F484591

General Info

Members Datasets Scaffolds Average Seq Length
883 378 1766 113

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10358841|Ga0307513_103588412
Length 123
Sequence MGTVLPFPATATGGRGNPRSSEQIGFARAELNRIVDLYGRMVAAGLWKDYAIAFEPGMAAFWAFRRTAERPEYRIEKRPAAGGRQGMWALVGESGQILRRGPELGPVLAPIERRLMKLVANQV

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
101 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
105 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
106 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
217 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
218 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
221 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
224 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
225 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
226 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
229 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
232 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
233 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
234 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
235 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
236 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
237 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
238 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
239 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
240 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
241 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
242 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
254 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
271 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
274 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
279 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
307 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
308 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
309 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
310 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
317 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
318 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
319 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
320 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
321 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
322 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
323 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
324 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
325 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
326 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
327 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
328 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
329 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
330 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
331 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
332 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
333 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
336 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
337 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
338 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
339 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
340 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
341 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
342 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
347 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
348 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
351 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
352 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
353 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
354 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
355 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
356 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
357 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
358 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
359 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
360 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
361 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
362 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
363 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
364 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
365 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
366 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
367 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
368 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
369 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
370 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
371 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
372 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
373 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
376 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
377 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
378 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.34
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.83
Nodule 0.34
Rhizoplane 2.83
Rhizosphere 79.84
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10358841 3300031456 Bacteria 1203
2 SwRhRL2b_contig_2704254 2162886007 Bacteria 3508
3 SwRhRL2b_contig_3171842 2162886007 Bacteria 907
4 ARcpr5yngRDRAFT_c004010 3300000043 Bacteria 1410
5 ARCol0yngRDRAFT_1001507 3300000652 Bacteria 1893
6 JGI24741J21665_1000228 3300001915 Bacteria 16799
7 JGI24741J21665_1001726 3300001915 Bacteria 6031
8 JGI24740J21852_10003943 3300001979 Bacteria 6441
9 JGI24740J21852_10006052 3300001979 Bacteria 5057
10 JGI24739J22299_10001727 3300001989 Bacteria 8304
11 JGI24739J22299_10062269 3300001989 Bacteria 1177
12 JGI24739J22299_10106652 3300001989 Bacteria 843
13 JGI24739J22299_10162518 3300001989 Bacteria 659
14 JGI24737J22298_10001061 3300001990 Bacteria 9709
15 JGI24737J22298_10006500 3300001990 Bacteria 3989
16 JGI24737J22298_10007233 3300001990 Bacteria 3754
17 JGI24737J22298_10012547 3300001990 Bacteria 2763
18 JGI24737J22298_10028582 3300001990 Bacteria 1752
19 JGI24737J22298_10163449 3300001990 Bacteria 657
20 JGI24735J21928_10002009 3300002067 Bacteria 7153
21 JGI24735J21928_10007545 3300002067 Bacteria 3545
22 JGI24735J21928_10007736 3300002067 Bacteria 3493
23 JGI24735J21928_10014606 3300002067 Bacteria 2458
24 JGI24735J21928_10025048 3300002067 Bacteria 1802
25 JGI24748J21848_1029298 3300002074 Bacteria 678
26 JGI24738J21930_10085601 3300002075 Bacteria 663
27 JGI24749J21850_1000076 3300002076 Bacteria 17900
28 JGI24744J21845_10017741 3300002077 Bacteria 1414
29 JGI24034J26672_10086268 3300002239 Bacteria 578
30 JGI24034J26672_10098801 3300002239 Bacteria 548
31 JGI24742J22300_10053852 3300002244 Bacteria 732
32 JGI24742J22300_10099262 3300002244 Bacteria 562
33 JGI24751J29686_10000195 3300002459 Bacteria 26688
34 JGI25153J46596_10000002 3300003215 Bacteria 653569
35 JGI25153J46596_10005653 3300003215 Bacteria 6524
36 rootH2_10026085 3300003320 Bacteria 1849
37 rootH1_10042232 3300003323 Bacteria 2212
38 Ga0055542_1008070 3300003762 Bacteria 2084
39 Ga0055542_1026022 3300003762 Bacteria 791
40 Ga0055529_1009231 3300003763 Bacteria 1298
41 Ga0055526_1001039 3300003771 Bacteria 20291
42 Ga0055537_1002318 3300003773 Bacteria 6499
43 Ga0055537_1005551 3300003773 Bacteria 3365
44 Ga0055524_1000056 3300003775 Bacteria 141764
45 Ga0055530_10008426 3300003791 Bacteria 4134
46 Ga0055530_10052238 3300003791 Bacteria 944
47 Ga0055531_10001973 3300003794 Bacteria 14309
48 Ga0055543_1065149 3300004625 Bacteria 579
49 Ga0058859_11339750 3300004798 Unclassified 619
50 Ga0065165_1023324 3300005262 Bacteria 2101
51 Ga0065165_1045828 3300005262 Bacteria 1272
52 Ga0065704_10000880 3300005289 Bacteria 11265
53 Ga0065704_10021576 3300005289 Bacteria 1421
54 Ga0065704_10102515 3300005289 Bacteria 2202
55 Ga0065707_10004914 3300005295 Bacteria 4993
56 Ga0065707_10085091 3300005295 Bacteria 6474
57 Ga0065707_10090551 3300005295 Bacteria 4117
58 Ga0065707_10435780 3300005295 Bacteria 815
59 Ga0070658_10000002 3300005327 Bacteria 637290
60 Ga0070658_10000608 3300005327 Bacteria 31026
61 Ga0070658_10003163 3300005327 Bacteria 13593
62 Ga0070658_10294785 3300005327 Bacteria 1382
63 Ga0070676_10001330 3300005328 Bacteria 12417
64 Ga0070670_100000033 3300005331 Bacteria 158509
65 Ga0070670_100611841 3300005331 Bacteria 975
66 Ga0070670_101197457 3300005331 Bacteria 694
67 Ga0070677_10000317 3300005333 Bacteria 16850
68 Ga0068869_100000539 3300005334 Bacteria 21181
69 Ga0068869_100282971 3300005334 Bacteria 1334
70 Ga0068869_100715426 3300005334 Bacteria 855
71 Ga0068869_101199531 3300005334 Bacteria 667
72 Ga0070666_10094384 3300005335 Bacteria 2058
73 Ga0070666_10102081 3300005335 Bacteria 1977
74 Ga0070682_100962338 3300005337 Bacteria 706
75 Ga0068868_100012870 3300005338 Bacteria 6120
76 Ga0070660_100000137 3300005339 Bacteria 46762
77 Ga0070660_100000561 3300005339 Bacteria 24963
78 Ga0070660_100062727 3300005339 Bacteria 2888
79 Ga0070660_100087481 3300005339 Bacteria 2452
80 Ga0070660_100105325 3300005339 Bacteria 2238
81 Ga0070661_100007643 3300005344 Bacteria 7461
82 Ga0070661_100273053 3300005344 Bacteria 1310
83 Ga0070661_100415539 3300005344 Bacteria 1066
84 Ga0070692_10003203 3300005345 Bacteria 6584
85 Ga0070668_100000018 3300005347 Bacteria 99142
86 Ga0070668_100008256 3300005347 Bacteria 7729
87 Ga0070668_100009296 3300005347 Bacteria 7289
88 Ga0070668_100029208 3300005347 Bacteria 4186
89 Ga0070668_100097071 3300005347 Bacteria 2330
90 Ga0070668_100395096 3300005347 Bacteria 1179
91 Ga0070668_100558380 3300005347 Bacteria 997
92 Ga0070668_102240225 3300005347 Bacteria 505
93 Ga0070669_100000005 3300005353 Bacteria 309134
94 Ga0070669_100047551 3300005353 Bacteria 3130
95 Ga0070669_100098822 3300005353 Bacteria 2199
96 Ga0070669_100185357 3300005353 Bacteria 1630
97 Ga0070669_100186036 3300005353 Bacteria 1627
98 Ga0070669_100534466 3300005353 Bacteria 976
99 Ga0070675_100000664 3300005354 Bacteria 23789
100 Ga0070675_100303583 3300005354 Bacteria 1407
101 Ga0070675_101078977 3300005354 Bacteria 738
102 Ga0070675_101387591 3300005354 Bacteria 648
103 Ga0070671_100000189 3300005355 Bacteria 41536
104 Ga0070671_100002574 3300005355 Bacteria 14066
105 Ga0070671_100058331 3300005355 Bacteria 3214
106 Ga0070671_100462264 3300005355 Bacteria 1089
107 Ga0070671_101227681 3300005355 Bacteria 660
108 Ga0070674_100000527 3300005356 Bacteria 19255
109 Ga0070674_100019659 3300005356 Bacteria 4295
110 Ga0070674_100047101 3300005356 Bacteria 2952
111 Ga0070674_100048838 3300005356 Bacteria 2906
112 Ga0070673_100000007 3300005364 Bacteria 177157
113 Ga0070673_102179771 3300005364 Bacteria 527
114 Ga0070659_100010029 3300005366 Bacteria 6972
115 Ga0070659_100031864 3300005366 Bacteria 4086
116 Ga0070659_100065018 3300005366 Bacteria 2888
117 Ga0070659_100102921 3300005366 Bacteria 2299
118 Ga0070659_100199063 3300005366 Bacteria 1648
119 Ga0070659_100282044 3300005366 Bacteria 1382
120 Ga0070659_100680563 3300005366 Bacteria 888
121 Ga0070659_100937630 3300005366 Bacteria 758
122 Ga0070667_100000089 3300005367 Bacteria 113661
123 Ga0070667_100005221 3300005367 Bacteria 10854
124 Ga0070667_100139378 3300005367 Bacteria 2123
125 Ga0070667_100327880 3300005367 Bacteria 1382
126 Ga0070667_101784883 3300005367 Bacteria 579
127 Ga0070701_10177318 3300005438 Bacteria 1245
128 Ga0070701_10605475 3300005438 Bacteria 726
129 Ga0070701_11045938 3300005438 Bacteria 572
130 Ga0070663_100016292 3300005455 Bacteria 4823
131 Ga0070663_100220730 3300005455 Bacteria 1488
132 Ga0070663_100280633 3300005455 Bacteria 1327
133 Ga0070663_100342679 3300005455 Bacteria 1208
134 Ga0070678_100000271 3300005456 Bacteria 24005
135 Ga0070678_100007473 3300005456 Bacteria 6487
136 Ga0070662_100239416 3300005457 Bacteria 1455
137 Ga0070662_100262273 3300005457 Bacteria 1392
138 Ga0070662_100335230 3300005457 Unclassified 1236
139 Ga0070662_100903529 3300005457 Bacteria 753
140 Ga0070662_100958247 3300005457 Bacteria 732
141 Ga0070662_101342573 3300005457 Bacteria 616
142 Ga0070681_11815822 3300005458 Bacteria 537
143 Ga0068867_100000134 3300005459 Bacteria 47761
144 Ga0070685_10520041 3300005466 Bacteria 845
145 Ga0070699_100729328 3300005518 Bacteria 906
146 Ga0068853_100298564 3300005539 Bacteria 1488
147 Ga0068853_100715865 3300005539 Bacteria 955
148 Ga0068853_100808760 3300005539 Bacteria 898
149 Ga0068853_101336861 3300005539 Bacteria 693
150 Ga0068853_101431514 3300005539 Bacteria 669
151 Ga0070672_100009747 3300005543 Bacteria 6633
152 Ga0070672_100117631 3300005543 Bacteria 2173
153 Ga0070672_100244314 3300005543 Bacteria 1511
154 Ga0070672_100441548 3300005543 Bacteria 1120
155 Ga0070672_100483844 3300005543 Bacteria 1069
156 Ga0070696_100683838 3300005546 Bacteria 835
157 Ga0070665_100000265 3300005548 Bacteria 85729
158 Ga0070665_100000493 3300005548 Bacteria 56564
159 Ga0070665_100028240 3300005548 Bacteria 5650
160 Ga0070665_100084455 3300005548 Bacteria 3181
161 Ga0070665_100264549 3300005548 Bacteria 1721
162 Ga0070665_100650171 3300005548 Bacteria 1067
163 Ga0070665_100668471 3300005548 Bacteria 1052
164 Ga0070665_102528454 3300005548 Bacteria 515
165 Ga0068855_100000191 3300005563 Bacteria 79120
166 Ga0068855_100179242 3300005563 Bacteria 2396
167 Ga0068855_100476636 3300005563 Bacteria 1359
168 Ga0068855_100867477 3300005563 Bacteria 955
169 Ga0070664_100031198 3300005564 Bacteria 4450
170 Ga0070664_100149494 3300005564 Bacteria 2061
171 Ga0070664_101034887 3300005564 Bacteria 772
172 Ga0068857_100096788 3300005577 Bacteria 2645
173 Ga0068857_100170339 3300005577 Bacteria 1979
174 Ga0068857_100298447 3300005577 Bacteria 1485
175 Ga0068857_100813241 3300005577 Bacteria 893
176 Ga0068857_101091141 3300005577 Bacteria 770
177 Ga0068854_100070232 3300005578 Bacteria 2559
178 Ga0068854_100224649 3300005578 Bacteria 1487
179 Ga0068854_100771223 3300005578 Bacteria 836
180 Ga0068854_100936697 3300005578 Bacteria 763
181 Ga0068854_101020136 3300005578 Bacteria 733
182 Ga0068856_100008621 3300005614 Bacteria 9916
183 Ga0068856_100311578 3300005614 Bacteria 1591
184 Ga0068852_100095289 3300005616 Bacteria 2672
185 Ga0068852_100134152 3300005616 Bacteria 2284
186 Ga0068852_100204240 3300005616 Bacteria 1871
187 Ga0068852_100740033 3300005616 Bacteria 995
188 Ga0068859_100010744 3300005617 Bacteria 9214
189 Ga0068859_100011274 3300005617 Bacteria 8995
190 Ga0068859_100016302 3300005617 Bacteria 7465
191 Ga0068859_100268857 3300005617 Bacteria 1797
192 Ga0068859_101513920 3300005617 Bacteria 740
193 Ga0068859_102256822 3300005617 Bacteria 600
194 Ga0068864_100000042 3300005618 Bacteria 162930
195 Ga0068866_10128821 3300005718 Bacteria 1436
196 Ga0068861_100023975 3300005719 Bacteria 4407
197 Ga0068861_100065855 3300005719 Bacteria 2792
198 Ga0068861_100807385 3300005719 Bacteria 881
199 Ga0068861_100904161 3300005719 Bacteria 836
200 Ga0068861_101598729 3300005719 Bacteria 642
201 Ga0068851_10037591 3300005834 Bacteria 2427
202 Ga0068851_10038999 3300005834 Bacteria 2385
203 Ga0068851_10447647 3300005834 Bacteria 767
204 Ga0068851_10627986 3300005834 Bacteria 656
205 Ga0068870_10529845 3300005840 Bacteria 790
206 Ga0068863_100000030 3300005841 Bacteria 176023
207 Ga0068863_100001219 3300005841 Bacteria 25689
208 Ga0068863_100003973 3300005841 Bacteria 14604
209 Ga0068858_100488825 3300005842 Bacteria 1188
210 Ga0068860_100000148 3300005843 Bacteria 113661
211 Ga0068860_100002421 3300005843 Bacteria 19585
212 Ga0068860_100077492 3300005843 Bacteria 3161
213 Ga0068860_100943145 3300005843 Bacteria 880
214 Ga0068860_101090979 3300005843 Bacteria 817
215 Ga0068862_100000005 3300005844 Bacteria 350713
216 Ga0068862_100000149 3300005844 Bacteria 79784
217 Ga0068862_100014432 3300005844 Bacteria 6555
218 Ga0068862_100022099 3300005844 Bacteria 5322
219 Ga0068862_101350836 3300005844 Bacteria 715
220 Ga0068862_102062504 3300005844 Bacteria 581
221 Ga0081539_10165735 3300005985 Bacteria 1049
222 Ga0075432_10482713 3300006058 Bacteria 549
223 Ga0097621_100062388 3300006237 Bacteria 3060
224 Ga0075370_10403154 3300006353 Bacteria 820
225 Ga0075430_100035193 3300006846 Bacteria 4249
226 Ga0068865_100000008 3300006881 Bacteria 177158
227 Ga0068865_100840529 3300006881 Bacteria 795
228 Ga0097620_100010744 3300006931 Bacteria 9214
229 Ga0097620_100011274 3300006931 Bacteria 8995
230 Ga0097620_100016302 3300006931 Bacteria 7465
231 Ga0097620_100268850 3300006931 Bacteria 1797
232 Ga0097620_101513960 3300006931 Bacteria 740
233 Ga0097620_102256473 3300006931 Bacteria 600
234 Ga0079104_1055173 3300006946 Bacteria 872
235 Ga0099826_10421449 3300006948 Bacteria 643
236 Ga0105251_10009288 3300009011 Bacteria 5822
237 Ga0105240_10120463 3300009093 Bacteria 3160
238 Ga0105240_10154472 3300009093 Bacteria 2731
239 Ga0111539_10670297 3300009094 Bacteria 1208
240 Ga0105245_10001922 3300009098 Bacteria 18868
241 Ga0105245_10095357 3300009098 Bacteria 2745
242 Ga0105245_10708213 3300009098 Bacteria 1040
243 Ga0105245_11127325 3300009098 Bacteria 831
244 Ga0105247_10004166 3300009101 Bacteria 9275
245 Ga0105247_11233653 3300009101 Bacteria 597
246 Ga0105243_10000213 3300009148 Bacteria 67585
247 Ga0105243_10003232 3300009148 Bacteria 13310
248 Ga0105243_10057527 3300009148 Bacteria 3096
249 Ga0105243_10413212 3300009148 Bacteria 1256
250 Ga0105243_11127751 3300009148 Bacteria 794
251 Ga0105243_11800105 3300009148 Bacteria 643
252 Ga0105241_10002321 3300009174 Bacteria 14295
253 Ga0105241_10012233 3300009174 Bacteria 6297
254 Ga0105241_11611788 3300009174 Bacteria 628
255 Ga0105241_12668187 3300009174 Bacteria 503
256 Ga0105242_10000437 3300009176 Bacteria 33251
257 Ga0105242_11245171 3300009176 Bacteria 765
258 Ga0105242_11841882 3300009176 Bacteria 644
259 Ga0105248_10000171 3300009177 Bacteria 75565
260 Ga0105248_10316025 3300009177 Bacteria 1759
261 Ga0105237_10046738 3300009545 Bacteria 4354
262 Ga0105237_10125051 3300009545 Bacteria 2566
263 Ga0105237_11493221 3300009545 Bacteria 682
264 Ga0105237_12111537 3300009545 Bacteria 572
265 Ga0105238_10110993 3300009551 Bacteria 2722
266 Ga0105238_10823291 3300009551 Bacteria 945
267 Ga0105238_10835782 3300009551 Bacteria 937
268 Ga0105238_11046774 3300009551 Bacteria 838
269 Ga0105238_11126041 3300009551 Bacteria 808
270 Ga0105238_11799142 3300009551 Bacteria 645
271 Ga0105249_10000056 3300009553 Bacteria 160443
272 Ga0105249_10015107 3300009553 Bacteria 6831
273 Ga0105249_10019471 3300009553 Bacteria 6055
274 Ga0105249_10060847 3300009553 Bacteria 3465
275 Ga0105249_10904749 3300009553 Bacteria 949
276 Ga0105148_100086 3300009978 Bacteria 14695
277 Ga0105147_105670 3300009982 Bacteria 1051
278 Ga0105239_10034267 3300010375 Bacteria 5574
279 Ga0105239_10239671 3300010375 Bacteria 2036
280 Ga0105246_10002390 3300011119 Bacteria 11329
281 Ga0105246_10041447 3300011119 Bacteria 3112
282 Ga0105246_11067787 3300011119 Bacteria 735
283 Ga0157317_1002050 3300012475 Bacteria 1158
284 Ga0157327_1015475 3300012512 Bacteria 794
285 Ga0157326_1000010 3300012513 Bacteria 16665
286 Ga0157373_10013087 3300013100 Bacteria 6089
287 Ga0157373_10015808 3300013100 Bacteria 5510
288 Ga0157373_10046169 3300013100 Bacteria 3108
289 Ga0157373_10061923 3300013100 Bacteria 2650
290 Ga0157371_10000059 3300013102 Bacteria 170541
291 Ga0157370_10016799 3300013104 Bacteria 7401
292 Ga0157370_10175173 3300013104 Bacteria 1994
293 Ga0157370_11074959 3300013104 Bacteria 727
294 Ga0157369_10002550 3300013105 Bacteria 21798
295 Ga0157369_10147458 3300013105 Bacteria 2487
296 Ga0157369_10380251 3300013105 Bacteria 1466
297 Ga0157374_10019747 3300013296 Bacteria 5970
298 Ga0157374_10029189 3300013296 Bacteria 4991
299 Ga0157374_12265340 3300013296 Bacteria 570
300 Ga0157378_10004325 3300013297 Bacteria 12498
301 Ga0163162_10068729 3300013306 Bacteria 3594
302 Ga0163162_10368425 3300013306 Bacteria 1570
303 Ga0163162_11082141 3300013306 Bacteria 908
304 Ga0163162_12395927 3300013306 Bacteria 607
305 Ga0157372_10358684 3300013307 Bacteria 1698
306 Ga0157372_10535199 3300013307 Bacteria 1366
307 Ga0157372_10537722 3300013307 Bacteria 1362
308 Ga0157372_10852825 3300013307 Bacteria 1058
309 Ga0157372_10991801 3300013307 Bacteria 973
310 Ga0157372_12227023 3300013307 Bacteria 629
311 Ga0157372_12313318 3300013307 Bacteria 617
312 Ga0157375_10004295 3300013308 Bacteria 12363
313 Ga0157375_11334067 3300013308 Bacteria 844
314 Ga0163163_10408569 3300014325 Bacteria 1416
315 Ga0163163_11842621 3300014325 Bacteria 665
316 Ga0157380_10000084 3300014326 Bacteria 52067
317 Ga0157380_10006098 3300014326 Bacteria 8448
318 Ga0157380_11226862 3300014326 Bacteria 794
319 Ga0157377_10046846 3300014745 Bacteria 2420
320 Ga0157376_10000315 3300014969 Bacteria 32437
321 Ga0157376_11007997 3300014969 Bacteria 855
322 Ga0157376_11171708 3300014969 Bacteria 796
323 Ga0163161_10003807 3300017792 Bacteria 10577
324 Ga0163161_10220521 3300017792 Bacteria 1468
325 Ga0163161_10238126 3300017792 Bacteria 1414
326 Ga0163161_10677675 3300017792 Bacteria 857
327 Ga0206354_10227562 3300020081 Bacteria 2130
328 Ga0206353_11261817 3300020082 Bacteria 25116
329 Ga0213873_10000019 3300021358 Bacteria 122085
330 Ga0213874_10213503 3300021377 Bacteria 699
331 Ga0213876_10000075 3300021384 Bacteria 120068
332 Ga0213876_10001526 3300021384 Bacteria 14331
333 Ga0213875_10000323 3300021388 Bacteria 45327
334 Ga0209674_103791 3300025226 Bacteria 2666
335 Ga0209563_100116 3300025230 Bacteria 134661
336 Ga0207425_1002702 3300025245 Bacteria 6063
337 Ga0209026_1012534 3300025250 Bacteria 1474
338 Ga0209677_104219 3300025253 Bacteria 4248
339 Ga0209148_1000398 3300025254 Bacteria 50941
340 Ga0209148_1001103 3300025254 Bacteria 16204
341 Ga0209233_1080964 3300025261 Bacteria 578
342 Ga0209565_1000008 3300025263 Bacteria 774179
343 Ga0209565_1000244 3300025263 Bacteria 58330
344 Ga0209455_1001110 3300025272 Bacteria 13190
345 Ga0209673_1000569 3300025273 Bacteria 58821
346 Ga0209673_1006074 3300025273 Bacteria 5925
347 Ga0209564_1009843 3300025295 Bacteria 4485
348 Ga0209564_1030333 3300025295 Bacteria 1677
349 Ga0209758_1000001 3300025297 Bacteria 1981790
350 Ga0209758_1002073 3300025297 Bacteria 21369
351 Ga0209050_1003166 3300025298 Bacteria 12531
352 Ga0209050_1038584 3300025298 Bacteria 1359
353 Ga0209256_1000009 3300025299 Bacteria 922071
354 Ga0209256_1000010 3300025299 Bacteria 912110
355 Ga0209257_1003147 3300025304 Bacteria 14718
356 Ga0207656_10006564 3300025321 Bacteria 4193
357 Ga0207713_1097285 3300025735 Bacteria 1022
358 Ga0207682_10000624 3300025893 Bacteria 16451
359 Ga0207642_10584665 3300025899 Bacteria 693
360 Ga0207710_10007932 3300025900 Bacteria 4489
361 Ga0207680_10044629 3300025903 Bacteria 2608
362 Ga0207680_10087932 3300025903 Bacteria 1969
363 Ga0207647_10047708 3300025904 Bacteria 2663
364 Ga0207647_10059593 3300025904 Bacteria 2336
365 Ga0207647_10126621 3300025904 Bacteria 1503
366 Ga0207647_10136397 3300025904 Bacteria 1440
367 Ga0207647_10316887 3300025904 Bacteria 886
368 Ga0207645_10001217 3300025907 Bacteria 21219
369 Ga0207645_10040611 3300025907 Bacteria 2979
370 Ga0207645_10829117 3300025907 Bacteria 629
371 Ga0207705_10000008 3300025909 Bacteria 589717
372 Ga0207705_10000197 3300025909 Bacteria 61058
373 Ga0207705_10009236 3300025909 Bacteria 7177
374 Ga0207654_10001228 3300025911 Bacteria 13697
375 Ga0207707_10630770 3300025912 Bacteria 905
376 Ga0207695_10029722 3300025913 Bacteria 6030
377 Ga0207695_10059676 3300025913 Bacteria 3954
378 Ga0207695_11195947 3300025913 Bacteria 640
379 Ga0207671_10076484 3300025914 Bacteria 2505
380 Ga0207657_10001820 3300025919 Bacteria 22995
381 Ga0207657_10004655 3300025919 Bacteria 14494
382 Ga0207657_10021785 3300025919 Bacteria 6021
383 Ga0207657_10031380 3300025919 Bacteria 4813
384 Ga0207657_10065746 3300025919 Bacteria 3090
385 Ga0207657_10104067 3300025919 Bacteria 2352
386 Ga0207657_10355578 3300025919 Bacteria 1155
387 Ga0207649_10000225 3300025920 Bacteria 46073
388 Ga0207681_10000003 3300025923 Bacteria 713245
389 Ga0207681_10222448 3300025923 Bacteria 1461
390 Ga0207681_10261162 3300025923 Bacteria 1356
391 Ga0207681_10492107 3300025923 Bacteria 1003
392 Ga0207681_10862858 3300025923 Bacteria 757
393 Ga0207681_11229633 3300025923 Bacteria 629
394 Ga0207694_10008225 3300025924 Bacteria 7888
395 Ga0207694_10048518 3300025924 Bacteria 3285
396 Ga0207694_11066471 3300025924 Bacteria 684
397 Ga0207694_11270717 3300025924 Bacteria 623
398 Ga0207650_10000012 3300025925 Bacteria 437889
399 Ga0207650_10512520 3300025925 Bacteria 1003
400 Ga0207650_11203270 3300025925 Bacteria 645
401 Ga0207659_10002169 3300025926 Bacteria 11660
402 Ga0207687_10004919 3300025927 Bacteria 8874
403 Ga0207687_10221646 3300025927 Bacteria 1490
404 Ga0207644_10000096 3300025931 Bacteria 63618
405 Ga0207644_10172545 3300025931 Bacteria 1689
406 Ga0207644_10280019 3300025931 Bacteria 1339
407 Ga0207644_11156170 3300025931 Bacteria 650
408 Ga0207690_10003708 3300025932 Bacteria 9081
409 Ga0207690_10006876 3300025932 Bacteria 6748
410 Ga0207690_10020317 3300025932 Bacteria 4102
411 Ga0207690_10023602 3300025932 Bacteria 3840
412 Ga0207690_10403802 3300025932 Bacteria 1090
413 Ga0207690_11041125 3300025932 Bacteria 681
414 Ga0207706_10073104 3300025933 Bacteria 3015
415 Ga0207706_10095684 3300025933 Bacteria 2612
416 Ga0207706_10234640 3300025933 Bacteria 1604
417 Ga0207706_10271714 3300025933 Bacteria 1479
418 Ga0207706_10320350 3300025933 Unclassified 1349
419 Ga0207706_10324756 3300025933 Bacteria 1339
420 Ga0207706_10575052 3300025933 Bacteria 969
421 Ga0207686_10000908 3300025934 Bacteria 17774
422 Ga0207686_10914065 3300025934 Bacteria 709
423 Ga0207686_11070967 3300025934 Bacteria 656
424 Ga0207709_10000018 3300025935 Bacteria 431545
425 Ga0207709_10000399 3300025935 Bacteria 42600
426 Ga0207709_10056889 3300025935 Bacteria 2423
427 Ga0207709_10778053 3300025935 Bacteria 771
428 Ga0207670_11146560 3300025936 Bacteria 657
429 Ga0207669_10000068 3300025937 Bacteria 52240
430 Ga0207669_10097629 3300025937 Bacteria 1932
431 Ga0207669_10165796 3300025937 Bacteria 1566
432 Ga0207669_10193174 3300025937 Bacteria 1470
433 Ga0207704_10000013 3300025938 Bacteria 170478
434 Ga0207704_11104321 3300025938 Bacteria 674
435 Ga0207691_10013456 3300025940 Bacteria 7830
436 Ga0207691_10334715 3300025940 Bacteria 1297
437 Ga0207691_10384679 3300025940 Bacteria 1198
438 Ga0207691_10459888 3300025940 Bacteria 1082
439 Ga0207711_10001461 3300025941 Bacteria 22080
440 Ga0207689_10000852 3300025942 Bacteria 29407
441 Ga0207689_10513223 3300025942 Bacteria 1005
442 Ga0207679_10096554 3300025945 Bacteria 2300
443 Ga0207679_10220374 3300025945 Bacteria 1596
444 Ga0207679_11237767 3300025945 Bacteria 685
445 Ga0207667_10000107 3300025949 Bacteria 133066
446 Ga0207667_10000113 3300025949 Bacteria 131083
447 Ga0207667_10029652 3300025949 Bacteria 5931
448 Ga0207667_10040848 3300025949 Bacteria 4936
449 Ga0207667_10289671 3300025949 Bacteria 1673
450 Ga0207667_11944280 3300025949 Bacteria 549
451 Ga0207651_10000013 3300025960 Bacteria 177573
452 Ga0207651_10856658 3300025960 Bacteria 808
453 Ga0207712_10000015 3300025961 Bacteria 346689
454 Ga0207712_10007843 3300025961 Bacteria 6749
455 Ga0207712_10231975 3300025961 Bacteria 1482
456 Ga0207712_10282526 3300025961 Bacteria 1355
457 Ga0207668_10000082 3300025972 Bacteria 71860
458 Ga0207668_10002153 3300025972 Bacteria 11488
459 Ga0207668_10003245 3300025972 Bacteria 9538
460 Ga0207668_10094341 3300025972 Bacteria 2206
461 Ga0207668_10109849 3300025972 Bacteria 2067
462 Ga0207668_10277830 3300025972 Bacteria 1372
463 Ga0207668_10782422 3300025972 Bacteria 843
464 Ga0207640_10013098 3300025981 Bacteria 4743
465 Ga0207640_10016371 3300025981 Bacteria 4312
466 Ga0207640_10745270 3300025981 Bacteria 844
467 Ga0207640_10896765 3300025981 Bacteria 774
468 Ga0207658_10000069 3300025986 Bacteria 113687
469 Ga0207658_10013699 3300025986 Bacteria 5546
470 Ga0207658_10176272 3300025986 Bacteria 1766
471 Ga0207658_11243804 3300025986 Bacteria 681
472 Ga0207677_10007087 3300026023 Bacteria 6171
473 Ga0207703_10558857 3300026035 Bacteria 1079
474 Ga0207639_10000269 3300026041 Bacteria 37143
475 Ga0207639_10002666 3300026041 Bacteria 11981
476 Ga0207639_10078461 3300026041 Bacteria 2606
477 Ga0207639_10163513 3300026041 Bacteria 1878
478 Ga0207639_10209648 3300026041 Bacteria 1676
479 Ga0207639_10483699 3300026041 Bacteria 1129
480 Ga0207639_10657564 3300026041 Bacteria 970
481 Ga0207639_11150271 3300026041 Bacteria 728
482 Ga0207639_11429729 3300026041 Bacteria 649
483 Ga0207678_10000400 3300026067 Bacteria 39732
484 Ga0207678_10041375 3300026067 Bacteria 3996
485 Ga0207678_10049909 3300026067 Bacteria 3616
486 Ga0207702_10001111 3300026078 Bacteria 27466
487 Ga0207702_10006623 3300026078 Bacteria 9964
488 Ga0207641_10000001 3300026088 Bacteria 1180841
489 Ga0207641_10004476 3300026088 Bacteria 12094
490 Ga0207641_10004557 3300026088 Bacteria 11975
491 Ga0207648_10000382 3300026089 Bacteria 48961
492 Ga0207676_10000009 3300026095 Bacteria 545256
493 Ga0207674_10003571 3300026116 Bacteria 18967
494 Ga0207674_10036095 3300026116 Bacteria 5155
495 Ga0207674_10171019 3300026116 Bacteria 2126
496 Ga0207674_10273124 3300026116 Bacteria 1638
497 Ga0207674_11171166 3300026116 Bacteria 738
498 Ga0207675_100001338 3300026118 Bacteria 24709
499 Ga0207675_101215545 3300026118 Bacteria 774
500 Ga0207675_101375987 3300026118 Bacteria 726
501 Ga0207683_10004636 3300026121 Bacteria 11854
502 Ga0207683_10031296 3300026121 Bacteria 4618
503 Ga0207698_10005545 3300026142 Bacteria 7808
504 Ga0207698_10007060 3300026142 Bacteria 7035
505 Ga0207698_10986946 3300026142 Bacteria 852
506 Ga0207698_11546020 3300026142 Bacteria 679
507 Ga0209282_1423339 3300027666 Bacteria 514
508 Ga0209974_10150676 3300027876 Bacteria 839
509 Ga0209974_10250693 3300027876 Bacteria 666
510 Ga0268266_10000592 3300028379 Bacteria 49766
511 Ga0268266_10001249 3300028379 Bacteria 31063
512 Ga0268266_10043391 3300028379 Bacteria 3843
513 Ga0268266_10045446 3300028379 Bacteria 3757
514 Ga0268266_10529866 3300028379 Bacteria 1127
515 Ga0268266_10758684 3300028379 Bacteria 936
516 Ga0268265_10000001 3300028380 Bacteria 1230727
517 Ga0268265_10000021 3300028380 Bacteria 272292
518 Ga0268265_10084475 3300028380 Bacteria 2516
519 Ga0268265_11110522 3300028380 Bacteria 785
520 Ga0268265_11147560 3300028380 Bacteria 773
521 Ga0268265_11624645 3300028380 Bacteria 651
522 Ga0268264_10000217 3300028381 Bacteria 113674
523 Ga0268264_10000820 3300028381 Bacteria 33465
524 Ga0268264_10073017 3300028381 Bacteria 2911
525 Ga0268264_10284417 3300028381 Bacteria 1550
526 Ga0268264_10785682 3300028381 Bacteria 950
527 Ga0307517_10026887 3300028786 Bacteria 6941
528 Ga0307517_10247107 3300028786 Bacteria 1051
529 Ga0307513_10080483 3300031456 Bacteria 3360
530 Ga0307513_10096035 3300031456 Bacteria 3003
531 Ga0307513_10868071 3300031456 Bacteria 609
532 Ga0307408_100003396 3300031548 Bacteria 10921
533 Ga0307408_100201703 3300031548 Bacteria 1610
534 Ga0307408_100383802 3300031548 Bacteria 1201
535 Ga0307408_100579505 3300031548 Bacteria 994
536 Ga0307408_100591425 3300031548 Bacteria 985
537 Ga0307408_101091131 3300031548 Unclassified 740
538 Ga0307408_101260092 3300031548 Bacteria 692
539 Ga0307405_10009363 3300031731 Bacteria 5017
540 Ga0307405_10069099 3300031731 Bacteria 2263
541 Ga0307405_10856583 3300031731 Bacteria 765
542 Ga0307405_11789744 3300031731 Bacteria 546
543 Ga0307413_10204967 3300031824 Bacteria 1427
544 Ga0307413_10358754 3300031824 Bacteria 1128
545 Ga0307413_10750588 3300031824 Bacteria 816
546 Ga0307413_11171371 3300031824 Bacteria 667
547 Ga0307410_10007333 3300031852 Bacteria 6030
548 Ga0307410_10251874 3300031852 Bacteria 1373
549 Ga0307410_10614952 3300031852 Bacteria 908
550 Ga0307406_10020843 3300031901 Bacteria 3868
551 Ga0307406_10402458 3300031901 Bacteria 1085
552 Ga0307406_10614371 3300031901 Bacteria 898
553 Ga0307406_10829038 3300031901 Bacteria 782
554 Ga0307406_11067072 3300031901 Bacteria 696
555 Ga0307406_11647363 3300031901 Bacteria 568
556 Ga0307407_10637191 3300031903 Bacteria 797
557 Ga0307412_10000933 3300031911 Bacteria 16724
558 Ga0307412_10006025 3300031911 Bacteria 6827
559 Ga0307412_10046102 3300031911 Bacteria 2854
560 Ga0307412_10237122 3300031911 Bacteria 1408
561 Ga0307412_10419986 3300031911 Bacteria 1094
562 Ga0307412_10729255 3300031911 Bacteria 853
563 Ga0307409_100266740 3300031995 Bacteria 1575
564 Ga0307409_100504182 3300031995 Bacteria 1179
565 Ga0307409_100631410 3300031995 Bacteria 1062
566 Ga0307409_102880027 3300031995 Bacteria 508
567 Ga0307416_100018226 3300032002 Bacteria 4940
568 Ga0307416_100501079 3300032002 Bacteria 1279
569 Ga0307416_100874634 3300032002 Bacteria 998
570 Ga0307416_100932177 3300032002 Bacteria 970
571 Ga0307416_100963417 3300032002 Bacteria 955
572 Ga0307416_101748634 3300032002 Bacteria 726
573 Ga0307416_102486638 3300032002 Bacteria 617
574 Ga0307414_10081160 3300032004 Bacteria 2374
575 Ga0307414_10819924 3300032004 Bacteria 849
576 Ga0307414_10898408 3300032004 Bacteria 812
577 Ga0307411_10036109 3300032005 Bacteria 3093
578 Ga0307411_10167062 3300032005 Bacteria 1655
579 Ga0307411_10370592 3300032005 Bacteria 1174
580 Ga0307411_10849095 3300032005 Bacteria 808
581 Ga0307411_11170128 3300032005 Bacteria 696
582 Ga0307415_101378921 3300032126 Bacteria 670
583 Ga0307415_101662381 3300032126 Bacteria 615
584 Ga0307510_10498612 3300033180 Bacteria 660
585 Ga0395905_0559065 3300037471 Bacteria 1045
586 Ga0436364_0129444 3300037853 Bacteria 50814
587 Ga0436364_1053529 3300037853 Bacteria 530
588 Ga0395901_0078920 3300038443 Bacteria 3437
589 Ga0395901_0835766 3300038443 Bacteria 907
590 Ga0436365_0069111 3300039437 Bacteria 1047
591 Ga0436365_0271953 3300039437 Bacteria 2346
592 Ga0436365_1058137 3300039437 Bacteria 63934
593 Ga0436365_1650613 3300039437 Bacteria 78818
594 Ga0436363_1210139 3300039450 Bacteria 716
595 Ga0436363_1299169 3300039450 Unclassified 855
596 Ga0436362_0592983 3300039453 Bacteria 296966
597 Ga0439436_0040324 3300041404 Bacteria 1339
598 Ga0439436_0121544 3300041404 Bacteria 730
599 Ga0439439_0070566 3300041406 Bacteria 935
600 Ga0439439_0091595 3300041406 Bacteria 831
601 Ga0439461_0000104 3300041410 Bacteria 11032
602 Ga0439461_0036616 3300041410 Bacteria 1045
603 Ga0439465_0002958 3300041413 Bacteria 5558
604 Ga0439465_0083574 3300041413 Bacteria 1085
605 Ga0451791_0981418 3300041451 Bacteria 540
606 Ga0451791_1334057 3300041451 Bacteria 594
607 Ga0451793_0429151 3300041452 Bacteria 1205
608 Ga0451797_0399028 3300041453 Bacteria 652
609 Ga0451806_030996 3300041462 Bacteria 2073
610 Ga0451807_1470937 3300041486 Bacteria 663
611 Ga0451807_2479410 3300041486 Bacteria 908
612 Ga0451841_0606824 3300041498 Bacteria 1027
613 Ga0451853_3256376 3300041512 Bacteria 1469
614 Ga0451853_3471798 3300041512 Bacteria 571
615 Ga0439431_0001244 3300041997 Bacteria 5586
616 Ga0439431_0010641 3300041997 Bacteria 2089
617 Ga0439442_002694 3300042002 Bacteria 3485
618 Ga0439445_0001112 3300042004 Bacteria 5742
619 Ga0439445_0195494 3300042004 Bacteria 596
620 Ga0439448_0010891 3300042005 Bacteria 2704
621 Ga0439432_000223 3300042006 Bacteria 20460
622 Ga0439452_008518 3300042010 Bacteria 3083
623 Ga0439452_018851 3300042010 Bacteria 1831
624 Ga0439455_0006014 3300042012 Bacteria 2496
625 Ga0439457_020990 3300042014 Bacteria 1448
626 Ga0439462_0001077 3300042015 Bacteria 5894
627 Ga0439462_0041159 3300042015 Bacteria 1234
628 Ga0439462_0083675 3300042015 Bacteria 872
629 Ga0450903_053513 3300042138 Bacteria 589
630 Ga0450904_027242 3300042139 Bacteria 591
631 Ga0450889_034631 3300042144 Bacteria 598
632 Ga0450910_055980 3300042147 Bacteria 659
633 Ga0439446_0150159 3300042156 Bacteria 766
634 Ga0439434_0000659 3300042435 Bacteria 9905
635 Ga0439434_0094754 3300042435 Bacteria 957
636 Ga0466965_0818381 3300044683 Bacteria 540
637 Ga0466963_0202177 3300044694 Bacteria 1390
638 Ga0466968_0014423 3300044735 Bacteria 3123
639 Ga0466960_0638627 3300044901 Bacteria 635
640 Ga0466967_0349286 3300045976 Bacteria 1431
641 Ga0466967_0543896 3300045976 Bacteria 1143
642 Ga0495617_137933 3300046452 Bacteria 780
643 Ga0495638_0014426 3300046460 Bacteria 5339
644 Ga0495638_0019313 3300046460 Bacteria 4509
645 Ga0495638_0351986 3300046460 Bacteria 778
646 Ga0495638_0479471 3300046460 Bacteria 630
647 Ga0495650_0000174 3300046471 Bacteria 142519
648 Ga0495584_0032188 3300046491 Bacteria 2655
649 Ga0495585_0006996 3300046492 Bacteria 6944
650 Ga0495585_0086431 3300046492 Bacteria 1694
651 Ga0495585_0311951 3300046492 Bacteria 771
652 Ga0495596_0011201 3300046500 Bacteria 3877
653 Ga0495607_0051847 3300046501 Bacteria 2380
654 Ga0495607_0270607 3300046501 Bacteria 810
655 Ga0495583_0000593 3300046506 Bacteria 49619
656 Ga0495583_0001959 3300046506 Bacteria 18914
657 Ga0495583_0004659 3300046506 Bacteria 9673
658 Ga0495583_0019153 3300046506 Bacteria 3580
659 Ga0495583_0078014 3300046506 Bacteria 1443
660 Ga0495583_0197572 3300046506 Bacteria 818
661 Ga0495606_0000306 3300046507 Bacteria 84561
662 Ga0495606_0004735 3300046507 Bacteria 13401
663 Ga0495606_0159453 3300046507 Bacteria 1317
664 Ga0495606_0448865 3300046507 Bacteria 661
665 Ga0495632_0000001 3300046519 Bacteria 873295
666 Ga0495637_0000330 3300046520 Bacteria 36746
667 Ga0495637_0013008 3300046520 Bacteria 3964
668 Ga0495643_0000020 3300046522 Bacteria 294973
669 Ga0495643_0001502 3300046522 Bacteria 21129
670 Ga0495643_0034150 3300046522 Bacteria 2808
671 Ga0495643_0034966 3300046522 Bacteria 2768
672 Ga0495643_0058452 3300046522 Bacteria 2052
673 Ga0495643_0158460 3300046522 Bacteria 1115
674 Ga0495648_0000747 3300046524 Bacteria 34745
675 Ga0495648_0009787 3300046524 Bacteria 7376
676 Ga0495648_0052170 3300046524 Bacteria 2486
677 Ga0495648_0123768 3300046524 Bacteria 1385
678 Ga0495663_0000002 3300046525 Bacteria 495384
679 Ga0495663_0012615 3300046525 Bacteria 2356
680 Ga0495642_0033098 3300046528 Bacteria 2077
681 Ga0495642_0116343 3300046528 Bacteria 1146
682 Ga0495609_0181400 3300046538 Bacteria 886
683 Ga0495621_0419509 3300046539 Bacteria 570
684 Ga0495622_0177699 3300046557 Bacteria 955
685 Ga0495633_0000213 3300046558 Bacteria 72710
686 Ga0495633_0003218 3300046558 Bacteria 11022
687 Ga0495633_0011499 3300046558 Bacteria 4767
688 Ga0495633_0081609 3300046558 Bacteria 1504
689 Ga0495668_0000072 3300046616 Bacteria 167170
690 Ga0495668_0384034 3300046616 Bacteria 771
691 Ga0495668_0493228 3300046616 Bacteria 675
692 Ga0495611_0049263 3300046648 Bacteria 1895
693 Ga0495625_0007192 3300046660 Bacteria 9749
694 Ga0495625_0100566 3300046660 Bacteria 1987
695 Ga0495625_0239627 3300046660 Bacteria 1181
696 Ga0495625_0257377 3300046660 Bacteria 1131
697 Ga0495625_0322017 3300046660 Bacteria 984
698 Ga0495661_0062396 3300046665 Bacteria 2208
699 Ga0495669_0000221 3300046684 Bacteria 34153
700 Ga0495669_0430931 3300046684 Bacteria 640
701 Ga0495670_0839631 3300046691 Bacteria 502
702 Ga0495671_0000016 3300046692 Bacteria 294821
703 Ga0495671_0043108 3300046692 Bacteria 2265
704 Ga0495649_0151440 3300046694 Bacteria 1218
705 Ga0495649_0209870 3300046694 Bacteria 1009
706 Ga0495649_0286446 3300046694 Bacteria 841
707 Ga0495649_0421522 3300046694 Bacteria 668
708 Ga0495649_0437142 3300046694 Bacteria 654
709 Ga0495600_0002120 3300046809 Bacteria 11231
710 Ga0495683_0024341 3300047323 Bacteria 3108
711 Ga0495683_0057651 3300047323 Bacteria 1930
712 Ga0495687_000045 3300047443 Bacteria 211968
713 Ga0495687_000240 3300047443 Bacteria 75621
714 Ga0495677_0000736 3300047445 Bacteria 13209
715 Ga0495673_0176366 3300047469 Bacteria 812
716 Ga0495681_0003075 3300047470 Bacteria 11701
717 Ga0495681_0036020 3300047470 Bacteria 2452
718 Ga0495681_0039224 3300047470 Bacteria 2315
719 Ga0495686_0013150 3300047472 Bacteria 5757
720 Ga0495686_0032988 3300047472 Bacteria 3346
721 Ga0495686_0042056 3300047472 Bacteria 2907
722 Ga0495686_0048131 3300047472 Bacteria 2689
723 Ga0495686_0393804 3300047472 Bacteria 745
724 Ga0495686_0494382 3300047472 Bacteria 645
725 Ga0496101_0487541 3300048904 Bacteria 973
726 Ga0496102_0000043 3300048905 Bacteria 189201
727 Ga0496102_0000689 3300048905 Bacteria 33586
728 Ga0496102_1401467 3300048905 Bacteria 618
729 Ga0496103_0000133 3300048906 Bacteria 78740
730 Ga0496103_0000404 3300048906 Bacteria 38247
731 Ga0496104_0034187 3300048907 Bacteria 4738
732 Ga0496105_0001929 3300048908 Bacteria 14897
733 Ga0496105_0170012 3300048908 Bacteria 1787
734 Ga0496107_0073738 3300048910 Bacteria 2483
735 Ga0496108_0003224 3300048911 Bacteria 13116
736 Ga0496108_0708748 3300048911 Bacteria 872
737 Ga0496109_0948778 3300048912 Bacteria 798
738 Ga0496110_0122395 3300048913 Bacteria 2345
739 Ga0496111_0019497 3300048914 Bacteria 4712
740 Ga0496113_0072089 3300048916 Bacteria 2628
741 Ga0496114_0001243 3300048917 Bacteria 19286
742 Ga0496115_0000009 3300048918 Bacteria 234372
743 Ga0496116_0000682 3300048919 Bacteria 44118
744 Ga0496116_0011866 3300048919 Bacteria 7169
745 Ga0496116_0128013 3300048919 Bacteria 1453
746 Ga0496117_0000104 3300048920 Bacteria 189201
747 Ga0496117_0000724 3300048920 Bacteria 51893
748 Ga0496117_0020427 3300048920 Bacteria 5399
749 Ga0496118_0000080 3300048921 Bacteria 189201
750 Ga0496118_0000989 3300048921 Bacteria 44266
751 Ga0496118_0001437 3300048921 Bacteria 35866
752 Ga0496118_0045769 3300048921 Bacteria 3411
753 Ga0496119_0005815 3300048922 Bacteria 11661
754 Ga0496119_0041673 3300048922 Bacteria 2921
755 Ga0496119_0054427 3300048922 Bacteria 2436
756 Ga0496120_0035441 3300048923 Bacteria 2980
757 Ga0496120_0039653 3300048923 Bacteria 2776
758 Ga0496120_0080909 3300048923 Bacteria 1759
759 Ga0496120_0149318 3300048923 Bacteria 1176
760 Ga0496121_0000192 3300048924 Bacteria 136529
761 Ga0496121_0002614 3300048924 Bacteria 27193
762 Ga0496121_0014340 3300048924 Bacteria 8422
763 Ga0496121_0062860 3300048924 Bacteria 3038
764 Ga0496121_0065817 3300048924 Bacteria 2946
765 Ga0496122_0011471 3300048925 Bacteria 8966
766 Ga0496122_0020096 3300048925 Bacteria 6063
767 Ga0496122_0025373 3300048925 Bacteria 5148
768 Ga0496123_0017577 3300048926 Bacteria 5743
769 Ga0496123_0031483 3300048926 Bacteria 3858
770 Ga0496123_0038776 3300048926 Bacteria 3343
771 Ga0496123_0511938 3300048926 Bacteria 522
772 Ga0496124_0000050 3300048927 Bacteria 258041
773 Ga0496124_0000093 3300048927 Bacteria 189201
774 Ga0496124_0002396 3300048927 Bacteria 24661
775 Ga0496124_0032581 3300048927 Bacteria 4599
776 Ga0496124_0152508 3300048927 Bacteria 1810
777 Ga0496125_0001515 3300048928 Bacteria 33290
778 Ga0496125_0010490 3300048928 Bacteria 9369
779 Ga0496125_0013525 3300048928 Bacteria 8018
780 Ga0496125_0019149 3300048928 Bacteria 6470
781 Ga0496125_0383470 3300048928 Bacteria 828
782 Ga0496126_0000930 3300048929 Bacteria 50554
783 Ga0496126_0018147 3300048929 Bacteria 6983
784 Ga0496126_0246823 3300048929 Bacteria 1489
785 Ga0496126_0446809 3300048929 Bacteria 1041
786 Ga0496126_1063964 3300048929 Bacteria 603
787 Ga0495682_0010956 3300049460 Bacteria 3495
788 Ga0501290_000464 3300049513 Bacteria 6297
789 Ga0501290_019445 3300049513 Bacteria 921
790 Ga0501292_000026 3300049515 Bacteria 42153
791 Ga0501294_000620 3300049517 Bacteria 4032
792 Ga0501301_002495 3300049524 Bacteria 1220
793 Ga0501034_0190481 3300049571 Bacteria 2013
794 Ga0501034_1128492 3300049571 Bacteria 664
795 Ga0501036_0953269 3300049572 Bacteria 703
796 Ga0501038_0054714 3300049574 Bacteria 3431
797 Ga0501069_0002940 3300049585 Bacteria 8754
798 Ga0501070_0893115 3300049586 Bacteria 693
799 Ga0501071_0150188 3300049587 Bacteria 1738
800 Ga0501206_000824 3300049653 Bacteria 3798
801 Ga0501206_001417 3300049653 Bacteria 2999
802 Ga0501211_000775 3300049658 Bacteria 3285
803 Ga0501222_000640 3300049662 Bacteria 5129
804 Ga0501223_000004 3300049663 Bacteria 141027
805 Ga0501223_019176 3300049663 Bacteria 1344
806 Ga0501223_119122 3300049663 Bacteria 556
807 Ga0501224_001500 3300049664 Bacteria 3101
808 Ga0501227_002925 3300049665 Bacteria 3736
809 Ga0501235_000242 3300049669 Bacteria 9987
810 Ga0501235_001905 3300049669 Bacteria 4460
811 Ga0501236_002479 3300049670 Bacteria 2120
812 Ga0501243_074664 3300049675 Bacteria 650
813 Ga0501246_000072 3300049676 Bacteria 5676
814 Ga0501255_009478 3300049684 Bacteria 1081
815 Ga0501256_030053 3300049685 Bacteria 608
816 Ga0501257_000036 3300049686 Bacteria 38192
817 Ga0501259_000268 3300049688 Bacteria 8191
818 Ga0501261_000046 3300049690 Bacteria 24263
819 Ga0501225_0000003 3300049705 Bacteria 141070
820 Ga0501225_0000673 3300049705 Bacteria 10658
821 Ga0501225_0019806 3300049705 Bacteria 1860
822 Ga0501225_0023768 3300049705 Bacteria 1688
823 Ga0501225_0179185 3300049705 Unclassified 661
824 Ga0501245_001012 3300049708 Bacteria 3613
825 Ga0501245_002795 3300049708 Bacteria 2346
826 Ga0501080_0728551 3300049742 Bacteria 873
827 Ga0501241_002337 3300049758 Bacteria 3672
828 Ga0501263_083451 3300049760 Bacteria 531
829 Ga0501271_013080 3300049768 Bacteria 906
830 Ga0501273_056564 3300049770 Bacteria 610
831 Ga0501279_000027 3300049775 Bacteria 40843
832 Ga0501280_000044 3300049776 Bacteria 37121
833 Ga0501281_00442 3300049777 Bacteria 4033
834 Ga0501281_03489 3300049777 Bacteria 1125
835 Ga0501282_000334 3300049778 Bacteria 5704
836 Ga0501035_1063161 3300049822 Bacteria 634
837 nmdc:mga07m45_137992_c1 3300050496 Bacteria 1412
838 nmdc:mga0qj67_9482_c1 3300050509 Bacteria 7247
839 Ga0500610_0002355 3300053079 Bacteria 6923
840 Ga0500643_000215 3300053087 Bacteria 54391
841 Ga0500643_017862 3300053087 Bacteria 2364
842 Ga0500643_030093 3300053087 Bacteria 1666
843 Ga0500643_063675 3300053087 Bacteria 1032
844 Ga0500643_149542 3300053087 Bacteria 627
845 Ga0500583_0168838 3300053092 Bacteria 1089
846 Ga0500651_0183706 3300053093 Bacteria 1241
847 Ga0500566_0011749 3300053094 Bacteria 5161
848 Ga0500555_000889 3300053103 Bacteria 10630
849 Ga0500555_091163 3300053103 Bacteria 782
850 Ga0500592_000482 3300053116 Bacteria 6619
851 Ga0500594_0049194 3300053118 Bacteria 1181
852 Ga0500595_000578 3300053119 Bacteria 21839
853 Ga0500597_021870 3300053120 Bacteria 2535
854 Ga0500607_251570 3300053121 Bacteria 702
855 Ga0500618_002362 3300053125 Bacteria 7206
856 Ga0500642_0000646 3300053130 Bacteria 10383
857 Ga0500658_0014254 3300053134 Bacteria 2941
858 Ga0500658_0224339 3300053134 Bacteria 862
859 Ga0500658_0225543 3300053134 Bacteria 859
860 Ga0500559_0014974 3300053136 Bacteria 3278
861 Ga0500568_0009185 3300053139 Bacteria 4714
862 Ga0500568_0027124 3300053139 Bacteria 2397
863 Ga0500577_0133299 3300053142 Bacteria 1043
864 Ga0500604_0000018 3300053151 Bacteria 78699
865 Ga0500604_0141903 3300053151 Bacteria 812
866 Ga0500604_0272026 3300053151 Bacteria 587
867 Ga0500616_0000419 3300053153 Bacteria 56812
868 Ga0500616_0005521 3300053153 Bacteria 8567
869 Ga0500624_000062 3300053157 Bacteria 66317
870 Ga0500627_0108573 3300053158 Bacteria 1248
871 Ga0500638_308795 3300053162 Bacteria 606
872 Ga0500636_0004227 3300053177 Bacteria 8134
873 Ga0500636_0098148 3300053177 Bacteria 1669
874 Ga0500637_0000692 3300053178 Bacteria 13419
875 Ga0500645_000138 3300053730 Bacteria 57099
876 Ga0500609_010977 3300053731 Bacteria 1223
877 Ga0500596_001649 3300053735 Bacteria 4510
878 Ga0500587_003146 3300053739 Bacteria 2326
879 Ga0501082_0306412 3300060353 Bacteria 1383
880 2644126085 2643221622 Bacteria 4212502
881 2778124431 2775507255 Bacteria 3945731
882 2919711043 2919709256 Bacteria 4318106
883 8057103651 8057101203 Bacteria 5034064
884 Ga0307513_10358841
885 SwRhRL2b_contig_2704254
886 SwRhRL2b_contig_3171842
887 ARcpr5yngRDRAFT_c004010
888 ARCol0yngRDRAFT_1001507
889 JGI24741J21665_1000228
890 JGI24741J21665_1001726
891 JGI24740J21852_10003943
892 JGI24740J21852_10006052
893 JGI24739J22299_10001727
894 JGI24739J22299_10062269
895 JGI24739J22299_10106652
896 JGI24739J22299_10162518
897 JGI24737J22298_10001061
898 JGI24737J22298_10006500
899 JGI24737J22298_10007233
900 JGI24737J22298_10012547
901 JGI24737J22298_10028582
902 JGI24737J22298_10163449
903 JGI24735J21928_10002009
904 JGI24735J21928_10007545
905 JGI24735J21928_10007736
906 JGI24735J21928_10014606
907 JGI24735J21928_10025048
908 JGI24748J21848_1029298
909 JGI24738J21930_10085601
910 JGI24749J21850_1000076
911 JGI24744J21845_10017741
912 JGI24034J26672_10086268
913 JGI24034J26672_10098801
914 JGI24742J22300_10053852
915 JGI24742J22300_10099262
916 JGI24751J29686_10000195
917 JGI25153J46596_10000002
918 JGI25153J46596_10005653
919 rootH2_10026085
920 rootH1_10042232
921 Ga0055542_1008070
922 Ga0055542_1026022
923 Ga0055529_1009231
924 Ga0055526_1001039
925 Ga0055537_1002318
926 Ga0055537_1005551
927 Ga0055524_1000056
928 Ga0055530_10008426
929 Ga0055530_10052238
930 Ga0055531_10001973
931 Ga0055543_1065149
932 Ga0058859_11339750
933 Ga0065165_1023324
934 Ga0065165_1045828
935 Ga0065704_10000880
936 Ga0065704_10021576
937 Ga0065704_10102515
938 Ga0065707_10004914
939 Ga0065707_10085091
940 Ga0065707_10090551
941 Ga0065707_10435780
942 Ga0070658_10000002
943 Ga0070658_10000608
944 Ga0070658_10003163
945 Ga0070658_10294785
946 Ga0070676_10001330
947 Ga0070670_100000033
948 Ga0070670_100611841
949 Ga0070670_101197457
950 Ga0070677_10000317
951 Ga0068869_100000539
952 Ga0068869_100282971
953 Ga0068869_100715426
954 Ga0068869_101199531
955 Ga0070666_10094384
956 Ga0070666_10102081
957 Ga0070682_100962338
958 Ga0068868_100012870
959 Ga0070660_100000137
960 Ga0070660_100000561
961 Ga0070660_100062727
962 Ga0070660_100087481
963 Ga0070660_100105325
964 Ga0070661_100007643
965 Ga0070661_100273053
966 Ga0070661_100415539
967 Ga0070692_10003203
968 Ga0070668_100000018
969 Ga0070668_100008256
970 Ga0070668_100009296
971 Ga0070668_100029208
972 Ga0070668_100097071
973 Ga0070668_100395096
974 Ga0070668_100558380
975 Ga0070668_102240225
976 Ga0070669_100000005
977 Ga0070669_100047551
978 Ga0070669_100098822
979 Ga0070669_100185357
980 Ga0070669_100186036
981 Ga0070669_100534466
982 Ga0070675_100000664
983 Ga0070675_100303583
984 Ga0070675_101078977
985 Ga0070675_101387591
986 Ga0070671_100000189
987 Ga0070671_100002574
988 Ga0070671_100058331
989 Ga0070671_100462264
990 Ga0070671_101227681
991 Ga0070674_100000527
992 Ga0070674_100019659
993 Ga0070674_100047101
994 Ga0070674_100048838
995 Ga0070673_100000007
996 Ga0070673_102179771
997 Ga0070659_100010029
998 Ga0070659_100031864
999 Ga0070659_100065018
1000 Ga0070659_100102921
1001 Ga0070659_100199063
1002 Ga0070659_100282044
1003 Ga0070659_100680563
1004 Ga0070659_100937630
1005 Ga0070667_100000089
1006 Ga0070667_100005221
1007 Ga0070667_100139378
1008 Ga0070667_100327880
1009 Ga0070667_101784883
1010 Ga0070701_10177318
1011 Ga0070701_10605475
1012 Ga0070701_11045938
1013 Ga0070663_100016292
1014 Ga0070663_100220730
1015 Ga0070663_100280633
1016 Ga0070663_100342679
1017 Ga0070678_100000271
1018 Ga0070678_100007473
1019 Ga0070662_100239416
1020 Ga0070662_100262273
1021 Ga0070662_100335230
1022 Ga0070662_100903529
1023 Ga0070662_100958247
1024 Ga0070662_101342573
1025 Ga0070681_11815822
1026 Ga0068867_100000134
1027 Ga0070685_10520041
1028 Ga0070699_100729328
1029 Ga0068853_100298564
1030 Ga0068853_100715865
1031 Ga0068853_100808760
1032 Ga0068853_101336861
1033 Ga0068853_101431514
1034 Ga0070672_100009747
1035 Ga0070672_100117631
1036 Ga0070672_100244314
1037 Ga0070672_100441548
1038 Ga0070672_100483844
1039 Ga0070696_100683838
1040 Ga0070665_100000265
1041 Ga0070665_100000493
1042 Ga0070665_100028240
1043 Ga0070665_100084455
1044 Ga0070665_100264549
1045 Ga0070665_100650171
1046 Ga0070665_100668471
1047 Ga0070665_102528454
1048 Ga0068855_100000191
1049 Ga0068855_100179242
1050 Ga0068855_100476636
1051 Ga0068855_100867477
1052 Ga0070664_100031198
1053 Ga0070664_100149494
1054 Ga0070664_101034887
1055 Ga0068857_100096788
1056 Ga0068857_100170339
1057 Ga0068857_100298447
1058 Ga0068857_100813241
1059 Ga0068857_101091141
1060 Ga0068854_100070232
1061 Ga0068854_100224649
1062 Ga0068854_100771223
1063 Ga0068854_100936697
1064 Ga0068854_101020136
1065 Ga0068856_100008621
1066 Ga0068856_100311578
1067 Ga0068852_100095289
1068 Ga0068852_100134152
1069 Ga0068852_100204240
1070 Ga0068852_100740033
1071 Ga0068859_100010744
1072 Ga0068859_100011274
1073 Ga0068859_100016302
1074 Ga0068859_100268857
1075 Ga0068859_101513920
1076 Ga0068859_102256822
1077 Ga0068864_100000042
1078 Ga0068866_10128821
1079 Ga0068861_100023975
1080 Ga0068861_100065855
1081 Ga0068861_100807385
1082 Ga0068861_100904161
1083 Ga0068861_101598729
1084 Ga0068851_10037591
1085 Ga0068851_10038999
1086 Ga0068851_10447647
1087 Ga0068851_10627986
1088 Ga0068870_10529845
1089 Ga0068863_100000030
1090 Ga0068863_100001219
1091 Ga0068863_100003973
1092 Ga0068858_100488825
1093 Ga0068860_100000148
1094 Ga0068860_100002421
1095 Ga0068860_100077492
1096 Ga0068860_100943145
1097 Ga0068860_101090979
1098 Ga0068862_100000005
1099 Ga0068862_100000149
1100 Ga0068862_100014432
1101 Ga0068862_100022099
1102 Ga0068862_101350836
1103 Ga0068862_102062504
1104 Ga0081539_10165735
1105 Ga0075432_10482713
1106 Ga0097621_100062388
1107 Ga0075370_10403154
1108 Ga0075430_100035193
1109 Ga0068865_100000008
1110 Ga0068865_100840529
1111 Ga0097620_100010744
1112 Ga0097620_100011274
1113 Ga0097620_100016302
1114 Ga0097620_100268850
1115 Ga0097620_101513960
1116 Ga0097620_102256473
1117 Ga0079104_1055173
1118 Ga0099826_10421449
1119 Ga0105251_10009288
1120 Ga0105240_10120463
1121 Ga0105240_10154472
1122 Ga0111539_10670297
1123 Ga0105245_10001922
1124 Ga0105245_10095357
1125 Ga0105245_10708213
1126 Ga0105245_11127325
1127 Ga0105247_10004166
1128 Ga0105247_11233653
1129 Ga0105243_10000213
1130 Ga0105243_10003232
1131 Ga0105243_10057527
1132 Ga0105243_10413212
1133 Ga0105243_11127751
1134 Ga0105243_11800105
1135 Ga0105241_10002321
1136 Ga0105241_10012233
1137 Ga0105241_11611788
1138 Ga0105241_12668187
1139 Ga0105242_10000437
1140 Ga0105242_11245171
1141 Ga0105242_11841882
1142 Ga0105248_10000171
1143 Ga0105248_10316025
1144 Ga0105237_10046738
1145 Ga0105237_10125051
1146 Ga0105237_11493221
1147 Ga0105237_12111537
1148 Ga0105238_10110993
1149 Ga0105238_10823291
1150 Ga0105238_10835782
1151 Ga0105238_11046774
1152 Ga0105238_11126041
1153 Ga0105238_11799142
1154 Ga0105249_10000056
1155 Ga0105249_10015107
1156 Ga0105249_10019471
1157 Ga0105249_10060847
1158 Ga0105249_10904749
1159 Ga0105148_100086
1160 Ga0105147_105670
1161 Ga0105239_10034267
1162 Ga0105239_10239671
1163 Ga0105246_10002390
1164 Ga0105246_10041447
1165 Ga0105246_11067787
1166 Ga0157317_1002050
1167 Ga0157327_1015475
1168 Ga0157326_1000010
1169 Ga0157373_10013087
1170 Ga0157373_10015808
1171 Ga0157373_10046169
1172 Ga0157373_10061923
1173 Ga0157371_10000059
1174 Ga0157370_10016799
1175 Ga0157370_10175173
1176 Ga0157370_11074959
1177 Ga0157369_10002550
1178 Ga0157369_10147458
1179 Ga0157369_10380251
1180 Ga0157374_10019747
1181 Ga0157374_10029189
1182 Ga0157374_12265340
1183 Ga0157378_10004325
1184 Ga0163162_10068729
1185 Ga0163162_10368425
1186 Ga0163162_11082141
1187 Ga0163162_12395927
1188 Ga0157372_10358684
1189 Ga0157372_10535199
1190 Ga0157372_10537722
1191 Ga0157372_10852825
1192 Ga0157372_10991801
1193 Ga0157372_12227023
1194 Ga0157372_12313318
1195 Ga0157375_10004295
1196 Ga0157375_11334067
1197 Ga0163163_10408569
1198 Ga0163163_11842621
1199 Ga0157380_10000084
1200 Ga0157380_10006098
1201 Ga0157380_11226862
1202 Ga0157377_10046846
1203 Ga0157376_10000315
1204 Ga0157376_11007997
1205 Ga0157376_11171708
1206 Ga0163161_10003807
1207 Ga0163161_10220521
1208 Ga0163161_10238126
1209 Ga0163161_10677675
1210 Ga0206354_10227562
1211 Ga0206353_11261817
1212 Ga0213873_10000019
1213 Ga0213874_10213503
1214 Ga0213876_10000075
1215 Ga0213876_10001526
1216 Ga0213875_10000323
1217 Ga0209674_103791
1218 Ga0209563_100116
1219 Ga0207425_1002702
1220 Ga0209026_1012534
1221 Ga0209677_104219
1222 Ga0209148_1000398
1223 Ga0209148_1001103
1224 Ga0209233_1080964
1225 Ga0209565_1000008
1226 Ga0209565_1000244
1227 Ga0209455_1001110
1228 Ga0209673_1000569
1229 Ga0209673_1006074
1230 Ga0209564_1009843
1231 Ga0209564_1030333
1232 Ga0209758_1000001
1233 Ga0209758_1002073
1234 Ga0209050_1003166
1235 Ga0209050_1038584
1236 Ga0209256_1000009
1237 Ga0209256_1000010
1238 Ga0209257_1003147
1239 Ga0207656_10006564
1240 Ga0207713_1097285
1241 Ga0207682_10000624
1242 Ga0207642_10584665
1243 Ga0207710_10007932
1244 Ga0207680_10044629
1245 Ga0207680_10087932
1246 Ga0207647_10047708
1247 Ga0207647_10059593
1248 Ga0207647_10126621
1249 Ga0207647_10136397
1250 Ga0207647_10316887
1251 Ga0207645_10001217
1252 Ga0207645_10040611
1253 Ga0207645_10829117
1254 Ga0207705_10000008
1255 Ga0207705_10000197
1256 Ga0207705_10009236
1257 Ga0207654_10001228
1258 Ga0207707_10630770
1259 Ga0207695_10029722
1260 Ga0207695_10059676
1261 Ga0207695_11195947
1262 Ga0207671_10076484
1263 Ga0207657_10001820
1264 Ga0207657_10004655
1265 Ga0207657_10021785
1266 Ga0207657_10031380
1267 Ga0207657_10065746
1268 Ga0207657_10104067
1269 Ga0207657_10355578
1270 Ga0207649_10000225
1271 Ga0207681_10000003
1272 Ga0207681_10222448
1273 Ga0207681_10261162
1274 Ga0207681_10492107
1275 Ga0207681_10862858
1276 Ga0207681_11229633
1277 Ga0207694_10008225
1278 Ga0207694_10048518
1279 Ga0207694_11066471
1280 Ga0207694_11270717
1281 Ga0207650_10000012
1282 Ga0207650_10512520
1283 Ga0207650_11203270
1284 Ga0207659_10002169
1285 Ga0207687_10004919
1286 Ga0207687_10221646
1287 Ga0207644_10000096
1288 Ga0207644_10172545
1289 Ga0207644_10280019
1290 Ga0207644_11156170
1291 Ga0207690_10003708
1292 Ga0207690_10006876
1293 Ga0207690_10020317
1294 Ga0207690_10023602
1295 Ga0207690_10403802
1296 Ga0207690_11041125
1297 Ga0207706_10073104
1298 Ga0207706_10095684
1299 Ga0207706_10234640
1300 Ga0207706_10271714
1301 Ga0207706_10320350
1302 Ga0207706_10324756
1303 Ga0207706_10575052
1304 Ga0207686_10000908
1305 Ga0207686_10914065
1306 Ga0207686_11070967
1307 Ga0207709_10000018
1308 Ga0207709_10000399
1309 Ga0207709_10056889
1310 Ga0207709_10778053
1311 Ga0207670_11146560
1312 Ga0207669_10000068
1313 Ga0207669_10097629
1314 Ga0207669_10165796
1315 Ga0207669_10193174
1316 Ga0207704_10000013
1317 Ga0207704_11104321
1318 Ga0207691_10013456
1319 Ga0207691_10334715
1320 Ga0207691_10384679
1321 Ga0207691_10459888
1322 Ga0207711_10001461
1323 Ga0207689_10000852
1324 Ga0207689_10513223
1325 Ga0207679_10096554
1326 Ga0207679_10220374
1327 Ga0207679_11237767
1328 Ga0207667_10000107
1329 Ga0207667_10000113
1330 Ga0207667_10029652
1331 Ga0207667_10040848
1332 Ga0207667_10289671
1333 Ga0207667_11944280
1334 Ga0207651_10000013
1335 Ga0207651_10856658
1336 Ga0207712_10000015
1337 Ga0207712_10007843
1338 Ga0207712_10231975
1339 Ga0207712_10282526
1340 Ga0207668_10000082
1341 Ga0207668_10002153
1342 Ga0207668_10003245
1343 Ga0207668_10094341
1344 Ga0207668_10109849
1345 Ga0207668_10277830
1346 Ga0207668_10782422
1347 Ga0207640_10013098
1348 Ga0207640_10016371
1349 Ga0207640_10745270
1350 Ga0207640_10896765
1351 Ga0207658_10000069
1352 Ga0207658_10013699
1353 Ga0207658_10176272
1354 Ga0207658_11243804
1355 Ga0207677_10007087
1356 Ga0207703_10558857
1357 Ga0207639_10000269
1358 Ga0207639_10002666
1359 Ga0207639_10078461
1360 Ga0207639_10163513
1361 Ga0207639_10209648
1362 Ga0207639_10483699
1363 Ga0207639_10657564
1364 Ga0207639_11150271
1365 Ga0207639_11429729
1366 Ga0207678_10000400
1367 Ga0207678_10041375
1368 Ga0207678_10049909
1369 Ga0207702_10001111
1370 Ga0207702_10006623
1371 Ga0207641_10000001
1372 Ga0207641_10004476
1373 Ga0207641_10004557
1374 Ga0207648_10000382
1375 Ga0207676_10000009
1376 Ga0207674_10003571
1377 Ga0207674_10036095
1378 Ga0207674_10171019
1379 Ga0207674_10273124
1380 Ga0207674_11171166
1381 Ga0207675_100001338
1382 Ga0207675_101215545
1383 Ga0207675_101375987
1384 Ga0207683_10004636
1385 Ga0207683_10031296
1386 Ga0207698_10005545
1387 Ga0207698_10007060
1388 Ga0207698_10986946
1389 Ga0207698_11546020
1390 Ga0209282_1423339
1391 Ga0209974_10150676
1392 Ga0209974_10250693
1393 Ga0268266_10000592
1394 Ga0268266_10001249
1395 Ga0268266_10043391
1396 Ga0268266_10045446
1397 Ga0268266_10529866
1398 Ga0268266_10758684
1399 Ga0268265_10000001
1400 Ga0268265_10000021
1401 Ga0268265_10084475
1402 Ga0268265_11110522
1403 Ga0268265_11147560
1404 Ga0268265_11624645
1405 Ga0268264_10000217
1406 Ga0268264_10000820
1407 Ga0268264_10073017
1408 Ga0268264_10284417
1409 Ga0268264_10785682
1410 Ga0307517_10026887
1411 Ga0307517_10247107
1412 Ga0307513_10080483
1413 Ga0307513_10096035
1414 Ga0307513_10868071
1415 Ga0307408_100003396
1416 Ga0307408_100201703
1417 Ga0307408_100383802
1418 Ga0307408_100579505
1419 Ga0307408_100591425
1420 Ga0307408_101091131
1421 Ga0307408_101260092
1422 Ga0307405_10009363
1423 Ga0307405_10069099
1424 Ga0307405_10856583
1425 Ga0307405_11789744
1426 Ga0307413_10204967
1427 Ga0307413_10358754
1428 Ga0307413_10750588
1429 Ga0307413_11171371
1430 Ga0307410_10007333
1431 Ga0307410_10251874
1432 Ga0307410_10614952
1433 Ga0307406_10020843
1434 Ga0307406_10402458
1435 Ga0307406_10614371
1436 Ga0307406_10829038
1437 Ga0307406_11067072
1438 Ga0307406_11647363
1439 Ga0307407_10637191
1440 Ga0307412_10000933
1441 Ga0307412_10006025
1442 Ga0307412_10046102
1443 Ga0307412_10237122
1444 Ga0307412_10419986
1445 Ga0307412_10729255
1446 Ga0307409_100266740
1447 Ga0307409_100504182
1448 Ga0307409_100631410
1449 Ga0307409_102880027
1450 Ga0307416_100018226
1451 Ga0307416_100501079
1452 Ga0307416_100874634
1453 Ga0307416_100932177
1454 Ga0307416_100963417
1455 Ga0307416_101748634
1456 Ga0307416_102486638
1457 Ga0307414_10081160
1458 Ga0307414_10819924
1459 Ga0307414_10898408
1460 Ga0307411_10036109
1461 Ga0307411_10167062
1462 Ga0307411_10370592
1463 Ga0307411_10849095
1464 Ga0307411_11170128
1465 Ga0307415_101378921
1466 Ga0307415_101662381
1467 Ga0307510_10498612
1468 Ga0395905_0559065
1469 Ga0436364_0129444
1470 Ga0436364_1053529
1471 Ga0395901_0078920
1472 Ga0395901_0835766
1473 Ga0436365_0069111
1474 Ga0436365_0271953
1475 Ga0436365_1058137
1476 Ga0436365_1650613
1477 Ga0436363_1210139
1478 Ga0436363_1299169
1479 Ga0436362_0592983
1480 Ga0439436_0040324
1481 Ga0439436_0121544
1482 Ga0439439_0070566
1483 Ga0439439_0091595
1484 Ga0439461_0000104
1485 Ga0439461_0036616
1486 Ga0439465_0002958
1487 Ga0439465_0083574
1488 Ga0451791_0981418
1489 Ga0451791_1334057
1490 Ga0451793_0429151
1491 Ga0451797_0399028
1492 Ga0451806_030996
1493 Ga0451807_1470937
1494 Ga0451807_2479410
1495 Ga0451841_0606824
1496 Ga0451853_3256376
1497 Ga0451853_3471798
1498 Ga0439431_0001244
1499 Ga0439431_0010641
1500 Ga0439442_002694
1501 Ga0439445_0001112
1502 Ga0439445_0195494
1503 Ga0439448_0010891
1504 Ga0439432_000223
1505 Ga0439452_008518
1506 Ga0439452_018851
1507 Ga0439455_0006014
1508 Ga0439457_020990
1509 Ga0439462_0001077
1510 Ga0439462_0041159
1511 Ga0439462_0083675
1512 Ga0450903_053513
1513 Ga0450904_027242
1514 Ga0450889_034631
1515 Ga0450910_055980
1516 Ga0439446_0150159
1517 Ga0439434_0000659
1518 Ga0439434_0094754
1519 Ga0466965_0818381
1520 Ga0466963_0202177
1521 Ga0466968_0014423
1522 Ga0466960_0638627
1523 Ga0466967_0349286
1524 Ga0466967_0543896
1525 Ga0495617_137933
1526 Ga0495638_0014426
1527 Ga0495638_0019313
1528 Ga0495638_0351986
1529 Ga0495638_0479471
1530 Ga0495650_0000174
1531 Ga0495584_0032188
1532 Ga0495585_0006996
1533 Ga0495585_0086431
1534 Ga0495585_0311951
1535 Ga0495596_0011201
1536 Ga0495607_0051847
1537 Ga0495607_0270607
1538 Ga0495583_0000593
1539 Ga0495583_0001959
1540 Ga0495583_0004659
1541 Ga0495583_0019153
1542 Ga0495583_0078014
1543 Ga0495583_0197572
1544 Ga0495606_0000306
1545 Ga0495606_0004735
1546 Ga0495606_0159453
1547 Ga0495606_0448865
1548 Ga0495632_0000001
1549 Ga0495637_0000330
1550 Ga0495637_0013008
1551 Ga0495643_0000020
1552 Ga0495643_0001502
1553 Ga0495643_0034150
1554 Ga0495643_0034966
1555 Ga0495643_0058452
1556 Ga0495643_0158460
1557 Ga0495648_0000747
1558 Ga0495648_0009787
1559 Ga0495648_0052170
1560 Ga0495648_0123768
1561 Ga0495663_0000002
1562 Ga0495663_0012615
1563 Ga0495642_0033098
1564 Ga0495642_0116343
1565 Ga0495609_0181400
1566 Ga0495621_0419509
1567 Ga0495622_0177699
1568 Ga0495633_0000213
1569 Ga0495633_0003218
1570 Ga0495633_0011499
1571 Ga0495633_0081609
1572 Ga0495668_0000072
1573 Ga0495668_0384034
1574 Ga0495668_0493228
1575 Ga0495611_0049263
1576 Ga0495625_0007192
1577 Ga0495625_0100566
1578 Ga0495625_0239627
1579 Ga0495625_0257377
1580 Ga0495625_0322017
1581 Ga0495661_0062396
1582 Ga0495669_0000221
1583 Ga0495669_0430931
1584 Ga0495670_0839631
1585 Ga0495671_0000016
1586 Ga0495671_0043108
1587 Ga0495649_0151440
1588 Ga0495649_0209870
1589 Ga0495649_0286446
1590 Ga0495649_0421522
1591 Ga0495649_0437142
1592 Ga0495600_0002120
1593 Ga0495683_0024341
1594 Ga0495683_0057651
1595 Ga0495687_000045
1596 Ga0495687_000240
1597 Ga0495677_0000736
1598 Ga0495673_0176366
1599 Ga0495681_0003075
1600 Ga0495681_0036020
1601 Ga0495681_0039224
1602 Ga0495686_0013150
1603 Ga0495686_0032988
1604 Ga0495686_0042056
1605 Ga0495686_0048131
1606 Ga0495686_0393804
1607 Ga0495686_0494382
1608 Ga0496101_0487541
1609 Ga0496102_0000043
1610 Ga0496102_0000689
1611 Ga0496102_1401467
1612 Ga0496103_0000133
1613 Ga0496103_0000404
1614 Ga0496104_0034187
1615 Ga0496105_0001929
1616 Ga0496105_0170012
1617 Ga0496107_0073738
1618 Ga0496108_0003224
1619 Ga0496108_0708748
1620 Ga0496109_0948778
1621 Ga0496110_0122395
1622 Ga0496111_0019497
1623 Ga0496113_0072089
1624 Ga0496114_0001243
1625 Ga0496115_0000009
1626 Ga0496116_0000682
1627 Ga0496116_0011866
1628 Ga0496116_0128013
1629 Ga0496117_0000104
1630 Ga0496117_0000724
1631 Ga0496117_0020427
1632 Ga0496118_0000080
1633 Ga0496118_0000989
1634 Ga0496118_0001437
1635 Ga0496118_0045769
1636 Ga0496119_0005815
1637 Ga0496119_0041673
1638 Ga0496119_0054427
1639 Ga0496120_0035441
1640 Ga0496120_0039653
1641 Ga0496120_0080909
1642 Ga0496120_0149318
1643 Ga0496121_0000192
1644 Ga0496121_0002614
1645 Ga0496121_0014340
1646 Ga0496121_0062860
1647 Ga0496121_0065817
1648 Ga0496122_0011471
1649 Ga0496122_0020096
1650 Ga0496122_0025373
1651 Ga0496123_0017577
1652 Ga0496123_0031483
1653 Ga0496123_0038776
1654 Ga0496123_0511938
1655 Ga0496124_0000050
1656 Ga0496124_0000093
1657 Ga0496124_0002396
1658 Ga0496124_0032581
1659 Ga0496124_0152508
1660 Ga0496125_0001515
1661 Ga0496125_0010490
1662 Ga0496125_0013525
1663 Ga0496125_0019149
1664 Ga0496125_0383470
1665 Ga0496126_0000930
1666 Ga0496126_0018147
1667 Ga0496126_0246823
1668 Ga0496126_0446809
1669 Ga0496126_1063964
1670 Ga0495682_0010956
1671 Ga0501290_000464
1672 Ga0501290_019445
1673 Ga0501292_000026
1674 Ga0501294_000620
1675 Ga0501301_002495
1676 Ga0501034_0190481
1677 Ga0501034_1128492
1678 Ga0501036_0953269
1679 Ga0501038_0054714
1680 Ga0501069_0002940
1681 Ga0501070_0893115
1682 Ga0501071_0150188
1683 Ga0501206_000824
1684 Ga0501206_001417
1685 Ga0501211_000775
1686 Ga0501222_000640
1687 Ga0501223_000004
1688 Ga0501223_019176
1689 Ga0501223_119122
1690 Ga0501224_001500
1691 Ga0501227_002925
1692 Ga0501235_000242
1693 Ga0501235_001905
1694 Ga0501236_002479
1695 Ga0501243_074664
1696 Ga0501246_000072
1697 Ga0501255_009478
1698 Ga0501256_030053
1699 Ga0501257_000036
1700 Ga0501259_000268
1701 Ga0501261_000046
1702 Ga0501225_0000003
1703 Ga0501225_0000673
1704 Ga0501225_0019806
1705 Ga0501225_0023768
1706 Ga0501225_0179185
1707 Ga0501245_001012
1708 Ga0501245_002795
1709 Ga0501080_0728551
1710 Ga0501241_002337
1711 Ga0501263_083451
1712 Ga0501271_013080
1713 Ga0501273_056564
1714 Ga0501279_000027
1715 Ga0501280_000044
1716 Ga0501281_00442
1717 Ga0501281_03489
1718 Ga0501282_000334
1719 Ga0501035_1063161
1720 nmdc:mga07m45_137992_c1
1721 nmdc:mga0qj67_9482_c1
1722 Ga0500610_0002355
1723 Ga0500643_000215
1724 Ga0500643_017862
1725 Ga0500643_030093
1726 Ga0500643_063675
1727 Ga0500643_149542
1728 Ga0500583_0168838
1729 Ga0500651_0183706
1730 Ga0500566_0011749
1731 Ga0500555_000889
1732 Ga0500555_091163
1733 Ga0500592_000482
1734 Ga0500594_0049194
1735 Ga0500595_000578
1736 Ga0500597_021870
1737 Ga0500607_251570
1738 Ga0500618_002362
1739 Ga0500642_0000646
1740 Ga0500658_0014254
1741 Ga0500658_0224339
1742 Ga0500658_0225543
1743 Ga0500559_0014974
1744 Ga0500568_0009185
1745 Ga0500568_0027124
1746 Ga0500577_0133299
1747 Ga0500604_0000018
1748 Ga0500604_0141903
1749 Ga0500604_0272026
1750 Ga0500616_0000419
1751 Ga0500616_0005521
1752 Ga0500624_000062
1753 Ga0500627_0108573
1754 Ga0500638_308795
1755 Ga0500636_0004227
1756 Ga0500636_0098148
1757 Ga0500637_0000692
1758 Ga0500645_000138
1759 Ga0500609_010977
1760 Ga0500596_001649
1761 Ga0500587_003146
1762 Ga0501082_0306412
1763 2644126085
1764 2778124431
1765 2919711043
1766 8057103651

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10984

DUF2794

Protein of unknown function (DUF2794)

24

108

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4khb-assembly4.cif.gz_G structure of the spt16d pob3n heterodimer 0.7802 39 63
6xu6-assembly1.cif.gz_Ck drosophila melanogaster testis 80s ribosome 0.6658 32 60
4eiq-assembly2.cif.gz_B chromopyrrolic acid-soaked rebc-10x with bound 7-carboxy-k252c 0.6179 82 113
2r0c-assembly1.cif.gz_A structure of the substrate-free form of the rebeccamycin biosynthetic enzyme rebc 0.6142 82 113
2r0g-assembly1.cif.gz_A chromopyrrolic acid-soaked rebc with bound 7-carboxy-k252c 0.6131 82 113
ID Description Score Start End Superfamily
af_A0A1D6DWZ1_6_279_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7971 44 73 3.30.420.40
4khbG00 Mainly Beta;Roll;PH-domain like;FACT complex subunit Spt16p/Cdc68p 0.7802 39 63 2.30.29.210
af_Q4DQP0_62_285_3.30.1120.90 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain;Nucleosome assembly protein 0.7658 40 74 3.30.1120.90
af_A0A1D6L052_103_280_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7282 45 73 3.60.21.10
af_A0A2R8RXK9_328_492_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7055 45 73 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A838MNA9-F1-model_v4 DUF2794 domain-containing protein 0.98 19 116
AF-A0A3N9RSA3-F1-model_v4 DUF2794 domain-containing protein 0.9781 19 116
AF-A0A838MNA9-F1-model_v4 DUF2794 domain-containing protein 0.9702 19 116
AF-A0A3N9RSA3-F1-model_v4 DUF2794 domain-containing protein 0.9683 19 116
AF-A0A1N7MQ27-F1-model_v4 DM10 domain-containing protein 0.9675 25 114 GO:0005737
GO:0005856
GO:0042995

Map