495628_0112248 | 3300046516 | Bacteria | 2095 |
| 551 | Ga0495630_0018348 | 3300046517 | Bacteria | 5139 |
| 552 | Ga0495630_0027780 | 3300046517 | Bacteria | 4201 |
| 553 | Ga0495652_0000679 | 3300046529 | Bacteria | 39396 |
| 554 | Ga0495652_0000769 | 3300046529 | Bacteria | 36908 |
| 555 | Ga0495652_0009984 | 3300046529 | Bacteria | 8603 |
| 556 | Ga0495652_0013266 | 3300046529 | Bacteria | 7418 |
| 557 | Ga0495652_0016891 | 3300046529 | Bacteria | 6522 |
| 558 | Ga0495652_0051756 | 3300046529 | Bacteria | 3505 |
| 559 | Ga0495652_0090925 | 3300046529 | Bacteria | 2496 |
| 560 | Ga0495665_0001371 | 3300046531 | Bacteria | 13031 |
| 561 | Ga0495665_0006507 | 3300046531 | Bacteria | 6308 |
| 562 | Ga0495665_0011482 | 3300046531 | Bacteria | 4795 |
| 563 | Ga0495665_0021638 | 3300046531 | Bacteria | 3457 |
| 564 | Ga0495640_0013066 | 3300046533 | Bacteria | 6324 |
| 565 | Ga0495640_0023414 | 3300046533 | Bacteria | 4499 |
| 566 | Ga0495640_0034424 | 3300046533 | Bacteria | 3591 |
| 567 | Ga0495640_0047829 | 3300046533 | Bacteria | 2958 |
| 568 | Ga0495587_0000077 | 3300046536 | Bacteria | 77532 |
| 569 | Ga0495587_0004198 | 3300046536 | Bacteria | 9537 |
| 570 | Ga0495587_0014003 | 3300046536 | Bacteria | 5036 |
| 571 | Ga0495587_0056171 | 3300046536 | Bacteria | 2316 |
| 572 | Ga0495587_0068029 | 3300046536 | Bacteria | 2075 |
| 573 | Ga0495621_0000572 | 3300046539 | Bacteria | 9176 |
| 574 | Ga0495645_0064304 | 3300046543 | Bacteria | 2655 |
| 575 | Ga0495645_0078985 | 3300046543 | Bacteria | 2364 |
| 576 | Ga0495645_0084253 | 3300046543 | Bacteria | 2276 |
| 577 | Ga0495667_0000071 | 3300046559 | Bacteria | 77538 |
| 578 | Ga0495667_0002937 | 3300046559 | Bacteria | 11443 |
| 579 | Ga0495667_0005115 | 3300046559 | Bacteria | 8860 |
| 580 | Ga0495667_0006824 | 3300046559 | Bacteria | 7750 |
| 581 | Ga0495667_0013560 | 3300046559 | Bacteria | 5513 |
| 582 | Ga0495667_0030210 | 3300046559 | Bacteria | 3643 |
| 583 | Ga0495667_0036047 | 3300046559 | Bacteria | 3304 |
| 584 | Ga0495667_0048750 | 3300046559 | Bacteria | 2796 |
| 585 | Ga0495634_0011952 | 3300046642 | Bacteria | 6298 |
| 586 | Ga0495634_0019468 | 3300046642 | Bacteria | 4823 |
| 587 | Ga0495634_0031304 | 3300046642 | Bacteria | 3665 |
| 588 | Ga0495634_0031861 | 3300046642 | Bacteria | 3629 |
| 589 | Ga0495634_0074759 | 3300046642 | Bacteria | 2226 |
| 590 | Ga0495635_0009283 | 3300046663 | Bacteria | 6871 |
| 591 | Ga0495635_0012304 | 3300046663 | Bacteria | 5995 |
| 592 | Ga0495635_0017230 | 3300046663 | Bacteria | 5046 |
| 593 | Ga0495635_0018757 | 3300046663 | Bacteria | 4827 |
| 594 | Ga0495635_0023243 | 3300046663 | Bacteria | 4321 |
| 595 | Ga0495588_0004695 | 3300046674 | Bacteria | 6035 |
| 596 | Ga0495588_0022616 | 3300046674 | Bacteria | 3108 |
| 597 | Ga0495657_0000095 | 3300046675 | Bacteria | 77538 |
| 598 | Ga0495657_0003888 | 3300046675 | Bacteria | 12027 |
| 599 | Ga0495657_0005793 | 3300046675 | Bacteria | 9734 |
| 600 | Ga0495657_0008653 | 3300046675 | Bacteria | 7765 |
| 601 | Ga0495599_0000155 | 3300046678 | Bacteria | 45015 |
| 602 | Ga0495599_0007643 | 3300046678 | Bacteria | 6565 |
| 603 | Ga0495599_0086353 | 3300046678 | Bacteria | 1959 |
| 604 | Ga0495599_0104857 | 3300046678 | Bacteria | 1761 |
| 605 | Ga0495623_0001673 | 3300046679 | Bacteria | 14902 |
| 606 | Ga0495623_0015929 | 3300046679 | Bacteria | 4860 |
| 607 | Ga0495623_0019635 | 3300046679 | Bacteria | 4368 |
| 608 | Ga0495646_0009024 | 3300046680 | Bacteria | 6324 |
| 609 | Ga0495646_0032465 | 3300046680 | Bacteria | 3249 |
| 610 | Ga0495647_0014609 | 3300046681 | Bacteria | 2738 |
| 611 | Ga0495647_0015267 | 3300046681 | Bacteria | 2688 |
| 612 | Ga0495658_0000236 | 3300046683 | Bacteria | 31770 |
| 613 | Ga0495658_0000726 | 3300046683 | Bacteria | 17778 |
| 614 | Ga0495658_0008286 | 3300046683 | Bacteria | 5149 |
| 615 | Ga0495613_0000207 | 3300046689 | Bacteria | 58099 |
| 616 | Ga0495613_0004518 | 3300046689 | Bacteria | 10433 |
| 617 | Ga0495613_0018030 | 3300046689 | Bacteria | 5261 |
| 618 | Ga0495613_0091729 | 3300046689 | Bacteria | 2200 |
| 619 | Ga0495624_0002604 | 3300046690 | Bacteria | 13611 |
| 620 | Ga0495624_0020231 | 3300046690 | Bacteria | 4433 |
| 621 | Ga0495624_0025322 | 3300046690 | Bacteria | 3896 |
| 622 | Ga0495600_0001750 | 3300046809 | Bacteria | 12137 |
| 623 | Ga0495600_0013426 | 3300046809 | Bacteria | 5147 |
| 624 | Ga0495600_0017470 | 3300046809 | Bacteria | 4564 |
| 625 | Ga0495600_0023354 | 3300046809 | Bacteria | 3978 |
| 626 | Ga0495600_0025724 | 3300046809 | Bacteria | 3793 |
| 627 | Ga0495600_0037480 | 3300046809 | Bacteria | 3152 |
| 628 | Ga0495600_0044659 | 3300046809 | Bacteria | 2890 |
| 629 | Ga0495581_0001112 | 3300047315 | Bacteria | 14690 |
| 630 | Ga0495581_0001409 | 3300047315 | Bacteria | 13320 |
| 631 | Ga0495581_0011427 | 3300047315 | Bacteria | 5139 |
| 632 | Ga0495581_0037896 | 3300047315 | Bacteria | 2790 |
| 633 | Ga0495604_0000087 | 3300047317 | Bacteria | 79147 |
| 634 | Ga0495604_0001649 | 3300047317 | Bacteria | 18351 |
| 635 | Ga0495604_0046959 | 3300047317 | Bacteria | 3365 |
| 636 | Ga0495604_0052269 | 3300047317 | Bacteria | 3165 |
| 637 | Ga0495674_0010613 | 3300047319 | Bacteria | 8716 |
| 638 | Ga0495674_0040756 | 3300047319 | Bacteria | 4151 |
| 639 | Ga0495674_0060103 | 3300047319 | Bacteria | 3317 |
| 640 | Ga0495674_0074405 | 3300047319 | Bacteria | 2925 |
| 641 | Ga0495674_0077342 | 3300047319 | Bacteria | 2861 |
| 642 | Ga0495676_0011573 | 3300047321 | Bacteria | 7959 |
| 643 | Ga0495676_0020754 | 3300047321 | Bacteria | 5756 |
| 644 | Ga0495676_0083124 | 3300047321 | Bacteria | 2421 |
| 645 | Ga0495680_0002287 | 3300047322 | Bacteria | 19719 |
| 646 | Ga0495680_0003033 | 3300047322 | Bacteria | 16753 |
| 647 | Ga0495680_0006516 | 3300047322 | Bacteria | 10836 |
| 648 | Ga0495680_0006570 | 3300047322 | Bacteria | 10790 |
| 649 | Ga0495680_0006733 | 3300047322 | Bacteria | 10627 |
| 650 | Ga0495680_0012893 | 3300047322 | Bacteria | 7324 |
| 651 | Ga0495680_0020012 | 3300047322 | Bacteria | 5640 |
| 652 | Ga0495680_0027766 | 3300047322 | Bacteria | 4645 |
| 653 | Ga0495680_0039139 | 3300047322 | Bacteria | 3784 |
| 654 | Ga0495680_0055223 | 3300047322 | Bacteria | 3081 |
| 655 | Ga0495680_0086991 | 3300047322 | Bacteria | 2351 |
| 656 | Ga0495680_0126468 | 3300047322 | Bacteria | 1882 |
| 657 | Ga0495675_0000157 | 3300047444 | Bacteria | 48143 |
| 658 | Ga0495675_0001850 | 3300047444 | Bacteria | 12615 |
| 659 | Ga0495675_0003497 | 3300047444 | Bacteria | 9465 |
| 660 | Ga0495675_0009503 | 3300047444 | Bacteria | 6056 |
| 661 | Ga0495675_0033710 | 3300047444 | Bacteria | 3268 |
| 662 | Ga0495684_0003809 | 3300047471 | Bacteria | 11754 |
| 663 | Ga0495684_0018295 | 3300047471 | Bacteria | 5400 |
| 664 | Ga0495684_0050461 | 3300047471 | Bacteria | 3177 |
| 665 | Ga0495684_0056981 | 3300047471 | Bacteria | 2978 |
| 666 | Ga0495684_0058330 | 3300047471 | Bacteria | 2941 |
| 667 | Ga0495684_0059009 | 3300047471 | Bacteria | 2922 |
| 668 | Ga0495593_0011846 | 3300047673 | Bacteria | 5000 |
| 669 | Ga0495593_0057053 | 3300047673 | Bacteria | 2051 |
| 670 | Ga0495602_0000461 | 3300048088 | Bacteria | 37751 |
| 671 | Ga0495602_0017632 | 3300048088 | Bacteria | 7154 |
| 672 | Ga0496101_0002239 | 3300048904 | Bacteria | 11828 |
| 673 | Ga0496101_0002703 | 3300048904 | Bacteria | 10880 |
| 674 | Ga0496102_0006157 | 3300048905 | Bacteria | 10227 |
| 675 | Ga0496102_0006613 | 3300048905 | Bacteria | 9906 |
| 676 | Ga0496102_0013799 | 3300048905 | Bacteria | 7009 |
| 677 | Ga0496102_0020367 | 3300048905 | Bacteria | 5862 |
| 678 | Ga0496102_0079312 | 3300048905 | Bacteria | 3024 |
| 679 | Ga0496102_0082024 | 3300048905 | Bacteria | 2974 |
| 680 | Ga0496102_0107632 | 3300048905 | Bacteria | 2596 |
| 681 | Ga0496103_0002293 | 3300048906 | Bacteria | 12088 |
| 682 | Ga0496103_0053099 | 3300048906 | Bacteria | 2511 |
| 683 | Ga0496103_0088633 | 3300048906 | Bacteria | 1951 |
| 684 | Ga0496104_0012420 | 3300048907 | Bacteria | 7657 |
| 685 | Ga0496104_0017300 | 3300048907 | Bacteria | 6562 |
| 686 | Ga0496104_0019218 | 3300048907 | Bacteria | 6247 |
| 687 | Ga0496104_0071383 | 3300048907 | Bacteria | 3301 |
| 688 | Ga0496104_0071625 | 3300048907 | Bacteria | 3295 |
| 689 | Ga0496104_0110864 | 3300048907 | Bacteria | 2631 |
| 690 | Ga0496104_0205506 | 3300048907 | Unclassified | 1881 |
| 691 | Ga0496105_0000756 | 3300048908 | Bacteria | 21951 |
| 692 | Ga0496105_0002305 | 3300048908 | Bacteria | 13849 |
| 693 | Ga0496105_0016330 | 3300048908 | Bacteria | 5925 |
| 694 | Ga0496105_0060205 | 3300048908 | Bacteria | 3133 |
| 695 | Ga0496105_0072332 | 3300048908 | Bacteria | 2850 |
| 696 | Ga0496105_0085683 | 3300048908 | Bacteria | 2603 |
| 697 | Ga0496105_0103220 | 3300048908 | Bacteria | 2354 |
| 698 | Ga0496106_0003648 | 3300048909 | Bacteria | 11477 |
| 699 | Ga0496106_0019313 | 3300048909 | Bacteria | 5053 |
| 700 | Ga0496107_0005385 | 3300048910 | Bacteria | 8755 |
| 701 | Ga0496107_0009138 | 3300048910 | Bacteria | 6870 |
| 702 | Ga0496107_0051083 | 3300048910 | Bacteria | 2981 |
| 703 | Ga0496108_0000337 | 3300048911 | Bacteria | 39725 |
| 704 | Ga0496108_0012789 | 3300048911 | Bacteria | 6834 |
| 705 | Ga0496108_0015456 | 3300048911 | Bacteria | 6226 |
| 706 | Ga0496108_0030880 | 3300048911 | Bacteria | 4440 |
| 707 | Ga0496108_0034247 | 3300048911 | Bacteria | 4219 |
| 708 | Ga0496108_0038524 | 3300048911 | Bacteria | 3982 |
| 709 | Ga0496108_0050752 | 3300048911 | Bacteria | 3474 |
| 710 | Ga0496108_0065856 | 3300048911 | Bacteria | 3054 |
| 711 | Ga0496108_0082633 | 3300048911 | Bacteria | 2724 |
| 712 | Ga0496108_0082690 | 3300048911 | Bacteria | 2723 |
| 713 | Ga0496108_0088572 | 3300048911 | Bacteria | 2630 |
| 714 | Ga0496108_0089272 | 3300048911 | Bacteria | 2619 |
| 715 | Ga0496109_0004142 | 3300048912 | Bacteria | 12111 |
| 716 | Ga0496109_0005796 | 3300048912 | Bacteria | 10341 |
| 717 | Ga0496109_0027124 | 3300048912 | Bacteria | 5112 |
| 718 | Ga0496109_0035131 | 3300048912 | Bacteria | 4519 |
| 719 | Ga0496109_0054063 | 3300048912 | Bacteria | 3664 |
| 720 | Ga0496109_0058506 | 3300048912 | Bacteria | 3520 |
| 721 | Ga0496109_0081171 | 3300048912 | Bacteria | 2988 |
| 722 | Ga0496109_0095421 | 3300048912 | Bacteria | 2754 |
| 723 | Ga0496109_0102338 | 3300048912 | Bacteria | 2658 |
| 724 | Ga0496109_0108886 | 3300048912 | Bacteria | 2575 |
| 725 | Ga0496110_0000249 | 3300048913 | Bacteria | 34963 |
| 726 | Ga0496110_0021412 | 3300048913 | Bacteria | 5474 |
| 727 | Ga0496110_0036269 | 3300048913 | Bacteria | 4281 |
| 728 | Ga0496110_0038608 | 3300048913 | Bacteria | 4156 |
| 729 | Ga0496110_0048234 | 3300048913 | Bacteria | 3733 |
| 730 | Ga0496110_0070893 | 3300048913 | Bacteria | 3089 |
| 731 | Ga0496110_0075476 | 3300048913 | Bacteria | 2995 |
| 732 | Ga0496110_0099095 | 3300048913 | Bacteria | 2613 |
| 733 | Ga0496110_0107222 | 3300048913 | Bacteria | 2507 |
| 734 | Ga0496111_0003049 | 3300048914 | Bacteria | 10281 |
| 735 | Ga0496111_0022383 | 3300048914 | Bacteria | 4424 |
| 736 | Ga0496111_0071066 | 3300048914 | Bacteria | 2533 |
| 737 | Ga0496111_0094521 | 3300048914 | Bacteria | 2192 |
| 738 | Ga0496112_0000620 | 3300048915 | Bacteria | 24573 |
| 739 | Ga0496112_0002834 | 3300048915 | Bacteria | 14076 |
| 740 | Ga0496112_0008758 | 3300048915 | Bacteria | 9077 |
| 741 | Ga0496112_0010866 | 3300048915 | Bacteria | 8285 |
| 742 | Ga0496112_0016419 | 3300048915 | Bacteria | 6935 |
| 743 | Ga0496112_0115326 | 3300048915 | Bacteria | 2657 |
| 744 | Ga0496113_0050528 | 3300048916 | Bacteria | 3100 |
| 745 | Ga0496113_0080845 | 3300048916 | Bacteria | 2490 |
| 746 | Ga0496114_0020614 | 3300048917 | Bacteria | 5351 |
| 747 | Ga0496114_0024825 | 3300048917 | Bacteria | 4893 |
| 748 | Ga0496114_0030283 | 3300048917 | Bacteria | 4453 |
| 749 | Ga0496114_0056320 | 3300048917 | Bacteria | 3281 |
| 750 | Ga0496114_0100339 | 3300048917 | Bacteria | 2470 |
| 751 | Ga0496114_0204919 | 3300048917 | Bacteria | 1729 |
| 752 | Ga0496115_0004134 | 3300048918 | Bacteria | 10475 |
| 753 | Ga0496115_0008063 | 3300048918 | Bacteria | 7778 |
| 754 | Ga0496115_0029753 | 3300048918 | Bacteria | 4292 |
| 755 | Ga0496115_0072365 | 3300048918 | Bacteria | 2797 |
| 756 | Ga0496121_0002166 | 3300048924 | Bacteria | 30741 |
| 757 | Ga0496126_0019805 | 3300048929 | Bacteria | 6618 |
| 758 | Ga0496126_0174840 | 3300048929 | Bacteria | 1827 |
| 759 | Ga0501031_0006295 | 3300049568 | Bacteria | 7737 |
| 760 | Ga0501031_0027487 | 3300049568 | Bacteria | 3709 |
| 761 | Ga0501031_0032255 | 3300049568 | Bacteria | 3415 |
| 762 | Ga0501032_0002022 | 3300049569 | Bacteria | 15992 |
| 763 | Ga0501033_0011445 | 3300049570 | Bacteria | 6789 |
| 764 | Ga0501033_0013928 | 3300049570 | Bacteria | 6120 |
| 765 | Ga0501034_0004204 | 3300049571 | Bacteria | 16074 |
| 766 | Ga0501034_0062091 | 3300049571 | Bacteria | 3752 |
| 767 | Ga0501036_0000582 | 3300049572 | Bacteria | 26379 |
| 768 | Ga0501036_0106033 | 3300049572 | Bacteria | 2377 |
| 769 | Ga0501037_0021309 | 3300049573 | Bacteria | 4788 |
| 770 | Ga0501037_0072555 | 3300049573 | Bacteria | 2503 |
| 771 | Ga0501038_0000732 | 3300049574 | Bacteria | 29297 |
| 772 | Ga0501038_0038074 | 3300049574 | Bacteria | 4212 |
| 773 | Ga0501039_0000391 | 3300049575 | Bacteria | 31522 |
| 774 | Ga0501039_0049987 | 3300049575 | Bacteria | 3233 |
| 775 | Ga0501040_0000516 | 3300049576 | Bacteria | 23123 |
| 776 | Ga0501040_0005371 | 3300049576 | Bacteria | 8286 |
| 777 | Ga0501040_0009161 | 3300049576 | Bacteria | 6446 |
| 778 | Ga0501040_0021756 | 3300049576 | Bacteria | 4287 |
| 779 | Ga0501041_0004140 | 3300049577 | Bacteria | 8392 |
| 780 | Ga0501041_0039901 | 3300049577 | Bacteria | 2848 |
| 781 | Ga0501041_0056794 | 3300049577 | Bacteria | 2392 |
| 782 | Ga0501042_0002049 | 3300049578 | Bacteria | 12219 |
| 783 | Ga0501042_0003403 | 3300049578 | Bacteria | 9986 |
| 784 | Ga0501043_0001992 | 3300049579 | Bacteria | 17433 |
| 785 | Ga0501046_0001108 | 3300049580 | Bacteria | 26300 |
| 786 | Ga0501046_0024415 | 3300049580 | Bacteria | 4959 |
| 787 | Ga0501048_0000495 | 3300049582 | Bacteria | 27512 |
| 788 | Ga0501048_0045452 | 3300049582 | Bacteria | 3136 |
| 789 | Ga0501048_0045918 | 3300049582 | Bacteria | 3118 |
| 790 | Ga0501067_0026266 | 3300049583 | Bacteria | 3226 |
| 791 | Ga0501068_0001135 | 3300049584 | Bacteria | 14099 |
| 792 | Ga0501069_0048019 | 3300049585 | Bacteria | 2370 |
| 793 | Ga0501069_0048322 | 3300049585 | Bacteria | 2362 |
| 794 | Ga0501070_0002476 | 3300049586 | Bacteria | 16188 |
| 795 | Ga0501071_0000731 | 3300049587 | Bacteria | 17342 |
| 796 | Ga0501071_0024018 | 3300049587 | Bacteria | 4261 |
| 797 | Ga0501072_0001629 | 3300049588 | Bacteria | 16799 |
| 798 | Ga0501072_0011031 | 3300049588 | Bacteria | 6896 |
| 799 | Ga0501072_0030265 | 3300049588 | Bacteria | 4233 |
| 800 | Ga0501072_0055103 | 3300049588 | Bacteria | 3134 |
| 801 | Ga0501072_0067248 | 3300049588 | Bacteria | 2827 |
| 802 | Ga0501073_0043786 | 3300049589 | Bacteria | 3156 |
| 803 | Ga0501073_0058246 | 3300049589 | Bacteria | 2700 |
| 804 | Ga0501074_0000958 | 3300049590 | Bacteria | 18660 |
| 805 | Ga0501074_0014082 | 3300049590 | Bacteria | 5814 |
| 806 | Ga0501074_0042949 | 3300049590 | Bacteria | 3271 |
| 807 | Ga0501075_0000672 | 3300049591 | Bacteria | 21090 |
| 808 | Ga0501076_0018257 | 3300049592 | Bacteria | 5344 |
| 809 | Ga0501076_0038716 | 3300049592 | Bacteria | 3743 |
| 810 | Ga0501077_0002810 | 3300049593 | Bacteria | 10443 |
| 811 | Ga0501077_0051458 | 3300049593 | Bacteria | 2617 |
| 812 | Ga0501079_0000214 | 3300049741 | Bacteria | 34037 |
| 813 | Ga0501079_0021008 | 3300049741 | Bacteria | 4990 |
| 814 | Ga0501079_0043254 | 3300049741 | Bacteria | 3476 |
| 815 | Ga0501080_0005478 | 3300049742 | Bacteria | 11329 |
| 816 | Ga0501080_0124125 | 3300049742 | Bacteria | 2391 |
| 817 | Ga0501081_0000596 | 3300049743 | Bacteria | 20599 |
| 818 | Ga0501081_0010424 | 3300049743 | Bacteria | 6060 |
| 819 | Ga0501035_0015257 | 3300049822 | Bacteria | 7090 |
| 820 | Ga0501044_0007168 | 3300049823 | Bacteria | 12263 |
| 821 | Ga0501045_0000417 | 3300049824 | Bacteria | 25889 |
| 822 | Ga0501045_0007946 | 3300049824 | Bacteria | 7387 |
| 823 | nmdc:mga05p37_156892_c1 | 3300050507 | Bacteria | 2781 |
| 824 | nmdc:mga05p37_205530_c1 | 3300050507 | Bacteria | 2382 |
| 825 | nmdc:mga05p37_388566_c1 | 3300050507 | Bacteria | 1633 |
| 826 | nmdc:mga05p37_7880_c1 | 3300050507 | Bacteria | 12571 |
| 827 | nmdc:mga05p37_89312_c1 | 3300050507 | Bacteria | 3797 |
| 828 | nmdc:mga0qj67_228307_c1 | 3300050509 | Bacteria | 1511 |
| 829 | nmdc:mga08y16_183109_c1 | 3300050511 | Bacteria | 2174 |
| 830 | nmdc:mga08y16_33820_c1 | 3300050511 | Bacteria | 5369 |
| 831 | nmdc:mga08y16_33936_c1 | 3300050511 | Bacteria | 5361 |
| 832 | nmdc:mga08y16_56814_c1 | 3300050511 | Bacteria | 4090 |
| 833 | nmdc:mga0n895_10525_c1 | 3300050512 | Bacteria | 8180 |
| 834 | nmdc:mga0n895_198239_c1 | 3300050512 | Bacteria | 2039 |
| 835 | nmdc:mga0n895_2126_c1 | 3300050512 | Bacteria | 15301 |
| 836 | nmdc:mga0n895_43378_c1 | 3300050512 | Bacteria | 4383 |
| 837 | nmdc:mga0n895_47645_c1 | 3300050512 | Bacteria | 4191 |
| 838 | nmdc:mga0n895_825_c1 | 3300050512 | Bacteria | 22195 |
| 839 | nmdc:mga0rr50_41015_c1 | 3300050513 | Bacteria | 3369 |
| 840 | nmdc:mga0rr50_7773_c1 | 3300050513 | Bacteria | 6644 |
| 841 | nmdc:mga0rr50_95517_c1 | 3300050513 | Bacteria | 2324 |
| 842 | nmdc:mga08x19_7539_c1 | 3300050514 | Bacteria | 6466 |
| 843 | nmdc:mga08x19_9178_c1 | 3300050514 | Bacteria | 5903 |
| 844 | nmdc:mga0a205_13608_c1 | 3300050515 | Bacteria | 7579 |
| 845 | nmdc:mga0a205_192441_c1 | 3300050515 | Bacteria | 1931 |
| 846 | nmdc:mga0a205_24936_c1 | 3300050515 | Bacteria | 5692 |
| 847 | nmdc:mga0a205_37118_c1 | 3300050515 | Bacteria | 4685 |
| 848 | nmdc:mga0a205_44872_c1 | 3300050515 | Bacteria | 4263 |
| 849 | nmdc:mga0a205_6248_c1 | 3300050515 | Bacteria | 10753 |
| 850 | Ga0495601_0002354 | 3300053077 | Bacteria | 10702 |
| 851 | Ga0495601_0044793 | 3300053077 | Bacteria | 2781 |
| 852 | Ga0495612_0017888 | 3300053078 | Bacteria | 2837 |
| 853 | Ga0495612_0024350 | 3300053078 | Bacteria | 2429 |
| 854 | Ga0495595_0002737 | 3300053084 | Bacteria | 6916 |
| 855 | Ga0495619_0021469 | 3300053085 | Bacteria | 4122 |
| 856 | Ga0495619_0026491 | 3300053085 | Bacteria | 3730 |
| 857 | Ga0495619_0027064 | 3300053085 | Bacteria | 3693 |
| 858 | Ga0495619_0035391 | 3300053085 | Bacteria | 3247 |
| 859 | Ga0500616_0001517 | 3300053153 | Bacteria | 21901 |
| 860 | Ga0500616_0004633 | 3300053153 | Bacteria | 9704 |
| 861 | Ga0501082_0004602 | 3300060353 | Bacteria | 12045 |
| 862 | Ga0501082_0009312 | 3300060353 | Bacteria | 8465 |
| 863 | Ga0501082_0079914 | 3300060353 | Bacteria | 2822 |
| 864 | Ga0530510_0020513 | 3300061734 | Bacteria | 4698 |
| 865 | Ga0530510_0030155 | 3300061734 | Bacteria | 3895 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10250643 | Ga0157369_102506432 | 406 |
| 2 | 3300035724 | Ga0373933_0049229 | Ga0373933_0049229_978_2498 | 415 |
| 3 | 3300050515 | nmdc:mga0a205_192441_c1 | nmdc:mga0a205_192441_c1_366_1886 | 427 |
| 4 | 3300046678 | Ga0495599_0104857 | Ga0495599_0104857_53_1576 | 430 |
| 5 | 3300047322 | Ga0495680_0126468 | Ga0495680_0126468_369_1859 | 433 |
| 6 | 3300025940 | Ga0207691_10107485 | Ga0207691_101074852 | 436 |
| 7 | 3300042137 | Ga0450902_007704 | Ga0450902_007704_39_1643 | 439 |
| 8 | 3300005338 | Ga0068868_100105593 | Ga0068868_1001055932 | 445 |
| 9 | 3300037068 | Ga0373925_0109962 | Ga0373925_0109962_76_1767 | 448 |
| 10 | 3300050507 | nmdc:mga05p37_388566_c1 | nmdc:mga05p37_388566_c1_135_1604 | 449 |
| 11 | 3300050509 | nmdc:mga0qj67_228307_c1 | nmdc:mga0qj67_228307_c1_29_1498 | 449 |
| 12 | 3300048912 | Ga0496109_0095421 | Ga0496109_0095421_64_1770 | 450 |
| 13 | 3300048915 | Ga0496112_0002834 | Ga0496112_0002834_12575_14062 | 452 |
| 14 | 3300046663 | Ga0495635_0017230 | Ga0495635_0017230_691_2208 | 455 |
| 15 | 3300046511 | Ga0495608_0044263 | Ga0495608_0044263_19_1479 | 458 |
| 16 | 3300005337 | Ga0070682_100021497 | Ga0070682_1000214971 | 459 |
| 17 | 3300005356 | Ga0070674_100005664 | Ga0070674_1000056649 | 459 |
| 18 | 3300005441 | Ga0070700_100004148 | Ga0070700_1000041481 | 459 |
| 19 | 3300005615 | Ga0070702_100092737 | Ga0070702_1000927371 | 459 |
| 20 | 3300011119 | Ga0105246_10050500 | Ga0105246_100505002 | 459 |
| 21 | 3300014745 | Ga0157377_10010375 | Ga0157377_100103752 | 459 |
| 22 | 3300025937 | Ga0207669_10105408 | Ga0207669_101054082 | 459 |
| 23 | 3300025944 | Ga0207661_10044306 | Ga0207661_100443062 | 459 |
| 24 | 3300026023 | Ga0207677_10081446 | Ga0207677_100814461 | 459 |
| 25 | 3300046514 | Ga0495618_0073762 | Ga0495618_0073762_20_1711 | 459 |
| 26 | 3300002075 | JGI24738J21930_10007244 | JGI24738J21930_100072441 | 461 |
| 27 | 3300009553 | Ga0105249_10008050 | Ga0105249_100080506 | 461 |
| 28 | 3300025908 | Ga0207643_10007267 | Ga0207643_100072674 | 461 |
| 29 | 3300026075 | Ga0207708_10002530 | Ga0207708_1000253010 | 461 |
| 30 | 3300026089 | Ga0207648_10004509 | Ga0207648_1000450911 | 461 |
| 31 | 3300047315 | Ga0495581_0037896 | Ga0495581_0037896_1297_2778 | 463 |
| 32 | 3300006852 | Ga0075433_10038978 | Ga0075433_100389781 | 466 |
| 33 | 3300006914 | Ga0075436_100049588 | Ga0075436_1000495882 | 466 |
| 34 | 3300050515 | nmdc:mga0a205_13608_c1 | nmdc:mga0a205_13608_c1_2432_4171 | 466 |
| 35 | 3300049568 | Ga0501031_0027487 | Ga0501031_0027487_11_1522 | 467 |
| 36 | 3300053153 | Ga0500616_0001517 | Ga0500616_0001517_12200_13888 | 468 |
| 37 | 3300025933 | Ga0207706_10106804 | Ga0207706_101068042 | 469 |
| 38 | 3300037466 | Ga0395898_0179084 | Ga0395898_0179084_411_2015 | 471 |
| 39 | 3300042461 | Ga0439460_0018107 | Ga0439460_0018107_202_1839 | 472 |
| 40 | 3300046663 | Ga0495635_0018757 | Ga0495635_0018757_876_2498 | 472 |
| 41 | 3300005329 | Ga0070683_100012321 | Ga0070683_1000123212 | 475 |
| 42 | 3300005438 | Ga0070701_10013604 | Ga0070701_100136043 | 475 |
| 43 | 3300014326 | Ga0157380_10009185 | Ga0157380_100091858 | 475 |
| 44 | 3300025918 | Ga0207662_10016436 | Ga0207662_100164362 | 475 |
| 45 | 3300048911 | Ga0496108_0065856 | Ga0496108_0065856_998_2674 | 475 |
| 46 | 3300005343 | Ga0070687_100021220 | Ga0070687_1000212202 | 477 |
| 47 | 3300005459 | Ga0068867_100019015 | Ga0068867_1000190153 | 477 |
| 48 | 3300005535 | Ga0070684_100055477 | Ga0070684_1000554772 | 477 |
| 49 | 3300005543 | Ga0070672_100072106 | Ga0070672_1000721061 | 477 |
| 50 | 3300005718 | Ga0068866_10025248 | Ga0068866_100252483 | 477 |
| 51 | 3300009098 | Ga0105245_10125346 | Ga0105245_101253462 | 477 |
| 52 | 3300009148 | Ga0105243_10002387 | Ga0105243_100023872 | 477 |
| 53 | 3300025899 | Ga0207642_10012998 | Ga0207642_100129982 | 477 |
| 54 | 3300025940 | Ga0207691_10022500 | Ga0207691_100225003 | 477 |
| 55 | 3300026118 | Ga0207675_100003463 | Ga0207675_1000034636 | 477 |
| 56 | 3300035113 | Ga0373936_0003892 | Ga0373936_0003892_487_2250 | 477 |
| 57 | 3300037068 | Ga0373925_0000028 | Ga0373925_0000028_143019_144845 | 481 |
| 58 | 3300005455 | Ga0070663_100029447 | Ga0070663_1000294472 | 482 |
| 59 | 3300005458 | Ga0070681_10036883 | Ga0070681_100368835 | 482 |
| 60 | 3300005564 | Ga0070664_100054431 | Ga0070664_1000544312 | 482 |
| 61 | 3300009011 | Ga0105251_10016259 | Ga0105251_100162593 | 482 |
| 62 | 3300013100 | Ga0157373_10047373 | Ga0157373_100473731 | 482 |
| 63 | 3300022467 | Ga0224712_10025006 | Ga0224712_100250062 | 482 |
| 64 | 3300025906 | Ga0207699_10004489 | Ga0207699_100044896 | 482 |
| 65 | 3300025919 | Ga0207657_10010945 | Ga0207657_100109457 | 482 |
| 66 | 3300025928 | Ga0207700_10025233 | Ga0207700_100252331 | 482 |
| 67 | 3300025929 | Ga0207664_10039346 | Ga0207664_100393462 | 482 |
| 68 | 3300026116 | Ga0207674_10017738 | Ga0207674_100177382 | 482 |
| 69 | 3300026121 | Ga0207683_10009054 | Ga0207683_100090543 | 482 |
| 70 | 3300028380 | Ga0268265_10122970 | Ga0268265_101229702 | 482 |
| 71 | 3300036401 | Ga0373937_0003783 | Ga0373937_0003783_5512_7113 | 482 |
| 72 | 3300046462 | Ga0495651_0019855 | Ga0495651_0019855_2893_4494 | 482 |
| 73 | 3300046463 | Ga0495653_0099119 | Ga0495653_0099119_185_1786 | 482 |
| 74 | 3300046529 | Ga0495652_0051756 | Ga0495652_0051756_1473_3074 | 482 |
| 75 | 3300046559 | Ga0495667_0005115 | Ga0495667_0005115_6949_8550 | 482 |
| 76 | 3300046675 | Ga0495657_0005793 | Ga0495657_0005793_2543_4144 | 482 |
| 77 | 3300046679 | Ga0495623_0015929 | Ga0495623_0015929_377_1978 | 482 |
| 78 | 3300046809 | Ga0495600_0037480 | Ga0495600_0037480_891_2492 | 482 |
| 79 | 3300047444 | Ga0495675_0033710 | Ga0495675_0033710_1135_2736 | 482 |
| 80 | 3300048907 | Ga0496104_0017300 | Ga0496104_0017300_4421_6181 | 482 |
| 81 | 3300048908 | Ga0496105_0103220 | Ga0496105_0103220_247_2007 | 482 |
| 82 | 3300048913 | Ga0496110_0107222 | Ga0496110_0107222_195_1955 | 482 |
| 83 | 3300048917 | Ga0496114_0100339 | Ga0496114_0100339_445_2205 | 482 |
| 84 | 3300048914 | Ga0496111_0094521 | Ga0496111_0094521_107_1768 | 483 |
| 85 | 3300006852 | Ga0075433_10105672 | Ga0075433_101056722 | 484 |
| 86 | 3300006871 | Ga0075434_100084553 | Ga0075434_1000845532 | 484 |
| 87 | 3300009094 | Ga0111539_10178312 | Ga0111539_101783121 | 484 |
| 88 | 3300050507 | nmdc:mga05p37_205530_c1 | nmdc:mga05p37_205530_c1_346_2037 | 484 |
| 89 | 3300050511 | nmdc:mga08y16_56814_c1 | nmdc:mga08y16_56814_c1_437_2128 | 484 |
| 90 | 3300050513 | nmdc:mga0rr50_41015_c1 | nmdc:mga0rr50_41015_c1_121_1812 | 484 |
| 91 | 3300050515 | nmdc:mga0a205_24936_c1 | nmdc:mga0a205_24936_c1_1732_3423 | 484 |
| 92 | 3300006847 | Ga0075431_100025422 | Ga0075431_1000254221 | 485 |
| 93 | 3300005543 | Ga0070672_100120348 | Ga0070672_1001203482 | 487 |
| 94 | 3300025901 | Ga0207688_10044282 | Ga0207688_100442821 | 487 |
| 95 | 3300025942 | Ga0207689_10029825 | Ga0207689_100298254 | 487 |
| 96 | 3300048906 | Ga0496103_0053099 | Ga0496103_0053099_90_1850 | 487 |
| 97 | 3300005344 | Ga0070661_100101541 | Ga0070661_1001015412 | 489 |
| 98 | 3300005355 | Ga0070671_100012639 | Ga0070671_1000126394 | 489 |
| 99 | 3300005614 | Ga0068856_100013804 | Ga0068856_1000138044 | 489 |
| 100 | 3300025928 | Ga0207700_10072356 | Ga0207700_100723562 | 489 |
| 101 | 3300025931 | Ga0207644_10012375 | Ga0207644_100123754 | 489 |
| 102 | 3300048913 | Ga0496110_0036269 | Ga0496110_0036269_50_1789 | 489 |
| 103 | 3300046536 | Ga0495587_0068029 | Ga0495587_0068029_466_2043 | 490 |
| 104 | 3300048912 | Ga0496109_0035131 | Ga0496109_0035131_2494_4233 | 490 |
| 105 | 3300060353 | Ga0501082_0079914 | Ga0501082_0079914_971_2674 | 490 |
| 106 | 3300026095 | Ga0207676_10016826 | Ga0207676_100168264 | 491 |
| 107 | 3300050512 | nmdc:mga0n895_47645_c1 | nmdc:mga0n895_47645_c1_1625_3385 | 491 |
| 108 | 3300005435 | Ga0070714_100068894 | Ga0070714_1000688942 | 493 |
| 109 | 3300006028 | Ga0070717_10084741 | Ga0070717_100847412 | 493 |
| 110 | 3300025928 | Ga0207700_10066774 | Ga0207700_100667741 | 493 |
| 111 | 3300032002 | Ga0307416_100090392 | Ga0307416_1000903922 | 493 |
| 112 | 3300035086 | Ga0373934_0001615 | Ga0373934_0001615_4599_6359 | 493 |
| 113 | 3300035119 | Ga0373956_0001004 | Ga0373956_0001004_1439_3199 | 493 |
| 114 | 3300035120 | Ga0373957_0008506 | Ga0373957_0008506_827_2587 | 493 |
| 115 | 3300035172 | Ga0373955_0000005 | Ga0373955_0000005_73346_75106 | 493 |
| 116 | 3300035724 | Ga0373933_0000043 | Ga0373933_0000043_5250_7010 | 493 |
| 117 | 3300036401 | Ga0373937_0000245 | Ga0373937_0000245_4641_6401 | 493 |
| 118 | 3300036401 | Ga0373937_0063250 | Ga0373937_0063250_299_2167 | 493 |
| 119 | 3300037068 | Ga0373925_0001494 | Ga0373925_0001494_17815_19521 | 493 |
| 120 | 3300046454 | Ga0495592_0000092 | Ga0495592_0000092_72747_74507 | 493 |
| 121 | 3300046454 | Ga0495592_0097787 | Ga0495592_0097787_241_1932 | 493 |
| 122 | 3300046462 | Ga0495651_0000066 | Ga0495651_0000066_71138_72898 | 493 |
| 123 | 3300046463 | Ga0495653_0002166 | Ga0495653_0002166_9143_10903 | 493 |
| 124 | 3300046511 | Ga0495608_0000070 | Ga0495608_0000070_4641_6401 | 493 |
| 125 | 3300046511 | Ga0495608_0065762 | Ga0495608_0065762_188_1879 | 493 |
| 126 | 3300046514 | Ga0495618_0091766 | Ga0495618_0091766_142_1833 | 493 |
| 127 | 3300046516 | Ga0495628_0000624 | Ga0495628_0000624_25962_27722 | 493 |
| 128 | 3300046516 | Ga0495628_0112248 | Ga0495628_0112248_15_1706 | 493 |
| 129 | 3300046529 | Ga0495652_0000769 | Ga0495652_0000769_4641_6401 | 493 |
| 130 | 3300046529 | Ga0495652_0090925 | Ga0495652_0090925_234_2102 | 493 |
| 131 | 3300046533 | Ga0495640_0013066 | Ga0495640_0013066_670_2361 | 493 |
| 132 | 3300046536 | Ga0495587_0000077 | Ga0495587_0000077_71138_72898 | 493 |
| 133 | 3300046559 | Ga0495667_0000071 | Ga0495667_0000071_71138_72898 | 493 |
| 134 | 3300046642 | Ga0495634_0074759 | Ga0495634_0074759_48_1916 | 493 |
| 135 | 3300046675 | Ga0495657_0000095 | Ga0495657_0000095_71138_72898 | 493 |
| 136 | 3300046678 | Ga0495599_0000155 | Ga0495599_0000155_10094_11854 | 493 |
| 137 | 3300046679 | Ga0495623_0001673 | Ga0495623_0001673_4641_6401 | 493 |
| 138 | 3300046809 | Ga0495600_0001750 | Ga0495600_0001750_1874_3634 | 493 |
| 139 | 3300047317 | Ga0495604_0000087 | Ga0495604_0000087_72747_74507 | 493 |
| 140 | 3300047319 | Ga0495674_0060103 | Ga0495674_0060103_1000_2868 | 493 |
| 141 | 3300047322 | Ga0495680_0003033 | Ga0495680_0003033_9616_11376 | 493 |
| 142 | 3300047322 | Ga0495680_0039139 | Ga0495680_0039139_693_2384 | 493 |
| 143 | 3300047444 | Ga0495675_0000157 | Ga0495675_0000157_41759_43519 | 493 |
| 144 | 3300048088 | Ga0495602_0000461 | Ga0495602_0000461_4641_6401 | 493 |
| 145 | 3300053084 | Ga0495595_0002737 | Ga0495595_0002737_4613_6373 | 493 |
| 146 | 3300053085 | Ga0495619_0027064 | Ga0495619_0027064_927_2618 | 493 |
| 147 | 3300005329 | Ga0070683_100177975 | Ga0070683_1001779752 | 494 |
| 148 | 3300025944 | Ga0207661_10133799 | Ga0207661_101337992 | 494 |
| 149 | 3300042157 | Ga0439458_0008711 | Ga0439458_0008711_234_1985 | 495 |
| 150 | 3300046459 | Ga0495629_0014399 | Ga0495629_0014399_2209_3972 | 496 |
| 151 | 3300046461 | Ga0495641_0001952 | Ga0495641_0001952_1466_3229 | 496 |
| 152 | 3300046690 | Ga0495624_0002604 | Ga0495624_0002604_5828_7591 | 496 |
| 153 | 3300047673 | Ga0495593_0011846 | Ga0495593_0011846_3012_4775 | 496 |
| 154 | 3300053078 | Ga0495612_0024350 | Ga0495612_0024350_29_1792 | 496 |
| 155 | 3300005338 | Ga0068868_100117303 | Ga0068868_1001173032 | 497 |
| 156 | 3300005340 | Ga0070689_100102416 | Ga0070689_1001024162 | 497 |
| 157 | 3300005563 | Ga0068855_100181217 | Ga0068855_1001812171 | 497 |
| 158 | 3300005841 | Ga0068863_100081257 | Ga0068863_1000812574 | 497 |
| 159 | 3300025929 | Ga0207664_10017382 | Ga0207664_100173822 | 497 |
| 160 | 3300005468 | Ga0070707_100080485 | Ga0070707_1000804852 | 498 |
| 161 | 3300025928 | Ga0207700_10058256 | Ga0207700_100582562 | 499 |
| 162 | 3300025945 | Ga0207679_10106384 | Ga0207679_101063841 | 499 |
| 163 | 3300005435 | Ga0070714_100002168 | Ga0070714_1000021688 | 500 |
| 164 | 3300006028 | Ga0070717_10041275 | Ga0070717_100412752 | 500 |
| 165 | 3300006175 | Ga0070712_100042643 | Ga0070712_1000426433 | 500 |
| 166 | 3300025898 | Ga0207692_10042480 | Ga0207692_100424802 | 500 |
| 167 | 3300025928 | Ga0207700_10048897 | Ga0207700_100488972 | 500 |
| 168 | 3300025929 | Ga0207664_10004524 | Ga0207664_100045247 | 500 |
| 169 | 3300009093 | Ga0105240_10114985 | Ga0105240_101149852 | 501 |
| 170 | 3300009553 | Ga0105249_10055325 | Ga0105249_100553251 | 501 |
| 171 | 3300037471 | Ga0395905_0059024 | Ga0395905_0059024_805_2442 | 501 |
| 172 | 3300046463 | Ga0495653_0004422 | Ga0495653_0004422_5090_6781 | 501 |
| 173 | 3300046516 | Ga0495628_0003918 | Ga0495628_0003918_1741_3432 | 501 |
| 174 | 3300046559 | Ga0495667_0036047 | Ga0495667_0036047_1050_2741 | 501 |
| 175 | 3300047471 | Ga0495684_0003809 | Ga0495684_0003809_560_2251 | 501 |
| 176 | 3300005435 | Ga0070714_100000974 | Ga0070714_1000009743 | 502 |
| 177 | 3300005435 | Ga0070714_100101202 | Ga0070714_1001012022 | 502 |
| 178 | 3300005436 | Ga0070713_100041203 | Ga0070713_1000412032 | 502 |
| 179 | 3300006028 | Ga0070717_10013777 | Ga0070717_100137772 | 502 |
| 180 | 3300006173 | Ga0070716_100004409 | Ga0070716_1000044093 | 502 |
| 181 | 3300025929 | Ga0207664_10010352 | Ga0207664_100103525 | 502 |
| 182 | 3300025939 | Ga0207665_10008637 | Ga0207665_100086373 | 502 |
| 183 | 3300048929 | Ga0496126_0019805 | Ga0496126_0019805_3008_4777 | 502 |
| 184 | 3300049589 | Ga0501073_0043786 | Ga0501073_0043786_33_1691 | 503 |
| 185 | 3300025929 | Ga0207664_10025480 | Ga0207664_100254803 | 504 |
| 186 | 3300026075 | Ga0207708_10071096 | Ga0207708_100710963 | 504 |
| 187 | 3300042005 | Ga0439448_0007867 | Ga0439448_0007867_596_2329 | 504 |
| 188 | 3300042016 | Ga0439463_002716 | Ga0439463_002716_1898_3631 | 504 |
| 189 | 3300006175 | Ga0070712_100012909 | Ga0070712_1000129094 | 505 |
| 190 | 3300006844 | Ga0075428_100167834 | Ga0075428_1001678342 | 505 |
| 191 | 3300026035 | Ga0207703_10123776 | Ga0207703_101237762 | 505 |
| 192 | 3300035724 | Ga0373933_0022557 | Ga0373933_0022557_318_2090 | 505 |
| 193 | 3300041512 | Ga0451853_0174584 | Ga0451853_0174584_526_2310 | 505 |
| 194 | 3300048915 | Ga0496112_0115326 | Ga0496112_0115326_46_1860 | 505 |
| 195 | 3300005535 | Ga0070684_100049238 | Ga0070684_1000492382 | 506 |
| 196 | 3300026116 | Ga0207674_10084964 | Ga0207674_100849641 | 506 |
| 197 | 3300005336 | Ga0070680_100061964 | Ga0070680_1000619642 | 507 |
| 198 | 3300005337 | Ga0070682_100006989 | Ga0070682_1000069894 | 507 |
| 199 | 3300005345 | Ga0070692_10005242 | Ga0070692_100052422 | 507 |
| 200 | 3300005366 | Ga0070659_100049664 | Ga0070659_1000496642 | 507 |
| 201 | 3300005434 | Ga0070709_10005337 | Ga0070709_100053373 | 507 |
| 202 | 3300005437 | Ga0070710_10007083 | Ga0070710_100070833 | 507 |
| 203 | 3300005439 | Ga0070711_100007610 | Ga0070711_1000076102 | 507 |
| 204 | 3300005441 | Ga0070700_100007174 | Ga0070700_1000071745 | 507 |
| 205 | 3300005530 | Ga0070679_100167816 | Ga0070679_1001678162 | 507 |
| 206 | 3300005547 | Ga0070693_100060028 | Ga0070693_1000600282 | 507 |
| 207 | 3300005564 | Ga0070664_100034953 | Ga0070664_1000349532 | 507 |
| 208 | 3300005577 | Ga0068857_100022308 | Ga0068857_1000223085 | 507 |
| 209 | 3300005834 | Ga0068851_10020541 | Ga0068851_100205412 | 507 |
| 210 | 3300005937 | Ga0081455_10000123 | Ga0081455_1000012358 | 507 |
| 211 | 3300006173 | Ga0070716_100074208 | Ga0070716_1000742081 | 507 |
| 212 | 3300006175 | Ga0070712_100031738 | Ga0070712_1000317382 | 507 |
| 213 | 3300006237 | Ga0097621_100117148 | Ga0097621_1001171482 | 507 |
| 214 | 3300006358 | Ga0068871_100075614 | Ga0068871_1000756141 | 507 |
| 215 | 3300006871 | Ga0075434_100026109 | Ga0075434_1000261094 | 507 |
| 216 | 3300006881 | Ga0068865_100031231 | Ga0068865_1000312312 | 507 |
| 217 | 3300007076 | Ga0075435_100058051 | Ga0075435_1000580512 | 507 |
| 218 | 3300009098 | Ga0105245_10036074 | Ga0105245_100360743 | 507 |
| 219 | 3300009174 | Ga0105241_10019360 | Ga0105241_100193604 | 507 |
| 220 | 3300009176 | Ga0105242_10027713 | Ga0105242_100277132 | 507 |
| 221 | 3300009551 | Ga0105238_10015810 | Ga0105238_100158106 | 507 |
| 222 | 3300011119 | Ga0105246_10050252 | Ga0105246_100502522 | 507 |
| 223 | 3300013306 | Ga0163162_10033665 | Ga0163162_100336654 | 507 |
| 224 | 3300013306 | Ga0163162_10068450 | Ga0163162_100684502 | 507 |
| 225 | 3300013307 | Ga0157372_10112101 | Ga0157372_101121012 | 507 |
| 226 | 3300013308 | Ga0157375_10134302 | Ga0157375_101343022 | 507 |
| 227 | 3300014969 | Ga0157376_10017650 | Ga0157376_100176505 | 507 |
| 228 | 3300025321 | Ga0207656_10021898 | Ga0207656_100218982 | 507 |
| 229 | 3300025906 | Ga0207699_10004492 | Ga0207699_100044923 | 507 |
| 230 | 3300025924 | Ga0207694_10114250 | Ga0207694_101142501 | 507 |
| 231 | 3300025928 | Ga0207700_10011992 | Ga0207700_100119922 | 507 |
| 232 | 3300025929 | Ga0207664_10003669 | Ga0207664_100036692 | 507 |
| 233 | 3300026075 | Ga0207708_10006019 | Ga0207708_100060192 | 507 |
| 234 | 3300026078 | Ga0207702_10114614 | Ga0207702_101146142 | 507 |
| 235 | 3300026089 | Ga0207648_10029778 | Ga0207648_100297782 | 507 |
| 236 | 3300026116 | Ga0207674_10014208 | Ga0207674_100142085 | 507 |
| 237 | 3300044765 | Ga0466970_0012932 | Ga0466970_0012932_1421_3112 | 507 |
| 238 | 3300048906 | Ga0496103_0088633 | Ga0496103_0088633_248_1918 | 507 |
| 239 | 3300048907 | Ga0496104_0071383 | Ga0496104_0071383_845_2659 | 507 |
| 240 | 3300048908 | Ga0496105_0060205 | Ga0496105_0060205_472_2166 | 507 |
| 241 | 3300048911 | Ga0496108_0015456 | Ga0496108_0015456_857_2671 | 507 |
| 242 | 3300048911 | Ga0496108_0038524 | Ga0496108_0038524_495_2189 | 507 |
| 243 | 3300048912 | Ga0496109_0081171 | Ga0496109_0081171_654_2396 | 507 |
| 244 | 3300048913 | Ga0496110_0021412 | Ga0496110_0021412_1409_3223 | 507 |
| 245 | 3300048913 | Ga0496110_0048234 | Ga0496110_0048234_1724_3418 | 507 |
| 246 | 3300048914 | Ga0496111_0022383 | Ga0496111_0022383_1104_2798 | 507 |
| 247 | 3300031456 | Ga0307513_10019341 | Ga0307513_100193417 | 508 |
| 248 | 3300035083 | Ga0373926_0001583 | Ga0373926_0001583_1100_2863 | 508 |
| 249 | 3300035089 | Ga0373944_0001827 | Ga0373944_0001827_507_2270 | 508 |
| 250 | 3300035116 | Ga0373945_0000591 | Ga0373945_0000591_7632_9395 | 508 |
| 251 | 3300035117 | Ga0373953_0009920 | Ga0373953_0009920_703_2466 | 508 |
| 252 | 3300035170 | Ga0373943_0001628 | Ga0373943_0001628_1372_3135 | 508 |
| 253 | 3300035410 | Ga0373924_0008586 | Ga0373924_0008586_1218_2981 | 508 |
| 254 | 3300035725 | Ga0373947_0019417 | Ga0373947_0019417_1867_3630 | 508 |
| 255 | 3300036401 | Ga0373937_0040151 | Ga0373937_0040151_2101_3864 | 508 |
| 256 | 3300037068 | Ga0373925_0001915 | Ga0373925_0001915_772_2535 | 508 |
| 257 | 3300046472 | Ga0495580_0015030 | Ga0495580_0015030_3531_5294 | 508 |
| 258 | 3300046473 | Ga0495582_0001399 | Ga0495582_0001399_1023_2786 | 508 |
| 259 | 3300046476 | Ga0495662_0012129 | Ga0495662_0012129_1372_3135 | 508 |
| 260 | 3300046499 | Ga0495594_0017675 | Ga0495594_0017675_1738_3501 | 508 |
| 261 | 3300046531 | Ga0495665_0006507 | Ga0495665_0006507_2985_4748 | 508 |
| 262 | 3300046533 | Ga0495640_0034424 | Ga0495640_0034424_998_2761 | 508 |
| 263 | 3300046543 | Ga0495645_0084253 | Ga0495645_0084253_226_1989 | 508 |
| 264 | 3300046679 | Ga0495623_0019635 | Ga0495623_0019635_784_2547 | 508 |
| 265 | 3300046681 | Ga0495647_0014609 | Ga0495647_0014609_751_2514 | 508 |
| 266 | 3300046689 | Ga0495613_0004518 | Ga0495613_0004518_1497_3260 | 508 |
| 267 | 3300047444 | Ga0495675_0001850 | Ga0495675_0001850_226_1989 | 508 |
| 268 | 3300047471 | Ga0495684_0056981 | Ga0495684_0056981_1076_2839 | 508 |
| 269 | 3300048907 | Ga0496104_0110864 | Ga0496104_0110864_685_2469 | 508 |
| 270 | 3300048908 | Ga0496105_0072332 | Ga0496105_0072332_388_2172 | 508 |
| 271 | 3300048912 | Ga0496109_0005796 | Ga0496109_0005796_3409_5193 | 508 |
| 272 | 3300048914 | Ga0496111_0071066 | Ga0496111_0071066_538_2322 | 508 |
| 273 | 3300005366 | Ga0070659_100013914 | Ga0070659_1000139143 | 509 |
| 274 | 3300005435 | Ga0070714_100013040 | Ga0070714_1000130402 | 509 |
| 275 | 3300005436 | Ga0070713_100029057 | Ga0070713_1000290571 | 509 |
| 276 | 3300005439 | Ga0070711_100020370 | Ga0070711_1000203702 | 509 |
| 277 | 3300005616 | Ga0068852_100037992 | Ga0068852_1000379923 | 509 |
| 278 | 3300006880 | Ga0075429_100047159 | Ga0075429_1000471592 | 509 |
| 279 | 3300013105 | Ga0157369_10018141 | Ga0157369_100181414 | 509 |
| 280 | 3300014497 | Ga0182008_10025926 | Ga0182008_100259262 | 509 |
| 281 | 3300025907 | Ga0207645_10044425 | Ga0207645_100444252 | 509 |
| 282 | 3300025928 | Ga0207700_10035520 | Ga0207700_100355203 | 509 |
| 283 | 3300046559 | Ga0495667_0030210 | Ga0495667_0030210_1844_3607 | 509 |
| 284 | 3300048912 | Ga0496109_0058506 | Ga0496109_0058506_1032_2726 | 509 |
| 285 | 3300048918 | Ga0496115_0008063 | Ga0496115_0008063_4984_6618 | 509 |
| 286 | 3300049571 | Ga0501034_0062091 | Ga0501034_0062091_294_2057 | 509 |
| 287 | 3300005438 | Ga0070701_10023749 | Ga0070701_100237492 | 511 |
| 288 | 3300031901 | Ga0307406_10076400 | Ga0307406_100764001 | 511 |
| 289 | 3300048917 | Ga0496114_0204919 | Ga0496114_0204919_58_1662 | 511 |
| 290 | 3300003203 | JGI25406J46586_10001317 | JGI25406J46586_1000131710 | 512 |
| 291 | 3300005334 | Ga0068869_100035330 | Ga0068869_1000353303 | 512 |
| 292 | 3300005985 | Ga0081539_10000919 | Ga0081539_1000091915 | 512 |
| 293 | 3300046463 | Ga0495653_0003794 | Ga0495653_0003794_3142_4929 | 512 |
| 294 | 3300046809 | Ga0495600_0044659 | Ga0495600_0044659_289_2076 | 512 |
| 295 | 3300005548 | Ga0070665_100062706 | Ga0070665_1000627062 | 513 |
| 296 | 3300006852 | Ga0075433_10024336 | Ga0075433_100243365 | 513 |
| 297 | 3300006852 | Ga0075433_10025055 | Ga0075433_100250553 | 513 |
| 298 | 3300006871 | Ga0075434_100119422 | Ga0075434_1001194222 | 513 |
| 299 | 3300009147 | Ga0114129_10015764 | Ga0114129_100157646 | 513 |
| 300 | 3300009147 | Ga0114129_10046739 | Ga0114129_100467392 | 513 |
| 301 | 3300010375 | Ga0105239_10041232 | Ga0105239_100412324 | 513 |
| 302 | 3300014325 | Ga0163163_10061935 | Ga0163163_100619352 | 513 |
| 303 | 3300025906 | Ga0207699_10001901 | Ga0207699_100019015 | 513 |
| 304 | 3300026095 | Ga0207676_10033378 | Ga0207676_100333783 | 513 |
| 305 | 3300048913 | Ga0496110_0099095 | Ga0496110_0099095_27_1721 | 513 |
| 306 | 3300050507 | nmdc:mga05p37_156892_c1 | nmdc:mga05p37_156892_c1_434_2191 | 513 |
| 307 | 3300050507 | nmdc:mga05p37_7880_c1 | nmdc:mga05p37_7880_c1_10659_12392 | 513 |
| 308 | 3300050512 | nmdc:mga0n895_198239_c1 | nmdc:mga0n895_198239_c1_83_1816 | 513 |
| 309 | 3300050512 | nmdc:mga0n895_43378_c1 | nmdc:mga0n895_43378_c1_1639_3396 | 513 |
| 310 | 3300050513 | nmdc:mga0rr50_95517_c1 | nmdc:mga0rr50_95517_c1_247_2004 | 513 |
| 311 | 3300050515 | nmdc:mga0a205_37118_c1 | nmdc:mga0a205_37118_c1_212_1945 | 513 |
| 312 | 3300011119 | Ga0105246_10017620 | Ga0105246_100176202 | 514 |
| 313 | 3300046463 | Ga0495653_0012547 | Ga0495653_0012547_1521_3200 | 515 |
| 314 | 3300005329 | Ga0070683_100129725 | Ga0070683_1001297251 | 516 |
| 315 | 3300013296 | Ga0157374_10040301 | Ga0157374_100403011 | 516 |
| 316 | 3300025936 | Ga0207670_10097738 | Ga0207670_100977381 | 516 |
| 317 | 3300025944 | Ga0207661_10088523 | Ga0207661_100885231 | 516 |
| 318 | 3300046678 | Ga0495599_0086353 | Ga0495599_0086353_190_1914 | 516 |
| 319 | 3300005331 | Ga0070670_100011377 | Ga0070670_1000113776 | 517 |
| 320 | 3300005334 | Ga0068869_100000672 | Ga0068869_10000067213 | 517 |
| 321 | 3300005337 | Ga0070682_100001129 | Ga0070682_1000011292 | 517 |
| 322 | 3300005339 | Ga0070660_100009909 | Ga0070660_1000099095 | 517 |
| 323 | 3300005355 | Ga0070671_100005326 | Ga0070671_10000532611 | 517 |
| 324 | 3300005455 | Ga0070663_100029835 | Ga0070663_1000298352 | 517 |
| 325 | 3300005456 | Ga0070678_100003700 | Ga0070678_1000037004 | 517 |
| 326 | 3300005458 | Ga0070681_10032436 | Ga0070681_100324363 | 517 |
| 327 | 3300005466 | Ga0070685_10002662 | Ga0070685_100026628 | 517 |
| 328 | 3300005530 | Ga0070679_100085799 | Ga0070679_1000857993 | 517 |
| 329 | 3300005547 | Ga0070693_100010163 | Ga0070693_1000101633 | 517 |
| 330 | 3300005548 | Ga0070665_100042412 | Ga0070665_1000424122 | 517 |
| 331 | 3300005614 | Ga0068856_100006035 | Ga0068856_1000060357 | 517 |
| 332 | 3300005615 | Ga0070702_100005662 | Ga0070702_1000056622 | 517 |
| 333 | 3300005617 | Ga0068859_100082194 | Ga0068859_1000821942 | 517 |
| 334 | 3300005618 | Ga0068864_100003975 | Ga0068864_1000039758 | 517 |
| 335 | 3300005834 | Ga0068851_10012207 | Ga0068851_100122072 | 517 |
| 336 | 3300005840 | Ga0068870_10003481 | Ga0068870_100034813 | 517 |
| 337 | 3300005841 | Ga0068863_100006471 | Ga0068863_10000647110 | 517 |
| 338 | 3300005842 | Ga0068858_100068777 | Ga0068858_1000687772 | 517 |
| 339 | 3300006237 | Ga0097621_100007462 | Ga0097621_1000074623 | 517 |
| 340 | 3300006358 | Ga0068871_100009216 | Ga0068871_1000092166 | 517 |
| 341 | 3300006847 | Ga0075431_100097074 | Ga0075431_1000970742 | 517 |
| 342 | 3300006852 | Ga0075433_10011613 | Ga0075433_100116133 | 517 |
| 343 | 3300006914 | Ga0075436_100010143 | Ga0075436_1000101433 | 517 |
| 344 | 3300006931 | Ga0097620_100082193 | Ga0097620_1000821932 | 517 |
| 345 | 3300007076 | Ga0075435_100005298 | Ga0075435_1000052985 | 517 |
| 346 | 3300009093 | Ga0105240_10094129 | Ga0105240_100941293 | 517 |
| 347 | 3300009101 | Ga0105247_10009645 | Ga0105247_100096453 | 517 |
| 348 | 3300009174 | Ga0105241_10001988 | Ga0105241_1000198812 | 517 |
| 349 | 3300009177 | Ga0105248_10068314 | Ga0105248_100683143 | 517 |
| 350 | 3300011119 | Ga0105246_10010935 | Ga0105246_100109352 | 517 |
| 351 | 3300013296 | Ga0157374_10094403 | Ga0157374_100944032 | 517 |
| 352 | 3300013308 | Ga0157375_10030166 | Ga0157375_100301662 | 517 |
| 353 | 3300014969 | Ga0157376_10022075 | Ga0157376_100220753 | 517 |
| 354 | 3300025321 | Ga0207656_10012516 | Ga0207656_100125163 | 517 |
| 355 | 3300025900 | Ga0207710_10006639 | Ga0207710_100066393 | 517 |
| 356 | 3300025901 | Ga0207688_10000213 | Ga0207688_1000021312 | 517 |
| 357 | 3300025908 | Ga0207643_10000218 | Ga0207643_100002185 | 517 |
| 358 | 3300025909 | Ga0207705_10037063 | Ga0207705_100370632 | 517 |
| 359 | 3300025911 | Ga0207654_10003770 | Ga0207654_100037703 | 517 |
| 360 | 3300025919 | Ga0207657_10008572 | Ga0207657_100085726 | 517 |
| 361 | 3300025920 | Ga0207649_10007987 | Ga0207649_100079873 | 517 |
| 362 | 3300025925 | Ga0207650_10009927 | Ga0207650_100099273 | 517 |
| 363 | 3300025931 | Ga0207644_10008003 | Ga0207644_100080035 | 517 |
| 364 | 3300025942 | Ga0207689_10002593 | Ga0207689_1000259312 | 517 |
| 365 | 3300025944 | Ga0207661_10002657 | Ga0207661_100026573 | 517 |
| 366 | 3300025945 | Ga0207679_10010995 | Ga0207679_100109953 | 517 |
| 367 | 3300026067 | Ga0207678_10011871 | Ga0207678_100118713 | 517 |
| 368 | 3300026075 | Ga0207708_10045044 | Ga0207708_100450442 | 517 |
| 369 | 3300026078 | Ga0207702_10002437 | Ga0207702_100024373 | 517 |
| 370 | 3300026078 | Ga0207702_10009971 | Ga0207702_100099713 | 517 |
| 371 | 3300026095 | Ga0207676_10003391 | Ga0207676_100033913 | 517 |
| 372 | 3300026116 | Ga0207674_10107503 | Ga0207674_101075033 | 517 |
| 373 | 3300026121 | Ga0207683_10000454 | Ga0207683_1000045425 | 517 |
| 374 | 3300026142 | Ga0207698_10004756 | Ga0207698_100047563 | 517 |
| 375 | 3300042157 | Ga0439458_0008012 | Ga0439458_0008012_337_2070 | 517 |
| 376 | 3300048905 | Ga0496102_0013799 | Ga0496102_0013799_2408_4159 | 517 |
| 377 | 3300048908 | Ga0496105_0002305 | Ga0496105_0002305_10268_12019 | 517 |
| 378 | 3300048909 | Ga0496106_0003648 | Ga0496106_0003648_8140_9891 | 517 |
| 379 | 3300048911 | Ga0496108_0012789 | Ga0496108_0012789_1831_3582 | 517 |
| 380 | 3300049569 | Ga0501032_0002022 | Ga0501032_0002022_8516_10150 | 517 |
| 381 | 3300049570 | Ga0501033_0011445 | Ga0501033_0011445_3610_5244 | 517 |
| 382 | 3300049571 | Ga0501034_0004204 | Ga0501034_0004204_12735_14369 | 517 |
| 383 | 3300049573 | Ga0501037_0021309 | Ga0501037_0021309_409_2043 | 517 |
| 384 | 3300049574 | Ga0501038_0038074 | Ga0501038_0038074_524_2158 | 517 |
| 385 | 3300049576 | Ga0501040_0021756 | Ga0501040_0021756_433_2067 | 517 |
| 386 | 3300049582 | Ga0501048_0045452 | Ga0501048_0045452_1070_2704 | 517 |
| 387 | 3300049584 | Ga0501068_0001135 | Ga0501068_0001135_1891_3525 | 517 |
| 388 | 3300049585 | Ga0501069_0048322 | Ga0501069_0048322_432_2066 | 517 |
| 389 | 3300049586 | Ga0501070_0002476 | Ga0501070_0002476_1094_2728 | 517 |
| 390 | 3300049588 | Ga0501072_0030265 | Ga0501072_0030265_1891_3525 | 517 |
| 391 | 3300049590 | Ga0501074_0014082 | Ga0501074_0014082_3748_5382 | 517 |
| 392 | 3300049742 | Ga0501080_0005478 | Ga0501080_0005478_4581_6215 | 517 |
| 393 | 3300049743 | Ga0501081_0010424 | Ga0501081_0010424_3994_5628 | 517 |
| 394 | 3300049824 | Ga0501045_0007946 | Ga0501045_0007946_4080_5714 | 517 |
| 395 | 3300050511 | nmdc:mga08y16_33936_c1 | nmdc:mga08y16_33936_c1_1530_3281 | 517 |
| 396 | 3300050512 | nmdc:mga0n895_825_c1 | nmdc:mga0n895_825_c1_2443_4194 | 517 |
| 397 | 3300050514 | nmdc:mga08x19_7539_c1 | nmdc:mga08x19_7539_c1_2622_4373 | 517 |
| 398 | 3300050515 | nmdc:mga0a205_6248_c1 | nmdc:mga0a205_6248_c1_7300_9051 | 517 |
| 399 | 3300005435 | Ga0070714_100017478 | Ga0070714_1000174783 | 518 |
| 400 | 3300005436 | Ga0070713_100003754 | Ga0070713_1000037544 | 518 |
| 401 | 3300025922 | Ga0207646_10012024 | Ga0207646_100120245 | 518 |
| 402 | 3300026067 | Ga0207678_10078529 | Ga0207678_100785292 | 518 |
| 403 | 3300045976 | Ga0466967_0101822 | Ga0466967_0101822_572_2320 | 518 |
| 404 | 3300048913 | Ga0496110_0038608 | Ga0496110_0038608_1737_3485 | 518 |
| 405 | 3300037068 | Ga0373925_0007560 | Ga0373925_0007560_323_2110 | 519 |
| 406 | 3300046462 | Ga0495651_0011712 | Ga0495651_0011712_1840_3627 | 519 |
| 407 | 3300046473 | Ga0495582_0002910 | Ga0495582_0002910_3135_4814 | 519 |
| 408 | 3300046516 | Ga0495628_0027893 | Ga0495628_0027893_711_2498 | 519 |
| 409 | 3300046517 | Ga0495630_0027780 | Ga0495630_0027780_393_2180 | 519 |
| 410 | 3300046536 | Ga0495587_0004198 | Ga0495587_0004198_1788_3575 | 519 |
| 411 | 3300046642 | Ga0495634_0019468 | Ga0495634_0019468_72_1859 | 519 |
| 412 | 3300046674 | Ga0495588_0022616 | Ga0495588_0022616_1358_3037 | 519 |
| 413 | 3300046680 | Ga0495646_0009024 | Ga0495646_0009024_3645_5432 | 519 |
| 414 | 3300047319 | Ga0495674_0074405 | Ga0495674_0074405_755_2542 | 519 |
| 415 | 3300047321 | Ga0495676_0083124 | Ga0495676_0083124_201_1880 | 519 |
| 416 | 3300047322 | Ga0495680_0006570 | Ga0495680_0006570_6790_8577 | 519 |
| 417 | 3300048929 | Ga0496126_0174840 | Ga0496126_0174840_42_1781 | 519 |
| 418 | 3300036401 | Ga0373937_0084052 | Ga0373937_0084052_1187_2920 | 520 |
| 419 | 3300046454 | Ga0495592_0033973 | Ga0495592_0033973_1714_3393 | 520 |
| 420 | 3300046529 | Ga0495652_0013266 | Ga0495652_0013266_3018_4748 | 520 |
| 421 | 3300046536 | Ga0495587_0056171 | Ga0495587_0056171_65_1795 | 520 |
| 422 | 3300046559 | Ga0495667_0013560 | Ga0495667_0013560_859_2538 | 520 |
| 423 | 3300046680 | Ga0495646_0032465 | Ga0495646_0032465_1404_3083 | 520 |
| 424 | 3300047444 | Ga0495675_0009503 | Ga0495675_0009503_3259_4938 | 520 |
| 425 | 3300048907 | Ga0496104_0071625 | Ga0496104_0071625_1003_2709 | 520 |
| 426 | 3300048910 | Ga0496107_0005385 | Ga0496107_0005385_2350_4056 | 520 |
| 427 | 3300048911 | Ga0496108_0089272 | Ga0496108_0089272_10_1716 | 520 |
| 428 | 3300048912 | Ga0496109_0108886 | Ga0496109_0108886_849_2555 | 520 |
| 429 | 3300048917 | Ga0496114_0020614 | Ga0496114_0020614_3650_5338 | 520 |
| 430 | 3300049583 | Ga0501067_0026266 | Ga0501067_0026266_502_2289 | 520 |
| 431 | 3300049585 | Ga0501069_0048019 | Ga0501069_0048019_119_1906 | 520 |
| 432 | 3300005436 | Ga0070713_100023202 | Ga0070713_1000232022 | 521 |
| 433 | 3300009098 | Ga0105245_10005589 | Ga0105245_100055896 | 521 |
| 434 | 3300009147 | Ga0114129_10314640 | Ga0114129_103146401 | 521 |
| 435 | 3300013308 | Ga0157375_10042902 | Ga0157375_100429025 | 521 |
| 436 | 3300014745 | Ga0157377_10009848 | Ga0157377_100098484 | 521 |
| 437 | 3300025928 | Ga0207700_10024576 | Ga0207700_100245764 | 521 |
| 438 | 3300006175 | Ga0070712_100046323 | Ga0070712_1000463232 | 522 |
| 439 | 3300009093 | Ga0105240_10015709 | Ga0105240_1001570912 | 522 |
| 440 | 3300009174 | Ga0105241_10005381 | Ga0105241_100053815 | 522 |
| 441 | 3300009545 | Ga0105237_10008550 | Ga0105237_1000855012 | 522 |
| 442 | 3300009551 | Ga0105238_10004485 | Ga0105238_100044856 | 522 |
| 443 | 3300010375 | Ga0105239_10028892 | Ga0105239_100288925 | 522 |
| 444 | 3300025915 | Ga0207693_10081784 | Ga0207693_100817842 | 522 |
| 445 | 3300036401 | Ga0373937_0179693 | Ga0373937_0179693_260_1963 | 522 |
| 446 | 3300046543 | Ga0495645_0078985 | Ga0495645_0078985_444_2174 | 522 |
| 447 | 3300047322 | Ga0495680_0086991 | Ga0495680_0086991_282_1985 | 522 |
| 448 | 3300005548 | Ga0070665_100126293 | Ga0070665_1001262933 | 523 |
| 449 | 3300005616 | Ga0068852_100084755 | Ga0068852_1000847553 | 523 |
| 450 | 3300009094 | Ga0111539_10148357 | Ga0111539_101483573 | 523 |
| 451 | 3300025932 | Ga0207690_10090184 | Ga0207690_100901841 | 523 |
| 452 | 3300026023 | Ga0207677_10029647 | Ga0207677_100296473 | 523 |
| 453 | 3300027907 | Ga0207428_10133363 | Ga0207428_101333632 | 523 |
| 454 | 3300028379 | Ga0268266_10054809 | Ga0268266_100548093 | 523 |
| 455 | 3300044694 | Ga0466963_0001267 | Ga0466963_0001267_2788_4506 | 523 |
| 456 | 3300045049 | Ga0466959_0070396 | Ga0466959_0070396_437_2155 | 523 |
| 457 | 3300045976 | Ga0466967_0007021 | Ga0466967_0007021_3233_4951 | 523 |
| 458 | 3300046462 | Ga0495651_0058460 | Ga0495651_0058460_642_2342 | 523 |
| 459 | 3300046511 | Ga0495608_0043756 | Ga0495608_0043756_461_2161 | 523 |
| 460 | 3300047319 | Ga0495674_0077342 | Ga0495674_0077342_1118_2815 | 523 |
| 461 | 3300047322 | Ga0495680_0012893 | Ga0495680_0012893_5145_6842 | 523 |
| 462 | 3300047471 | Ga0495684_0058330 | Ga0495684_0058330_537_2237 | 523 |
| 463 | 3300048924 | Ga0496121_0002166 | Ga0496121_0002166_24796_26514 | 523 |
| 464 | 3300050511 | nmdc:mga08y16_183109_c1 | nmdc:mga08y16_183109_c1_375_2063 | 523 |
| 465 | 3300053077 | Ga0495601_0044793 | Ga0495601_0044793_354_2054 | 523 |
| 466 | 3300009094 | Ga0111539_10234046 | Ga0111539_102340462 | 524 |
| 467 | 3300048911 | Ga0496108_0034247 | Ga0496108_0034247_2190_3890 | 524 |
| 468 | 3300048911 | Ga0496108_0088572 | Ga0496108_0088572_572_2311 | 524 |
| 469 | 3300048912 | Ga0496109_0004142 | Ga0496109_0004142_9290_10990 | 524 |
| 470 | 3300048917 | Ga0496114_0024825 | Ga0496114_0024825_2842_4578 | 524 |
| 471 | 3300005444 | Ga0070694_100006385 | Ga0070694_1000063854 | 525 |
| 472 | 3300005468 | Ga0070707_100012396 | Ga0070707_1000123967 | 525 |
| 473 | 3300005518 | Ga0070699_100002823 | Ga0070699_10000282310 | 525 |
| 474 | 3300005536 | Ga0070697_100005200 | Ga0070697_1000052002 | 525 |
| 475 | 3300005548 | Ga0070665_100012542 | Ga0070665_1000125423 | 525 |
| 476 | 3300005563 | Ga0068855_100005045 | Ga0068855_10000504515 | 525 |
| 477 | 3300005578 | Ga0068854_100002147 | Ga0068854_1000021474 | 525 |
| 478 | 3300006028 | Ga0070717_10047747 | Ga0070717_100477472 | 525 |
| 479 | 3300009553 | Ga0105249_10010209 | Ga0105249_100102092 | 525 |
| 480 | 3300025904 | Ga0207647_10005252 | Ga0207647_100052527 | 525 |
| 481 | 3300025913 | Ga0207695_10002866 | Ga0207695_1000286612 | 525 |
| 482 | 3300025914 | Ga0207671_10003461 | Ga0207671_1000346115 | 525 |
| 483 | 3300025924 | Ga0207694_10000843 | Ga0207694_1000084318 | 525 |
| 484 | 3300025949 | Ga0207667_10015537 | Ga0207667_100155377 | 525 |
| 485 | 3300025981 | Ga0207640_10004012 | Ga0207640_100040124 | 525 |
| 486 | 3300026067 | Ga0207678_10096187 | Ga0207678_100961873 | 525 |
| 487 | 3300006028 | Ga0070717_10025313 | Ga0070717_100253134 | 526 |
| 488 | 3300006844 | Ga0075428_100134410 | Ga0075428_1001344102 | 526 |
| 489 | 3300006847 | Ga0075431_100085037 | Ga0075431_1000850372 | 526 |
| 490 | 3300006871 | Ga0075434_100180303 | Ga0075434_1001803031 | 526 |
| 491 | 3300006880 | Ga0075429_100082607 | Ga0075429_1000826072 | 526 |
| 492 | 3300027907 | Ga0207428_10115835 | Ga0207428_101158351 | 526 |
| 493 | 3300035725 | Ga0373947_0004411 | Ga0373947_0004411_1442_3232 | 526 |
| 494 | 3300046459 | Ga0495629_0001429 | Ga0495629_0001429_11978_13768 | 526 |
| 495 | 3300046473 | Ga0495582_0000338 | Ga0495582_0000338_5999_7789 | 526 |
| 496 | 3300046531 | Ga0495665_0001371 | Ga0495665_0001371_1726_3516 | 526 |
| 497 | 3300046681 | Ga0495647_0015267 | Ga0495647_0015267_418_2208 | 526 |
| 498 | 3300046683 | Ga0495658_0000726 | Ga0495658_0000726_4980_6770 | 526 |
| 499 | 3300047315 | Ga0495581_0001112 | Ga0495581_0001112_9721_11511 | 526 |
| 500 | 3300050515 | nmdc:mga0a205_44872_c1 | nmdc:mga0a205_44872_c1_952_2670 | 526 |
| 501 | 3300005457 | Ga0070662_100017767 | Ga0070662_1000177674 | 527 |
| 502 | 3300005843 | Ga0068860_100045967 | Ga0068860_1000459672 | 527 |
| 503 | 3300005937 | Ga0081455_10001506 | Ga0081455_1000150625 | 527 |
| 504 | 3300025933 | Ga0207706_10076573 | Ga0207706_100765732 | 527 |
| 505 | 3300028380 | Ga0268265_10108993 | Ga0268265_101089932 | 527 |
| 506 | 3300028381 | Ga0268264_10039541 | Ga0268264_100395413 | 527 |
| 507 | 3300053085 | Ga0495619_0026491 | Ga0495619_0026491_645_2462 | 527 |
| 508 | 3300005329 | Ga0070683_100039924 | Ga0070683_1000399244 | 528 |
| 509 | 3300005329 | Ga0070683_100060608 | Ga0070683_1000606083 | 528 |
| 510 | 3300005336 | Ga0070680_100000135 | Ga0070680_10000013512 | 528 |
| 511 | 3300005458 | Ga0070681_10000020 | Ga0070681_1000002090 | 528 |
| 512 | 3300005458 | Ga0070681_10055574 | Ga0070681_100555742 | 528 |
| 513 | 3300005530 | Ga0070679_100000044 | Ga0070679_10000004443 | 528 |
| 514 | 3300009147 | Ga0114129_10040454 | Ga0114129_100404544 | 528 |
| 515 | 3300010375 | Ga0105239_10032423 | Ga0105239_100324233 | 528 |
| 516 | 3300025912 | Ga0207707_10000090 | Ga0207707_1000009043 | 528 |
| 517 | 3300025917 | Ga0207660_10000219 | Ga0207660_100002192 | 528 |
| 518 | 3300025917 | Ga0207660_10059241 | Ga0207660_100592412 | 528 |
| 519 | 3300025921 | Ga0207652_10000485 | Ga0207652_1000048542 | 528 |
| 520 | 3300048908 | Ga0496105_0085683 | Ga0496105_0085683_847_2577 | 528 |
| 521 | 3300048917 | Ga0496114_0056320 | Ga0496114_0056320_999_2732 | 528 |
| 522 | 3300005336 | Ga0070680_100030659 | Ga0070680_1000306593 | 529 |
| 523 | 3300005471 | Ga0070698_100104833 | Ga0070698_1001048331 | 529 |
| 524 | 3300005530 | Ga0070679_100102225 | Ga0070679_1001022252 | 529 |
| 525 | 3300005535 | Ga0070684_100020042 | Ga0070684_1000200423 | 529 |
| 526 | 3300009093 | Ga0105240_10072227 | Ga0105240_100722272 | 529 |
| 527 | 3300009147 | Ga0114129_10055068 | Ga0114129_100550685 | 529 |
| 528 | 3300014325 | Ga0163163_10009952 | Ga0163163_100099528 | 529 |
| 529 | 3300025912 | Ga0207707_10035007 | Ga0207707_100350073 | 529 |
| 530 | 3300046459 | Ga0495629_0001088 | Ga0495629_0001088_9000_10715 | 529 |
| 531 | 3300046473 | Ga0495582_0000078 | Ga0495582_0000078_25137_26852 | 529 |
| 532 | 3300046531 | Ga0495665_0021638 | Ga0495665_0021638_972_2687 | 529 |
| 533 | 3300046539 | Ga0495621_0000572 | Ga0495621_0000572_2556_4319 | 529 |
| 534 | 3300046683 | Ga0495658_0000236 | Ga0495658_0000236_23710_25425 | 529 |
| 535 | 3300046689 | Ga0495613_0000207 | Ga0495613_0000207_24539_26254 | 529 |
| 536 | 3300047315 | Ga0495581_0001409 | Ga0495581_0001409_5654_7369 | 529 |
| 537 | 3300048905 | Ga0496102_0020367 | Ga0496102_0020367_3961_5697 | 529 |
| 538 | 3300048915 | Ga0496112_0016419 | Ga0496112_0016419_5171_6907 | 529 |
| 539 | 3300050507 | nmdc:mga05p37_89312_c1 | nmdc:mga05p37_89312_c1_1446_3179 | 529 |
| 540 | 3300050512 | nmdc:mga0n895_2126_c1 | nmdc:mga0n895_2126_c1_1249_2985 | 529 |
| 541 | 3300061734 | Ga0530510_0030155 | Ga0530510_0030155_1867_3603 | 529 |
| 542 | 3300005338 | Ga0068868_100007548 | Ga0068868_1000075488 | 530 |
| 543 | 3300005338 | Ga0068868_100034361 | Ga0068868_1000343612 | 530 |
| 544 | 3300005366 | Ga0070659_100049618 | Ga0070659_1000496183 | 530 |
| 545 | 3300005436 | Ga0070713_100061707 | Ga0070713_1000617072 | 530 |
| 546 | 3300005439 | Ga0070711_100071560 | Ga0070711_1000715602 | 530 |
| 547 | 3300005535 | Ga0070684_100037755 | Ga0070684_1000377553 | 530 |
| 548 | 3300005563 | Ga0068855_100002117 | Ga0068855_10000211719 | 530 |
| 549 | 3300005614 | Ga0068856_100076180 | Ga0068856_1000761802 | 530 |
| 550 | 3300005617 | Ga0068859_100046929 | Ga0068859_1000469295 | 530 |
| 551 | 3300006028 | Ga0070717_10011176 | Ga0070717_100111766 | 530 |
| 552 | 3300006871 | Ga0075434_100012332 | Ga0075434_1000123325 | 530 |
| 553 | 3300006914 | Ga0075436_100017185 | Ga0075436_1000171854 | 530 |
| 554 | 3300006931 | Ga0097620_100046929 | Ga0097620_1000469295 | 530 |
| 555 | 3300007076 | Ga0075435_100000523 | Ga0075435_10000052322 | 530 |
| 556 | 3300009551 | Ga0105238_10030996 | Ga0105238_100309964 | 530 |
| 557 | 3300011119 | Ga0105246_10002583 | Ga0105246_100025836 | 530 |
| 558 | 3300013105 | Ga0157369_10157007 | Ga0157369_101570072 | 530 |
| 559 | 3300013296 | Ga0157374_10008821 | Ga0157374_100088216 | 530 |
| 560 | 3300013307 | Ga0157372_10077393 | Ga0157372_100773933 | 530 |
| 561 | 3300014325 | Ga0163163_10115834 | Ga0163163_101158342 | 530 |
| 562 | 3300025901 | Ga0207688_10002494 | Ga0207688_100024944 | 530 |
| 563 | 3300025914 | Ga0207671_10035151 | Ga0207671_100351514 | 530 |
| 564 | 3300025916 | Ga0207663_10122751 | Ga0207663_101227511 | 530 |
| 565 | 3300025919 | Ga0207657_10102038 | Ga0207657_101020382 | 530 |
| 566 | 3300025927 | Ga0207687_10031812 | Ga0207687_100318122 | 530 |
| 567 | 3300025932 | Ga0207690_10004202 | Ga0207690_100042028 | 530 |
| 568 | 3300025939 | Ga0207665_10023651 | Ga0207665_100236512 | 530 |
| 569 | 3300025949 | Ga0207667_10004602 | Ga0207667_100046028 | 530 |
| 570 | 3300025960 | Ga0207651_10118895 | Ga0207651_101188952 | 530 |
| 571 | 3300026023 | Ga0207677_10062601 | Ga0207677_100626012 | 530 |
| 572 | 3300026121 | Ga0207683_10106699 | Ga0207683_101066992 | 530 |
| 573 | 3300028379 | Ga0268266_10094610 | Ga0268266_100946102 | 530 |
| 574 | 3300035695 | Ga0373927_0019496 | Ga0373927_0019496_507_2183 | 530 |
| 575 | 3300035724 | Ga0373933_0039045 | Ga0373933_0039045_457_2133 | 530 |
| 576 | 3300046461 | Ga0495641_0022859 | Ga0495641_0022859_484_2160 | 530 |
| 577 | 3300046475 | Ga0495639_0003784 | Ga0495639_0003784_1822_3498 | 530 |
| 578 | 3300046475 | Ga0495639_0030093 | Ga0495639_0030093_694_2370 | 530 |
| 579 | 3300046476 | Ga0495662_0008850 | Ga0495662_0008850_2182_3858 | 530 |
| 580 | 3300046499 | Ga0495594_0032192 | Ga0495594_0032192_571_2247 | 530 |
| 581 | 3300046514 | Ga0495618_0034995 | Ga0495618_0034995_575_2251 | 530 |
| 582 | 3300046517 | Ga0495630_0018348 | Ga0495630_0018348_2980_4656 | 530 |
| 583 | 3300046531 | Ga0495665_0011482 | Ga0495665_0011482_944_2620 | 530 |
| 584 | 3300046533 | Ga0495640_0047829 | Ga0495640_0047829_505_2181 | 530 |
| 585 | 3300046559 | Ga0495667_0048750 | Ga0495667_0048750_453_2129 | 530 |
| 586 | 3300046642 | Ga0495634_0011952 | Ga0495634_0011952_2087_3763 | 530 |
| 587 | 3300046663 | Ga0495635_0023243 | Ga0495635_0023243_204_1880 | 530 |
| 588 | 3300046674 | Ga0495588_0004695 | Ga0495588_0004695_2422_4098 | 530 |
| 589 | 3300046683 | Ga0495658_0008286 | Ga0495658_0008286_2446_4122 | 530 |
| 590 | 3300046689 | Ga0495613_0018030 | Ga0495613_0018030_904_2580 | 530 |
| 591 | 3300046690 | Ga0495624_0020231 | Ga0495624_0020231_227_1903 | 530 |
| 592 | 3300046690 | Ga0495624_0025322 | Ga0495624_0025322_1708_3384 | 530 |
| 593 | 3300046809 | Ga0495600_0025724 | Ga0495600_0025724_1906_3582 | 530 |
| 594 | 3300047315 | Ga0495581_0011427 | Ga0495581_0011427_760_2436 | 530 |
| 595 | 3300047317 | Ga0495604_0052269 | Ga0495604_0052269_603_2279 | 530 |
| 596 | 3300047319 | Ga0495674_0040756 | Ga0495674_0040756_735_2411 | 530 |
| 597 | 3300047321 | Ga0495676_0011573 | Ga0495676_0011573_4311_5987 | 530 |
| 598 | 3300047322 | Ga0495680_0055223 | Ga0495680_0055223_960_2636 | 530 |
| 599 | 3300047471 | Ga0495684_0018295 | Ga0495684_0018295_1022_2698 | 530 |
| 600 | 3300047673 | Ga0495593_0057053 | Ga0495593_0057053_176_1852 | 530 |
| 601 | 3300048904 | Ga0496101_0002239 | Ga0496101_0002239_10073_11749 | 530 |
| 602 | 3300048904 | Ga0496101_0002703 | Ga0496101_0002703_6921_8660 | 530 |
| 603 | 3300048905 | Ga0496102_0006157 | Ga0496102_0006157_4211_5887 | 530 |
| 604 | 3300048905 | Ga0496102_0006613 | Ga0496102_0006613_1346_3085 | 530 |
| 605 | 3300048906 | Ga0496103_0002293 | Ga0496103_0002293_6353_8029 | 530 |
| 606 | 3300048908 | Ga0496105_0000756 | Ga0496105_0000756_16362_18038 | 530 |
| 607 | 3300048909 | Ga0496106_0019313 | Ga0496106_0019313_688_2364 | 530 |
| 608 | 3300048910 | Ga0496107_0009138 | Ga0496107_0009138_2905_4581 | 530 |
| 609 | 3300048910 | Ga0496107_0051083 | Ga0496107_0051083_544_2220 | 530 |
| 610 | 3300048911 | Ga0496108_0082690 | Ga0496108_0082690_755_2431 | 530 |
| 611 | 3300048912 | Ga0496109_0027124 | Ga0496109_0027124_851_2590 | 530 |
| 612 | 3300048913 | Ga0496110_0000249 | Ga0496110_0000249_8113_9789 | 530 |
| 613 | 3300048913 | Ga0496110_0075476 | Ga0496110_0075476_708_2447 | 530 |
| 614 | 3300048914 | Ga0496111_0003049 | Ga0496111_0003049_2452_4128 | 530 |
| 615 | 3300048915 | Ga0496112_0000620 | Ga0496112_0000620_10624_12300 | 530 |
| 616 | 3300048916 | Ga0496113_0080845 | Ga0496113_0080845_545_2284 | 530 |
| 617 | 3300048918 | Ga0496115_0004134 | Ga0496115_0004134_2470_4209 | 530 |
| 618 | 3300048918 | Ga0496115_0029753 | Ga0496115_0029753_2408_4084 | 530 |
| 619 | 3300050512 | nmdc:mga0n895_10525_c1 | nmdc:mga0n895_10525_c1_3936_5612 | 530 |
| 620 | 3300050513 | nmdc:mga0rr50_7773_c1 | nmdc:mga0rr50_7773_c1_4583_6259 | 530 |
| 621 | 3300050514 | nmdc:mga08x19_9178_c1 | nmdc:mga08x19_9178_c1_1717_3393 | 530 |
| 622 | 3300053077 | Ga0495601_0002354 | Ga0495601_0002354_2361_4037 | 530 |
| 623 | 3300053078 | Ga0495612_0017888 | Ga0495612_0017888_711_2387 | 530 |
| 624 | 3300053085 | Ga0495619_0035391 | Ga0495619_0035391_1050_2726 | 530 |
| 625 | 3300005467 | Ga0070706_100004208 | Ga0070706_10000420815 | 531 |
| 626 | 3300009551 | Ga0105238_10013378 | Ga0105238_100133784 | 531 |
| 627 | 3300025910 | Ga0207684_10001508 | Ga0207684_100015085 | 531 |
| 628 | 3300037418 | Ga0395900_0143787 | Ga0395900_0143787_163_1848 | 531 |
| 629 | 3300046516 | Ga0495628_0021322 | Ga0495628_0021322_3498_5312 | 531 |
| 630 | 3300005437 | Ga0070710_10032808 | Ga0070710_100328082 | 532 |
| 631 | 3300005577 | Ga0068857_100140635 | Ga0068857_1001406352 | 532 |
| 632 | 3300024225 | Ga0224572_1002365 | Ga0224572_10023652 | 532 |
| 633 | 3300025916 | Ga0207663_10035938 | Ga0207663_100359382 | 532 |
| 634 | 3300026121 | Ga0207683_10154855 | Ga0207683_101548551 | 532 |
| 635 | 3300035724 | Ga0373933_0081560 | Ga0373933_0081560_29_1783 | 532 |
| 636 | 3300046454 | Ga0495592_0011277 | Ga0495592_0011277_2836_4620 | 532 |
| 637 | 3300046462 | Ga0495651_0010231 | Ga0495651_0010231_1727_3511 | 532 |
| 638 | 3300046463 | Ga0495653_0008124 | Ga0495653_0008124_5181_6965 | 532 |
| 639 | 3300046511 | Ga0495608_0007499 | Ga0495608_0007499_4107_5891 | 532 |
| 640 | 3300046529 | Ga0495652_0016891 | Ga0495652_0016891_3777_5561 | 532 |
| 641 | 3300046533 | Ga0495640_0023414 | Ga0495640_0023414_758_2542 | 532 |
| 642 | 3300046536 | Ga0495587_0014003 | Ga0495587_0014003_1277_3061 | 532 |
| 643 | 3300046543 | Ga0495645_0064304 | Ga0495645_0064304_617_2401 | 532 |
| 644 | 3300046559 | Ga0495667_0006824 | Ga0495667_0006824_3734_5518 | 532 |
| 645 | 3300046642 | Ga0495634_0031304 | Ga0495634_0031304_1670_3499 | 532 |
| 646 | 3300046663 | Ga0495635_0012304 | Ga0495635_0012304_2598_4382 | 532 |
| 647 | 3300046675 | Ga0495657_0008653 | Ga0495657_0008653_4628_6412 | 532 |
| 648 | 3300046678 | Ga0495599_0007643 | Ga0495599_0007643_2812_4596 | 532 |
| 649 | 3300046809 | Ga0495600_0013426 | Ga0495600_0013426_1618_3402 | 532 |
| 650 | 3300047317 | Ga0495604_0001649 | Ga0495604_0001649_14676_16460 | 532 |
| 651 | 3300047319 | Ga0495674_0010613 | Ga0495674_0010613_1949_3733 | 532 |
| 652 | 3300047322 | Ga0495680_0020012 | Ga0495680_0020012_1568_3352 | 532 |
| 653 | 3300047444 | Ga0495675_0003497 | Ga0495675_0003497_483_2267 | 532 |
| 654 | 3300047471 | Ga0495684_0059009 | Ga0495684_0059009_542_2326 | 532 |
| 655 | 3300048088 | Ga0495602_0017632 | Ga0495602_0017632_3732_5516 | 532 |
| 656 | 3300053085 | Ga0495619_0021469 | Ga0495619_0021469_1620_3404 | 532 |
| 657 | 3300005435 | Ga0070714_100002616 | Ga0070714_1000026164 | 533 |
| 658 | 3300005436 | Ga0070713_100085957 | Ga0070713_1000859572 | 533 |
| 659 | 3300005530 | Ga0070679_100037668 | Ga0070679_1000376684 | 533 |
| 660 | 3300006042 | Ga0075368_10006845 | Ga0075368_100068452 | 533 |
| 661 | 3300006048 | Ga0075363_100025841 | Ga0075363_1000258412 | 533 |
| 662 | 3300025915 | Ga0207693_10010102 | Ga0207693_100101024 | 533 |
| 663 | 3300025929 | Ga0207664_10003919 | Ga0207664_100039198 | 533 |
| 664 | 3300025938 | Ga0207704_10056512 | Ga0207704_100565122 | 533 |
| 665 | 3300053153 | Ga0500616_0004633 | Ga0500616_0004633_4724_6466 | 533 |
| 666 | 3300009545 | Ga0105237_10021863 | Ga0105237_100218633 | 534 |
| 667 | 3300009551 | Ga0105238_10044458 | Ga0105238_100444583 | 534 |
| 668 | 3300013105 | Ga0157369_10011108 | Ga0157369_100111083 | 534 |
| 669 | 3300013307 | Ga0157372_10017094 | Ga0157372_100170942 | 534 |
| 670 | 3300025912 | Ga0207707_10007781 | Ga0207707_100077812 | 534 |
| 671 | 3300025935 | Ga0207709_10029106 | Ga0207709_100291063 | 534 |
| 672 | 3300048907 | Ga0496104_0205506 | Ga0496104_0205506_159_1850 | 534 |
| 673 | 3300049568 | Ga0501031_0032255 | Ga0501031_0032255_185_1870 | 534 |
| 674 | 3300061734 | Ga0530510_0020513 | Ga0530510_0020513_14_1699 | 534 |
| 675 | 3300005441 | Ga0070700_100021607 | Ga0070700_1000216072 | 535 |
| 676 | 3300005544 | Ga0070686_100122995 | Ga0070686_1001229951 | 535 |
| 677 | 3300010375 | Ga0105239_10054291 | Ga0105239_100542913 | 535 |
| 678 | 3300025919 | Ga0207657_10013651 | Ga0207657_100136514 | 535 |
| 679 | 3300025927 | Ga0207687_10000842 | Ga0207687_100008427 | 535 |
| 680 | 3300026023 | Ga0207677_10004443 | Ga0207677_100044437 | 535 |
| 681 | 3300026075 | Ga0207708_10033380 | Ga0207708_100333802 | 535 |
| 682 | 3300035118 | Ga0373954_0042125 | Ga0373954_0042125_132_1868 | 535 |
| 683 | 3300035120 | Ga0373957_0019408 | Ga0373957_0019408_176_1912 | 535 |
| 684 | 3300036401 | Ga0373937_0063513 | Ga0373937_0063513_599_2335 | 535 |
| 685 | 3300046462 | Ga0495651_0018918 | Ga0495651_0018918_1094_2830 | 535 |
| 686 | 3300048905 | Ga0496102_0107632 | Ga0496102_0107632_41_1729 | 535 |
| 687 | 3300048911 | Ga0496108_0000337 | Ga0496108_0000337_24490_26226 | 535 |
| 688 | 3300048912 | Ga0496109_0054063 | Ga0496109_0054063_13_1701 | 535 |
| 689 | 3300048913 | Ga0496110_0070893 | Ga0496110_0070893_917_2605 | 535 |
| 690 | iso_pu_bacteria | 2751185782 | 2753271297 | 535 |
| 691 | 3300005434 | Ga0070709_10022372 | Ga0070709_100223722 | 536 |
| 692 | 3300005437 | Ga0070710_10020055 | Ga0070710_100200552 | 536 |
| 693 | 3300005439 | Ga0070711_100042360 | Ga0070711_1000423602 | 536 |
| 694 | 3300006163 | Ga0070715_10001284 | Ga0070715_100012844 | 536 |
| 695 | 3300006173 | Ga0070716_100012672 | Ga0070716_1000126724 | 536 |
| 696 | 3300025898 | Ga0207692_10006172 | Ga0207692_100061723 | 536 |
| 697 | 3300025906 | Ga0207699_10000619 | Ga0207699_1000061914 | 536 |
| 698 | 3300025928 | Ga0207700_10008259 | Ga0207700_100082594 | 536 |
| 699 | 3300025939 | Ga0207665_10000412 | Ga0207665_100004129 | 536 |
| 700 | 3300048907 | Ga0496104_0012420 | Ga0496104_0012420_1511_3292 | 536 |
| 701 | 3300048908 | Ga0496105_0016330 | Ga0496105_0016330_1704_3500 | 536 |
| 702 | 3300048911 | Ga0496108_0050752 | Ga0496108_0050752_1235_3016 | 536 |
| 703 | 3300048915 | Ga0496112_0008758 | Ga0496112_0008758_1710_3491 | 536 |
| 704 | 3300048918 | Ga0496115_0072365 | Ga0496115_0072365_73_1854 | 536 |
| 705 | 3300005467 | Ga0070706_100012140 | Ga0070706_1000121407 | 537 |
| 706 | 3300006175 | Ga0070712_100017813 | Ga0070712_1000178131 | 537 |
| 707 | 3300025910 | Ga0207684_10005740 | Ga0207684_100057406 | 537 |
| 708 | 3300025915 | Ga0207693_10027829 | Ga0207693_100278292 | 537 |
| 709 | 3300045976 | Ga0466967_0004137 | Ga0466967_0004137_5685_7493 | 537 |
| 710 | 3300049588 | Ga0501072_0011031 | Ga0501072_0011031_842_2548 | 537 |
| 711 | 3300005329 | Ga0070683_100004234 | Ga0070683_10000423411 | 538 |
| 712 | 3300005616 | Ga0068852_100110271 | Ga0068852_1001102712 | 538 |
| 713 | 3300006173 | Ga0070716_100046609 | Ga0070716_1000466092 | 538 |
| 714 | 3300006175 | Ga0070712_100055682 | Ga0070712_1000556822 | 538 |
| 715 | 3300009094 | Ga0111539_10019426 | Ga0111539_100194267 | 538 |
| 716 | 3300025939 | Ga0207665_10004021 | Ga0207665_1000402110 | 538 |
| 717 | iso_pu_bacteria | 8054472261 | 8054474548 | 538 |
| 718 | 3300005327 | Ga0070658_10149849 | Ga0070658_101498492 | 539 |
| 719 | 3300005336 | Ga0070680_100005054 | Ga0070680_1000050543 | 539 |
| 720 | 3300005336 | Ga0070680_100080356 | Ga0070680_1000803562 | 539 |
| 721 | 3300005340 | Ga0070689_100004510 | Ga0070689_1000045102 | 539 |
| 722 | 3300005435 | Ga0070714_100007815 | Ga0070714_1000078158 | 539 |
| 723 | 3300005435 | Ga0070714_100046678 | Ga0070714_1000466782 | 539 |
| 724 | 3300005458 | Ga0070681_10026083 | Ga0070681_100260832 | 539 |
| 725 | 3300005459 | Ga0068867_100044464 | Ga0068867_1000444642 | 539 |
| 726 | 3300005530 | Ga0070679_100033742 | Ga0070679_1000337426 | 539 |
| 727 | 3300005535 | Ga0070684_100000622 | Ga0070684_1000006226 | 539 |
| 728 | 3300005577 | Ga0068857_100005707 | Ga0068857_1000057077 | 539 |
| 729 | 3300005614 | Ga0068856_100136322 | Ga0068856_1001363222 | 539 |
| 730 | 3300005615 | Ga0070702_100059838 | Ga0070702_1000598381 | 539 |
| 731 | 3300005616 | Ga0068852_100005875 | Ga0068852_1000058758 | 539 |
| 732 | 3300006881 | Ga0068865_100066120 | Ga0068865_1000661202 | 539 |
| 733 | 3300009101 | Ga0105247_10039178 | Ga0105247_100391782 | 539 |
| 734 | 3300009553 | Ga0105249_10036681 | Ga0105249_100366812 | 539 |
| 735 | 3300009553 | Ga0105249_10046632 | Ga0105249_100466322 | 539 |
| 736 | 3300010375 | Ga0105239_10081713 | Ga0105239_100817133 | 539 |
| 737 | 3300011119 | Ga0105246_10038000 | Ga0105246_100380002 | 539 |
| 738 | 3300013105 | Ga0157369_10001889 | Ga0157369_1000188916 | 539 |
| 739 | 3300013307 | Ga0157372_10209447 | Ga0157372_102094471 | 539 |
| 740 | 3300014745 | Ga0157377_10014394 | Ga0157377_100143944 | 539 |
| 741 | 3300020082 | Ga0206353_11878011 | Ga0206353_118780118 | 539 |
| 742 | 3300025917 | Ga0207660_10043409 | Ga0207660_100434092 | 539 |
| 743 | 3300025921 | Ga0207652_10016208 | Ga0207652_100162085 | 539 |
| 744 | 3300025928 | Ga0207700_10004656 | Ga0207700_100046566 | 539 |
| 745 | 3300025929 | Ga0207664_10026630 | Ga0207664_100266302 | 539 |
| 746 | 3300025944 | Ga0207661_10006624 | Ga0207661_100066242 | 539 |
| 747 | 3300025944 | Ga0207661_10065827 | Ga0207661_100658272 | 539 |
| 748 | 3300025945 | Ga0207679_10060091 | Ga0207679_100600912 | 539 |
| 749 | 3300026041 | Ga0207639_10057038 | Ga0207639_100570382 | 539 |
| 750 | 3300026075 | Ga0207708_10032889 | Ga0207708_100328892 | 539 |
| 751 | 3300026089 | Ga0207648_10017309 | Ga0207648_100173093 | 539 |
| 752 | 3300026116 | Ga0207674_10000093 | Ga0207674_1000009314 | 539 |
| 753 | 3300041512 | Ga0451853_2073262 | Ga0451853_2073262_1536_3224 | 539 |
| 754 | 3300046462 | Ga0495651_0003513 | Ga0495651_0003513_392_2116 | 539 |
| 755 | 3300046516 | Ga0495628_0013221 | Ga0495628_0013221_3779_5503 | 539 |
| 756 | 3300046529 | Ga0495652_0000679 | Ga0495652_0000679_432_2156 | 539 |
| 757 | 3300048905 | Ga0496102_0079312 | Ga0496102_0079312_98_1786 | 539 |
| 758 | 3300048907 | Ga0496104_0019218 | Ga0496104_0019218_3082_4851 | 539 |
| 759 | 3300048911 | Ga0496108_0030880 | Ga0496108_0030880_599_2368 | 539 |
| 760 | 3300048915 | Ga0496112_0010866 | Ga0496112_0010866_5101_6870 | 539 |
| 761 | 3300048916 | Ga0496113_0050528 | Ga0496113_0050528_389_2158 | 539 |
| 762 | 3300009148 | Ga0105243_10094380 | Ga0105243_100943802 | 540 |
| 763 | 3300025972 | Ga0207668_10017830 | Ga0207668_100178302 | 540 |
| 764 | 3300035695 | Ga0373927_0016122 | Ga0373927_0016122_2397_4241 | 540 |
| 765 | 3300042005 | Ga0439448_0008553 | Ga0439448_0008553_1066_2856 | 540 |
| 766 | 3300046559 | Ga0495667_0002937 | Ga0495667_0002937_9190_10920 | 540 |
| 767 | 3300046642 | Ga0495634_0031861 | Ga0495634_0031861_695_2425 | 540 |
| 768 | 3300047321 | Ga0495676_0020754 | Ga0495676_0020754_201_1952 | 540 |
| 769 | 3300047322 | Ga0495680_0006733 | Ga0495680_0006733_3927_5657 | 540 |
| 770 | 3300048905 | Ga0496102_0082024 | Ga0496102_0082024_700_2409 | 540 |
| 771 | 3300048917 | Ga0496114_0030283 | Ga0496114_0030283_2298_4007 | 540 |
| 772 | 3300049568 | Ga0501031_0006295 | Ga0501031_0006295_5147_6904 | 540 |
| 773 | 3300049573 | Ga0501037_0072555 | Ga0501037_0072555_206_1963 | 540 |
| 774 | 3300049575 | Ga0501039_0049987 | Ga0501039_0049987_674_2431 | 540 |
| 775 | 3300049576 | Ga0501040_0005371 | Ga0501040_0005371_528_2285 | 540 |
| 776 | 3300049576 | Ga0501040_0009161 | Ga0501040_0009161_638_2395 | 540 |
| 777 | 3300049577 | Ga0501041_0039901 | Ga0501041_0039901_235_1992 | 540 |
| 778 | 3300049577 | Ga0501041_0056794 | Ga0501041_0056794_248_1960 | 540 |
| 779 | 3300049578 | Ga0501042_0002049 | Ga0501042_0002049_1122_2879 | 540 |
| 780 | 3300049580 | Ga0501046_0024415 | Ga0501046_0024415_248_1960 | 540 |
| 781 | 3300049582 | Ga0501048_0045918 | Ga0501048_0045918_930_2687 | 540 |
| 782 | 3300049587 | Ga0501071_0024018 | Ga0501071_0024018_864_2621 | 540 |
| 783 | 3300049588 | Ga0501072_0067248 | Ga0501072_0067248_586_2343 | 540 |
| 784 | 3300049589 | Ga0501073_0058246 | Ga0501073_0058246_630_2387 | 540 |
| 785 | 3300049590 | Ga0501074_0042949 | Ga0501074_0042949_804_2561 | 540 |
| 786 | 3300049592 | Ga0501076_0018257 | Ga0501076_0018257_2467_4224 | 540 |
| 787 | 3300049592 | Ga0501076_0038716 | Ga0501076_0038716_865_2622 | 540 |
| 788 | 3300049593 | Ga0501077_0051458 | Ga0501077_0051458_342_2054 | 540 |
| 789 | 3300049741 | Ga0501079_0021008 | Ga0501079_0021008_2715_4427 | 540 |
| 790 | 3300049741 | Ga0501079_0043254 | Ga0501079_0043254_905_2662 | 540 |
| 791 | 3300049822 | Ga0501035_0015257 | Ga0501035_0015257_308_2020 | 540 |
| 792 | 3300049823 | Ga0501044_0007168 | Ga0501044_0007168_7147_8859 | 540 |
| 793 | 3300060353 | Ga0501082_0009312 | Ga0501082_0009312_759_2516 | 540 |
| 794 | iso_pu_bacteria | 2786546132 | 2786674696 | 540 |
| 795 | iso_pu_bacteria | 2877676314 | 2877677624 | 540 |
| 796 | iso_pu_bacteria | 2954673503 | 2954680706 | 540 |
| 797 | iso_pu_bacteria | 2954682443 | 2954683447 | 540 |
| 798 | iso_pu_bacteria | 3002998708 | 3002999400 | 540 |
| 799 | 3300036401 | Ga0373937_0096125 | Ga0373937_0096125_877_2628 | 541 |
| 800 | 3300046462 | Ga0495651_0001498 | Ga0495651_0001498_4485_6272 | 541 |
| 801 | 3300046463 | Ga0495653_0036173 | Ga0495653_0036173_193_1980 | 541 |
| 802 | 3300046516 | Ga0495628_0052056 | Ga0495628_0052056_251_2038 | 541 |
| 803 | 3300046516 | Ga0495628_0094001 | Ga0495628_0094001_292_2043 | 541 |
| 804 | 3300046529 | Ga0495652_0009984 | Ga0495652_0009984_1056_2843 | 541 |
| 805 | 3300046663 | Ga0495635_0009283 | Ga0495635_0009283_4052_5824 | 541 |
| 806 | 3300046675 | Ga0495657_0003888 | Ga0495657_0003888_766_2553 | 541 |
| 807 | 3300046809 | Ga0495600_0017470 | Ga0495600_0017470_1456_3228 | 541 |
| 808 | 3300046809 | Ga0495600_0023354 | Ga0495600_0023354_1034_2821 | 541 |
| 809 | 3300047317 | Ga0495604_0046959 | Ga0495604_0046959_284_2071 | 541 |
| 810 | 3300047322 | Ga0495680_0002287 | Ga0495680_0002287_1402_3189 | 541 |
| 811 | 3300047322 | Ga0495680_0006516 | Ga0495680_0006516_3032_4804 | 541 |
| 812 | 3300049572 | Ga0501036_0106033 | Ga0501036_0106033_259_2058 | 541 |
| 813 | 3300049574 | Ga0501038_0000732 | Ga0501038_0000732_777_2573 | 541 |
| 814 | iso_pu_bacteria | 2863404153 | 2863409549 | 541 |
| 815 | 3300031995 | Ga0307409_100027270 | Ga0307409_1000272703 | 543 |
| 816 | 3300032002 | Ga0307416_100005109 | Ga0307416_1000051096 | 543 |
| 817 | 3300032005 | Ga0307411_10016550 | Ga0307411_100165503 | 543 |
| 818 | 3300032126 | Ga0307415_100037871 | Ga0307415_1000378712 | 543 |
| 819 | iso_pu_bacteria | 2643221678 | 2644438961 | 543 |
| 820 | iso_pu_bacteria | 2808606359 | 2808847489 | 543 |
| 821 | iso_pu_bacteria | 2818991462 | 2819691367 | 543 |
| 822 | iso_pu_bacteria | 2818991469 | 2819729263 | 543 |
| 823 | iso_pu_bacteria | 2862382967 | 2862387072 | 543 |
| 824 | iso_pu_bacteria | 2862507626 | 2862510038 | 543 |
| 825 | iso_pu_bacteria | 2919468124 | 2919475622 | 543 |
| 826 | iso_pu_bacteria | 8008558824 | 8008565007 | 543 |
| 827 | 3300002075 | JGI24738J21930_10002594 | JGI24738J21930_100025943 | 544 |
| 828 | 3300002077 | JGI24744J21845_10000361 | JGI24744J21845_100003612 | 544 |
| 829 | 3300005329 | Ga0070683_100040738 | Ga0070683_1000407383 | 544 |
| 830 | 3300005345 | Ga0070692_10001374 | Ga0070692_100013743 | 544 |
| 831 | 3300005364 | Ga0070673_100024595 | Ga0070673_1000245952 | 544 |
| 832 | 3300005438 | Ga0070701_10005335 | Ga0070701_100053355 | 544 |
| 833 | 3300005441 | Ga0070700_100012601 | Ga0070700_1000126013 | 544 |
| 834 | 3300005459 | Ga0068867_100021874 | Ga0068867_1000218743 | 544 |
| 835 | 3300005535 | Ga0070684_100022148 | Ga0070684_1000221483 | 544 |
| 836 | 3300005543 | Ga0070672_100039743 | Ga0070672_1000397432 | 544 |
| 837 | 3300005615 | Ga0070702_100009743 | Ga0070702_1000097433 | 544 |
| 838 | 3300005616 | Ga0068852_100009233 | Ga0068852_1000092336 | 544 |
| 839 | 3300005719 | Ga0068861_100002408 | Ga0068861_1000024088 | 544 |
| 840 | 3300006038 | Ga0075365_10013836 | Ga0075365_100138362 | 544 |
| 841 | 3300006881 | Ga0068865_100003709 | Ga0068865_1000037097 | 544 |
| 842 | 3300009098 | Ga0105245_10011825 | Ga0105245_100118255 | 544 |
| 843 | 3300009148 | Ga0105243_10009903 | Ga0105243_100099033 | 544 |
| 844 | 3300009177 | Ga0105248_10067072 | Ga0105248_100670723 | 544 |
| 845 | 3300013307 | Ga0157372_10129147 | Ga0157372_101291472 | 544 |
| 846 | 3300014326 | Ga0157380_10038542 | Ga0157380_100385422 | 544 |
| 847 | 3300025908 | Ga0207643_10007735 | Ga0207643_100077351 | 544 |
| 848 | 3300025935 | Ga0207709_10008686 | Ga0207709_100086863 | 544 |
| 849 | 3300025940 | Ga0207691_10013198 | Ga0207691_100131983 | 544 |
| 850 | 3300025960 | Ga0207651_10121339 | Ga0207651_101213391 | 544 |
| 851 | 3300026041 | Ga0207639_10057387 | Ga0207639_100573872 | 544 |
| 852 | 3300026075 | Ga0207708_10000985 | Ga0207708_1000098516 | 544 |
| 853 | 3300026089 | Ga0207648_10001308 | Ga0207648_1000130828 | 544 |
| 854 | 3300026142 | Ga0207698_10046821 | Ga0207698_100468212 | 544 |
| 855 | 3300032002 | Ga0307416_100114158 | Ga0307416_1001141583 | 544 |
| 856 | 3300046689 | Ga0495613_0091729 | Ga0495613_0091729_319_2058 | 544 |
| 857 | 3300047322 | Ga0495680_0027766 | Ga0495680_0027766_1009_2748 | 544 |
| 858 | 3300047471 | Ga0495684_0050461 | Ga0495684_0050461_1274_3013 | 544 |
| 859 | 3300048911 | Ga0496108_0082633 | Ga0496108_0082633_496_2247 | 544 |
| 860 | 3300048912 | Ga0496109_0102338 | Ga0496109_0102338_909_2612 | 544 |
| 861 | 3300049570 | Ga0501033_0013928 | Ga0501033_0013928_3439_5211 | 544 |
| 862 | 3300049572 | Ga0501036_0000582 | Ga0501036_0000582_12990_14762 | 544 |
| 863 | 3300049575 | Ga0501039_0000391 | Ga0501039_0000391_16283_18055 | 544 |
| 864 | 3300049576 | Ga0501040_0000516 | Ga0501040_0000516_18321_20093 | 544 |
| 865 | 3300049577 | Ga0501041_0004140 | Ga0501041_0004140_6400_8172 | 544 |
| 866 | 3300049578 | Ga0501042_0003403 | Ga0501042_0003403_7492_9264 | 544 |
| 867 | 3300049579 | Ga0501043_0001992 | Ga0501043_0001992_2678_4450 | 544 |
| 868 | 3300049580 | Ga0501046_0001108 | Ga0501046_0001108_3323_5095 | 544 |
| 869 | 3300049582 | Ga0501048_0000495 | Ga0501048_0000495_8856_10628 | 544 |
| 870 | 3300049587 | Ga0501071_0000731 | Ga0501071_0000731_4428_6200 | 544 |
| 871 | 3300049588 | Ga0501072_0001629 | Ga0501072_0001629_12060_13832 | 544 |
| 872 | 3300049588 | Ga0501072_0055103 | Ga0501072_0055103_639_2384 | 544 |
| 873 | 3300049590 | Ga0501074_0000958 | Ga0501074_0000958_8712_10484 | 544 |
| 874 | 3300049591 | Ga0501075_0000672 | Ga0501075_0000672_4676_6448 | 544 |
| 875 | 3300049593 | Ga0501077_0002810 | Ga0501077_0002810_5351_7123 | 544 |
| 876 | 3300049741 | Ga0501079_0000214 | Ga0501079_0000214_13757_15529 | 544 |
| 877 | 3300049742 | Ga0501080_0124125 | Ga0501080_0124125_170_1942 | 544 |
| 878 | 3300049743 | Ga0501081_0000596 | Ga0501081_0000596_13757_15529 | 544 |
| 879 | 3300049824 | Ga0501045_0000417 | Ga0501045_0000417_13734_15506 | 544 |
| 880 | 3300050511 | nmdc:mga08y16_33820_c1 | nmdc:mga08y16_33820_c1_1353_3104 | 544 |
| 881 | 3300060353 | Ga0501082_0004602 | Ga0501082_0004602_7079_8851 | 544 |
| 882 | iso_pu_bacteria | 2558860280 | 2559432459 | 544 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ezb-assembly2.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9099 | 395 | 525 |
| 7v73-assembly1.cif.gz_A | thermostabilized human prestin in complex with chloride | 0.8865 | 2 | 531 |
| 7lhv-assembly1.cif.gz_B | structure of arabidopsis thaliana sulfate transporter atsultr4;1 | 0.8862 | 2 | 526 |
| 8opq-assembly1.cif.gz_A | structure of human solute carrier 26 family member a6 (slc26a6) anion transporter in an inward-facing state | 0.8832 | 2 | 530 |
| 7s9d-assembly1.cif.gz_B | cryo-em structure of dolphin prestin: intermediate state | 0.8814 | 7 | 531 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGF7_437_560_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9451 | 409 | 528 | 3.30.750.24 |
| af_Q942E2_508_653_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9224 | 394 | 526 | 3.30.750.24 |
| af_Q94LW6_488_626_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9189 | 394 | 528 | 3.30.750.24 |
| af_I1KA21_504_648_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9182 | 394 | 528 | 3.30.750.24 |
| af_Q10QI4_508_648_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9154 | 393 | 529 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U1BMN8-F1-model_v4 | deleted | 0.9522 | 1 | 532 |
|
| AF-A0A521THE0-F1-model_v4 | Sulfate permease | 0.9491 | 1 | 529 |
GO:0008509
GO:0016020 GO:0098661 |
| AF-A0A2V5KGL9-F1-model_v4 | Sodium-independent anion transporter | 0.9446 | 2 | 358 |
GO:0016020
GO:0055085 |
| AF-A0A495K0Q3-F1-model_v4 | High affinity sulfate transporter 1 | 0.9399 | 1 | 531 |
GO:0008509
GO:0016020 GO:0098661 |
| AF-A0A656TQD3-F1-model_v4 | deleted | 0.9373 | 2 | 345 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar