F484569

General Info

Members Datasets Scaffolds Average Seq Length
882 326 865 555

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221678|2644438961
Length 604
Sequence RLRAVPGIRAVSTYRREWLVKDLVAGVVLTTLLVPQGMAYAELAGLPAITGLYTSILCLLGYAVCGPSRVLVLGPDSSLGPMIAATVLPLVVADGDPDRAVALASVLALMVAAVMILASVAKLGFIADLISKPTMIGYMNGLALTILIGQLPKLLGFKVEADNLIGECAGLVRKLADGAAVPAAATVGGCGIVLILVLQRLLPKIPAVLVMVVLAIAATAVFDLGAHGVDLVGELPEGFPPFTVPDVRLADLAPLFGGALGIALVSLADTISNASAFAARSGQEVRGNQEMAGVGAANLAAGLFQGFPVSASGSRTAVAERAGARSQLTGVVGAALIVLMLVLVPGLFRDLPQPALAAVVITASLSLADIPGAVRLWRQRRAEFLLCLAAFVGVALLGVLPGIAVAVALSVLNVFRRAWWPYNTVLGRVQDLEGYHDVRSYPQARQLPGLVIHRFDAPLIFANAKAFRDEIRRLADVDPRPTWIVIAAEPITDVDTTAADVLQELDENLNAQGVHLVFAELKDPVRRKIERYELTRTIDPRHFFPTVEAAVDAFRLRTGAEWAPRRPPPDIAPPPADTAPPPLDIASPPPADDGHHDGAEDRTT

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
3 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
4 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
5 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
6 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
7 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
8 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
9 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
10 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
11 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
12 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
13 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
14 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
15 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
214 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
215 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
325 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
326 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 0.23
Isolates 1.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0.23
Rhizoplane 9.52
Rhizosphere 88.1
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10002594 3300002075 Bacteria 4675
2 JGI24738J21930_10007244 3300002075 Bacteria 2570
3 JGI24744J21845_10000361 3300002077 Bacteria 7757
4 JGI25406J46586_10001317 3300003203 Bacteria 11674
5 Ga0070658_10149849 3300005327 Bacteria 1952
6 Ga0070683_100004234 3300005329 Bacteria 11763
7 Ga0070683_100012321 3300005329 Bacteria 7428
8 Ga0070683_100039924 3300005329 Bacteria 4312
9 Ga0070683_100040738 3300005329 Bacteria 4271
10 Ga0070683_100060608 3300005329 Bacteria 3517
11 Ga0070683_100129725 3300005329 Bacteria 2385
12 Ga0070683_100177975 3300005329 Bacteria 2019
13 Ga0070670_100011377 3300005331 Bacteria 7608
14 Ga0068869_100000672 3300005334 Bacteria 19319
15 Ga0068869_100035330 3300005334 Bacteria 3541
16 Ga0070680_100000135 3300005336 Bacteria 44656
17 Ga0070680_100005054 3300005336 Bacteria 9949
18 Ga0070680_100030659 3300005336 Bacteria 4321
19 Ga0070680_100061964 3300005336 Bacteria 3062
20 Ga0070680_100080356 3300005336 Unclassified 2688
21 Ga0070682_100001129 3300005337 Bacteria 15254
22 Ga0070682_100006989 3300005337 Bacteria 6347
23 Ga0070682_100021497 3300005337 Bacteria 3808
24 Ga0068868_100007548 3300005338 Bacteria 7747
25 Ga0068868_100034361 3300005338 Bacteria 3914
26 Ga0068868_100105593 3300005338 Bacteria 2284
27 Ga0068868_100117303 3300005338 Bacteria 2168
28 Ga0070660_100009909 3300005339 Bacteria 6721
29 Ga0070689_100004510 3300005340 Bacteria 9430
30 Ga0070689_100102416 3300005340 Bacteria 2268
31 Ga0070687_100021220 3300005343 Bacteria 3049
32 Ga0070661_100101541 3300005344 Bacteria 2140
33 Ga0070692_10001374 3300005345 Bacteria 8788
34 Ga0070692_10005242 3300005345 Bacteria 5500
35 Ga0070671_100005326 3300005355 Bacteria 10264
36 Ga0070671_100012639 3300005355 Bacteria 6803
37 Ga0070674_100005664 3300005356 Bacteria 7238
38 Ga0070673_100024595 3300005364 Bacteria 4420
39 Ga0070659_100013914 3300005366 Bacteria 6004
40 Ga0070659_100049618 3300005366 Bacteria 3301
41 Ga0070659_100049664 3300005366 Bacteria 3299
42 Ga0070709_10005337 3300005434 Bacteria 6960
43 Ga0070709_10022372 3300005434 Bacteria 3696
44 Ga0070714_100000974 3300005435 Bacteria 20448
45 Ga0070714_100002168 3300005435 Bacteria 14424
46 Ga0070714_100002616 3300005435 Bacteria 13269
47 Ga0070714_100007815 3300005435 Bacteria 8332
48 Ga0070714_100013040 3300005435 Bacteria 6650
49 Ga0070714_100017478 3300005435 Bacteria 5809
50 Ga0070714_100046678 3300005435 Unclassified 3676
51 Ga0070714_100068894 3300005435 Bacteria 3054
52 Ga0070714_100101202 3300005435 Bacteria 2539
53 Ga0070713_100003754 3300005436 Bacteria 10050
54 Ga0070713_100023202 3300005436 Bacteria 4811
55 Ga0070713_100029057 3300005436 Bacteria 4372
56 Ga0070713_100041203 3300005436 Bacteria 3761
57 Ga0070713_100061707 3300005436 Bacteria 3137
58 Ga0070713_100085957 3300005436 Bacteria 2695
59 Ga0070710_10007083 3300005437 Bacteria 5414
60 Ga0070710_10020055 3300005437 Bacteria 3464
61 Ga0070710_10032808 3300005437 Bacteria 2815
62 Ga0070701_10005335 3300005438 Bacteria 5296
63 Ga0070701_10013604 3300005438 Bacteria 3707
64 Ga0070701_10023749 3300005438 Bacteria 2958
65 Ga0070711_100007610 3300005439 Bacteria 6594
66 Ga0070711_100020370 3300005439 Bacteria 4274
67 Ga0070711_100042360 3300005439 Bacteria 3077
68 Ga0070711_100071560 3300005439 Bacteria 2444
69 Ga0070700_100004148 3300005441 Bacteria 7557
70 Ga0070700_100007174 3300005441 Bacteria 6002
71 Ga0070700_100012601 3300005441 Bacteria 4725
72 Ga0070700_100021607 3300005441 Bacteria 3742
73 Ga0070694_100006385 3300005444 Bacteria 7152
74 Ga0070663_100029447 3300005455 Bacteria 3753
75 Ga0070663_100029835 3300005455 Bacteria 3731
76 Ga0070678_100003700 3300005456 Bacteria 8557
77 Ga0070662_100017767 3300005457 Bacteria 4799
78 Ga0070681_10000020 3300005458 Bacteria 123918
79 Ga0070681_10026083 3300005458 Bacteria 5876
80 Ga0070681_10032436 3300005458 Bacteria 5242
81 Ga0070681_10036883 3300005458 Bacteria 4907
82 Ga0070681_10055574 3300005458 Bacteria 3941
83 Ga0068867_100019015 3300005459 Bacteria 4891
84 Ga0068867_100021874 3300005459 Bacteria 4566
85 Ga0068867_100044464 3300005459 Bacteria 3254
86 Ga0070685_10002662 3300005466 Bacteria 9150
87 Ga0070706_100004208 3300005467 Bacteria 13977
88 Ga0070706_100012140 3300005467 Bacteria 7990
89 Ga0070707_100012396 3300005468 Bacteria 7960
90 Ga0070707_100080485 3300005468 Unclassified 3144
91 Ga0070698_100104833 3300005471 Bacteria 2797
92 Ga0070699_100002823 3300005518 Bacteria 15504
93 Ga0070679_100000044 3300005530 Bacteria 94029
94 Ga0070679_100033742 3300005530 Bacteria 5068
95 Ga0070679_100037668 3300005530 Bacteria 4805
96 Ga0070679_100085799 3300005530 Bacteria 3135
97 Ga0070679_100102225 3300005530 Bacteria 2852
98 Ga0070679_100167816 3300005530 Bacteria 2168
99 Ga0070684_100000622 3300005535 Bacteria 24475
100 Ga0070684_100020042 3300005535 Bacteria 5544
101 Ga0070684_100022148 3300005535 Bacteria 5296
102 Ga0070684_100037755 3300005535 Bacteria 4146
103 Ga0070684_100049238 3300005535 Bacteria 3657
104 Ga0070684_100055477 3300005535 Bacteria 3454
105 Ga0070697_100005200 3300005536 Bacteria 9996
106 Ga0070672_100039743 3300005543 Bacteria 3605
107 Ga0070672_100072106 3300005543 Bacteria 2750
108 Ga0070672_100120348 3300005543 Bacteria 2148
109 Ga0070686_100122995 3300005544 Bacteria 1784
110 Ga0070693_100010163 3300005547 Bacteria 4704
111 Ga0070693_100060028 3300005547 Bacteria 2206
112 Ga0070665_100012542 3300005548 Bacteria 8537
113 Ga0070665_100042412 3300005548 Bacteria 4573
114 Ga0070665_100062706 3300005548 Bacteria 3727
115 Ga0070665_100126293 3300005548 Bacteria 2560
116 Ga0068855_100002117 3300005563 Bacteria 24552
117 Ga0068855_100005045 3300005563 Bacteria 16111
118 Ga0068855_100181217 3300005563 Bacteria 2381
119 Ga0070664_100034953 3300005564 Bacteria 4217
120 Ga0070664_100054431 3300005564 Bacteria 3394
121 Ga0068857_100005707 3300005577 Bacteria 10644
122 Ga0068857_100022308 3300005577 Bacteria 5570
123 Ga0068857_100140635 3300005577 Bacteria 2181
124 Ga0068854_100002147 3300005578 Bacteria 12110
125 Ga0068856_100006035 3300005614 Bacteria 11916
126 Ga0068856_100013804 3300005614 Bacteria 7809
127 Ga0068856_100076180 3300005614 Bacteria 3323
128 Ga0068856_100136322 3300005614 Bacteria 2460
129 Ga0070702_100005662 3300005615 Bacteria 5848
130 Ga0070702_100009743 3300005615 Bacteria 4711
131 Ga0070702_100059838 3300005615 Bacteria 2212
132 Ga0070702_100092737 3300005615 Bacteria 1835
133 Ga0068852_100005875 3300005616 Bacteria 8820
134 Ga0068852_100009233 3300005616 Bacteria 7306
135 Ga0068852_100037992 3300005616 Bacteria 4043
136 Ga0068852_100084755 3300005616 Bacteria 2821
137 Ga0068852_100110271 3300005616 Bacteria 2500
138 Ga0068859_100046929 3300005617 Bacteria 4338
139 Ga0068859_100082194 3300005617 Bacteria 3264
140 Ga0068864_100003975 3300005618 Bacteria 12171
141 Ga0068866_10025248 3300005718 Bacteria 2791
142 Ga0068861_100002408 3300005719 Bacteria 12180
143 Ga0068851_10012207 3300005834 Bacteria 4045
144 Ga0068851_10020541 3300005834 Bacteria 3199
145 Ga0068870_10003481 3300005840 Bacteria 6675
146 Ga0068863_100006471 3300005841 Bacteria 11485
147 Ga0068863_100081257 3300005841 Bacteria 3070
148 Ga0068858_100068777 3300005842 Bacteria 3282
149 Ga0068860_100045967 3300005843 Bacteria 4164
150 Ga0081455_10000123 3300005937 Bacteria 89254
151 Ga0081455_10001506 3300005937 Bacteria 28768
152 Ga0081539_10000919 3300005985 Bacteria 55491
153 Ga0070717_10011176 3300006028 Bacteria 6805
154 Ga0070717_10013777 3300006028 Bacteria 6205
155 Ga0070717_10025313 3300006028 Bacteria 4718
156 Ga0070717_10041275 3300006028 Bacteria 3762
157 Ga0070717_10047747 3300006028 Bacteria 3509
158 Ga0070717_10084741 3300006028 Bacteria 2666
159 Ga0075365_10013836 3300006038 Bacteria 4840
160 Ga0075368_10006845 3300006042 Bacteria 4005
161 Ga0075363_100025841 3300006048 Bacteria 2999
162 Ga0070715_10001284 3300006163 Bacteria 7195
163 Ga0070716_100004409 3300006173 Bacteria 6728
164 Ga0070716_100012672 3300006173 Bacteria 4279
165 Ga0070716_100046609 3300006173 Bacteria 2440
166 Ga0070716_100074208 3300006173 Bacteria 2009
167 Ga0070712_100012909 3300006175 Bacteria 5322
168 Ga0070712_100017813 3300006175 Bacteria 4601
169 Ga0070712_100031738 3300006175 Bacteria 3561
170 Ga0070712_100042643 3300006175 Bacteria 3121
171 Ga0070712_100046323 3300006175 Bacteria 3006
172 Ga0070712_100055682 3300006175 Bacteria 2770
173 Ga0097621_100007462 3300006237 Bacteria 7822
174 Ga0097621_100117148 3300006237 Bacteria 2256
175 Ga0068871_100009216 3300006358 Bacteria 7139
176 Ga0068871_100075614 3300006358 Bacteria 2781
177 Ga0075428_100134410 3300006844 Bacteria 2689
178 Ga0075428_100167834 3300006844 Bacteria 2380
179 Ga0075431_100025422 3300006847 Bacteria 6069
180 Ga0075431_100085037 3300006847 Bacteria 3265
181 Ga0075431_100097074 3300006847 Bacteria 3042
182 Ga0075433_10011613 3300006852 Bacteria 7095
183 Ga0075433_10024336 3300006852 Bacteria 5108
184 Ga0075433_10025055 3300006852 Bacteria 5042
185 Ga0075433_10038978 3300006852 Bacteria 4106
186 Ga0075433_10105672 3300006852 Bacteria 2495
187 Ga0075434_100012332 3300006871 Bacteria 8098
188 Ga0075434_100026109 3300006871 Bacteria 5721
189 Ga0075434_100084553 3300006871 Bacteria 3172
190 Ga0075434_100119422 3300006871 Bacteria 2650
191 Ga0075434_100180303 3300006871 Bacteria 2132
192 Ga0075429_100047159 3300006880 Bacteria 3749
193 Ga0075429_100082607 3300006880 Bacteria 2800
194 Ga0068865_100003709 3300006881 Bacteria 9176
195 Ga0068865_100031231 3300006881 Bacteria 3551
196 Ga0068865_100066120 3300006881 Bacteria 2550
197 Ga0075436_100010143 3300006914 Bacteria 6450
198 Ga0075436_100017185 3300006914 Bacteria 4951
199 Ga0075436_100049588 3300006914 Bacteria 2897
200 Ga0097620_100046929 3300006931 Bacteria 4338
201 Ga0097620_100082193 3300006931 Bacteria 3264
202 Ga0075435_100000523 3300007076 Bacteria 23542
203 Ga0075435_100005298 3300007076 Bacteria 8981
204 Ga0075435_100058051 3300007076 Bacteria 3133
205 Ga0105251_10016259 3300009011 Bacteria 4028
206 Ga0105240_10015709 3300009093 Bacteria 10273
207 Ga0105240_10072227 3300009093 Bacteria 4265
208 Ga0105240_10094129 3300009093 Bacteria 3655
209 Ga0105240_10114985 3300009093 Bacteria 3249
210 Ga0111539_10019426 3300009094 Bacteria 8387
211 Ga0111539_10148357 3300009094 Bacteria 2746
212 Ga0111539_10178312 3300009094 Bacteria 2482
213 Ga0111539_10234046 3300009094 Bacteria 2139
214 Ga0105245_10005589 3300009098 Bacteria 11043
215 Ga0105245_10011825 3300009098 Bacteria 7592
216 Ga0105245_10036074 3300009098 Bacteria 4390
217 Ga0105245_10125346 3300009098 Bacteria 2404
218 Ga0105247_10009645 3300009101 Bacteria 5857
219 Ga0105247_10039178 3300009101 Bacteria 2895
220 Ga0114129_10015764 3300009147 Bacteria 10745
221 Ga0114129_10040454 3300009147 Bacteria 6571
222 Ga0114129_10046739 3300009147 Bacteria 6083
223 Ga0114129_10055068 3300009147 Bacteria 5575
224 Ga0114129_10314640 3300009147 Bacteria 2083
225 Ga0105243_10002387 3300009148 Bacteria 15737
226 Ga0105243_10009903 3300009148 Bacteria 7248
227 Ga0105243_10094380 3300009148 Bacteria 2470
228 Ga0105241_10001988 3300009174 Bacteria 15474
229 Ga0105241_10005381 3300009174 Bacteria 9465
230 Ga0105241_10019360 3300009174 Bacteria 5019
231 Ga0105242_10027713 3300009176 Bacteria 4503
232 Ga0105248_10067072 3300009177 Bacteria 4029
233 Ga0105248_10068314 3300009177 Bacteria 3990
234 Ga0105237_10008550 3300009545 Bacteria 11066
235 Ga0105237_10021863 3300009545 Bacteria 6570
236 Ga0105238_10004485 3300009551 Bacteria 13832
237 Ga0105238_10013378 3300009551 Bacteria 8281
238 Ga0105238_10015810 3300009551 Bacteria 7638
239 Ga0105238_10030996 3300009551 Bacteria 5443
240 Ga0105238_10044458 3300009551 Bacteria 4489
241 Ga0105249_10008050 3300009553 Bacteria 9190
242 Ga0105249_10010209 3300009553 Bacteria 8248
243 Ga0105249_10036681 3300009553 Bacteria 4448
244 Ga0105249_10046632 3300009553 Bacteria 3945
245 Ga0105249_10055325 3300009553 Bacteria 3629
246 Ga0105239_10028892 3300010375 Bacteria 6095
247 Ga0105239_10032423 3300010375 Bacteria 5741
248 Ga0105239_10041232 3300010375 Bacteria 5059
249 Ga0105239_10054291 3300010375 Bacteria 4394
250 Ga0105239_10081713 3300010375 Bacteria 3557
251 Ga0105246_10002583 3300011119 Bacteria 10949
252 Ga0105246_10010935 3300011119 Bacteria 5626
253 Ga0105246_10017620 3300011119 Bacteria 4543
254 Ga0105246_10038000 3300011119 Bacteria 3233
255 Ga0105246_10050252 3300011119 Bacteria 2859
256 Ga0105246_10050500 3300011119 Bacteria 2853
257 Ga0157373_10047373 3300013100 Bacteria 3066
258 Ga0157369_10001889 3300013105 Bacteria 25266
259 Ga0157369_10011108 3300013105 Bacteria 10244
260 Ga0157369_10018141 3300013105 Bacteria 7893
261 Ga0157369_10157007 3300013105 Bacteria 2402
262 Ga0157369_10250643 3300013105 Bacteria 1848
263 Ga0157374_10008821 3300013296 Bacteria 8631
264 Ga0157374_10040301 3300013296 Bacteria 4301
265 Ga0157374_10094403 3300013296 Bacteria 2858
266 Ga0163162_10033665 3300013306 Bacteria 5092
267 Ga0163162_10068450 3300013306 Bacteria 3602
268 Ga0157372_10017094 3300013307 Bacteria 7786
269 Ga0157372_10077393 3300013307 Bacteria 3757
270 Ga0157372_10112101 3300013307 Bacteria 3125
271 Ga0157372_10129147 3300013307 Bacteria 2907
272 Ga0157372_10209447 3300013307 Bacteria 2259
273 Ga0157375_10030166 3300013308 Bacteria 5110
274 Ga0157375_10042902 3300013308 Bacteria 4382
275 Ga0157375_10134302 3300013308 Bacteria 2596
276 Ga0163163_10009952 3300014325 Bacteria 8526
277 Ga0163163_10061935 3300014325 Bacteria 3707
278 Ga0163163_10115834 3300014325 Bacteria 2711
279 Ga0157380_10009185 3300014326 Bacteria 7072
280 Ga0157380_10038542 3300014326 Bacteria 3712
281 Ga0182008_10025926 3300014497 Bacteria 2974
282 Ga0157377_10009848 3300014745 Bacteria 4708
283 Ga0157377_10010375 3300014745 Bacteria 4606
284 Ga0157377_10014394 3300014745 Bacteria 4025
285 Ga0157376_10017650 3300014969 Bacteria 5450
286 Ga0157376_10022075 3300014969 Bacteria 4954
287 Ga0206353_11878011 3300020082 Bacteria 5824
288 Ga0224712_10025006 3300022467 Bacteria 2094
289 Ga0224572_1002365 3300024225 Bacteria 3028
290 Ga0207656_10012516 3300025321 Bacteria 3227
291 Ga0207656_10021898 3300025321 Bacteria 2559
292 Ga0207692_10006172 3300025898 Bacteria 4853
293 Ga0207692_10042480 3300025898 Bacteria 2257
294 Ga0207642_10012998 3300025899 Bacteria 3023
295 Ga0207710_10006639 3300025900 Bacteria 4931
296 Ga0207688_10000213 3300025901 Bacteria 25981
297 Ga0207688_10002494 3300025901 Bacteria 9907
298 Ga0207688_10044282 3300025901 Bacteria 2480
299 Ga0207647_10005252 3300025904 Bacteria 9533
300 Ga0207699_10000619 3300025906 Bacteria 17260
301 Ga0207699_10001901 3300025906 Bacteria 9839
302 Ga0207699_10004489 3300025906 Bacteria 6669
303 Ga0207699_10004492 3300025906 Bacteria 6666
304 Ga0207645_10044425 3300025907 Bacteria 2843
305 Ga0207643_10000218 3300025908 Bacteria 40287
306 Ga0207643_10007267 3300025908 Bacteria 5942
307 Ga0207643_10007735 3300025908 Bacteria 5773
308 Ga0207705_10037063 3300025909 Bacteria 3489
309 Ga0207684_10001508 3300025910 Bacteria 24953
310 Ga0207684_10005740 3300025910 Bacteria 11395
311 Ga0207654_10003770 3300025911 Bacteria 7638
312 Ga0207707_10000090 3300025912 Bacteria 90918
313 Ga0207707_10007781 3300025912 Bacteria 9328
314 Ga0207707_10035007 3300025912 Bacteria 4391
315 Ga0207695_10002866 3300025913 Bacteria 25047
316 Ga0207671_10003461 3300025914 Bacteria 15716
317 Ga0207671_10035151 3300025914 Bacteria 3720
318 Ga0207693_10010102 3300025915 Bacteria 7668
319 Ga0207693_10027829 3300025915 Bacteria 4468
320 Ga0207693_10081784 3300025915 Bacteria 2529
321 Ga0207663_10035938 3300025916 Bacteria 2976
322 Ga0207663_10122751 3300025916 Bacteria 1782
323 Ga0207660_10000219 3300025917 Bacteria 36887
324 Ga0207660_10043409 3300025917 Bacteria 3160
325 Ga0207660_10059241 3300025917 Bacteria 2748
326 Ga0207662_10016436 3300025918 Bacteria 4176
327 Ga0207657_10008572 3300025919 Bacteria 10359
328 Ga0207657_10010945 3300025919 Bacteria 9024
329 Ga0207657_10013651 3300025919 Bacteria 7961
330 Ga0207657_10102038 3300025919 Bacteria 2380
331 Ga0207649_10007987 3300025920 Bacteria 5756
332 Ga0207652_10000485 3300025921 Bacteria 40829
333 Ga0207652_10016208 3300025921 Bacteria 6080
334 Ga0207646_10012024 3300025922 Bacteria 8341
335 Ga0207694_10000843 3300025924 Bacteria 27292
336 Ga0207694_10114250 3300025924 Bacteria 2150
337 Ga0207650_10009927 3300025925 Bacteria 6513
338 Ga0207687_10000842 3300025927 Bacteria 20740
339 Ga0207687_10031812 3300025927 Bacteria 3569
340 Ga0207700_10004656 3300025928 Bacteria 8128
341 Ga0207700_10008259 3300025928 Bacteria 6434
342 Ga0207700_10011992 3300025928 Bacteria 5562
343 Ga0207700_10024576 3300025928 Bacteria 4172
344 Ga0207700_10025233 3300025928 Bacteria 4125
345 Ga0207700_10035520 3300025928 Bacteria 3591
346 Ga0207700_10048897 3300025928 Bacteria 3143
347 Ga0207700_10058256 3300025928 Bacteria 2917
348 Ga0207700_10066774 3300025928 Bacteria 2750
349 Ga0207700_10072356 3300025928 Bacteria 2658
350 Ga0207664_10003669 3300025929 Bacteria 10285
351 Ga0207664_10003919 3300025929 Bacteria 10001
352 Ga0207664_10004524 3300025929 Bacteria 9421
353 Ga0207664_10010352 3300025929 Bacteria 6586
354 Ga0207664_10017382 3300025929 Bacteria 5271
355 Ga0207664_10025480 3300025929 Bacteria 4457
356 Ga0207664_10026630 3300025929 Unclassified 4373
357 Ga0207664_10039346 3300025929 Bacteria 3672
358 Ga0207644_10008003 3300025931 Bacteria 6912
359 Ga0207644_10012375 3300025931 Bacteria 5664
360 Ga0207690_10004202 3300025932 Bacteria 8512
361 Ga0207690_10090184 3300025932 Bacteria 2163
362 Ga0207706_10076573 3300025933 Bacteria 2942
363 Ga0207706_10106804 3300025933 Bacteria 2464
364 Ga0207709_10008686 3300025935 Bacteria 5606
365 Ga0207709_10029106 3300025935 Bacteria 3200
366 Ga0207670_10097738 3300025936 Bacteria 2091
367 Ga0207669_10105408 3300025937 Bacteria 1875
368 Ga0207704_10056512 3300025938 Bacteria 2405
369 Ga0207665_10000412 3300025939 Bacteria 29458
370 Ga0207665_10004021 3300025939 Bacteria 9817
371 Ga0207665_10008637 3300025939 Bacteria 6707
372 Ga0207665_10023651 3300025939 Bacteria 4047
373 Ga0207691_10013198 3300025940 Bacteria 7910
374 Ga0207691_10022500 3300025940 Bacteria 5944
375 Ga0207691_10107485 3300025940 Bacteria 2483
376 Ga0207689_10002593 3300025942 Bacteria 16723
377 Ga0207689_10029825 3300025942 Bacteria 4549
378 Ga0207661_10002657 3300025944 Bacteria 12298
379 Ga0207661_10006624 3300025944 Bacteria 8184
380 Ga0207661_10044306 3300025944 Bacteria 3516
381 Ga0207661_10065827 3300025944 Bacteria 2942
382 Ga0207661_10088523 3300025944 Bacteria 2574
383 Ga0207661_10133799 3300025944 Bacteria 2127
384 Ga0207679_10010995 3300025945 Bacteria 5841
385 Ga0207679_10060091 3300025945 Bacteria 2823
386 Ga0207679_10106384 3300025945 Bacteria 2205
387 Ga0207667_10004602 3300025949 Bacteria 16924
388 Ga0207667_10015537 3300025949 Bacteria 8640
389 Ga0207651_10118895 3300025960 Bacteria 2000
390 Ga0207651_10121339 3300025960 Bacteria 1983
391 Ga0207668_10017830 3300025972 Bacteria 4456
392 Ga0207640_10004012 3300025981 Bacteria 7953
393 Ga0207677_10004443 3300026023 Bacteria 7531
394 Ga0207677_10029647 3300026023 Bacteria 3481
395 Ga0207677_10062601 3300026023 Bacteria 2582
396 Ga0207677_10081446 3300026023 Bacteria 2323
397 Ga0207703_10123776 3300026035 Bacteria 2223
398 Ga0207639_10057038 3300026041 Bacteria 2997
399 Ga0207639_10057387 3300026041 Bacteria 2989
400 Ga0207678_10011871 3300026067 Bacteria 7650
401 Ga0207678_10078529 3300026067 Bacteria 2827
402 Ga0207678_10096187 3300026067 Bacteria 2531
403 Ga0207708_10000985 3300026075 Bacteria 21291
404 Ga0207708_10002530 3300026075 Bacteria 13445
405 Ga0207708_10006019 3300026075 Bacteria 8991
406 Ga0207708_10032889 3300026075 Bacteria 3938
407 Ga0207708_10033380 3300026075 Bacteria 3910
408 Ga0207708_10045044 3300026075 Bacteria 3362
409 Ga0207708_10071096 3300026075 Bacteria 2665
410 Ga0207702_10002437 3300026078 Bacteria 17646
411 Ga0207702_10009971 3300026078 Bacteria 7965
412 Ga0207702_10114614 3300026078 Bacteria 2402
413 Ga0207648_10001308 3300026089 Bacteria 27722
414 Ga0207648_10004509 3300026089 Bacteria 14281
415 Ga0207648_10017309 3300026089 Bacteria 6564
416 Ga0207648_10029778 3300026089 Bacteria 4841
417 Ga0207676_10003391 3300026095 Bacteria 11254
418 Ga0207676_10016826 3300026095 Bacteria 5295
419 Ga0207676_10033378 3300026095 Bacteria 3888
420 Ga0207674_10000093 3300026116 Bacteria 99440
421 Ga0207674_10014208 3300026116 Bacteria 8796
422 Ga0207674_10017738 3300026116 Bacteria 7758
423 Ga0207674_10084964 3300026116 Bacteria 3162
424 Ga0207674_10107503 3300026116 Bacteria 2767
425 Ga0207675_100003463 3300026118 Bacteria 15427
426 Ga0207683_10000454 3300026121 Bacteria 38017
427 Ga0207683_10009054 3300026121 Bacteria 8485
428 Ga0207683_10106699 3300026121 Bacteria 2505
429 Ga0207683_10154855 3300026121 Bacteria 2070
430 Ga0207698_10004756 3300026142 Bacteria 8308
431 Ga0207698_10046821 3300026142 Bacteria 3270
432 Ga0207428_10115835 3300027907 Bacteria 2059
433 Ga0207428_10133363 3300027907 Bacteria 1900
434 Ga0268266_10054809 3300028379 Bacteria 3427
435 Ga0268266_10094610 3300028379 Bacteria 2623
436 Ga0268265_10108993 3300028380 Bacteria 2256
437 Ga0268265_10122970 3300028380 Bacteria 2142
438 Ga0268264_10039541 3300028381 Bacteria 3897
439 Ga0307513_10019341 3300031456 Bacteria 8110
440 Ga0307406_10076400 3300031901 Bacteria 2212
441 Ga0307409_100027270 3300031995 Bacteria 4045
442 Ga0307416_100005109 3300032002 Bacteria 8010
443 Ga0307416_100090392 3300032002 Bacteria 2625
444 Ga0307416_100114158 3300032002 Bacteria 2389
445 Ga0307411_10016550 3300032005 Bacteria 4176
446 Ga0307415_100037871 3300032126 Bacteria 3173
447 Ga0373926_0001583 3300035083 Bacteria 6997
448 Ga0373934_0001615 3300035086 Bacteria 8273
449 Ga0373944_0001827 3300035089 Bacteria 5376
450 Ga0373936_0003892 3300035113 Bacteria 5626
451 Ga0373945_0000591 3300035116 Bacteria 10415
452 Ga0373953_0009920 3300035117 Bacteria 3298
453 Ga0373954_0042125 3300035118 Bacteria 2129
454 Ga0373956_0001004 3300035119 Bacteria 11642
455 Ga0373957_0008506 3300035120 Bacteria 3327
456 Ga0373957_0019408 3300035120 Bacteria 2392
457 Ga0373943_0001628 3300035170 Bacteria 10184
458 Ga0373955_0000005 3300035172 Bacteria 108267
459 Ga0373924_0008586 3300035410 Bacteria 3719
460 Ga0373927_0016122 3300035695 Bacteria 4930
461 Ga0373927_0019496 3300035695 Bacteria 4447
462 Ga0373933_0000043 3300035724 Bacteria 78147
463 Ga0373933_0022557 3300035724 Bacteria 3586
464 Ga0373933_0039045 3300035724 Bacteria 2792
465 Ga0373933_0049229 3300035724 Bacteria 2512
466 Ga0373933_0081560 3300035724 Bacteria 1984
467 Ga0373947_0004411 3300035725 Bacteria 8254
468 Ga0373947_0019417 3300035725 Bacteria 3918
469 Ga0373937_0000245 3300036401 Bacteria 53041
470 Ga0373937_0003783 3300036401 Bacteria 12795
471 Ga0373937_0040151 3300036401 Bacteria 4265
472 Ga0373937_0063250 3300036401 Bacteria 3403
473 Ga0373937_0063513 3300036401 Bacteria 3396
474 Ga0373937_0084052 3300036401 Bacteria 2944
475 Ga0373937_0096125 3300036401 Bacteria 2747
476 Ga0373937_0179693 3300036401 Bacteria 1987
477 Ga0373925_0000028 3300037068 Bacteria 149654
478 Ga0373925_0001494 3300037068 Bacteria 20080
479 Ga0373925_0001915 3300037068 Bacteria 17236
480 Ga0373925_0007560 3300037068 Bacteria 7917
481 Ga0373925_0109962 3300037068 Bacteria 2128
482 Ga0395900_0143787 3300037418 Bacteria 2441
483 Ga0395898_0179084 3300037466 Bacteria 2026
484 Ga0395905_0059024 3300037471 Bacteria 3587
485 Ga0451853_0174584 3300041512 Bacteria 2421
486 Ga0451853_2073262 3300041512 Bacteria 3827
487 Ga0439448_0007867 3300042005 Bacteria 3101
488 Ga0439448_0008553 3300042005 Bacteria 3000
489 Ga0439463_002716 3300042016 Bacteria 4473
490 Ga0450902_007704 3300042137 Bacteria 1671
491 Ga0439458_0008012 3300042157 Bacteria 2350
492 Ga0439458_0008711 3300042157 Bacteria 2263
493 Ga0439460_0018107 3300042461 Bacteria 1893
494 Ga0466963_0001267 3300044694 Bacteria 13391
495 Ga0466970_0012932 3300044765 Bacteria 4275
496 Ga0466959_0070396 3300045049 Bacteria 2534
497 Ga0466967_0004137 3300045976 Bacteria 9701
498 Ga0466967_0007021 3300045976 Bacteria 8065
499 Ga0466967_0101822 3300045976 Bacteria 2626
500 Ga0495592_0000092 3300046454 Bacteria 79147
501 Ga0495592_0011277 3300046454 Bacteria 6759
502 Ga0495592_0033973 3300046454 Bacteria 3846
503 Ga0495592_0097787 3300046454 Bacteria 2096
504 Ga0495629_0001088 3300046459 Bacteria 21535
505 Ga0495629_0001429 3300046459 Bacteria 18830
506 Ga0495629_0014399 3300046459 Bacteria 5689
507 Ga0495641_0001952 3300046461 Bacteria 16770
508 Ga0495641_0022859 3300046461 Bacteria 3119
509 Ga0495651_0000066 3300046462 Bacteria 77538
510 Ga0495651_0001498 3300046462 Bacteria 18071
511 Ga0495651_0003513 3300046462 Bacteria 12018
512 Ga0495651_0010231 3300046462 Bacteria 7200
513 Ga0495651_0011712 3300046462 Bacteria 6738
514 Ga0495651_0018918 3300046462 Bacteria 5337
515 Ga0495651_0019855 3300046462 Bacteria 5211
516 Ga0495651_0058460 3300046462 Bacteria 2958
517 Ga0495653_0002166 3300046463 Bacteria 15515
518 Ga0495653_0003794 3300046463 Bacteria 12221
519 Ga0495653_0004422 3300046463 Bacteria 11360
520 Ga0495653_0008124 3300046463 Bacteria 8594
521 Ga0495653_0012547 3300046463 Bacteria 6920
522 Ga0495653_0036173 3300046463 Bacteria 3891
523 Ga0495653_0099119 3300046463 Bacteria 2115
524 Ga0495580_0015030 3300046472 Bacteria 5858
525 Ga0495582_0000078 3300046473 Bacteria 49080
526 Ga0495582_0000338 3300046473 Bacteria 25659
527 Ga0495582_0001399 3300046473 Bacteria 13590
528 Ga0495582_0002910 3300046473 Bacteria 9572
529 Ga0495639_0003784 3300046475 Bacteria 6499
530 Ga0495639_0030093 3300046475 Bacteria 2412
531 Ga0495662_0008850 3300046476 Bacteria 4944
532 Ga0495662_0012129 3300046476 Bacteria 4210
533 Ga0495594_0017675 3300046499 Bacteria 3770
534 Ga0495594_0032192 3300046499 Bacteria 2845
535 Ga0495608_0000070 3300046511 Bacteria 77533
536 Ga0495608_0007499 3300046511 Bacteria 7702
537 Ga0495608_0043756 3300046511 Bacteria 2991
538 Ga0495608_0044263 3300046511 Bacteria 2971
539 Ga0495608_0065762 3300046511 Bacteria 2374
540 Ga0495618_0034995 3300046514 Bacteria 3151
541 Ga0495618_0073762 3300046514 Bacteria 2173
542 Ga0495618_0091766 3300046514 Bacteria 1942
543 Ga0495628_0000624 3300046516 Bacteria 32362
544 Ga0495628_0003918 3300046516 Bacteria 13261
545 Ga0495628_0013221 3300046516 Bacteria 6941
546 Ga0495628_0021322 3300046516 Bacteria 5332
547 Ga0495628_0027893 3300046516 Bacteria 4590
548 Ga0495628_0052056 3300046516 Bacteria 3235
549 Ga0495628_0094001 3300046516 Bacteria 2318
550 Ga0495628_0112248 3300046516 Bacteria 2095
551 Ga0495630_0018348 3300046517 Bacteria 5139
552 Ga0495630_0027780 3300046517 Bacteria 4201
553 Ga0495652_0000679 3300046529 Bacteria 39396
554 Ga0495652_0000769 3300046529 Bacteria 36908
555 Ga0495652_0009984 3300046529 Bacteria 8603
556 Ga0495652_0013266 3300046529 Bacteria 7418
557 Ga0495652_0016891 3300046529 Bacteria 6522
558 Ga0495652_0051756 3300046529 Bacteria 3505
559 Ga0495652_0090925 3300046529 Bacteria 2496
560 Ga0495665_0001371 3300046531 Bacteria 13031
561 Ga0495665_0006507 3300046531 Bacteria 6308
562 Ga0495665_0011482 3300046531 Bacteria 4795
563 Ga0495665_0021638 3300046531 Bacteria 3457
564 Ga0495640_0013066 3300046533 Bacteria 6324
565 Ga0495640_0023414 3300046533 Bacteria 4499
566 Ga0495640_0034424 3300046533 Bacteria 3591
567 Ga0495640_0047829 3300046533 Bacteria 2958
568 Ga0495587_0000077 3300046536 Bacteria 77532
569 Ga0495587_0004198 3300046536 Bacteria 9537
570 Ga0495587_0014003 3300046536 Bacteria 5036
571 Ga0495587_0056171 3300046536 Bacteria 2316
572 Ga0495587_0068029 3300046536 Bacteria 2075
573 Ga0495621_0000572 3300046539 Bacteria 9176
574 Ga0495645_0064304 3300046543 Bacteria 2655
575 Ga0495645_0078985 3300046543 Bacteria 2364
576 Ga0495645_0084253 3300046543 Bacteria 2276
577 Ga0495667_0000071 3300046559 Bacteria 77538
578 Ga0495667_0002937 3300046559 Bacteria 11443
579 Ga0495667_0005115 3300046559 Bacteria 8860
580 Ga0495667_0006824 3300046559 Bacteria 7750
581 Ga0495667_0013560 3300046559 Bacteria 5513
582 Ga0495667_0030210 3300046559 Bacteria 3643
583 Ga0495667_0036047 3300046559 Bacteria 3304
584 Ga0495667_0048750 3300046559 Bacteria 2796
585 Ga0495634_0011952 3300046642 Bacteria 6298
586 Ga0495634_0019468 3300046642 Bacteria 4823
587 Ga0495634_0031304 3300046642 Bacteria 3665
588 Ga0495634_0031861 3300046642 Bacteria 3629
589 Ga0495634_0074759 3300046642 Bacteria 2226
590 Ga0495635_0009283 3300046663 Bacteria 6871
591 Ga0495635_0012304 3300046663 Bacteria 5995
592 Ga0495635_0017230 3300046663 Bacteria 5046
593 Ga0495635_0018757 3300046663 Bacteria 4827
594 Ga0495635_0023243 3300046663 Bacteria 4321
595 Ga0495588_0004695 3300046674 Bacteria 6035
596 Ga0495588_0022616 3300046674 Bacteria 3108
597 Ga0495657_0000095 3300046675 Bacteria 77538
598 Ga0495657_0003888 3300046675 Bacteria 12027
599 Ga0495657_0005793 3300046675 Bacteria 9734
600 Ga0495657_0008653 3300046675 Bacteria 7765
601 Ga0495599_0000155 3300046678 Bacteria 45015
602 Ga0495599_0007643 3300046678 Bacteria 6565
603 Ga0495599_0086353 3300046678 Bacteria 1959
604 Ga0495599_0104857 3300046678 Bacteria 1761
605 Ga0495623_0001673 3300046679 Bacteria 14902
606 Ga0495623_0015929 3300046679 Bacteria 4860
607 Ga0495623_0019635 3300046679 Bacteria 4368
608 Ga0495646_0009024 3300046680 Bacteria 6324
609 Ga0495646_0032465 3300046680 Bacteria 3249
610 Ga0495647_0014609 3300046681 Bacteria 2738
611 Ga0495647_0015267 3300046681 Bacteria 2688
612 Ga0495658_0000236 3300046683 Bacteria 31770
613 Ga0495658_0000726 3300046683 Bacteria 17778
614 Ga0495658_0008286 3300046683 Bacteria 5149
615 Ga0495613_0000207 3300046689 Bacteria 58099
616 Ga0495613_0004518 3300046689 Bacteria 10433
617 Ga0495613_0018030 3300046689 Bacteria 5261
618 Ga0495613_0091729 3300046689 Bacteria 2200
619 Ga0495624_0002604 3300046690 Bacteria 13611
620 Ga0495624_0020231 3300046690 Bacteria 4433
621 Ga0495624_0025322 3300046690 Bacteria 3896
622 Ga0495600_0001750 3300046809 Bacteria 12137
623 Ga0495600_0013426 3300046809 Bacteria 5147
624 Ga0495600_0017470 3300046809 Bacteria 4564
625 Ga0495600_0023354 3300046809 Bacteria 3978
626 Ga0495600_0025724 3300046809 Bacteria 3793
627 Ga0495600_0037480 3300046809 Bacteria 3152
628 Ga0495600_0044659 3300046809 Bacteria 2890
629 Ga0495581_0001112 3300047315 Bacteria 14690
630 Ga0495581_0001409 3300047315 Bacteria 13320
631 Ga0495581_0011427 3300047315 Bacteria 5139
632 Ga0495581_0037896 3300047315 Bacteria 2790
633 Ga0495604_0000087 3300047317 Bacteria 79147
634 Ga0495604_0001649 3300047317 Bacteria 18351
635 Ga0495604_0046959 3300047317 Bacteria 3365
636 Ga0495604_0052269 3300047317 Bacteria 3165
637 Ga0495674_0010613 3300047319 Bacteria 8716
638 Ga0495674_0040756 3300047319 Bacteria 4151
639 Ga0495674_0060103 3300047319 Bacteria 3317
640 Ga0495674_0074405 3300047319 Bacteria 2925
641 Ga0495674_0077342 3300047319 Bacteria 2861
642 Ga0495676_0011573 3300047321 Bacteria 7959
643 Ga0495676_0020754 3300047321 Bacteria 5756
644 Ga0495676_0083124 3300047321 Bacteria 2421
645 Ga0495680_0002287 3300047322 Bacteria 19719
646 Ga0495680_0003033 3300047322 Bacteria 16753
647 Ga0495680_0006516 3300047322 Bacteria 10836
648 Ga0495680_0006570 3300047322 Bacteria 10790
649 Ga0495680_0006733 3300047322 Bacteria 10627
650 Ga0495680_0012893 3300047322 Bacteria 7324
651 Ga0495680_0020012 3300047322 Bacteria 5640
652 Ga0495680_0027766 3300047322 Bacteria 4645
653 Ga0495680_0039139 3300047322 Bacteria 3784
654 Ga0495680_0055223 3300047322 Bacteria 3081
655 Ga0495680_0086991 3300047322 Bacteria 2351
656 Ga0495680_0126468 3300047322 Bacteria 1882
657 Ga0495675_0000157 3300047444 Bacteria 48143
658 Ga0495675_0001850 3300047444 Bacteria 12615
659 Ga0495675_0003497 3300047444 Bacteria 9465
660 Ga0495675_0009503 3300047444 Bacteria 6056
661 Ga0495675_0033710 3300047444 Bacteria 3268
662 Ga0495684_0003809 3300047471 Bacteria 11754
663 Ga0495684_0018295 3300047471 Bacteria 5400
664 Ga0495684_0050461 3300047471 Bacteria 3177
665 Ga0495684_0056981 3300047471 Bacteria 2978
666 Ga0495684_0058330 3300047471 Bacteria 2941
667 Ga0495684_0059009 3300047471 Bacteria 2922
668 Ga0495593_0011846 3300047673 Bacteria 5000
669 Ga0495593_0057053 3300047673 Bacteria 2051
670 Ga0495602_0000461 3300048088 Bacteria 37751
671 Ga0495602_0017632 3300048088 Bacteria 7154
672 Ga0496101_0002239 3300048904 Bacteria 11828
673 Ga0496101_0002703 3300048904 Bacteria 10880
674 Ga0496102_0006157 3300048905 Bacteria 10227
675 Ga0496102_0006613 3300048905 Bacteria 9906
676 Ga0496102_0013799 3300048905 Bacteria 7009
677 Ga0496102_0020367 3300048905 Bacteria 5862
678 Ga0496102_0079312 3300048905 Bacteria 3024
679 Ga0496102_0082024 3300048905 Bacteria 2974
680 Ga0496102_0107632 3300048905 Bacteria 2596
681 Ga0496103_0002293 3300048906 Bacteria 12088
682 Ga0496103_0053099 3300048906 Bacteria 2511
683 Ga0496103_0088633 3300048906 Bacteria 1951
684 Ga0496104_0012420 3300048907 Bacteria 7657
685 Ga0496104_0017300 3300048907 Bacteria 6562
686 Ga0496104_0019218 3300048907 Bacteria 6247
687 Ga0496104_0071383 3300048907 Bacteria 3301
688 Ga0496104_0071625 3300048907 Bacteria 3295
689 Ga0496104_0110864 3300048907 Bacteria 2631
690 Ga0496104_0205506 3300048907 Unclassified 1881
691 Ga0496105_0000756 3300048908 Bacteria 21951
692 Ga0496105_0002305 3300048908 Bacteria 13849
693 Ga0496105_0016330 3300048908 Bacteria 5925
694 Ga0496105_0060205 3300048908 Bacteria 3133
695 Ga0496105_0072332 3300048908 Bacteria 2850
696 Ga0496105_0085683 3300048908 Bacteria 2603
697 Ga0496105_0103220 3300048908 Bacteria 2354
698 Ga0496106_0003648 3300048909 Bacteria 11477
699 Ga0496106_0019313 3300048909 Bacteria 5053
700 Ga0496107_0005385 3300048910 Bacteria 8755
701 Ga0496107_0009138 3300048910 Bacteria 6870
702 Ga0496107_0051083 3300048910 Bacteria 2981
703 Ga0496108_0000337 3300048911 Bacteria 39725
704 Ga0496108_0012789 3300048911 Bacteria 6834
705 Ga0496108_0015456 3300048911 Bacteria 6226
706 Ga0496108_0030880 3300048911 Bacteria 4440
707 Ga0496108_0034247 3300048911 Bacteria 4219
708 Ga0496108_0038524 3300048911 Bacteria 3982
709 Ga0496108_0050752 3300048911 Bacteria 3474
710 Ga0496108_0065856 3300048911 Bacteria 3054
711 Ga0496108_0082633 3300048911 Bacteria 2724
712 Ga0496108_0082690 3300048911 Bacteria 2723
713 Ga0496108_0088572 3300048911 Bacteria 2630
714 Ga0496108_0089272 3300048911 Bacteria 2619
715 Ga0496109_0004142 3300048912 Bacteria 12111
716 Ga0496109_0005796 3300048912 Bacteria 10341
717 Ga0496109_0027124 3300048912 Bacteria 5112
718 Ga0496109_0035131 3300048912 Bacteria 4519
719 Ga0496109_0054063 3300048912 Bacteria 3664
720 Ga0496109_0058506 3300048912 Bacteria 3520
721 Ga0496109_0081171 3300048912 Bacteria 2988
722 Ga0496109_0095421 3300048912 Bacteria 2754
723 Ga0496109_0102338 3300048912 Bacteria 2658
724 Ga0496109_0108886 3300048912 Bacteria 2575
725 Ga0496110_0000249 3300048913 Bacteria 34963
726 Ga0496110_0021412 3300048913 Bacteria 5474
727 Ga0496110_0036269 3300048913 Bacteria 4281
728 Ga0496110_0038608 3300048913 Bacteria 4156
729 Ga0496110_0048234 3300048913 Bacteria 3733
730 Ga0496110_0070893 3300048913 Bacteria 3089
731 Ga0496110_0075476 3300048913 Bacteria 2995
732 Ga0496110_0099095 3300048913 Bacteria 2613
733 Ga0496110_0107222 3300048913 Bacteria 2507
734 Ga0496111_0003049 3300048914 Bacteria 10281
735 Ga0496111_0022383 3300048914 Bacteria 4424
736 Ga0496111_0071066 3300048914 Bacteria 2533
737 Ga0496111_0094521 3300048914 Bacteria 2192
738 Ga0496112_0000620 3300048915 Bacteria 24573
739 Ga0496112_0002834 3300048915 Bacteria 14076
740 Ga0496112_0008758 3300048915 Bacteria 9077
741 Ga0496112_0010866 3300048915 Bacteria 8285
742 Ga0496112_0016419 3300048915 Bacteria 6935
743 Ga0496112_0115326 3300048915 Bacteria 2657
744 Ga0496113_0050528 3300048916 Bacteria 3100
745 Ga0496113_0080845 3300048916 Bacteria 2490
746 Ga0496114_0020614 3300048917 Bacteria 5351
747 Ga0496114_0024825 3300048917 Bacteria 4893
748 Ga0496114_0030283 3300048917 Bacteria 4453
749 Ga0496114_0056320 3300048917 Bacteria 3281
750 Ga0496114_0100339 3300048917 Bacteria 2470
751 Ga0496114_0204919 3300048917 Bacteria 1729
752 Ga0496115_0004134 3300048918 Bacteria 10475
753 Ga0496115_0008063 3300048918 Bacteria 7778
754 Ga0496115_0029753 3300048918 Bacteria 4292
755 Ga0496115_0072365 3300048918 Bacteria 2797
756 Ga0496121_0002166 3300048924 Bacteria 30741
757 Ga0496126_0019805 3300048929 Bacteria 6618
758 Ga0496126_0174840 3300048929 Bacteria 1827
759 Ga0501031_0006295 3300049568 Bacteria 7737
760 Ga0501031_0027487 3300049568 Bacteria 3709
761 Ga0501031_0032255 3300049568 Bacteria 3415
762 Ga0501032_0002022 3300049569 Bacteria 15992
763 Ga0501033_0011445 3300049570 Bacteria 6789
764 Ga0501033_0013928 3300049570 Bacteria 6120
765 Ga0501034_0004204 3300049571 Bacteria 16074
766 Ga0501034_0062091 3300049571 Bacteria 3752
767 Ga0501036_0000582 3300049572 Bacteria 26379
768 Ga0501036_0106033 3300049572 Bacteria 2377
769 Ga0501037_0021309 3300049573 Bacteria 4788
770 Ga0501037_0072555 3300049573 Bacteria 2503
771 Ga0501038_0000732 3300049574 Bacteria 29297
772 Ga0501038_0038074 3300049574 Bacteria 4212
773 Ga0501039_0000391 3300049575 Bacteria 31522
774 Ga0501039_0049987 3300049575 Bacteria 3233
775 Ga0501040_0000516 3300049576 Bacteria 23123
776 Ga0501040_0005371 3300049576 Bacteria 8286
777 Ga0501040_0009161 3300049576 Bacteria 6446
778 Ga0501040_0021756 3300049576 Bacteria 4287
779 Ga0501041_0004140 3300049577 Bacteria 8392
780 Ga0501041_0039901 3300049577 Bacteria 2848
781 Ga0501041_0056794 3300049577 Bacteria 2392
782 Ga0501042_0002049 3300049578 Bacteria 12219
783 Ga0501042_0003403 3300049578 Bacteria 9986
784 Ga0501043_0001992 3300049579 Bacteria 17433
785 Ga0501046_0001108 3300049580 Bacteria 26300
786 Ga0501046_0024415 3300049580 Bacteria 4959
787 Ga0501048_0000495 3300049582 Bacteria 27512
788 Ga0501048_0045452 3300049582 Bacteria 3136
789 Ga0501048_0045918 3300049582 Bacteria 3118
790 Ga0501067_0026266 3300049583 Bacteria 3226
791 Ga0501068_0001135 3300049584 Bacteria 14099
792 Ga0501069_0048019 3300049585 Bacteria 2370
793 Ga0501069_0048322 3300049585 Bacteria 2362
794 Ga0501070_0002476 3300049586 Bacteria 16188
795 Ga0501071_0000731 3300049587 Bacteria 17342
796 Ga0501071_0024018 3300049587 Bacteria 4261
797 Ga0501072_0001629 3300049588 Bacteria 16799
798 Ga0501072_0011031 3300049588 Bacteria 6896
799 Ga0501072_0030265 3300049588 Bacteria 4233
800 Ga0501072_0055103 3300049588 Bacteria 3134
801 Ga0501072_0067248 3300049588 Bacteria 2827
802 Ga0501073_0043786 3300049589 Bacteria 3156
803 Ga0501073_0058246 3300049589 Bacteria 2700
804 Ga0501074_0000958 3300049590 Bacteria 18660
805 Ga0501074_0014082 3300049590 Bacteria 5814
806 Ga0501074_0042949 3300049590 Bacteria 3271
807 Ga0501075_0000672 3300049591 Bacteria 21090
808 Ga0501076_0018257 3300049592 Bacteria 5344
809 Ga0501076_0038716 3300049592 Bacteria 3743
810 Ga0501077_0002810 3300049593 Bacteria 10443
811 Ga0501077_0051458 3300049593 Bacteria 2617
812 Ga0501079_0000214 3300049741 Bacteria 34037
813 Ga0501079_0021008 3300049741 Bacteria 4990
814 Ga0501079_0043254 3300049741 Bacteria 3476
815 Ga0501080_0005478 3300049742 Bacteria 11329
816 Ga0501080_0124125 3300049742 Bacteria 2391
817 Ga0501081_0000596 3300049743 Bacteria 20599
818 Ga0501081_0010424 3300049743 Bacteria 6060
819 Ga0501035_0015257 3300049822 Bacteria 7090
820 Ga0501044_0007168 3300049823 Bacteria 12263
821 Ga0501045_0000417 3300049824 Bacteria 25889
822 Ga0501045_0007946 3300049824 Bacteria 7387
823 nmdc:mga05p37_156892_c1 3300050507 Bacteria 2781
824 nmdc:mga05p37_205530_c1 3300050507 Bacteria 2382
825 nmdc:mga05p37_388566_c1 3300050507 Bacteria 1633
826 nmdc:mga05p37_7880_c1 3300050507 Bacteria 12571
827 nmdc:mga05p37_89312_c1 3300050507 Bacteria 3797
828 nmdc:mga0qj67_228307_c1 3300050509 Bacteria 1511
829 nmdc:mga08y16_183109_c1 3300050511 Bacteria 2174
830 nmdc:mga08y16_33820_c1 3300050511 Bacteria 5369
831 nmdc:mga08y16_33936_c1 3300050511 Bacteria 5361
832 nmdc:mga08y16_56814_c1 3300050511 Bacteria 4090
833 nmdc:mga0n895_10525_c1 3300050512 Bacteria 8180
834 nmdc:mga0n895_198239_c1 3300050512 Bacteria 2039
835 nmdc:mga0n895_2126_c1 3300050512 Bacteria 15301
836 nmdc:mga0n895_43378_c1 3300050512 Bacteria 4383
837 nmdc:mga0n895_47645_c1 3300050512 Bacteria 4191
838 nmdc:mga0n895_825_c1 3300050512 Bacteria 22195
839 nmdc:mga0rr50_41015_c1 3300050513 Bacteria 3369
840 nmdc:mga0rr50_7773_c1 3300050513 Bacteria 6644
841 nmdc:mga0rr50_95517_c1 3300050513 Bacteria 2324
842 nmdc:mga08x19_7539_c1 3300050514 Bacteria 6466
843 nmdc:mga08x19_9178_c1 3300050514 Bacteria 5903
844 nmdc:mga0a205_13608_c1 3300050515 Bacteria 7579
845 nmdc:mga0a205_192441_c1 3300050515 Bacteria 1931
846 nmdc:mga0a205_24936_c1 3300050515 Bacteria 5692
847 nmdc:mga0a205_37118_c1 3300050515 Bacteria 4685
848 nmdc:mga0a205_44872_c1 3300050515 Bacteria 4263
849 nmdc:mga0a205_6248_c1 3300050515 Bacteria 10753
850 Ga0495601_0002354 3300053077 Bacteria 10702
851 Ga0495601_0044793 3300053077 Bacteria 2781
852 Ga0495612_0017888 3300053078 Bacteria 2837
853 Ga0495612_0024350 3300053078 Bacteria 2429
854 Ga0495595_0002737 3300053084 Bacteria 6916
855 Ga0495619_0021469 3300053085 Bacteria 4122
856 Ga0495619_0026491 3300053085 Bacteria 3730
857 Ga0495619_0027064 3300053085 Bacteria 3693
858 Ga0495619_0035391 3300053085 Bacteria 3247
859 Ga0500616_0001517 3300053153 Bacteria 21901
860 Ga0500616_0004633 3300053153 Bacteria 9704
861 Ga0501082_0004602 3300060353 Bacteria 12045
862 Ga0501082_0009312 3300060353 Bacteria 8465
863 Ga0501082_0079914 3300060353 Bacteria 2822
864 Ga0530510_0020513 3300061734 Bacteria 4698
865 Ga0530510_0030155 3300061734 Bacteria 3895

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10250643 Ga0157369_102506432 406
2 3300035724 Ga0373933_0049229 Ga0373933_0049229_978_2498 415
3 3300050515 nmdc:mga0a205_192441_c1 nmdc:mga0a205_192441_c1_366_1886 427
4 3300046678 Ga0495599_0104857 Ga0495599_0104857_53_1576 430
5 3300047322 Ga0495680_0126468 Ga0495680_0126468_369_1859 433
6 3300025940 Ga0207691_10107485 Ga0207691_101074852 436
7 3300042137 Ga0450902_007704 Ga0450902_007704_39_1643 439
8 3300005338 Ga0068868_100105593 Ga0068868_1001055932 445
9 3300037068 Ga0373925_0109962 Ga0373925_0109962_76_1767 448
10 3300050507 nmdc:mga05p37_388566_c1 nmdc:mga05p37_388566_c1_135_1604 449
11 3300050509 nmdc:mga0qj67_228307_c1 nmdc:mga0qj67_228307_c1_29_1498 449
12 3300048912 Ga0496109_0095421 Ga0496109_0095421_64_1770 450
13 3300048915 Ga0496112_0002834 Ga0496112_0002834_12575_14062 452
14 3300046663 Ga0495635_0017230 Ga0495635_0017230_691_2208 455
15 3300046511 Ga0495608_0044263 Ga0495608_0044263_19_1479 458
16 3300005337 Ga0070682_100021497 Ga0070682_1000214971 459
17 3300005356 Ga0070674_100005664 Ga0070674_1000056649 459
18 3300005441 Ga0070700_100004148 Ga0070700_1000041481 459
19 3300005615 Ga0070702_100092737 Ga0070702_1000927371 459
20 3300011119 Ga0105246_10050500 Ga0105246_100505002 459
21 3300014745 Ga0157377_10010375 Ga0157377_100103752 459
22 3300025937 Ga0207669_10105408 Ga0207669_101054082 459
23 3300025944 Ga0207661_10044306 Ga0207661_100443062 459
24 3300026023 Ga0207677_10081446 Ga0207677_100814461 459
25 3300046514 Ga0495618_0073762 Ga0495618_0073762_20_1711 459
26 3300002075 JGI24738J21930_10007244 JGI24738J21930_100072441 461
27 3300009553 Ga0105249_10008050 Ga0105249_100080506 461
28 3300025908 Ga0207643_10007267 Ga0207643_100072674 461
29 3300026075 Ga0207708_10002530 Ga0207708_1000253010 461
30 3300026089 Ga0207648_10004509 Ga0207648_1000450911 461
31 3300047315 Ga0495581_0037896 Ga0495581_0037896_1297_2778 463
32 3300006852 Ga0075433_10038978 Ga0075433_100389781 466
33 3300006914 Ga0075436_100049588 Ga0075436_1000495882 466
34 3300050515 nmdc:mga0a205_13608_c1 nmdc:mga0a205_13608_c1_2432_4171 466
35 3300049568 Ga0501031_0027487 Ga0501031_0027487_11_1522 467
36 3300053153 Ga0500616_0001517 Ga0500616_0001517_12200_13888 468
37 3300025933 Ga0207706_10106804 Ga0207706_101068042 469
38 3300037466 Ga0395898_0179084 Ga0395898_0179084_411_2015 471
39 3300042461 Ga0439460_0018107 Ga0439460_0018107_202_1839 472
40 3300046663 Ga0495635_0018757 Ga0495635_0018757_876_2498 472
41 3300005329 Ga0070683_100012321 Ga0070683_1000123212 475
42 3300005438 Ga0070701_10013604 Ga0070701_100136043 475
43 3300014326 Ga0157380_10009185 Ga0157380_100091858 475
44 3300025918 Ga0207662_10016436 Ga0207662_100164362 475
45 3300048911 Ga0496108_0065856 Ga0496108_0065856_998_2674 475
46 3300005343 Ga0070687_100021220 Ga0070687_1000212202 477
47 3300005459 Ga0068867_100019015 Ga0068867_1000190153 477
48 3300005535 Ga0070684_100055477 Ga0070684_1000554772 477
49 3300005543 Ga0070672_100072106 Ga0070672_1000721061 477
50 3300005718 Ga0068866_10025248 Ga0068866_100252483 477
51 3300009098 Ga0105245_10125346 Ga0105245_101253462 477
52 3300009148 Ga0105243_10002387 Ga0105243_100023872 477
53 3300025899 Ga0207642_10012998 Ga0207642_100129982 477
54 3300025940 Ga0207691_10022500 Ga0207691_100225003 477
55 3300026118 Ga0207675_100003463 Ga0207675_1000034636 477
56 3300035113 Ga0373936_0003892 Ga0373936_0003892_487_2250 477
57 3300037068 Ga0373925_0000028 Ga0373925_0000028_143019_144845 481
58 3300005455 Ga0070663_100029447 Ga0070663_1000294472 482
59 3300005458 Ga0070681_10036883 Ga0070681_100368835 482
60 3300005564 Ga0070664_100054431 Ga0070664_1000544312 482
61 3300009011 Ga0105251_10016259 Ga0105251_100162593 482
62 3300013100 Ga0157373_10047373 Ga0157373_100473731 482
63 3300022467 Ga0224712_10025006 Ga0224712_100250062 482
64 3300025906 Ga0207699_10004489 Ga0207699_100044896 482
65 3300025919 Ga0207657_10010945 Ga0207657_100109457 482
66 3300025928 Ga0207700_10025233 Ga0207700_100252331 482
67 3300025929 Ga0207664_10039346 Ga0207664_100393462 482
68 3300026116 Ga0207674_10017738 Ga0207674_100177382 482
69 3300026121 Ga0207683_10009054 Ga0207683_100090543 482
70 3300028380 Ga0268265_10122970 Ga0268265_101229702 482
71 3300036401 Ga0373937_0003783 Ga0373937_0003783_5512_7113 482
72 3300046462 Ga0495651_0019855 Ga0495651_0019855_2893_4494 482
73 3300046463 Ga0495653_0099119 Ga0495653_0099119_185_1786 482
74 3300046529 Ga0495652_0051756 Ga0495652_0051756_1473_3074 482
75 3300046559 Ga0495667_0005115 Ga0495667_0005115_6949_8550 482
76 3300046675 Ga0495657_0005793 Ga0495657_0005793_2543_4144 482
77 3300046679 Ga0495623_0015929 Ga0495623_0015929_377_1978 482
78 3300046809 Ga0495600_0037480 Ga0495600_0037480_891_2492 482
79 3300047444 Ga0495675_0033710 Ga0495675_0033710_1135_2736 482
80 3300048907 Ga0496104_0017300 Ga0496104_0017300_4421_6181 482
81 3300048908 Ga0496105_0103220 Ga0496105_0103220_247_2007 482
82 3300048913 Ga0496110_0107222 Ga0496110_0107222_195_1955 482
83 3300048917 Ga0496114_0100339 Ga0496114_0100339_445_2205 482
84 3300048914 Ga0496111_0094521 Ga0496111_0094521_107_1768 483
85 3300006852 Ga0075433_10105672 Ga0075433_101056722 484
86 3300006871 Ga0075434_100084553 Ga0075434_1000845532 484
87 3300009094 Ga0111539_10178312 Ga0111539_101783121 484
88 3300050507 nmdc:mga05p37_205530_c1 nmdc:mga05p37_205530_c1_346_2037 484
89 3300050511 nmdc:mga08y16_56814_c1 nmdc:mga08y16_56814_c1_437_2128 484
90 3300050513 nmdc:mga0rr50_41015_c1 nmdc:mga0rr50_41015_c1_121_1812 484
91 3300050515 nmdc:mga0a205_24936_c1 nmdc:mga0a205_24936_c1_1732_3423 484
92 3300006847 Ga0075431_100025422 Ga0075431_1000254221 485
93 3300005543 Ga0070672_100120348 Ga0070672_1001203482 487
94 3300025901 Ga0207688_10044282 Ga0207688_100442821 487
95 3300025942 Ga0207689_10029825 Ga0207689_100298254 487
96 3300048906 Ga0496103_0053099 Ga0496103_0053099_90_1850 487
97 3300005344 Ga0070661_100101541 Ga0070661_1001015412 489
98 3300005355 Ga0070671_100012639 Ga0070671_1000126394 489
99 3300005614 Ga0068856_100013804 Ga0068856_1000138044 489
100 3300025928 Ga0207700_10072356 Ga0207700_100723562 489
101 3300025931 Ga0207644_10012375 Ga0207644_100123754 489
102 3300048913 Ga0496110_0036269 Ga0496110_0036269_50_1789 489
103 3300046536 Ga0495587_0068029 Ga0495587_0068029_466_2043 490
104 3300048912 Ga0496109_0035131 Ga0496109_0035131_2494_4233 490
105 3300060353 Ga0501082_0079914 Ga0501082_0079914_971_2674 490
106 3300026095 Ga0207676_10016826 Ga0207676_100168264 491
107 3300050512 nmdc:mga0n895_47645_c1 nmdc:mga0n895_47645_c1_1625_3385 491
108 3300005435 Ga0070714_100068894 Ga0070714_1000688942 493
109 3300006028 Ga0070717_10084741 Ga0070717_100847412 493
110 3300025928 Ga0207700_10066774 Ga0207700_100667741 493
111 3300032002 Ga0307416_100090392 Ga0307416_1000903922 493
112 3300035086 Ga0373934_0001615 Ga0373934_0001615_4599_6359 493
113 3300035119 Ga0373956_0001004 Ga0373956_0001004_1439_3199 493
114 3300035120 Ga0373957_0008506 Ga0373957_0008506_827_2587 493
115 3300035172 Ga0373955_0000005 Ga0373955_0000005_73346_75106 493
116 3300035724 Ga0373933_0000043 Ga0373933_0000043_5250_7010 493
117 3300036401 Ga0373937_0000245 Ga0373937_0000245_4641_6401 493
118 3300036401 Ga0373937_0063250 Ga0373937_0063250_299_2167 493
119 3300037068 Ga0373925_0001494 Ga0373925_0001494_17815_19521 493
120 3300046454 Ga0495592_0000092 Ga0495592_0000092_72747_74507 493
121 3300046454 Ga0495592_0097787 Ga0495592_0097787_241_1932 493
122 3300046462 Ga0495651_0000066 Ga0495651_0000066_71138_72898 493
123 3300046463 Ga0495653_0002166 Ga0495653_0002166_9143_10903 493
124 3300046511 Ga0495608_0000070 Ga0495608_0000070_4641_6401 493
125 3300046511 Ga0495608_0065762 Ga0495608_0065762_188_1879 493
126 3300046514 Ga0495618_0091766 Ga0495618_0091766_142_1833 493
127 3300046516 Ga0495628_0000624 Ga0495628_0000624_25962_27722 493
128 3300046516 Ga0495628_0112248 Ga0495628_0112248_15_1706 493
129 3300046529 Ga0495652_0000769 Ga0495652_0000769_4641_6401 493
130 3300046529 Ga0495652_0090925 Ga0495652_0090925_234_2102 493
131 3300046533 Ga0495640_0013066 Ga0495640_0013066_670_2361 493
132 3300046536 Ga0495587_0000077 Ga0495587_0000077_71138_72898 493
133 3300046559 Ga0495667_0000071 Ga0495667_0000071_71138_72898 493
134 3300046642 Ga0495634_0074759 Ga0495634_0074759_48_1916 493
135 3300046675 Ga0495657_0000095 Ga0495657_0000095_71138_72898 493
136 3300046678 Ga0495599_0000155 Ga0495599_0000155_10094_11854 493
137 3300046679 Ga0495623_0001673 Ga0495623_0001673_4641_6401 493
138 3300046809 Ga0495600_0001750 Ga0495600_0001750_1874_3634 493
139 3300047317 Ga0495604_0000087 Ga0495604_0000087_72747_74507 493
140 3300047319 Ga0495674_0060103 Ga0495674_0060103_1000_2868 493
141 3300047322 Ga0495680_0003033 Ga0495680_0003033_9616_11376 493
142 3300047322 Ga0495680_0039139 Ga0495680_0039139_693_2384 493
143 3300047444 Ga0495675_0000157 Ga0495675_0000157_41759_43519 493
144 3300048088 Ga0495602_0000461 Ga0495602_0000461_4641_6401 493
145 3300053084 Ga0495595_0002737 Ga0495595_0002737_4613_6373 493
146 3300053085 Ga0495619_0027064 Ga0495619_0027064_927_2618 493
147 3300005329 Ga0070683_100177975 Ga0070683_1001779752 494
148 3300025944 Ga0207661_10133799 Ga0207661_101337992 494
149 3300042157 Ga0439458_0008711 Ga0439458_0008711_234_1985 495
150 3300046459 Ga0495629_0014399 Ga0495629_0014399_2209_3972 496
151 3300046461 Ga0495641_0001952 Ga0495641_0001952_1466_3229 496
152 3300046690 Ga0495624_0002604 Ga0495624_0002604_5828_7591 496
153 3300047673 Ga0495593_0011846 Ga0495593_0011846_3012_4775 496
154 3300053078 Ga0495612_0024350 Ga0495612_0024350_29_1792 496
155 3300005338 Ga0068868_100117303 Ga0068868_1001173032 497
156 3300005340 Ga0070689_100102416 Ga0070689_1001024162 497
157 3300005563 Ga0068855_100181217 Ga0068855_1001812171 497
158 3300005841 Ga0068863_100081257 Ga0068863_1000812574 497
159 3300025929 Ga0207664_10017382 Ga0207664_100173822 497
160 3300005468 Ga0070707_100080485 Ga0070707_1000804852 498
161 3300025928 Ga0207700_10058256 Ga0207700_100582562 499
162 3300025945 Ga0207679_10106384 Ga0207679_101063841 499
163 3300005435 Ga0070714_100002168 Ga0070714_1000021688 500
164 3300006028 Ga0070717_10041275 Ga0070717_100412752 500
165 3300006175 Ga0070712_100042643 Ga0070712_1000426433 500
166 3300025898 Ga0207692_10042480 Ga0207692_100424802 500
167 3300025928 Ga0207700_10048897 Ga0207700_100488972 500
168 3300025929 Ga0207664_10004524 Ga0207664_100045247 500
169 3300009093 Ga0105240_10114985 Ga0105240_101149852 501
170 3300009553 Ga0105249_10055325 Ga0105249_100553251 501
171 3300037471 Ga0395905_0059024 Ga0395905_0059024_805_2442 501
172 3300046463 Ga0495653_0004422 Ga0495653_0004422_5090_6781 501
173 3300046516 Ga0495628_0003918 Ga0495628_0003918_1741_3432 501
174 3300046559 Ga0495667_0036047 Ga0495667_0036047_1050_2741 501
175 3300047471 Ga0495684_0003809 Ga0495684_0003809_560_2251 501
176 3300005435 Ga0070714_100000974 Ga0070714_1000009743 502
177 3300005435 Ga0070714_100101202 Ga0070714_1001012022 502
178 3300005436 Ga0070713_100041203 Ga0070713_1000412032 502
179 3300006028 Ga0070717_10013777 Ga0070717_100137772 502
180 3300006173 Ga0070716_100004409 Ga0070716_1000044093 502
181 3300025929 Ga0207664_10010352 Ga0207664_100103525 502
182 3300025939 Ga0207665_10008637 Ga0207665_100086373 502
183 3300048929 Ga0496126_0019805 Ga0496126_0019805_3008_4777 502
184 3300049589 Ga0501073_0043786 Ga0501073_0043786_33_1691 503
185 3300025929 Ga0207664_10025480 Ga0207664_100254803 504
186 3300026075 Ga0207708_10071096 Ga0207708_100710963 504
187 3300042005 Ga0439448_0007867 Ga0439448_0007867_596_2329 504
188 3300042016 Ga0439463_002716 Ga0439463_002716_1898_3631 504
189 3300006175 Ga0070712_100012909 Ga0070712_1000129094 505
190 3300006844 Ga0075428_100167834 Ga0075428_1001678342 505
191 3300026035 Ga0207703_10123776 Ga0207703_101237762 505
192 3300035724 Ga0373933_0022557 Ga0373933_0022557_318_2090 505
193 3300041512 Ga0451853_0174584 Ga0451853_0174584_526_2310 505
194 3300048915 Ga0496112_0115326 Ga0496112_0115326_46_1860 505
195 3300005535 Ga0070684_100049238 Ga0070684_1000492382 506
196 3300026116 Ga0207674_10084964 Ga0207674_100849641 506
197 3300005336 Ga0070680_100061964 Ga0070680_1000619642 507
198 3300005337 Ga0070682_100006989 Ga0070682_1000069894 507
199 3300005345 Ga0070692_10005242 Ga0070692_100052422 507
200 3300005366 Ga0070659_100049664 Ga0070659_1000496642 507
201 3300005434 Ga0070709_10005337 Ga0070709_100053373 507
202 3300005437 Ga0070710_10007083 Ga0070710_100070833 507
203 3300005439 Ga0070711_100007610 Ga0070711_1000076102 507
204 3300005441 Ga0070700_100007174 Ga0070700_1000071745 507
205 3300005530 Ga0070679_100167816 Ga0070679_1001678162 507
206 3300005547 Ga0070693_100060028 Ga0070693_1000600282 507
207 3300005564 Ga0070664_100034953 Ga0070664_1000349532 507
208 3300005577 Ga0068857_100022308 Ga0068857_1000223085 507
209 3300005834 Ga0068851_10020541 Ga0068851_100205412 507
210 3300005937 Ga0081455_10000123 Ga0081455_1000012358 507
211 3300006173 Ga0070716_100074208 Ga0070716_1000742081 507
212 3300006175 Ga0070712_100031738 Ga0070712_1000317382 507
213 3300006237 Ga0097621_100117148 Ga0097621_1001171482 507
214 3300006358 Ga0068871_100075614 Ga0068871_1000756141 507
215 3300006871 Ga0075434_100026109 Ga0075434_1000261094 507
216 3300006881 Ga0068865_100031231 Ga0068865_1000312312 507
217 3300007076 Ga0075435_100058051 Ga0075435_1000580512 507
218 3300009098 Ga0105245_10036074 Ga0105245_100360743 507
219 3300009174 Ga0105241_10019360 Ga0105241_100193604 507
220 3300009176 Ga0105242_10027713 Ga0105242_100277132 507
221 3300009551 Ga0105238_10015810 Ga0105238_100158106 507
222 3300011119 Ga0105246_10050252 Ga0105246_100502522 507
223 3300013306 Ga0163162_10033665 Ga0163162_100336654 507
224 3300013306 Ga0163162_10068450 Ga0163162_100684502 507
225 3300013307 Ga0157372_10112101 Ga0157372_101121012 507
226 3300013308 Ga0157375_10134302 Ga0157375_101343022 507
227 3300014969 Ga0157376_10017650 Ga0157376_100176505 507
228 3300025321 Ga0207656_10021898 Ga0207656_100218982 507
229 3300025906 Ga0207699_10004492 Ga0207699_100044923 507
230 3300025924 Ga0207694_10114250 Ga0207694_101142501 507
231 3300025928 Ga0207700_10011992 Ga0207700_100119922 507
232 3300025929 Ga0207664_10003669 Ga0207664_100036692 507
233 3300026075 Ga0207708_10006019 Ga0207708_100060192 507
234 3300026078 Ga0207702_10114614 Ga0207702_101146142 507
235 3300026089 Ga0207648_10029778 Ga0207648_100297782 507
236 3300026116 Ga0207674_10014208 Ga0207674_100142085 507
237 3300044765 Ga0466970_0012932 Ga0466970_0012932_1421_3112 507
238 3300048906 Ga0496103_0088633 Ga0496103_0088633_248_1918 507
239 3300048907 Ga0496104_0071383 Ga0496104_0071383_845_2659 507
240 3300048908 Ga0496105_0060205 Ga0496105_0060205_472_2166 507
241 3300048911 Ga0496108_0015456 Ga0496108_0015456_857_2671 507
242 3300048911 Ga0496108_0038524 Ga0496108_0038524_495_2189 507
243 3300048912 Ga0496109_0081171 Ga0496109_0081171_654_2396 507
244 3300048913 Ga0496110_0021412 Ga0496110_0021412_1409_3223 507
245 3300048913 Ga0496110_0048234 Ga0496110_0048234_1724_3418 507
246 3300048914 Ga0496111_0022383 Ga0496111_0022383_1104_2798 507
247 3300031456 Ga0307513_10019341 Ga0307513_100193417 508
248 3300035083 Ga0373926_0001583 Ga0373926_0001583_1100_2863 508
249 3300035089 Ga0373944_0001827 Ga0373944_0001827_507_2270 508
250 3300035116 Ga0373945_0000591 Ga0373945_0000591_7632_9395 508
251 3300035117 Ga0373953_0009920 Ga0373953_0009920_703_2466 508
252 3300035170 Ga0373943_0001628 Ga0373943_0001628_1372_3135 508
253 3300035410 Ga0373924_0008586 Ga0373924_0008586_1218_2981 508
254 3300035725 Ga0373947_0019417 Ga0373947_0019417_1867_3630 508
255 3300036401 Ga0373937_0040151 Ga0373937_0040151_2101_3864 508
256 3300037068 Ga0373925_0001915 Ga0373925_0001915_772_2535 508
257 3300046472 Ga0495580_0015030 Ga0495580_0015030_3531_5294 508
258 3300046473 Ga0495582_0001399 Ga0495582_0001399_1023_2786 508
259 3300046476 Ga0495662_0012129 Ga0495662_0012129_1372_3135 508
260 3300046499 Ga0495594_0017675 Ga0495594_0017675_1738_3501 508
261 3300046531 Ga0495665_0006507 Ga0495665_0006507_2985_4748 508
262 3300046533 Ga0495640_0034424 Ga0495640_0034424_998_2761 508
263 3300046543 Ga0495645_0084253 Ga0495645_0084253_226_1989 508
264 3300046679 Ga0495623_0019635 Ga0495623_0019635_784_2547 508
265 3300046681 Ga0495647_0014609 Ga0495647_0014609_751_2514 508
266 3300046689 Ga0495613_0004518 Ga0495613_0004518_1497_3260 508
267 3300047444 Ga0495675_0001850 Ga0495675_0001850_226_1989 508
268 3300047471 Ga0495684_0056981 Ga0495684_0056981_1076_2839 508
269 3300048907 Ga0496104_0110864 Ga0496104_0110864_685_2469 508
270 3300048908 Ga0496105_0072332 Ga0496105_0072332_388_2172 508
271 3300048912 Ga0496109_0005796 Ga0496109_0005796_3409_5193 508
272 3300048914 Ga0496111_0071066 Ga0496111_0071066_538_2322 508
273 3300005366 Ga0070659_100013914 Ga0070659_1000139143 509
274 3300005435 Ga0070714_100013040 Ga0070714_1000130402 509
275 3300005436 Ga0070713_100029057 Ga0070713_1000290571 509
276 3300005439 Ga0070711_100020370 Ga0070711_1000203702 509
277 3300005616 Ga0068852_100037992 Ga0068852_1000379923 509
278 3300006880 Ga0075429_100047159 Ga0075429_1000471592 509
279 3300013105 Ga0157369_10018141 Ga0157369_100181414 509
280 3300014497 Ga0182008_10025926 Ga0182008_100259262 509
281 3300025907 Ga0207645_10044425 Ga0207645_100444252 509
282 3300025928 Ga0207700_10035520 Ga0207700_100355203 509
283 3300046559 Ga0495667_0030210 Ga0495667_0030210_1844_3607 509
284 3300048912 Ga0496109_0058506 Ga0496109_0058506_1032_2726 509
285 3300048918 Ga0496115_0008063 Ga0496115_0008063_4984_6618 509
286 3300049571 Ga0501034_0062091 Ga0501034_0062091_294_2057 509
287 3300005438 Ga0070701_10023749 Ga0070701_100237492 511
288 3300031901 Ga0307406_10076400 Ga0307406_100764001 511
289 3300048917 Ga0496114_0204919 Ga0496114_0204919_58_1662 511
290 3300003203 JGI25406J46586_10001317 JGI25406J46586_1000131710 512
291 3300005334 Ga0068869_100035330 Ga0068869_1000353303 512
292 3300005985 Ga0081539_10000919 Ga0081539_1000091915 512
293 3300046463 Ga0495653_0003794 Ga0495653_0003794_3142_4929 512
294 3300046809 Ga0495600_0044659 Ga0495600_0044659_289_2076 512
295 3300005548 Ga0070665_100062706 Ga0070665_1000627062 513
296 3300006852 Ga0075433_10024336 Ga0075433_100243365 513
297 3300006852 Ga0075433_10025055 Ga0075433_100250553 513
298 3300006871 Ga0075434_100119422 Ga0075434_1001194222 513
299 3300009147 Ga0114129_10015764 Ga0114129_100157646 513
300 3300009147 Ga0114129_10046739 Ga0114129_100467392 513
301 3300010375 Ga0105239_10041232 Ga0105239_100412324 513
302 3300014325 Ga0163163_10061935 Ga0163163_100619352 513
303 3300025906 Ga0207699_10001901 Ga0207699_100019015 513
304 3300026095 Ga0207676_10033378 Ga0207676_100333783 513
305 3300048913 Ga0496110_0099095 Ga0496110_0099095_27_1721 513
306 3300050507 nmdc:mga05p37_156892_c1 nmdc:mga05p37_156892_c1_434_2191 513
307 3300050507 nmdc:mga05p37_7880_c1 nmdc:mga05p37_7880_c1_10659_12392 513
308 3300050512 nmdc:mga0n895_198239_c1 nmdc:mga0n895_198239_c1_83_1816 513
309 3300050512 nmdc:mga0n895_43378_c1 nmdc:mga0n895_43378_c1_1639_3396 513
310 3300050513 nmdc:mga0rr50_95517_c1 nmdc:mga0rr50_95517_c1_247_2004 513
311 3300050515 nmdc:mga0a205_37118_c1 nmdc:mga0a205_37118_c1_212_1945 513
312 3300011119 Ga0105246_10017620 Ga0105246_100176202 514
313 3300046463 Ga0495653_0012547 Ga0495653_0012547_1521_3200 515
314 3300005329 Ga0070683_100129725 Ga0070683_1001297251 516
315 3300013296 Ga0157374_10040301 Ga0157374_100403011 516
316 3300025936 Ga0207670_10097738 Ga0207670_100977381 516
317 3300025944 Ga0207661_10088523 Ga0207661_100885231 516
318 3300046678 Ga0495599_0086353 Ga0495599_0086353_190_1914 516
319 3300005331 Ga0070670_100011377 Ga0070670_1000113776 517
320 3300005334 Ga0068869_100000672 Ga0068869_10000067213 517
321 3300005337 Ga0070682_100001129 Ga0070682_1000011292 517
322 3300005339 Ga0070660_100009909 Ga0070660_1000099095 517
323 3300005355 Ga0070671_100005326 Ga0070671_10000532611 517
324 3300005455 Ga0070663_100029835 Ga0070663_1000298352 517
325 3300005456 Ga0070678_100003700 Ga0070678_1000037004 517
326 3300005458 Ga0070681_10032436 Ga0070681_100324363 517
327 3300005466 Ga0070685_10002662 Ga0070685_100026628 517
328 3300005530 Ga0070679_100085799 Ga0070679_1000857993 517
329 3300005547 Ga0070693_100010163 Ga0070693_1000101633 517
330 3300005548 Ga0070665_100042412 Ga0070665_1000424122 517
331 3300005614 Ga0068856_100006035 Ga0068856_1000060357 517
332 3300005615 Ga0070702_100005662 Ga0070702_1000056622 517
333 3300005617 Ga0068859_100082194 Ga0068859_1000821942 517
334 3300005618 Ga0068864_100003975 Ga0068864_1000039758 517
335 3300005834 Ga0068851_10012207 Ga0068851_100122072 517
336 3300005840 Ga0068870_10003481 Ga0068870_100034813 517
337 3300005841 Ga0068863_100006471 Ga0068863_10000647110 517
338 3300005842 Ga0068858_100068777 Ga0068858_1000687772 517
339 3300006237 Ga0097621_100007462 Ga0097621_1000074623 517
340 3300006358 Ga0068871_100009216 Ga0068871_1000092166 517
341 3300006847 Ga0075431_100097074 Ga0075431_1000970742 517
342 3300006852 Ga0075433_10011613 Ga0075433_100116133 517
343 3300006914 Ga0075436_100010143 Ga0075436_1000101433 517
344 3300006931 Ga0097620_100082193 Ga0097620_1000821932 517
345 3300007076 Ga0075435_100005298 Ga0075435_1000052985 517
346 3300009093 Ga0105240_10094129 Ga0105240_100941293 517
347 3300009101 Ga0105247_10009645 Ga0105247_100096453 517
348 3300009174 Ga0105241_10001988 Ga0105241_1000198812 517
349 3300009177 Ga0105248_10068314 Ga0105248_100683143 517
350 3300011119 Ga0105246_10010935 Ga0105246_100109352 517
351 3300013296 Ga0157374_10094403 Ga0157374_100944032 517
352 3300013308 Ga0157375_10030166 Ga0157375_100301662 517
353 3300014969 Ga0157376_10022075 Ga0157376_100220753 517
354 3300025321 Ga0207656_10012516 Ga0207656_100125163 517
355 3300025900 Ga0207710_10006639 Ga0207710_100066393 517
356 3300025901 Ga0207688_10000213 Ga0207688_1000021312 517
357 3300025908 Ga0207643_10000218 Ga0207643_100002185 517
358 3300025909 Ga0207705_10037063 Ga0207705_100370632 517
359 3300025911 Ga0207654_10003770 Ga0207654_100037703 517
360 3300025919 Ga0207657_10008572 Ga0207657_100085726 517
361 3300025920 Ga0207649_10007987 Ga0207649_100079873 517
362 3300025925 Ga0207650_10009927 Ga0207650_100099273 517
363 3300025931 Ga0207644_10008003 Ga0207644_100080035 517
364 3300025942 Ga0207689_10002593 Ga0207689_1000259312 517
365 3300025944 Ga0207661_10002657 Ga0207661_100026573 517
366 3300025945 Ga0207679_10010995 Ga0207679_100109953 517
367 3300026067 Ga0207678_10011871 Ga0207678_100118713 517
368 3300026075 Ga0207708_10045044 Ga0207708_100450442 517
369 3300026078 Ga0207702_10002437 Ga0207702_100024373 517
370 3300026078 Ga0207702_10009971 Ga0207702_100099713 517
371 3300026095 Ga0207676_10003391 Ga0207676_100033913 517
372 3300026116 Ga0207674_10107503 Ga0207674_101075033 517
373 3300026121 Ga0207683_10000454 Ga0207683_1000045425 517
374 3300026142 Ga0207698_10004756 Ga0207698_100047563 517
375 3300042157 Ga0439458_0008012 Ga0439458_0008012_337_2070 517
376 3300048905 Ga0496102_0013799 Ga0496102_0013799_2408_4159 517
377 3300048908 Ga0496105_0002305 Ga0496105_0002305_10268_12019 517
378 3300048909 Ga0496106_0003648 Ga0496106_0003648_8140_9891 517
379 3300048911 Ga0496108_0012789 Ga0496108_0012789_1831_3582 517
380 3300049569 Ga0501032_0002022 Ga0501032_0002022_8516_10150 517
381 3300049570 Ga0501033_0011445 Ga0501033_0011445_3610_5244 517
382 3300049571 Ga0501034_0004204 Ga0501034_0004204_12735_14369 517
383 3300049573 Ga0501037_0021309 Ga0501037_0021309_409_2043 517
384 3300049574 Ga0501038_0038074 Ga0501038_0038074_524_2158 517
385 3300049576 Ga0501040_0021756 Ga0501040_0021756_433_2067 517
386 3300049582 Ga0501048_0045452 Ga0501048_0045452_1070_2704 517
387 3300049584 Ga0501068_0001135 Ga0501068_0001135_1891_3525 517
388 3300049585 Ga0501069_0048322 Ga0501069_0048322_432_2066 517
389 3300049586 Ga0501070_0002476 Ga0501070_0002476_1094_2728 517
390 3300049588 Ga0501072_0030265 Ga0501072_0030265_1891_3525 517
391 3300049590 Ga0501074_0014082 Ga0501074_0014082_3748_5382 517
392 3300049742 Ga0501080_0005478 Ga0501080_0005478_4581_6215 517
393 3300049743 Ga0501081_0010424 Ga0501081_0010424_3994_5628 517
394 3300049824 Ga0501045_0007946 Ga0501045_0007946_4080_5714 517
395 3300050511 nmdc:mga08y16_33936_c1 nmdc:mga08y16_33936_c1_1530_3281 517
396 3300050512 nmdc:mga0n895_825_c1 nmdc:mga0n895_825_c1_2443_4194 517
397 3300050514 nmdc:mga08x19_7539_c1 nmdc:mga08x19_7539_c1_2622_4373 517
398 3300050515 nmdc:mga0a205_6248_c1 nmdc:mga0a205_6248_c1_7300_9051 517
399 3300005435 Ga0070714_100017478 Ga0070714_1000174783 518
400 3300005436 Ga0070713_100003754 Ga0070713_1000037544 518
401 3300025922 Ga0207646_10012024 Ga0207646_100120245 518
402 3300026067 Ga0207678_10078529 Ga0207678_100785292 518
403 3300045976 Ga0466967_0101822 Ga0466967_0101822_572_2320 518
404 3300048913 Ga0496110_0038608 Ga0496110_0038608_1737_3485 518
405 3300037068 Ga0373925_0007560 Ga0373925_0007560_323_2110 519
406 3300046462 Ga0495651_0011712 Ga0495651_0011712_1840_3627 519
407 3300046473 Ga0495582_0002910 Ga0495582_0002910_3135_4814 519
408 3300046516 Ga0495628_0027893 Ga0495628_0027893_711_2498 519
409 3300046517 Ga0495630_0027780 Ga0495630_0027780_393_2180 519
410 3300046536 Ga0495587_0004198 Ga0495587_0004198_1788_3575 519
411 3300046642 Ga0495634_0019468 Ga0495634_0019468_72_1859 519
412 3300046674 Ga0495588_0022616 Ga0495588_0022616_1358_3037 519
413 3300046680 Ga0495646_0009024 Ga0495646_0009024_3645_5432 519
414 3300047319 Ga0495674_0074405 Ga0495674_0074405_755_2542 519
415 3300047321 Ga0495676_0083124 Ga0495676_0083124_201_1880 519
416 3300047322 Ga0495680_0006570 Ga0495680_0006570_6790_8577 519
417 3300048929 Ga0496126_0174840 Ga0496126_0174840_42_1781 519
418 3300036401 Ga0373937_0084052 Ga0373937_0084052_1187_2920 520
419 3300046454 Ga0495592_0033973 Ga0495592_0033973_1714_3393 520
420 3300046529 Ga0495652_0013266 Ga0495652_0013266_3018_4748 520
421 3300046536 Ga0495587_0056171 Ga0495587_0056171_65_1795 520
422 3300046559 Ga0495667_0013560 Ga0495667_0013560_859_2538 520
423 3300046680 Ga0495646_0032465 Ga0495646_0032465_1404_3083 520
424 3300047444 Ga0495675_0009503 Ga0495675_0009503_3259_4938 520
425 3300048907 Ga0496104_0071625 Ga0496104_0071625_1003_2709 520
426 3300048910 Ga0496107_0005385 Ga0496107_0005385_2350_4056 520
427 3300048911 Ga0496108_0089272 Ga0496108_0089272_10_1716 520
428 3300048912 Ga0496109_0108886 Ga0496109_0108886_849_2555 520
429 3300048917 Ga0496114_0020614 Ga0496114_0020614_3650_5338 520
430 3300049583 Ga0501067_0026266 Ga0501067_0026266_502_2289 520
431 3300049585 Ga0501069_0048019 Ga0501069_0048019_119_1906 520
432 3300005436 Ga0070713_100023202 Ga0070713_1000232022 521
433 3300009098 Ga0105245_10005589 Ga0105245_100055896 521
434 3300009147 Ga0114129_10314640 Ga0114129_103146401 521
435 3300013308 Ga0157375_10042902 Ga0157375_100429025 521
436 3300014745 Ga0157377_10009848 Ga0157377_100098484 521
437 3300025928 Ga0207700_10024576 Ga0207700_100245764 521
438 3300006175 Ga0070712_100046323 Ga0070712_1000463232 522
439 3300009093 Ga0105240_10015709 Ga0105240_1001570912 522
440 3300009174 Ga0105241_10005381 Ga0105241_100053815 522
441 3300009545 Ga0105237_10008550 Ga0105237_1000855012 522
442 3300009551 Ga0105238_10004485 Ga0105238_100044856 522
443 3300010375 Ga0105239_10028892 Ga0105239_100288925 522
444 3300025915 Ga0207693_10081784 Ga0207693_100817842 522
445 3300036401 Ga0373937_0179693 Ga0373937_0179693_260_1963 522
446 3300046543 Ga0495645_0078985 Ga0495645_0078985_444_2174 522
447 3300047322 Ga0495680_0086991 Ga0495680_0086991_282_1985 522
448 3300005548 Ga0070665_100126293 Ga0070665_1001262933 523
449 3300005616 Ga0068852_100084755 Ga0068852_1000847553 523
450 3300009094 Ga0111539_10148357 Ga0111539_101483573 523
451 3300025932 Ga0207690_10090184 Ga0207690_100901841 523
452 3300026023 Ga0207677_10029647 Ga0207677_100296473 523
453 3300027907 Ga0207428_10133363 Ga0207428_101333632 523
454 3300028379 Ga0268266_10054809 Ga0268266_100548093 523
455 3300044694 Ga0466963_0001267 Ga0466963_0001267_2788_4506 523
456 3300045049 Ga0466959_0070396 Ga0466959_0070396_437_2155 523
457 3300045976 Ga0466967_0007021 Ga0466967_0007021_3233_4951 523
458 3300046462 Ga0495651_0058460 Ga0495651_0058460_642_2342 523
459 3300046511 Ga0495608_0043756 Ga0495608_0043756_461_2161 523
460 3300047319 Ga0495674_0077342 Ga0495674_0077342_1118_2815 523
461 3300047322 Ga0495680_0012893 Ga0495680_0012893_5145_6842 523
462 3300047471 Ga0495684_0058330 Ga0495684_0058330_537_2237 523
463 3300048924 Ga0496121_0002166 Ga0496121_0002166_24796_26514 523
464 3300050511 nmdc:mga08y16_183109_c1 nmdc:mga08y16_183109_c1_375_2063 523
465 3300053077 Ga0495601_0044793 Ga0495601_0044793_354_2054 523
466 3300009094 Ga0111539_10234046 Ga0111539_102340462 524
467 3300048911 Ga0496108_0034247 Ga0496108_0034247_2190_3890 524
468 3300048911 Ga0496108_0088572 Ga0496108_0088572_572_2311 524
469 3300048912 Ga0496109_0004142 Ga0496109_0004142_9290_10990 524
470 3300048917 Ga0496114_0024825 Ga0496114_0024825_2842_4578 524
471 3300005444 Ga0070694_100006385 Ga0070694_1000063854 525
472 3300005468 Ga0070707_100012396 Ga0070707_1000123967 525
473 3300005518 Ga0070699_100002823 Ga0070699_10000282310 525
474 3300005536 Ga0070697_100005200 Ga0070697_1000052002 525
475 3300005548 Ga0070665_100012542 Ga0070665_1000125423 525
476 3300005563 Ga0068855_100005045 Ga0068855_10000504515 525
477 3300005578 Ga0068854_100002147 Ga0068854_1000021474 525
478 3300006028 Ga0070717_10047747 Ga0070717_100477472 525
479 3300009553 Ga0105249_10010209 Ga0105249_100102092 525
480 3300025904 Ga0207647_10005252 Ga0207647_100052527 525
481 3300025913 Ga0207695_10002866 Ga0207695_1000286612 525
482 3300025914 Ga0207671_10003461 Ga0207671_1000346115 525
483 3300025924 Ga0207694_10000843 Ga0207694_1000084318 525
484 3300025949 Ga0207667_10015537 Ga0207667_100155377 525
485 3300025981 Ga0207640_10004012 Ga0207640_100040124 525
486 3300026067 Ga0207678_10096187 Ga0207678_100961873 525
487 3300006028 Ga0070717_10025313 Ga0070717_100253134 526
488 3300006844 Ga0075428_100134410 Ga0075428_1001344102 526
489 3300006847 Ga0075431_100085037 Ga0075431_1000850372 526
490 3300006871 Ga0075434_100180303 Ga0075434_1001803031 526
491 3300006880 Ga0075429_100082607 Ga0075429_1000826072 526
492 3300027907 Ga0207428_10115835 Ga0207428_101158351 526
493 3300035725 Ga0373947_0004411 Ga0373947_0004411_1442_3232 526
494 3300046459 Ga0495629_0001429 Ga0495629_0001429_11978_13768 526
495 3300046473 Ga0495582_0000338 Ga0495582_0000338_5999_7789 526
496 3300046531 Ga0495665_0001371 Ga0495665_0001371_1726_3516 526
497 3300046681 Ga0495647_0015267 Ga0495647_0015267_418_2208 526
498 3300046683 Ga0495658_0000726 Ga0495658_0000726_4980_6770 526
499 3300047315 Ga0495581_0001112 Ga0495581_0001112_9721_11511 526
500 3300050515 nmdc:mga0a205_44872_c1 nmdc:mga0a205_44872_c1_952_2670 526
501 3300005457 Ga0070662_100017767 Ga0070662_1000177674 527
502 3300005843 Ga0068860_100045967 Ga0068860_1000459672 527
503 3300005937 Ga0081455_10001506 Ga0081455_1000150625 527
504 3300025933 Ga0207706_10076573 Ga0207706_100765732 527
505 3300028380 Ga0268265_10108993 Ga0268265_101089932 527
506 3300028381 Ga0268264_10039541 Ga0268264_100395413 527
507 3300053085 Ga0495619_0026491 Ga0495619_0026491_645_2462 527
508 3300005329 Ga0070683_100039924 Ga0070683_1000399244 528
509 3300005329 Ga0070683_100060608 Ga0070683_1000606083 528
510 3300005336 Ga0070680_100000135 Ga0070680_10000013512 528
511 3300005458 Ga0070681_10000020 Ga0070681_1000002090 528
512 3300005458 Ga0070681_10055574 Ga0070681_100555742 528
513 3300005530 Ga0070679_100000044 Ga0070679_10000004443 528
514 3300009147 Ga0114129_10040454 Ga0114129_100404544 528
515 3300010375 Ga0105239_10032423 Ga0105239_100324233 528
516 3300025912 Ga0207707_10000090 Ga0207707_1000009043 528
517 3300025917 Ga0207660_10000219 Ga0207660_100002192 528
518 3300025917 Ga0207660_10059241 Ga0207660_100592412 528
519 3300025921 Ga0207652_10000485 Ga0207652_1000048542 528
520 3300048908 Ga0496105_0085683 Ga0496105_0085683_847_2577 528
521 3300048917 Ga0496114_0056320 Ga0496114_0056320_999_2732 528
522 3300005336 Ga0070680_100030659 Ga0070680_1000306593 529
523 3300005471 Ga0070698_100104833 Ga0070698_1001048331 529
524 3300005530 Ga0070679_100102225 Ga0070679_1001022252 529
525 3300005535 Ga0070684_100020042 Ga0070684_1000200423 529
526 3300009093 Ga0105240_10072227 Ga0105240_100722272 529
527 3300009147 Ga0114129_10055068 Ga0114129_100550685 529
528 3300014325 Ga0163163_10009952 Ga0163163_100099528 529
529 3300025912 Ga0207707_10035007 Ga0207707_100350073 529
530 3300046459 Ga0495629_0001088 Ga0495629_0001088_9000_10715 529
531 3300046473 Ga0495582_0000078 Ga0495582_0000078_25137_26852 529
532 3300046531 Ga0495665_0021638 Ga0495665_0021638_972_2687 529
533 3300046539 Ga0495621_0000572 Ga0495621_0000572_2556_4319 529
534 3300046683 Ga0495658_0000236 Ga0495658_0000236_23710_25425 529
535 3300046689 Ga0495613_0000207 Ga0495613_0000207_24539_26254 529
536 3300047315 Ga0495581_0001409 Ga0495581_0001409_5654_7369 529
537 3300048905 Ga0496102_0020367 Ga0496102_0020367_3961_5697 529
538 3300048915 Ga0496112_0016419 Ga0496112_0016419_5171_6907 529
539 3300050507 nmdc:mga05p37_89312_c1 nmdc:mga05p37_89312_c1_1446_3179 529
540 3300050512 nmdc:mga0n895_2126_c1 nmdc:mga0n895_2126_c1_1249_2985 529
541 3300061734 Ga0530510_0030155 Ga0530510_0030155_1867_3603 529
542 3300005338 Ga0068868_100007548 Ga0068868_1000075488 530
543 3300005338 Ga0068868_100034361 Ga0068868_1000343612 530
544 3300005366 Ga0070659_100049618 Ga0070659_1000496183 530
545 3300005436 Ga0070713_100061707 Ga0070713_1000617072 530
546 3300005439 Ga0070711_100071560 Ga0070711_1000715602 530
547 3300005535 Ga0070684_100037755 Ga0070684_1000377553 530
548 3300005563 Ga0068855_100002117 Ga0068855_10000211719 530
549 3300005614 Ga0068856_100076180 Ga0068856_1000761802 530
550 3300005617 Ga0068859_100046929 Ga0068859_1000469295 530
551 3300006028 Ga0070717_10011176 Ga0070717_100111766 530
552 3300006871 Ga0075434_100012332 Ga0075434_1000123325 530
553 3300006914 Ga0075436_100017185 Ga0075436_1000171854 530
554 3300006931 Ga0097620_100046929 Ga0097620_1000469295 530
555 3300007076 Ga0075435_100000523 Ga0075435_10000052322 530
556 3300009551 Ga0105238_10030996 Ga0105238_100309964 530
557 3300011119 Ga0105246_10002583 Ga0105246_100025836 530
558 3300013105 Ga0157369_10157007 Ga0157369_101570072 530
559 3300013296 Ga0157374_10008821 Ga0157374_100088216 530
560 3300013307 Ga0157372_10077393 Ga0157372_100773933 530
561 3300014325 Ga0163163_10115834 Ga0163163_101158342 530
562 3300025901 Ga0207688_10002494 Ga0207688_100024944 530
563 3300025914 Ga0207671_10035151 Ga0207671_100351514 530
564 3300025916 Ga0207663_10122751 Ga0207663_101227511 530
565 3300025919 Ga0207657_10102038 Ga0207657_101020382 530
566 3300025927 Ga0207687_10031812 Ga0207687_100318122 530
567 3300025932 Ga0207690_10004202 Ga0207690_100042028 530
568 3300025939 Ga0207665_10023651 Ga0207665_100236512 530
569 3300025949 Ga0207667_10004602 Ga0207667_100046028 530
570 3300025960 Ga0207651_10118895 Ga0207651_101188952 530
571 3300026023 Ga0207677_10062601 Ga0207677_100626012 530
572 3300026121 Ga0207683_10106699 Ga0207683_101066992 530
573 3300028379 Ga0268266_10094610 Ga0268266_100946102 530
574 3300035695 Ga0373927_0019496 Ga0373927_0019496_507_2183 530
575 3300035724 Ga0373933_0039045 Ga0373933_0039045_457_2133 530
576 3300046461 Ga0495641_0022859 Ga0495641_0022859_484_2160 530
577 3300046475 Ga0495639_0003784 Ga0495639_0003784_1822_3498 530
578 3300046475 Ga0495639_0030093 Ga0495639_0030093_694_2370 530
579 3300046476 Ga0495662_0008850 Ga0495662_0008850_2182_3858 530
580 3300046499 Ga0495594_0032192 Ga0495594_0032192_571_2247 530
581 3300046514 Ga0495618_0034995 Ga0495618_0034995_575_2251 530
582 3300046517 Ga0495630_0018348 Ga0495630_0018348_2980_4656 530
583 3300046531 Ga0495665_0011482 Ga0495665_0011482_944_2620 530
584 3300046533 Ga0495640_0047829 Ga0495640_0047829_505_2181 530
585 3300046559 Ga0495667_0048750 Ga0495667_0048750_453_2129 530
586 3300046642 Ga0495634_0011952 Ga0495634_0011952_2087_3763 530
587 3300046663 Ga0495635_0023243 Ga0495635_0023243_204_1880 530
588 3300046674 Ga0495588_0004695 Ga0495588_0004695_2422_4098 530
589 3300046683 Ga0495658_0008286 Ga0495658_0008286_2446_4122 530
590 3300046689 Ga0495613_0018030 Ga0495613_0018030_904_2580 530
591 3300046690 Ga0495624_0020231 Ga0495624_0020231_227_1903 530
592 3300046690 Ga0495624_0025322 Ga0495624_0025322_1708_3384 530
593 3300046809 Ga0495600_0025724 Ga0495600_0025724_1906_3582 530
594 3300047315 Ga0495581_0011427 Ga0495581_0011427_760_2436 530
595 3300047317 Ga0495604_0052269 Ga0495604_0052269_603_2279 530
596 3300047319 Ga0495674_0040756 Ga0495674_0040756_735_2411 530
597 3300047321 Ga0495676_0011573 Ga0495676_0011573_4311_5987 530
598 3300047322 Ga0495680_0055223 Ga0495680_0055223_960_2636 530
599 3300047471 Ga0495684_0018295 Ga0495684_0018295_1022_2698 530
600 3300047673 Ga0495593_0057053 Ga0495593_0057053_176_1852 530
601 3300048904 Ga0496101_0002239 Ga0496101_0002239_10073_11749 530
602 3300048904 Ga0496101_0002703 Ga0496101_0002703_6921_8660 530
603 3300048905 Ga0496102_0006157 Ga0496102_0006157_4211_5887 530
604 3300048905 Ga0496102_0006613 Ga0496102_0006613_1346_3085 530
605 3300048906 Ga0496103_0002293 Ga0496103_0002293_6353_8029 530
606 3300048908 Ga0496105_0000756 Ga0496105_0000756_16362_18038 530
607 3300048909 Ga0496106_0019313 Ga0496106_0019313_688_2364 530
608 3300048910 Ga0496107_0009138 Ga0496107_0009138_2905_4581 530
609 3300048910 Ga0496107_0051083 Ga0496107_0051083_544_2220 530
610 3300048911 Ga0496108_0082690 Ga0496108_0082690_755_2431 530
611 3300048912 Ga0496109_0027124 Ga0496109_0027124_851_2590 530
612 3300048913 Ga0496110_0000249 Ga0496110_0000249_8113_9789 530
613 3300048913 Ga0496110_0075476 Ga0496110_0075476_708_2447 530
614 3300048914 Ga0496111_0003049 Ga0496111_0003049_2452_4128 530
615 3300048915 Ga0496112_0000620 Ga0496112_0000620_10624_12300 530
616 3300048916 Ga0496113_0080845 Ga0496113_0080845_545_2284 530
617 3300048918 Ga0496115_0004134 Ga0496115_0004134_2470_4209 530
618 3300048918 Ga0496115_0029753 Ga0496115_0029753_2408_4084 530
619 3300050512 nmdc:mga0n895_10525_c1 nmdc:mga0n895_10525_c1_3936_5612 530
620 3300050513 nmdc:mga0rr50_7773_c1 nmdc:mga0rr50_7773_c1_4583_6259 530
621 3300050514 nmdc:mga08x19_9178_c1 nmdc:mga08x19_9178_c1_1717_3393 530
622 3300053077 Ga0495601_0002354 Ga0495601_0002354_2361_4037 530
623 3300053078 Ga0495612_0017888 Ga0495612_0017888_711_2387 530
624 3300053085 Ga0495619_0035391 Ga0495619_0035391_1050_2726 530
625 3300005467 Ga0070706_100004208 Ga0070706_10000420815 531
626 3300009551 Ga0105238_10013378 Ga0105238_100133784 531
627 3300025910 Ga0207684_10001508 Ga0207684_100015085 531
628 3300037418 Ga0395900_0143787 Ga0395900_0143787_163_1848 531
629 3300046516 Ga0495628_0021322 Ga0495628_0021322_3498_5312 531
630 3300005437 Ga0070710_10032808 Ga0070710_100328082 532
631 3300005577 Ga0068857_100140635 Ga0068857_1001406352 532
632 3300024225 Ga0224572_1002365 Ga0224572_10023652 532
633 3300025916 Ga0207663_10035938 Ga0207663_100359382 532
634 3300026121 Ga0207683_10154855 Ga0207683_101548551 532
635 3300035724 Ga0373933_0081560 Ga0373933_0081560_29_1783 532
636 3300046454 Ga0495592_0011277 Ga0495592_0011277_2836_4620 532
637 3300046462 Ga0495651_0010231 Ga0495651_0010231_1727_3511 532
638 3300046463 Ga0495653_0008124 Ga0495653_0008124_5181_6965 532
639 3300046511 Ga0495608_0007499 Ga0495608_0007499_4107_5891 532
640 3300046529 Ga0495652_0016891 Ga0495652_0016891_3777_5561 532
641 3300046533 Ga0495640_0023414 Ga0495640_0023414_758_2542 532
642 3300046536 Ga0495587_0014003 Ga0495587_0014003_1277_3061 532
643 3300046543 Ga0495645_0064304 Ga0495645_0064304_617_2401 532
644 3300046559 Ga0495667_0006824 Ga0495667_0006824_3734_5518 532
645 3300046642 Ga0495634_0031304 Ga0495634_0031304_1670_3499 532
646 3300046663 Ga0495635_0012304 Ga0495635_0012304_2598_4382 532
647 3300046675 Ga0495657_0008653 Ga0495657_0008653_4628_6412 532
648 3300046678 Ga0495599_0007643 Ga0495599_0007643_2812_4596 532
649 3300046809 Ga0495600_0013426 Ga0495600_0013426_1618_3402 532
650 3300047317 Ga0495604_0001649 Ga0495604_0001649_14676_16460 532
651 3300047319 Ga0495674_0010613 Ga0495674_0010613_1949_3733 532
652 3300047322 Ga0495680_0020012 Ga0495680_0020012_1568_3352 532
653 3300047444 Ga0495675_0003497 Ga0495675_0003497_483_2267 532
654 3300047471 Ga0495684_0059009 Ga0495684_0059009_542_2326 532
655 3300048088 Ga0495602_0017632 Ga0495602_0017632_3732_5516 532
656 3300053085 Ga0495619_0021469 Ga0495619_0021469_1620_3404 532
657 3300005435 Ga0070714_100002616 Ga0070714_1000026164 533
658 3300005436 Ga0070713_100085957 Ga0070713_1000859572 533
659 3300005530 Ga0070679_100037668 Ga0070679_1000376684 533
660 3300006042 Ga0075368_10006845 Ga0075368_100068452 533
661 3300006048 Ga0075363_100025841 Ga0075363_1000258412 533
662 3300025915 Ga0207693_10010102 Ga0207693_100101024 533
663 3300025929 Ga0207664_10003919 Ga0207664_100039198 533
664 3300025938 Ga0207704_10056512 Ga0207704_100565122 533
665 3300053153 Ga0500616_0004633 Ga0500616_0004633_4724_6466 533
666 3300009545 Ga0105237_10021863 Ga0105237_100218633 534
667 3300009551 Ga0105238_10044458 Ga0105238_100444583 534
668 3300013105 Ga0157369_10011108 Ga0157369_100111083 534
669 3300013307 Ga0157372_10017094 Ga0157372_100170942 534
670 3300025912 Ga0207707_10007781 Ga0207707_100077812 534
671 3300025935 Ga0207709_10029106 Ga0207709_100291063 534
672 3300048907 Ga0496104_0205506 Ga0496104_0205506_159_1850 534
673 3300049568 Ga0501031_0032255 Ga0501031_0032255_185_1870 534
674 3300061734 Ga0530510_0020513 Ga0530510_0020513_14_1699 534
675 3300005441 Ga0070700_100021607 Ga0070700_1000216072 535
676 3300005544 Ga0070686_100122995 Ga0070686_1001229951 535
677 3300010375 Ga0105239_10054291 Ga0105239_100542913 535
678 3300025919 Ga0207657_10013651 Ga0207657_100136514 535
679 3300025927 Ga0207687_10000842 Ga0207687_100008427 535
680 3300026023 Ga0207677_10004443 Ga0207677_100044437 535
681 3300026075 Ga0207708_10033380 Ga0207708_100333802 535
682 3300035118 Ga0373954_0042125 Ga0373954_0042125_132_1868 535
683 3300035120 Ga0373957_0019408 Ga0373957_0019408_176_1912 535
684 3300036401 Ga0373937_0063513 Ga0373937_0063513_599_2335 535
685 3300046462 Ga0495651_0018918 Ga0495651_0018918_1094_2830 535
686 3300048905 Ga0496102_0107632 Ga0496102_0107632_41_1729 535
687 3300048911 Ga0496108_0000337 Ga0496108_0000337_24490_26226 535
688 3300048912 Ga0496109_0054063 Ga0496109_0054063_13_1701 535
689 3300048913 Ga0496110_0070893 Ga0496110_0070893_917_2605 535
690 iso_pu_bacteria 2751185782 2753271297 535
691 3300005434 Ga0070709_10022372 Ga0070709_100223722 536
692 3300005437 Ga0070710_10020055 Ga0070710_100200552 536
693 3300005439 Ga0070711_100042360 Ga0070711_1000423602 536
694 3300006163 Ga0070715_10001284 Ga0070715_100012844 536
695 3300006173 Ga0070716_100012672 Ga0070716_1000126724 536
696 3300025898 Ga0207692_10006172 Ga0207692_100061723 536
697 3300025906 Ga0207699_10000619 Ga0207699_1000061914 536
698 3300025928 Ga0207700_10008259 Ga0207700_100082594 536
699 3300025939 Ga0207665_10000412 Ga0207665_100004129 536
700 3300048907 Ga0496104_0012420 Ga0496104_0012420_1511_3292 536
701 3300048908 Ga0496105_0016330 Ga0496105_0016330_1704_3500 536
702 3300048911 Ga0496108_0050752 Ga0496108_0050752_1235_3016 536
703 3300048915 Ga0496112_0008758 Ga0496112_0008758_1710_3491 536
704 3300048918 Ga0496115_0072365 Ga0496115_0072365_73_1854 536
705 3300005467 Ga0070706_100012140 Ga0070706_1000121407 537
706 3300006175 Ga0070712_100017813 Ga0070712_1000178131 537
707 3300025910 Ga0207684_10005740 Ga0207684_100057406 537
708 3300025915 Ga0207693_10027829 Ga0207693_100278292 537
709 3300045976 Ga0466967_0004137 Ga0466967_0004137_5685_7493 537
710 3300049588 Ga0501072_0011031 Ga0501072_0011031_842_2548 537
711 3300005329 Ga0070683_100004234 Ga0070683_10000423411 538
712 3300005616 Ga0068852_100110271 Ga0068852_1001102712 538
713 3300006173 Ga0070716_100046609 Ga0070716_1000466092 538
714 3300006175 Ga0070712_100055682 Ga0070712_1000556822 538
715 3300009094 Ga0111539_10019426 Ga0111539_100194267 538
716 3300025939 Ga0207665_10004021 Ga0207665_1000402110 538
717 iso_pu_bacteria 8054472261 8054474548 538
718 3300005327 Ga0070658_10149849 Ga0070658_101498492 539
719 3300005336 Ga0070680_100005054 Ga0070680_1000050543 539
720 3300005336 Ga0070680_100080356 Ga0070680_1000803562 539
721 3300005340 Ga0070689_100004510 Ga0070689_1000045102 539
722 3300005435 Ga0070714_100007815 Ga0070714_1000078158 539
723 3300005435 Ga0070714_100046678 Ga0070714_1000466782 539
724 3300005458 Ga0070681_10026083 Ga0070681_100260832 539
725 3300005459 Ga0068867_100044464 Ga0068867_1000444642 539
726 3300005530 Ga0070679_100033742 Ga0070679_1000337426 539
727 3300005535 Ga0070684_100000622 Ga0070684_1000006226 539
728 3300005577 Ga0068857_100005707 Ga0068857_1000057077 539
729 3300005614 Ga0068856_100136322 Ga0068856_1001363222 539
730 3300005615 Ga0070702_100059838 Ga0070702_1000598381 539
731 3300005616 Ga0068852_100005875 Ga0068852_1000058758 539
732 3300006881 Ga0068865_100066120 Ga0068865_1000661202 539
733 3300009101 Ga0105247_10039178 Ga0105247_100391782 539
734 3300009553 Ga0105249_10036681 Ga0105249_100366812 539
735 3300009553 Ga0105249_10046632 Ga0105249_100466322 539
736 3300010375 Ga0105239_10081713 Ga0105239_100817133 539
737 3300011119 Ga0105246_10038000 Ga0105246_100380002 539
738 3300013105 Ga0157369_10001889 Ga0157369_1000188916 539
739 3300013307 Ga0157372_10209447 Ga0157372_102094471 539
740 3300014745 Ga0157377_10014394 Ga0157377_100143944 539
741 3300020082 Ga0206353_11878011 Ga0206353_118780118 539
742 3300025917 Ga0207660_10043409 Ga0207660_100434092 539
743 3300025921 Ga0207652_10016208 Ga0207652_100162085 539
744 3300025928 Ga0207700_10004656 Ga0207700_100046566 539
745 3300025929 Ga0207664_10026630 Ga0207664_100266302 539
746 3300025944 Ga0207661_10006624 Ga0207661_100066242 539
747 3300025944 Ga0207661_10065827 Ga0207661_100658272 539
748 3300025945 Ga0207679_10060091 Ga0207679_100600912 539
749 3300026041 Ga0207639_10057038 Ga0207639_100570382 539
750 3300026075 Ga0207708_10032889 Ga0207708_100328892 539
751 3300026089 Ga0207648_10017309 Ga0207648_100173093 539
752 3300026116 Ga0207674_10000093 Ga0207674_1000009314 539
753 3300041512 Ga0451853_2073262 Ga0451853_2073262_1536_3224 539
754 3300046462 Ga0495651_0003513 Ga0495651_0003513_392_2116 539
755 3300046516 Ga0495628_0013221 Ga0495628_0013221_3779_5503 539
756 3300046529 Ga0495652_0000679 Ga0495652_0000679_432_2156 539
757 3300048905 Ga0496102_0079312 Ga0496102_0079312_98_1786 539
758 3300048907 Ga0496104_0019218 Ga0496104_0019218_3082_4851 539
759 3300048911 Ga0496108_0030880 Ga0496108_0030880_599_2368 539
760 3300048915 Ga0496112_0010866 Ga0496112_0010866_5101_6870 539
761 3300048916 Ga0496113_0050528 Ga0496113_0050528_389_2158 539
762 3300009148 Ga0105243_10094380 Ga0105243_100943802 540
763 3300025972 Ga0207668_10017830 Ga0207668_100178302 540
764 3300035695 Ga0373927_0016122 Ga0373927_0016122_2397_4241 540
765 3300042005 Ga0439448_0008553 Ga0439448_0008553_1066_2856 540
766 3300046559 Ga0495667_0002937 Ga0495667_0002937_9190_10920 540
767 3300046642 Ga0495634_0031861 Ga0495634_0031861_695_2425 540
768 3300047321 Ga0495676_0020754 Ga0495676_0020754_201_1952 540
769 3300047322 Ga0495680_0006733 Ga0495680_0006733_3927_5657 540
770 3300048905 Ga0496102_0082024 Ga0496102_0082024_700_2409 540
771 3300048917 Ga0496114_0030283 Ga0496114_0030283_2298_4007 540
772 3300049568 Ga0501031_0006295 Ga0501031_0006295_5147_6904 540
773 3300049573 Ga0501037_0072555 Ga0501037_0072555_206_1963 540
774 3300049575 Ga0501039_0049987 Ga0501039_0049987_674_2431 540
775 3300049576 Ga0501040_0005371 Ga0501040_0005371_528_2285 540
776 3300049576 Ga0501040_0009161 Ga0501040_0009161_638_2395 540
777 3300049577 Ga0501041_0039901 Ga0501041_0039901_235_1992 540
778 3300049577 Ga0501041_0056794 Ga0501041_0056794_248_1960 540
779 3300049578 Ga0501042_0002049 Ga0501042_0002049_1122_2879 540
780 3300049580 Ga0501046_0024415 Ga0501046_0024415_248_1960 540
781 3300049582 Ga0501048_0045918 Ga0501048_0045918_930_2687 540
782 3300049587 Ga0501071_0024018 Ga0501071_0024018_864_2621 540
783 3300049588 Ga0501072_0067248 Ga0501072_0067248_586_2343 540
784 3300049589 Ga0501073_0058246 Ga0501073_0058246_630_2387 540
785 3300049590 Ga0501074_0042949 Ga0501074_0042949_804_2561 540
786 3300049592 Ga0501076_0018257 Ga0501076_0018257_2467_4224 540
787 3300049592 Ga0501076_0038716 Ga0501076_0038716_865_2622 540
788 3300049593 Ga0501077_0051458 Ga0501077_0051458_342_2054 540
789 3300049741 Ga0501079_0021008 Ga0501079_0021008_2715_4427 540
790 3300049741 Ga0501079_0043254 Ga0501079_0043254_905_2662 540
791 3300049822 Ga0501035_0015257 Ga0501035_0015257_308_2020 540
792 3300049823 Ga0501044_0007168 Ga0501044_0007168_7147_8859 540
793 3300060353 Ga0501082_0009312 Ga0501082_0009312_759_2516 540
794 iso_pu_bacteria 2786546132 2786674696 540
795 iso_pu_bacteria 2877676314 2877677624 540
796 iso_pu_bacteria 2954673503 2954680706 540
797 iso_pu_bacteria 2954682443 2954683447 540
798 iso_pu_bacteria 3002998708 3002999400 540
799 3300036401 Ga0373937_0096125 Ga0373937_0096125_877_2628 541
800 3300046462 Ga0495651_0001498 Ga0495651_0001498_4485_6272 541
801 3300046463 Ga0495653_0036173 Ga0495653_0036173_193_1980 541
802 3300046516 Ga0495628_0052056 Ga0495628_0052056_251_2038 541
803 3300046516 Ga0495628_0094001 Ga0495628_0094001_292_2043 541
804 3300046529 Ga0495652_0009984 Ga0495652_0009984_1056_2843 541
805 3300046663 Ga0495635_0009283 Ga0495635_0009283_4052_5824 541
806 3300046675 Ga0495657_0003888 Ga0495657_0003888_766_2553 541
807 3300046809 Ga0495600_0017470 Ga0495600_0017470_1456_3228 541
808 3300046809 Ga0495600_0023354 Ga0495600_0023354_1034_2821 541
809 3300047317 Ga0495604_0046959 Ga0495604_0046959_284_2071 541
810 3300047322 Ga0495680_0002287 Ga0495680_0002287_1402_3189 541
811 3300047322 Ga0495680_0006516 Ga0495680_0006516_3032_4804 541
812 3300049572 Ga0501036_0106033 Ga0501036_0106033_259_2058 541
813 3300049574 Ga0501038_0000732 Ga0501038_0000732_777_2573 541
814 iso_pu_bacteria 2863404153 2863409549 541
815 3300031995 Ga0307409_100027270 Ga0307409_1000272703 543
816 3300032002 Ga0307416_100005109 Ga0307416_1000051096 543
817 3300032005 Ga0307411_10016550 Ga0307411_100165503 543
818 3300032126 Ga0307415_100037871 Ga0307415_1000378712 543
819 iso_pu_bacteria 2643221678 2644438961 543
820 iso_pu_bacteria 2808606359 2808847489 543
821 iso_pu_bacteria 2818991462 2819691367 543
822 iso_pu_bacteria 2818991469 2819729263 543
823 iso_pu_bacteria 2862382967 2862387072 543
824 iso_pu_bacteria 2862507626 2862510038 543
825 iso_pu_bacteria 2919468124 2919475622 543
826 iso_pu_bacteria 8008558824 8008565007 543
827 3300002075 JGI24738J21930_10002594 JGI24738J21930_100025943 544
828 3300002077 JGI24744J21845_10000361 JGI24744J21845_100003612 544
829 3300005329 Ga0070683_100040738 Ga0070683_1000407383 544
830 3300005345 Ga0070692_10001374 Ga0070692_100013743 544
831 3300005364 Ga0070673_100024595 Ga0070673_1000245952 544
832 3300005438 Ga0070701_10005335 Ga0070701_100053355 544
833 3300005441 Ga0070700_100012601 Ga0070700_1000126013 544
834 3300005459 Ga0068867_100021874 Ga0068867_1000218743 544
835 3300005535 Ga0070684_100022148 Ga0070684_1000221483 544
836 3300005543 Ga0070672_100039743 Ga0070672_1000397432 544
837 3300005615 Ga0070702_100009743 Ga0070702_1000097433 544
838 3300005616 Ga0068852_100009233 Ga0068852_1000092336 544
839 3300005719 Ga0068861_100002408 Ga0068861_1000024088 544
840 3300006038 Ga0075365_10013836 Ga0075365_100138362 544
841 3300006881 Ga0068865_100003709 Ga0068865_1000037097 544
842 3300009098 Ga0105245_10011825 Ga0105245_100118255 544
843 3300009148 Ga0105243_10009903 Ga0105243_100099033 544
844 3300009177 Ga0105248_10067072 Ga0105248_100670723 544
845 3300013307 Ga0157372_10129147 Ga0157372_101291472 544
846 3300014326 Ga0157380_10038542 Ga0157380_100385422 544
847 3300025908 Ga0207643_10007735 Ga0207643_100077351 544
848 3300025935 Ga0207709_10008686 Ga0207709_100086863 544
849 3300025940 Ga0207691_10013198 Ga0207691_100131983 544
850 3300025960 Ga0207651_10121339 Ga0207651_101213391 544
851 3300026041 Ga0207639_10057387 Ga0207639_100573872 544
852 3300026075 Ga0207708_10000985 Ga0207708_1000098516 544
853 3300026089 Ga0207648_10001308 Ga0207648_1000130828 544
854 3300026142 Ga0207698_10046821 Ga0207698_100468212 544
855 3300032002 Ga0307416_100114158 Ga0307416_1001141583 544
856 3300046689 Ga0495613_0091729 Ga0495613_0091729_319_2058 544
857 3300047322 Ga0495680_0027766 Ga0495680_0027766_1009_2748 544
858 3300047471 Ga0495684_0050461 Ga0495684_0050461_1274_3013 544
859 3300048911 Ga0496108_0082633 Ga0496108_0082633_496_2247 544
860 3300048912 Ga0496109_0102338 Ga0496109_0102338_909_2612 544
861 3300049570 Ga0501033_0013928 Ga0501033_0013928_3439_5211 544
862 3300049572 Ga0501036_0000582 Ga0501036_0000582_12990_14762 544
863 3300049575 Ga0501039_0000391 Ga0501039_0000391_16283_18055 544
864 3300049576 Ga0501040_0000516 Ga0501040_0000516_18321_20093 544
865 3300049577 Ga0501041_0004140 Ga0501041_0004140_6400_8172 544
866 3300049578 Ga0501042_0003403 Ga0501042_0003403_7492_9264 544
867 3300049579 Ga0501043_0001992 Ga0501043_0001992_2678_4450 544
868 3300049580 Ga0501046_0001108 Ga0501046_0001108_3323_5095 544
869 3300049582 Ga0501048_0000495 Ga0501048_0000495_8856_10628 544
870 3300049587 Ga0501071_0000731 Ga0501071_0000731_4428_6200 544
871 3300049588 Ga0501072_0001629 Ga0501072_0001629_12060_13832 544
872 3300049588 Ga0501072_0055103 Ga0501072_0055103_639_2384 544
873 3300049590 Ga0501074_0000958 Ga0501074_0000958_8712_10484 544
874 3300049591 Ga0501075_0000672 Ga0501075_0000672_4676_6448 544
875 3300049593 Ga0501077_0002810 Ga0501077_0002810_5351_7123 544
876 3300049741 Ga0501079_0000214 Ga0501079_0000214_13757_15529 544
877 3300049742 Ga0501080_0124125 Ga0501080_0124125_170_1942 544
878 3300049743 Ga0501081_0000596 Ga0501081_0000596_13757_15529 544
879 3300049824 Ga0501045_0000417 Ga0501045_0000417_13734_15506 544
880 3300050511 nmdc:mga08y16_33820_c1 nmdc:mga08y16_33820_c1_1353_3104 544
881 3300060353 Ga0501082_0004602 Ga0501082_0004602_7079_8851 544
882 iso_pu_bacteria 2558860280 2559432459 544

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

441

550

0.98

PF00916

Sulfate_transp

Sulfate permease family

19

390

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ezb-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9099 395 525
7v73-assembly1.cif.gz_A thermostabilized human prestin in complex with chloride 0.8865 2 531
7lhv-assembly1.cif.gz_B structure of arabidopsis thaliana sulfate transporter atsultr4;1 0.8862 2 526
8opq-assembly1.cif.gz_A structure of human solute carrier 26 family member a6 (slc26a6) anion transporter in an inward-facing state 0.8832 2 530
7s9d-assembly1.cif.gz_B cryo-em structure of dolphin prestin: intermediate state 0.8814 7 531
ID Description Score Start End Superfamily
af_P9WGF7_437_560_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9451 409 528 3.30.750.24
af_Q942E2_508_653_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9224 394 526 3.30.750.24
af_Q94LW6_488_626_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9189 394 528 3.30.750.24
af_I1KA21_504_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9182 394 528 3.30.750.24
af_Q10QI4_508_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9154 393 529 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A2U1BMN8-F1-model_v4 deleted 0.9522 1 532
AF-A0A521THE0-F1-model_v4 Sulfate permease 0.9491 1 529 GO:0008509
GO:0016020
GO:0098661
AF-A0A2V5KGL9-F1-model_v4 Sodium-independent anion transporter 0.9446 2 358 GO:0016020
GO:0055085
AF-A0A495K0Q3-F1-model_v4 High affinity sulfate transporter 1 0.9399 1 531 GO:0008509
GO:0016020
GO:0098661
AF-A0A656TQD3-F1-model_v4 deleted 0.9373 2 345

Feature Viewer

pLDDT pTM Quality
86.3 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map