F484591
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 883 | 378 | 1766 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10358841|Ga0307513_103588412 |
| Length | 123 |
| Sequence | MGTVLPFPATATGGRGNPRSSEQIGFARAELNRIVDLYGRMVAAGLWKDYAIAFEPGMAAFWAFRRTAERPEYRIEKRPAAGGRQGMWALVGESGQILRRGPELGPVLAPIERRLMKLVANQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 87 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 101 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 105 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 106 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 216 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 217 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 218 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 219 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 220 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 221 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 227 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 228 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 229 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 230 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 231 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 232 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 233 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 234 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 235 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 236 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 237 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 238 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 239 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 240 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 241 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 242 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 308 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 309 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 310 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 311 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 318 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 319 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 320 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 325 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 326 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 327 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 328 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 329 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 330 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 331 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 332 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 337 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 338 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 339 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 340 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 341 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 342 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 347 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 348 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 349 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 350 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 353 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 355 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 357 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 359 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 362 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 363 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 365 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 366 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 368 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 370 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 371 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 372 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 373 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 376 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 377 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 378 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.34 |
| Isolates | 0.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.83 |
| Nodule | 0.34 |
| Rhizoplane | 2.83 |
| Rhizosphere | 79.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307513_10358841 | 3300031456 | Bacteria | 1203 |
| 2 | SwRhRL2b_contig_2704254 | 2162886007 | Bacteria | 3508 |
| 3 | SwRhRL2b_contig_3171842 | 2162886007 | Bacteria | 907 |
| 4 | ARcpr5yngRDRAFT_c004010 | 3300000043 | Bacteria | 1410 |
| 5 | ARCol0yngRDRAFT_1001507 | 3300000652 | Bacteria | 1893 |
| 6 | JGI24741J21665_1000228 | 3300001915 | Bacteria | 16799 |
| 7 | JGI24741J21665_1001726 | 3300001915 | Bacteria | 6031 |
| 8 | JGI24740J21852_10003943 | 3300001979 | Bacteria | 6441 |
| 9 | JGI24740J21852_10006052 | 3300001979 | Bacteria | 5057 |
| 10 | JGI24739J22299_10001727 | 3300001989 | Bacteria | 8304 |
| 11 | JGI24739J22299_10062269 | 3300001989 | Bacteria | 1177 |
| 12 | JGI24739J22299_10106652 | 3300001989 | Bacteria | 843 |
| 13 | JGI24739J22299_10162518 | 3300001989 | Bacteria | 659 |
| 14 | JGI24737J22298_10001061 | 3300001990 | Bacteria | 9709 |
| 15 | JGI24737J22298_10006500 | 3300001990 | Bacteria | 3989 |
| 16 | JGI24737J22298_10007233 | 3300001990 | Bacteria | 3754 |
| 17 | JGI24737J22298_10012547 | 3300001990 | Bacteria | 2763 |
| 18 | JGI24737J22298_10028582 | 3300001990 | Bacteria | 1752 |
| 19 | JGI24737J22298_10163449 | 3300001990 | Bacteria | 657 |
| 20 | JGI24735J21928_10002009 | 3300002067 | Bacteria | 7153 |
| 21 | JGI24735J21928_10007545 | 3300002067 | Bacteria | 3545 |
| 22 | JGI24735J21928_10007736 | 3300002067 | Bacteria | 3493 |
| 23 | JGI24735J21928_10014606 | 3300002067 | Bacteria | 2458 |
| 24 | JGI24735J21928_10025048 | 3300002067 | Bacteria | 1802 |
| 25 | JGI24748J21848_1029298 | 3300002074 | Bacteria | 678 |
| 26 | JGI24738J21930_10085601 | 3300002075 | Bacteria | 663 |
| 27 | JGI24749J21850_1000076 | 3300002076 | Bacteria | 17900 |
| 28 | JGI24744J21845_10017741 | 3300002077 | Bacteria | 1414 |
| 29 | JGI24034J26672_10086268 | 3300002239 | Bacteria | 578 |
| 30 | JGI24034J26672_10098801 | 3300002239 | Bacteria | 548 |
| 31 | JGI24742J22300_10053852 | 3300002244 | Bacteria | 732 |
| 32 | JGI24742J22300_10099262 | 3300002244 | Bacteria | 562 |
| 33 | JGI24751J29686_10000195 | 3300002459 | Bacteria | 26688 |
| 34 | JGI25153J46596_10000002 | 3300003215 | Bacteria | 653569 |
| 35 | JGI25153J46596_10005653 | 3300003215 | Bacteria | 6524 |
| 36 | rootH2_10026085 | 3300003320 | Bacteria | 1849 |
| 37 | rootH1_10042232 | 3300003323 | Bacteria | 2212 |
| 38 | Ga0055542_1008070 | 3300003762 | Bacteria | 2084 |
| 39 | Ga0055542_1026022 | 3300003762 | Bacteria | 791 |
| 40 | Ga0055529_1009231 | 3300003763 | Bacteria | 1298 |
| 41 | Ga0055526_1001039 | 3300003771 | Bacteria | 20291 |
| 42 | Ga0055537_1002318 | 3300003773 | Bacteria | 6499 |
| 43 | Ga0055537_1005551 | 3300003773 | Bacteria | 3365 |
| 44 | Ga0055524_1000056 | 3300003775 | Bacteria | 141764 |
| 45 | Ga0055530_10008426 | 3300003791 | Bacteria | 4134 |
| 46 | Ga0055530_10052238 | 3300003791 | Bacteria | 944 |
| 47 | Ga0055531_10001973 | 3300003794 | Bacteria | 14309 |
| 48 | Ga0055543_1065149 | 3300004625 | Bacteria | 579 |
| 49 | Ga0058859_11339750 | 3300004798 | Unclassified | 619 |
| 50 | Ga0065165_1023324 | 3300005262 | Bacteria | 2101 |
| 51 | Ga0065165_1045828 | 3300005262 | Bacteria | 1272 |
| 52 | Ga0065704_10000880 | 3300005289 | Bacteria | 11265 |
| 53 | Ga0065704_10021576 | 3300005289 | Bacteria | 1421 |
| 54 | Ga0065704_10102515 | 3300005289 | Bacteria | 2202 |
| 55 | Ga0065707_10004914 | 3300005295 | Bacteria | 4993 |
| 56 | Ga0065707_10085091 | 3300005295 | Bacteria | 6474 |
| 57 | Ga0065707_10090551 | 3300005295 | Bacteria | 4117 |
| 58 | Ga0065707_10435780 | 3300005295 | Bacteria | 815 |
| 59 | Ga0070658_10000002 | 3300005327 | Bacteria | 637290 |
| 60 | Ga0070658_10000608 | 3300005327 | Bacteria | 31026 |
| 61 | Ga0070658_10003163 | 3300005327 | Bacteria | 13593 |
| 62 | Ga0070658_10294785 | 3300005327 | Bacteria | 1382 |
| 63 | Ga0070676_10001330 | 3300005328 | Bacteria | 12417 |
| 64 | Ga0070670_100000033 | 3300005331 | Bacteria | 158509 |
| 65 | Ga0070670_100611841 | 3300005331 | Bacteria | 975 |
| 66 | Ga0070670_101197457 | 3300005331 | Bacteria | 694 |
| 67 | Ga0070677_10000317 | 3300005333 | Bacteria | 16850 |
| 68 | Ga0068869_100000539 | 3300005334 | Bacteria | 21181 |
| 69 | Ga0068869_100282971 | 3300005334 | Bacteria | 1334 |
| 70 | Ga0068869_100715426 | 3300005334 | Bacteria | 855 |
| 71 | Ga0068869_101199531 | 3300005334 | Bacteria | 667 |
| 72 | Ga0070666_10094384 | 3300005335 | Bacteria | 2058 |
| 73 | Ga0070666_10102081 | 3300005335 | Bacteria | 1977 |
| 74 | Ga0070682_100962338 | 3300005337 | Bacteria | 706 |
| 75 | Ga0068868_100012870 | 3300005338 | Bacteria | 6120 |
| 76 | Ga0070660_100000137 | 3300005339 | Bacteria | 46762 |
| 77 | Ga0070660_100000561 | 3300005339 | Bacteria | 24963 |
| 78 | Ga0070660_100062727 | 3300005339 | Bacteria | 2888 |
| 79 | Ga0070660_100087481 | 3300005339 | Bacteria | 2452 |
| 80 | Ga0070660_100105325 | 3300005339 | Bacteria | 2238 |
| 81 | Ga0070661_100007643 | 3300005344 | Bacteria | 7461 |
| 82 | Ga0070661_100273053 | 3300005344 | Bacteria | 1310 |
| 83 | Ga0070661_100415539 | 3300005344 | Bacteria | 1066 |
| 84 | Ga0070692_10003203 | 3300005345 | Bacteria | 6584 |
| 85 | Ga0070668_100000018 | 3300005347 | Bacteria | 99142 |
| 86 | Ga0070668_100008256 | 3300005347 | Bacteria | 7729 |
| 87 | Ga0070668_100009296 | 3300005347 | Bacteria | 7289 |
| 88 | Ga0070668_100029208 | 3300005347 | Bacteria | 4186 |
| 89 | Ga0070668_100097071 | 3300005347 | Bacteria | 2330 |
| 90 | Ga0070668_100395096 | 3300005347 | Bacteria | 1179 |
| 91 | Ga0070668_100558380 | 3300005347 | Bacteria | 997 |
| 92 | Ga0070668_102240225 | 3300005347 | Bacteria | 505 |
| 93 | Ga0070669_100000005 | 3300005353 | Bacteria | 309134 |
| 94 | Ga0070669_100047551 | 3300005353 | Bacteria | 3130 |
| 95 | Ga0070669_100098822 | 3300005353 | Bacteria | 2199 |
| 96 | Ga0070669_100185357 | 3300005353 | Bacteria | 1630 |
| 97 | Ga0070669_100186036 | 3300005353 | Bacteria | 1627 |
| 98 | Ga0070669_100534466 | 3300005353 | Bacteria | 976 |
| 99 | Ga0070675_100000664 | 3300005354 | Bacteria | 23789 |
| 100 | Ga0070675_100303583 | 3300005354 | Bacteria | 1407 |
| 101 | Ga0070675_101078977 | 3300005354 | Bacteria | 738 |
| 102 | Ga0070675_101387591 | 3300005354 | Bacteria | 648 |
| 103 | Ga0070671_100000189 | 3300005355 | Bacteria | 41536 |
| 104 | Ga0070671_100002574 | 3300005355 | Bacteria | 14066 |
| 105 | Ga0070671_100058331 | 3300005355 | Bacteria | 3214 |
| 106 | Ga0070671_100462264 | 3300005355 | Bacteria | 1089 |
| 107 | Ga0070671_101227681 | 3300005355 | Bacteria | 660 |
| 108 | Ga0070674_100000527 | 3300005356 | Bacteria | 19255 |
| 109 | Ga0070674_100019659 | 3300005356 | Bacteria | 4295 |
| 110 | Ga0070674_100047101 | 3300005356 | Bacteria | 2952 |
| 111 | Ga0070674_100048838 | 3300005356 | Bacteria | 2906 |
| 112 | Ga0070673_100000007 | 3300005364 | Bacteria | 177157 |
| 113 | Ga0070673_102179771 | 3300005364 | Bacteria | 527 |
| 114 | Ga0070659_100010029 | 3300005366 | Bacteria | 6972 |
| 115 | Ga0070659_100031864 | 3300005366 | Bacteria | 4086 |
| 116 | Ga0070659_100065018 | 3300005366 | Bacteria | 2888 |
| 117 | Ga0070659_100102921 | 3300005366 | Bacteria | 2299 |
| 118 | Ga0070659_100199063 | 3300005366 | Bacteria | 1648 |
| 119 | Ga0070659_100282044 | 3300005366 | Bacteria | 1382 |
| 120 | Ga0070659_100680563 | 3300005366 | Bacteria | 888 |
| 121 | Ga0070659_100937630 | 3300005366 | Bacteria | 758 |
| 122 | Ga0070667_100000089 | 3300005367 | Bacteria | 113661 |
| 123 | Ga0070667_100005221 | 3300005367 | Bacteria | 10854 |
| 124 | Ga0070667_100139378 | 3300005367 | Bacteria | 2123 |
| 125 | Ga0070667_100327880 | 3300005367 | Bacteria | 1382 |
| 126 | Ga0070667_101784883 | 3300005367 | Bacteria | 579 |
| 127 | Ga0070701_10177318 | 3300005438 | Bacteria | 1245 |
| 128 | Ga0070701_10605475 | 3300005438 | Bacteria | 726 |
| 129 | Ga0070701_11045938 | 3300005438 | Bacteria | 572 |
| 130 | Ga0070663_100016292 | 3300005455 | Bacteria | 4823 |
| 131 | Ga0070663_100220730 | 3300005455 | Bacteria | 1488 |
| 132 | Ga0070663_100280633 | 3300005455 | Bacteria | 1327 |
| 133 | Ga0070663_100342679 | 3300005455 | Bacteria | 1208 |
| 134 | Ga0070678_100000271 | 3300005456 | Bacteria | 24005 |
| 135 | Ga0070678_100007473 | 3300005456 | Bacteria | 6487 |
| 136 | Ga0070662_100239416 | 3300005457 | Bacteria | 1455 |
| 137 | Ga0070662_100262273 | 3300005457 | Bacteria | 1392 |
| 138 | Ga0070662_100335230 | 3300005457 | Unclassified | 1236 |
| 139 | Ga0070662_100903529 | 3300005457 | Bacteria | 753 |
| 140 | Ga0070662_100958247 | 3300005457 | Bacteria | 732 |
| 141 | Ga0070662_101342573 | 3300005457 | Bacteria | 616 |
| 142 | Ga0070681_11815822 | 3300005458 | Bacteria | 537 |
| 143 | Ga0068867_100000134 | 3300005459 | Bacteria | 47761 |
| 144 | Ga0070685_10520041 | 3300005466 | Bacteria | 845 |
| 145 | Ga0070699_100729328 | 3300005518 | Bacteria | 906 |
| 146 | Ga0068853_100298564 | 3300005539 | Bacteria | 1488 |
| 147 | Ga0068853_100715865 | 3300005539 | Bacteria | 955 |
| 148 | Ga0068853_100808760 | 3300005539 | Bacteria | 898 |
| 149 | Ga0068853_101336861 | 3300005539 | Bacteria | 693 |
| 150 | Ga0068853_101431514 | 3300005539 | Bacteria | 669 |
| 151 | Ga0070672_100009747 | 3300005543 | Bacteria | 6633 |
| 152 | Ga0070672_100117631 | 3300005543 | Bacteria | 2173 |
| 153 | Ga0070672_100244314 | 3300005543 | Bacteria | 1511 |
| 154 | Ga0070672_100441548 | 3300005543 | Bacteria | 1120 |
| 155 | Ga0070672_100483844 | 3300005543 | Bacteria | 1069 |
| 156 | Ga0070696_100683838 | 3300005546 | Bacteria | 835 |
| 157 | Ga0070665_100000265 | 3300005548 | Bacteria | 85729 |
| 158 | Ga0070665_100000493 | 3300005548 | Bacteria | 56564 |
| 159 | Ga0070665_100028240 | 3300005548 | Bacteria | 5650 |
| 160 | Ga0070665_100084455 | 3300005548 | Bacteria | 3181 |
| 161 | Ga0070665_100264549 | 3300005548 | Bacteria | 1721 |
| 162 | Ga0070665_100650171 | 3300005548 | Bacteria | 1067 |
| 163 | Ga0070665_100668471 | 3300005548 | Bacteria | 1052 |
| 164 | Ga0070665_102528454 | 3300005548 | Bacteria | 515 |
| 165 | Ga0068855_100000191 | 3300005563 | Bacteria | 79120 |
| 166 | Ga0068855_100179242 | 3300005563 | Bacteria | 2396 |
| 167 | Ga0068855_100476636 | 3300005563 | Bacteria | 1359 |
| 168 | Ga0068855_100867477 | 3300005563 | Bacteria | 955 |
| 169 | Ga0070664_100031198 | 3300005564 | Bacteria | 4450 |
| 170 | Ga0070664_100149494 | 3300005564 | Bacteria | 2061 |
| 171 | Ga0070664_101034887 | 3300005564 | Bacteria | 772 |
| 172 | Ga0068857_100096788 | 3300005577 | Bacteria | 2645 |
| 173 | Ga0068857_100170339 | 3300005577 | Bacteria | 1979 |
| 174 | Ga0068857_100298447 | 3300005577 | Bacteria | 1485 |
| 175 | Ga0068857_100813241 | 3300005577 | Bacteria | 893 |
| 176 | Ga0068857_101091141 | 3300005577 | Bacteria | 770 |
| 177 | Ga0068854_100070232 | 3300005578 | Bacteria | 2559 |
| 178 | Ga0068854_100224649 | 3300005578 | Bacteria | 1487 |
| 179 | Ga0068854_100771223 | 3300005578 | Bacteria | 836 |
| 180 | Ga0068854_100936697 | 3300005578 | Bacteria | 763 |
| 181 | Ga0068854_101020136 | 3300005578 | Bacteria | 733 |
| 182 | Ga0068856_100008621 | 3300005614 | Bacteria | 9916 |
| 183 | Ga0068856_100311578 | 3300005614 | Bacteria | 1591 |
| 184 | Ga0068852_100095289 | 3300005616 | Bacteria | 2672 |
| 185 | Ga0068852_100134152 | 3300005616 | Bacteria | 2284 |
| 186 | Ga0068852_100204240 | 3300005616 | Bacteria | 1871 |
| 187 | Ga0068852_100740033 | 3300005616 | Bacteria | 995 |
| 188 | Ga0068859_100010744 | 3300005617 | Bacteria | 9214 |
| 189 | Ga0068859_100011274 | 3300005617 | Bacteria | 8995 |
| 190 | Ga0068859_100016302 | 3300005617 | Bacteria | 7465 |
| 191 | Ga0068859_100268857 | 3300005617 | Bacteria | 1797 |
| 192 | Ga0068859_101513920 | 3300005617 | Bacteria | 740 |
| 193 | Ga0068859_102256822 | 3300005617 | Bacteria | 600 |
| 194 | Ga0068864_100000042 | 3300005618 | Bacteria | 162930 |
| 195 | Ga0068866_10128821 | 3300005718 | Bacteria | 1436 |
| 196 | Ga0068861_100023975 | 3300005719 | Bacteria | 4407 |
| 197 | Ga0068861_100065855 | 3300005719 | Bacteria | 2792 |
| 198 | Ga0068861_100807385 | 3300005719 | Bacteria | 881 |
| 199 | Ga0068861_100904161 | 3300005719 | Bacteria | 836 |
| 200 | Ga0068861_101598729 | 3300005719 | Bacteria | 642 |
| 201 | Ga0068851_10037591 | 3300005834 | Bacteria | 2427 |
| 202 | Ga0068851_10038999 | 3300005834 | Bacteria | 2385 |
| 203 | Ga0068851_10447647 | 3300005834 | Bacteria | 767 |
| 204 | Ga0068851_10627986 | 3300005834 | Bacteria | 656 |
| 205 | Ga0068870_10529845 | 3300005840 | Bacteria | 790 |
| 206 | Ga0068863_100000030 | 3300005841 | Bacteria | 176023 |
| 207 | Ga0068863_100001219 | 3300005841 | Bacteria | 25689 |
| 208 | Ga0068863_100003973 | 3300005841 | Bacteria | 14604 |
| 209 | Ga0068858_100488825 | 3300005842 | Bacteria | 1188 |
| 210 | Ga0068860_100000148 | 3300005843 | Bacteria | 113661 |
| 211 | Ga0068860_100002421 | 3300005843 | Bacteria | 19585 |
| 212 | Ga0068860_100077492 | 3300005843 | Bacteria | 3161 |
| 213 | Ga0068860_100943145 | 3300005843 | Bacteria | 880 |
| 214 | Ga0068860_101090979 | 3300005843 | Bacteria | 817 |
| 215 | Ga0068862_100000005 | 3300005844 | Bacteria | 350713 |
| 216 | Ga0068862_100000149 | 3300005844 | Bacteria | 79784 |
| 217 | Ga0068862_100014432 | 3300005844 | Bacteria | 6555 |
| 218 | Ga0068862_100022099 | 3300005844 | Bacteria | 5322 |
| 219 | Ga0068862_101350836 | 3300005844 | Bacteria | 715 |
| 220 | Ga0068862_102062504 | 3300005844 | Bacteria | 581 |
| 221 | Ga0081539_10165735 | 3300005985 | Bacteria | 1049 |
| 222 | Ga0075432_10482713 | 3300006058 | Bacteria | 549 |
| 223 | Ga0097621_100062388 | 3300006237 | Bacteria | 3060 |
| 224 | Ga0075370_10403154 | 3300006353 | Bacteria | 820 |
| 225 | Ga0075430_100035193 | 3300006846 | Bacteria | 4249 |
| 226 | Ga0068865_100000008 | 3300006881 | Bacteria | 177158 |
| 227 | Ga0068865_100840529 | 3300006881 | Bacteria | 795 |
| 228 | Ga0097620_100010744 | 3300006931 | Bacteria | 9214 |
| 229 | Ga0097620_100011274 | 3300006931 | Bacteria | 8995 |
| 230 | Ga0097620_100016302 | 3300006931 | Bacteria | 7465 |
| 231 | Ga0097620_100268850 | 3300006931 | Bacteria | 1797 |
| 232 | Ga0097620_101513960 | 3300006931 | Bacteria | 740 |
| 233 | Ga0097620_102256473 | 3300006931 | Bacteria | 600 |
| 234 | Ga0079104_1055173 | 3300006946 | Bacteria | 872 |
| 235 | Ga0099826_10421449 | 3300006948 | Bacteria | 643 |
| 236 | Ga0105251_10009288 | 3300009011 | Bacteria | 5822 |
| 237 | Ga0105240_10120463 | 3300009093 | Bacteria | 3160 |
| 238 | Ga0105240_10154472 | 3300009093 | Bacteria | 2731 |
| 239 | Ga0111539_10670297 | 3300009094 | Bacteria | 1208 |
| 240 | Ga0105245_10001922 | 3300009098 | Bacteria | 18868 |
| 241 | Ga0105245_10095357 | 3300009098 | Bacteria | 2745 |
| 242 | Ga0105245_10708213 | 3300009098 | Bacteria | 1040 |
| 243 | Ga0105245_11127325 | 3300009098 | Bacteria | 831 |
| 244 | Ga0105247_10004166 | 3300009101 | Bacteria | 9275 |
| 245 | Ga0105247_11233653 | 3300009101 | Bacteria | 597 |
| 246 | Ga0105243_10000213 | 3300009148 | Bacteria | 67585 |
| 247 | Ga0105243_10003232 | 3300009148 | Bacteria | 13310 |
| 248 | Ga0105243_10057527 | 3300009148 | Bacteria | 3096 |
| 249 | Ga0105243_10413212 | 3300009148 | Bacteria | 1256 |
| 250 | Ga0105243_11127751 | 3300009148 | Bacteria | 794 |
| 251 | Ga0105243_11800105 | 3300009148 | Bacteria | 643 |
| 252 | Ga0105241_10002321 | 3300009174 | Bacteria | 14295 |
| 253 | Ga0105241_10012233 | 3300009174 | Bacteria | 6297 |
| 254 | Ga0105241_11611788 | 3300009174 | Bacteria | 628 |
| 255 | Ga0105241_12668187 | 3300009174 | Bacteria | 503 |
| 256 | Ga0105242_10000437 | 3300009176 | Bacteria | 33251 |
| 257 | Ga0105242_11245171 | 3300009176 | Bacteria | 765 |
| 258 | Ga0105242_11841882 | 3300009176 | Bacteria | 644 |
| 259 | Ga0105248_10000171 | 3300009177 | Bacteria | 75565 |
| 260 | Ga0105248_10316025 | 3300009177 | Bacteria | 1759 |
| 261 | Ga0105237_10046738 | 3300009545 | Bacteria | 4354 |
| 262 | Ga0105237_10125051 | 3300009545 | Bacteria | 2566 |
| 263 | Ga0105237_11493221 | 3300009545 | Bacteria | 682 |
| 264 | Ga0105237_12111537 | 3300009545 | Bacteria | 572 |
| 265 | Ga0105238_10110993 | 3300009551 | Bacteria | 2722 |
| 266 | Ga0105238_10823291 | 3300009551 | Bacteria | 945 |
| 267 | Ga0105238_10835782 | 3300009551 | Bacteria | 937 |
| 268 | Ga0105238_11046774 | 3300009551 | Bacteria | 838 |
| 269 | Ga0105238_11126041 | 3300009551 | Bacteria | 808 |
| 270 | Ga0105238_11799142 | 3300009551 | Bacteria | 645 |
| 271 | Ga0105249_10000056 | 3300009553 | Bacteria | 160443 |
| 272 | Ga0105249_10015107 | 3300009553 | Bacteria | 6831 |
| 273 | Ga0105249_10019471 | 3300009553 | Bacteria | 6055 |
| 274 | Ga0105249_10060847 | 3300009553 | Bacteria | 3465 |
| 275 | Ga0105249_10904749 | 3300009553 | Bacteria | 949 |
| 276 | Ga0105148_100086 | 3300009978 | Bacteria | 14695 |
| 277 | Ga0105147_105670 | 3300009982 | Bacteria | 1051 |
| 278 | Ga0105239_10034267 | 3300010375 | Bacteria | 5574 |
| 279 | Ga0105239_10239671 | 3300010375 | Bacteria | 2036 |
| 280 | Ga0105246_10002390 | 3300011119 | Bacteria | 11329 |
| 281 | Ga0105246_10041447 | 3300011119 | Bacteria | 3112 |
| 282 | Ga0105246_11067787 | 3300011119 | Bacteria | 735 |
| 283 | Ga0157317_1002050 | 3300012475 | Bacteria | 1158 |
| 284 | Ga0157327_1015475 | 3300012512 | Bacteria | 794 |
| 285 | Ga0157326_1000010 | 3300012513 | Bacteria | 16665 |
| 286 | Ga0157373_10013087 | 3300013100 | Bacteria | 6089 |
| 287 | Ga0157373_10015808 | 3300013100 | Bacteria | 5510 |
| 288 | Ga0157373_10046169 | 3300013100 | Bacteria | 3108 |
| 289 | Ga0157373_10061923 | 3300013100 | Bacteria | 2650 |
| 290 | Ga0157371_10000059 | 3300013102 | Bacteria | 170541 |
| 291 | Ga0157370_10016799 | 3300013104 | Bacteria | 7401 |
| 292 | Ga0157370_10175173 | 3300013104 | Bacteria | 1994 |
| 293 | Ga0157370_11074959 | 3300013104 | Bacteria | 727 |
| 294 | Ga0157369_10002550 | 3300013105 | Bacteria | 21798 |
| 295 | Ga0157369_10147458 | 3300013105 | Bacteria | 2487 |
| 296 | Ga0157369_10380251 | 3300013105 | Bacteria | 1466 |
| 297 | Ga0157374_10019747 | 3300013296 | Bacteria | 5970 |
| 298 | Ga0157374_10029189 | 3300013296 | Bacteria | 4991 |
| 299 | Ga0157374_12265340 | 3300013296 | Bacteria | 570 |
| 300 | Ga0157378_10004325 | 3300013297 | Bacteria | 12498 |
| 301 | Ga0163162_10068729 | 3300013306 | Bacteria | 3594 |
| 302 | Ga0163162_10368425 | 3300013306 | Bacteria | 1570 |
| 303 | Ga0163162_11082141 | 3300013306 | Bacteria | 908 |
| 304 | Ga0163162_12395927 | 3300013306 | Bacteria | 607 |
| 305 | Ga0157372_10358684 | 3300013307 | Bacteria | 1698 |
| 306 | Ga0157372_10535199 | 3300013307 | Bacteria | 1366 |
| 307 | Ga0157372_10537722 | 3300013307 | Bacteria | 1362 |
| 308 | Ga0157372_10852825 | 3300013307 | Bacteria | 1058 |
| 309 | Ga0157372_10991801 | 3300013307 | Bacteria | 973 |
| 310 | Ga0157372_12227023 | 3300013307 | Bacteria | 629 |
| 311 | Ga0157372_12313318 | 3300013307 | Bacteria | 617 |
| 312 | Ga0157375_10004295 | 3300013308 | Bacteria | 12363 |
| 313 | Ga0157375_11334067 | 3300013308 | Bacteria | 844 |
| 314 | Ga0163163_10408569 | 3300014325 | Bacteria | 1416 |
| 315 | Ga0163163_11842621 | 3300014325 | Bacteria | 665 |
| 316 | Ga0157380_10000084 | 3300014326 | Bacteria | 52067 |
| 317 | Ga0157380_10006098 | 3300014326 | Bacteria | 8448 |
| 318 | Ga0157380_11226862 | 3300014326 | Bacteria | 794 |
| 319 | Ga0157377_10046846 | 3300014745 | Bacteria | 2420 |
| 320 | Ga0157376_10000315 | 3300014969 | Bacteria | 32437 |
| 321 | Ga0157376_11007997 | 3300014969 | Bacteria | 855 |
| 322 | Ga0157376_11171708 | 3300014969 | Bacteria | 796 |
| 323 | Ga0163161_10003807 | 3300017792 | Bacteria | 10577 |
| 324 | Ga0163161_10220521 | 3300017792 | Bacteria | 1468 |
| 325 | Ga0163161_10238126 | 3300017792 | Bacteria | 1414 |
| 326 | Ga0163161_10677675 | 3300017792 | Bacteria | 857 |
| 327 | Ga0206354_10227562 | 3300020081 | Bacteria | 2130 |
| 328 | Ga0206353_11261817 | 3300020082 | Bacteria | 25116 |
| 329 | Ga0213873_10000019 | 3300021358 | Bacteria | 122085 |
| 330 | Ga0213874_10213503 | 3300021377 | Bacteria | 699 |
| 331 | Ga0213876_10000075 | 3300021384 | Bacteria | 120068 |
| 332 | Ga0213876_10001526 | 3300021384 | Bacteria | 14331 |
| 333 | Ga0213875_10000323 | 3300021388 | Bacteria | 45327 |
| 334 | Ga0209674_103791 | 3300025226 | Bacteria | 2666 |
| 335 | Ga0209563_100116 | 3300025230 | Bacteria | 134661 |
| 336 | Ga0207425_1002702 | 3300025245 | Bacteria | 6063 |
| 337 | Ga0209026_1012534 | 3300025250 | Bacteria | 1474 |
| 338 | Ga0209677_104219 | 3300025253 | Bacteria | 4248 |
| 339 | Ga0209148_1000398 | 3300025254 | Bacteria | 50941 |
| 340 | Ga0209148_1001103 | 3300025254 | Bacteria | 16204 |
| 341 | Ga0209233_1080964 | 3300025261 | Bacteria | 578 |
| 342 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 343 | Ga0209565_1000244 | 3300025263 | Bacteria | 58330 |
| 344 | Ga0209455_1001110 | 3300025272 | Bacteria | 13190 |
| 345 | Ga0209673_1000569 | 3300025273 | Bacteria | 58821 |
| 346 | Ga0209673_1006074 | 3300025273 | Bacteria | 5925 |
| 347 | Ga0209564_1009843 | 3300025295 | Bacteria | 4485 |
| 348 | Ga0209564_1030333 | 3300025295 | Bacteria | 1677 |
| 349 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 350 | Ga0209758_1002073 | 3300025297 | Bacteria | 21369 |
| 351 | Ga0209050_1003166 | 3300025298 | Bacteria | 12531 |
| 352 | Ga0209050_1038584 | 3300025298 | Bacteria | 1359 |
| 353 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 354 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 355 | Ga0209257_1003147 | 3300025304 | Bacteria | 14718 |
| 356 | Ga0207656_10006564 | 3300025321 | Bacteria | 4193 |
| 357 | Ga0207713_1097285 | 3300025735 | Bacteria | 1022 |
| 358 | Ga0207682_10000624 | 3300025893 | Bacteria | 16451 |
| 359 | Ga0207642_10584665 | 3300025899 | Bacteria | 693 |
| 360 | Ga0207710_10007932 | 3300025900 | Bacteria | 4489 |
| 361 | Ga0207680_10044629 | 3300025903 | Bacteria | 2608 |
| 362 | Ga0207680_10087932 | 3300025903 | Bacteria | 1969 |
| 363 | Ga0207647_10047708 | 3300025904 | Bacteria | 2663 |
| 364 | Ga0207647_10059593 | 3300025904 | Bacteria | 2336 |
| 365 | Ga0207647_10126621 | 3300025904 | Bacteria | 1503 |
| 366 | Ga0207647_10136397 | 3300025904 | Bacteria | 1440 |
| 367 | Ga0207647_10316887 | 3300025904 | Bacteria | 886 |
| 368 | Ga0207645_10001217 | 3300025907 | Bacteria | 21219 |
| 369 | Ga0207645_10040611 | 3300025907 | Bacteria | 2979 |
| 370 | Ga0207645_10829117 | 3300025907 | Bacteria | 629 |
| 371 | Ga0207705_10000008 | 3300025909 | Bacteria | 589717 |
| 372 | Ga0207705_10000197 | 3300025909 | Bacteria | 61058 |
| 373 | Ga0207705_10009236 | 3300025909 | Bacteria | 7177 |
| 374 | Ga0207654_10001228 | 3300025911 | Bacteria | 13697 |
| 375 | Ga0207707_10630770 | 3300025912 | Bacteria | 905 |
| 376 | Ga0207695_10029722 | 3300025913 | Bacteria | 6030 |
| 377 | Ga0207695_10059676 | 3300025913 | Bacteria | 3954 |
| 378 | Ga0207695_11195947 | 3300025913 | Bacteria | 640 |
| 379 | Ga0207671_10076484 | 3300025914 | Bacteria | 2505 |
| 380 | Ga0207657_10001820 | 3300025919 | Bacteria | 22995 |
| 381 | Ga0207657_10004655 | 3300025919 | Bacteria | 14494 |
| 382 | Ga0207657_10021785 | 3300025919 | Bacteria | 6021 |
| 383 | Ga0207657_10031380 | 3300025919 | Bacteria | 4813 |
| 384 | Ga0207657_10065746 | 3300025919 | Bacteria | 3090 |
| 385 | Ga0207657_10104067 | 3300025919 | Bacteria | 2352 |
| 386 | Ga0207657_10355578 | 3300025919 | Bacteria | 1155 |
| 387 | Ga0207649_10000225 | 3300025920 | Bacteria | 46073 |
| 388 | Ga0207681_10000003 | 3300025923 | Bacteria | 713245 |
| 389 | Ga0207681_10222448 | 3300025923 | Bacteria | 1461 |
| 390 | Ga0207681_10261162 | 3300025923 | Bacteria | 1356 |
| 391 | Ga0207681_10492107 | 3300025923 | Bacteria | 1003 |
| 392 | Ga0207681_10862858 | 3300025923 | Bacteria | 757 |
| 393 | Ga0207681_11229633 | 3300025923 | Bacteria | 629 |
| 394 | Ga0207694_10008225 | 3300025924 | Bacteria | 7888 |
| 395 | Ga0207694_10048518 | 3300025924 | Bacteria | 3285 |
| 396 | Ga0207694_11066471 | 3300025924 | Bacteria | 684 |
| 397 | Ga0207694_11270717 | 3300025924 | Bacteria | 623 |
| 398 | Ga0207650_10000012 | 3300025925 | Bacteria | 437889 |
| 399 | Ga0207650_10512520 | 3300025925 | Bacteria | 1003 |
| 400 | Ga0207650_11203270 | 3300025925 | Bacteria | 645 |
| 401 | Ga0207659_10002169 | 3300025926 | Bacteria | 11660 |
| 402 | Ga0207687_10004919 | 3300025927 | Bacteria | 8874 |
| 403 | Ga0207687_10221646 | 3300025927 | Bacteria | 1490 |
| 404 | Ga0207644_10000096 | 3300025931 | Bacteria | 63618 |
| 405 | Ga0207644_10172545 | 3300025931 | Bacteria | 1689 |
| 406 | Ga0207644_10280019 | 3300025931 | Bacteria | 1339 |
| 407 | Ga0207644_11156170 | 3300025931 | Bacteria | 650 |
| 408 | Ga0207690_10003708 | 3300025932 | Bacteria | 9081 |
| 409 | Ga0207690_10006876 | 3300025932 | Bacteria | 6748 |
| 410 | Ga0207690_10020317 | 3300025932 | Bacteria | 4102 |
| 411 | Ga0207690_10023602 | 3300025932 | Bacteria | 3840 |
| 412 | Ga0207690_10403802 | 3300025932 | Bacteria | 1090 |
| 413 | Ga0207690_11041125 | 3300025932 | Bacteria | 681 |
| 414 | Ga0207706_10073104 | 3300025933 | Bacteria | 3015 |
| 415 | Ga0207706_10095684 | 3300025933 | Bacteria | 2612 |
| 416 | Ga0207706_10234640 | 3300025933 | Bacteria | 1604 |
| 417 | Ga0207706_10271714 | 3300025933 | Bacteria | 1479 |
| 418 | Ga0207706_10320350 | 3300025933 | Unclassified | 1349 |
| 419 | Ga0207706_10324756 | 3300025933 | Bacteria | 1339 |
| 420 | Ga0207706_10575052 | 3300025933 | Bacteria | 969 |
| 421 | Ga0207686_10000908 | 3300025934 | Bacteria | 17774 |
| 422 | Ga0207686_10914065 | 3300025934 | Bacteria | 709 |
| 423 | Ga0207686_11070967 | 3300025934 | Bacteria | 656 |
| 424 | Ga0207709_10000018 | 3300025935 | Bacteria | 431545 |
| 425 | Ga0207709_10000399 | 3300025935 | Bacteria | 42600 |
| 426 | Ga0207709_10056889 | 3300025935 | Bacteria | 2423 |
| 427 | Ga0207709_10778053 | 3300025935 | Bacteria | 771 |
| 428 | Ga0207670_11146560 | 3300025936 | Bacteria | 657 |
| 429 | Ga0207669_10000068 | 3300025937 | Bacteria | 52240 |
| 430 | Ga0207669_10097629 | 3300025937 | Bacteria | 1932 |
| 431 | Ga0207669_10165796 | 3300025937 | Bacteria | 1566 |
| 432 | Ga0207669_10193174 | 3300025937 | Bacteria | 1470 |
| 433 | Ga0207704_10000013 | 3300025938 | Bacteria | 170478 |
| 434 | Ga0207704_11104321 | 3300025938 | Bacteria | 674 |
| 435 | Ga0207691_10013456 | 3300025940 | Bacteria | 7830 |
| 436 | Ga0207691_10334715 | 3300025940 | Bacteria | 1297 |
| 437 | Ga0207691_10384679 | 3300025940 | Bacteria | 1198 |
| 438 | Ga0207691_10459888 | 3300025940 | Bacteria | 1082 |
| 439 | Ga0207711_10001461 | 3300025941 | Bacteria | 22080 |
| 440 | Ga0207689_10000852 | 3300025942 | Bacteria | 29407 |
| 441 | Ga0207689_10513223 | 3300025942 | Bacteria | 1005 |
| 442 | Ga0207679_10096554 | 3300025945 | Bacteria | 2300 |
| 443 | Ga0207679_10220374 | 3300025945 | Bacteria | 1596 |
| 444 | Ga0207679_11237767 | 3300025945 | Bacteria | 685 |
| 445 | Ga0207667_10000107 | 3300025949 | Bacteria | 133066 |
| 446 | Ga0207667_10000113 | 3300025949 | Bacteria | 131083 |
| 447 | Ga0207667_10029652 | 3300025949 | Bacteria | 5931 |
| 448 | Ga0207667_10040848 | 3300025949 | Bacteria | 4936 |
| 449 | Ga0207667_10289671 | 3300025949 | Bacteria | 1673 |
| 450 | Ga0207667_11944280 | 3300025949 | Bacteria | 549 |
| 451 | Ga0207651_10000013 | 3300025960 | Bacteria | 177573 |
| 452 | Ga0207651_10856658 | 3300025960 | Bacteria | 808 |
| 453 | Ga0207712_10000015 | 3300025961 | Bacteria | 346689 |
| 454 | Ga0207712_10007843 | 3300025961 | Bacteria | 6749 |
| 455 | Ga0207712_10231975 | 3300025961 | Bacteria | 1482 |
| 456 | Ga0207712_10282526 | 3300025961 | Bacteria | 1355 |
| 457 | Ga0207668_10000082 | 3300025972 | Bacteria | 71860 |
| 458 | Ga0207668_10002153 | 3300025972 | Bacteria | 11488 |
| 459 | Ga0207668_10003245 | 3300025972 | Bacteria | 9538 |
| 460 | Ga0207668_10094341 | 3300025972 | Bacteria | 2206 |
| 461 | Ga0207668_10109849 | 3300025972 | Bacteria | 2067 |
| 462 | Ga0207668_10277830 | 3300025972 | Bacteria | 1372 |
| 463 | Ga0207668_10782422 | 3300025972 | Bacteria | 843 |
| 464 | Ga0207640_10013098 | 3300025981 | Bacteria | 4743 |
| 465 | Ga0207640_10016371 | 3300025981 | Bacteria | 4312 |
| 466 | Ga0207640_10745270 | 3300025981 | Bacteria | 844 |
| 467 | Ga0207640_10896765 | 3300025981 | Bacteria | 774 |
| 468 | Ga0207658_10000069 | 3300025986 | Bacteria | 113687 |
| 469 | Ga0207658_10013699 | 3300025986 | Bacteria | 5546 |
| 470 | Ga0207658_10176272 | 3300025986 | Bacteria | 1766 |
| 471 | Ga0207658_11243804 | 3300025986 | Bacteria | 681 |
| 472 | Ga0207677_10007087 | 3300026023 | Bacteria | 6171 |
| 473 | Ga0207703_10558857 | 3300026035 | Bacteria | 1079 |
| 474 | Ga0207639_10000269 | 3300026041 | Bacteria | 37143 |
| 475 | Ga0207639_10002666 | 3300026041 | Bacteria | 11981 |
| 476 | Ga0207639_10078461 | 3300026041 | Bacteria | 2606 |
| 477 | Ga0207639_10163513 | 3300026041 | Bacteria | 1878 |
| 478 | Ga0207639_10209648 | 3300026041 | Bacteria | 1676 |
| 479 | Ga0207639_10483699 | 3300026041 | Bacteria | 1129 |
| 480 | Ga0207639_10657564 | 3300026041 | Bacteria | 970 |
| 481 | Ga0207639_11150271 | 3300026041 | Bacteria | 728 |
| 482 | Ga0207639_11429729 | 3300026041 | Bacteria | 649 |
| 483 | Ga0207678_10000400 | 3300026067 | Bacteria | 39732 |
| 484 | Ga0207678_10041375 | 3300026067 | Bacteria | 3996 |
| 485 | Ga0207678_10049909 | 3300026067 | Bacteria | 3616 |
| 486 | Ga0207702_10001111 | 3300026078 | Bacteria | 27466 |
| 487 | Ga0207702_10006623 | 3300026078 | Bacteria | 9964 |
| 488 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 489 | Ga0207641_10004476 | 3300026088 | Bacteria | 12094 |
| 490 | Ga0207641_10004557 | 3300026088 | Bacteria | 11975 |
| 491 | Ga0207648_10000382 | 3300026089 | Bacteria | 48961 |
| 492 | Ga0207676_10000009 | 3300026095 | Bacteria | 545256 |
| 493 | Ga0207674_10003571 | 3300026116 | Bacteria | 18967 |
| 494 | Ga0207674_10036095 | 3300026116 | Bacteria | 5155 |
| 495 | Ga0207674_10171019 | 3300026116 | Bacteria | 2126 |
| 496 | Ga0207674_10273124 | 3300026116 | Bacteria | 1638 |
| 497 | Ga0207674_11171166 | 3300026116 | Bacteria | 738 |
| 498 | Ga0207675_100001338 | 3300026118 | Bacteria | 24709 |
| 499 | Ga0207675_101215545 | 3300026118 | Bacteria | 774 |
| 500 | Ga0207675_101375987 | 3300026118 | Bacteria | 726 |
| 501 | Ga0207683_10004636 | 3300026121 | Bacteria | 11854 |
| 502 | Ga0207683_10031296 | 3300026121 | Bacteria | 4618 |
| 503 | Ga0207698_10005545 | 3300026142 | Bacteria | 7808 |
| 504 | Ga0207698_10007060 | 3300026142 | Bacteria | 7035 |
| 505 | Ga0207698_10986946 | 3300026142 | Bacteria | 852 |
| 506 | Ga0207698_11546020 | 3300026142 | Bacteria | 679 |
| 507 | Ga0209282_1423339 | 3300027666 | Bacteria | 514 |
| 508 | Ga0209974_10150676 | 3300027876 | Bacteria | 839 |
| 509 | Ga0209974_10250693 | 3300027876 | Bacteria | 666 |
| 510 | Ga0268266_10000592 | 3300028379 | Bacteria | 49766 |
| 511 | Ga0268266_10001249 | 3300028379 | Bacteria | 31063 |
| 512 | Ga0268266_10043391 | 3300028379 | Bacteria | 3843 |
| 513 | Ga0268266_10045446 | 3300028379 | Bacteria | 3757 |
| 514 | Ga0268266_10529866 | 3300028379 | Bacteria | 1127 |
| 515 | Ga0268266_10758684 | 3300028379 | Bacteria | 936 |
| 516 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 517 | Ga0268265_10000021 | 3300028380 | Bacteria | 272292 |
| 518 | Ga0268265_10084475 | 3300028380 | Bacteria | 2516 |
| 519 | Ga0268265_11110522 | 3300028380 | Bacteria | 785 |
| 520 | Ga0268265_11147560 | 3300028380 | Bacteria | 773 |
| 521 | Ga0268265_11624645 | 3300028380 | Bacteria | 651 |
| 522 | Ga0268264_10000217 | 3300028381 | Bacteria | 113674 |
| 523 | Ga0268264_10000820 | 3300028381 | Bacteria | 33465 |
| 524 | Ga0268264_10073017 | 3300028381 | Bacteria | 2911 |
| 525 | Ga0268264_10284417 | 3300028381 | Bacteria | 1550 |
| 526 | Ga0268264_10785682 | 3300028381 | Bacteria | 950 |
| 527 | Ga0307517_10026887 | 3300028786 | Bacteria | 6941 |
| 528 | Ga0307517_10247107 | 3300028786 | Bacteria | 1051 |
| 529 | Ga0307513_10080483 | 3300031456 | Bacteria | 3360 |
| 530 | Ga0307513_10096035 | 3300031456 | Bacteria | 3003 |
| 531 | Ga0307513_10868071 | 3300031456 | Bacteria | 609 |
| 532 | Ga0307408_100003396 | 3300031548 | Bacteria | 10921 |
| 533 | Ga0307408_100201703 | 3300031548 | Bacteria | 1610 |
| 534 | Ga0307408_100383802 | 3300031548 | Bacteria | 1201 |
| 535 | Ga0307408_100579505 | 3300031548 | Bacteria | 994 |
| 536 | Ga0307408_100591425 | 3300031548 | Bacteria | 985 |
| 537 | Ga0307408_101091131 | 3300031548 | Unclassified | 740 |
| 538 | Ga0307408_101260092 | 3300031548 | Bacteria | 692 |
| 539 | Ga0307405_10009363 | 3300031731 | Bacteria | 5017 |
| 540 | Ga0307405_10069099 | 3300031731 | Bacteria | 2263 |
| 541 | Ga0307405_10856583 | 3300031731 | Bacteria | 765 |
| 542 | Ga0307405_11789744 | 3300031731 | Bacteria | 546 |
| 543 | Ga0307413_10204967 | 3300031824 | Bacteria | 1427 |
| 544 | Ga0307413_10358754 | 3300031824 | Bacteria | 1128 |
| 545 | Ga0307413_10750588 | 3300031824 | Bacteria | 816 |
| 546 | Ga0307413_11171371 | 3300031824 | Bacteria | 667 |
| 547 | Ga0307410_10007333 | 3300031852 | Bacteria | 6030 |
| 548 | Ga0307410_10251874 | 3300031852 | Bacteria | 1373 |
| 549 | Ga0307410_10614952 | 3300031852 | Bacteria | 908 |
| 550 | Ga0307406_10020843 | 3300031901 | Bacteria | 3868 |
| 551 | Ga0307406_10402458 | 3300031901 | Bacteria | 1085 |
| 552 | Ga0307406_10614371 | 3300031901 | Bacteria | 898 |
| 553 | Ga0307406_10829038 | 3300031901 | Bacteria | 782 |
| 554 | Ga0307406_11067072 | 3300031901 | Bacteria | 696 |
| 555 | Ga0307406_11647363 | 3300031901 | Bacteria | 568 |
| 556 | Ga0307407_10637191 | 3300031903 | Bacteria | 797 |
| 557 | Ga0307412_10000933 | 3300031911 | Bacteria | 16724 |
| 558 | Ga0307412_10006025 | 3300031911 | Bacteria | 6827 |
| 559 | Ga0307412_10046102 | 3300031911 | Bacteria | 2854 |
| 560 | Ga0307412_10237122 | 3300031911 | Bacteria | 1408 |
| 561 | Ga0307412_10419986 | 3300031911 | Bacteria | 1094 |
| 562 | Ga0307412_10729255 | 3300031911 | Bacteria | 853 |
| 563 | Ga0307409_100266740 | 3300031995 | Bacteria | 1575 |
| 564 | Ga0307409_100504182 | 3300031995 | Bacteria | 1179 |
| 565 | Ga0307409_100631410 | 3300031995 | Bacteria | 1062 |
| 566 | Ga0307409_102880027 | 3300031995 | Bacteria | 508 |
| 567 | Ga0307416_100018226 | 3300032002 | Bacteria | 4940 |
| 568 | Ga0307416_100501079 | 3300032002 | Bacteria | 1279 |
| 569 | Ga0307416_100874634 | 3300032002 | Bacteria | 998 |
| 570 | Ga0307416_100932177 | 3300032002 | Bacteria | 970 |
| 571 | Ga0307416_100963417 | 3300032002 | Bacteria | 955 |
| 572 | Ga0307416_101748634 | 3300032002 | Bacteria | 726 |
| 573 | Ga0307416_102486638 | 3300032002 | Bacteria | 617 |
| 574 | Ga0307414_10081160 | 3300032004 | Bacteria | 2374 |
| 575 | Ga0307414_10819924 | 3300032004 | Bacteria | 849 |
| 576 | Ga0307414_10898408 | 3300032004 | Bacteria | 812 |
| 577 | Ga0307411_10036109 | 3300032005 | Bacteria | 3093 |
| 578 | Ga0307411_10167062 | 3300032005 | Bacteria | 1655 |
| 579 | Ga0307411_10370592 | 3300032005 | Bacteria | 1174 |
| 580 | Ga0307411_10849095 | 3300032005 | Bacteria | 808 |
| 581 | Ga0307411_11170128 | 3300032005 | Bacteria | 696 |
| 582 | Ga0307415_101378921 | 3300032126 | Bacteria | 670 |
| 583 | Ga0307415_101662381 | 3300032126 | Bacteria | 615 |
| 584 | Ga0307510_10498612 | 3300033180 | Bacteria | 660 |
| 585 | Ga0395905_0559065 | 3300037471 | Bacteria | 1045 |
| 586 | Ga0436364_0129444 | 3300037853 | Bacteria | 50814 |
| 587 | Ga0436364_1053529 | 3300037853 | Bacteria | 530 |
| 588 | Ga0395901_0078920 | 3300038443 | Bacteria | 3437 |
| 589 | Ga0395901_0835766 | 3300038443 | Bacteria | 907 |
| 590 | Ga0436365_0069111 | 3300039437 | Bacteria | 1047 |
| 591 | Ga0436365_0271953 | 3300039437 | Bacteria | 2346 |
| 592 | Ga0436365_1058137 | 3300039437 | Bacteria | 63934 |
| 593 | Ga0436365_1650613 | 3300039437 | Bacteria | 78818 |
| 594 | Ga0436363_1210139 | 3300039450 | Bacteria | 716 |
| 595 | Ga0436363_1299169 | 3300039450 | Unclassified | 855 |
| 596 | Ga0436362_0592983 | 3300039453 | Bacteria | 296966 |
| 597 | Ga0439436_0040324 | 3300041404 | Bacteria | 1339 |
| 598 | Ga0439436_0121544 | 3300041404 | Bacteria | 730 |
| 599 | Ga0439439_0070566 | 3300041406 | Bacteria | 935 |
| 600 | Ga0439439_0091595 | 3300041406 | Bacteria | 831 |
| 601 | Ga0439461_0000104 | 3300041410 | Bacteria | 11032 |
| 602 | Ga0439461_0036616 | 3300041410 | Bacteria | 1045 |
| 603 | Ga0439465_0002958 | 3300041413 | Bacteria | 5558 |
| 604 | Ga0439465_0083574 | 3300041413 | Bacteria | 1085 |
| 605 | Ga0451791_0981418 | 3300041451 | Bacteria | 540 |
| 606 | Ga0451791_1334057 | 3300041451 | Bacteria | 594 |
| 607 | Ga0451793_0429151 | 3300041452 | Bacteria | 1205 |
| 608 | Ga0451797_0399028 | 3300041453 | Bacteria | 652 |
| 609 | Ga0451806_030996 | 3300041462 | Bacteria | 2073 |
| 610 | Ga0451807_1470937 | 3300041486 | Bacteria | 663 |
| 611 | Ga0451807_2479410 | 3300041486 | Bacteria | 908 |
| 612 | Ga0451841_0606824 | 3300041498 | Bacteria | 1027 |
| 613 | Ga0451853_3256376 | 3300041512 | Bacteria | 1469 |
| 614 | Ga0451853_3471798 | 3300041512 | Bacteria | 571 |
| 615 | Ga0439431_0001244 | 3300041997 | Bacteria | 5586 |
| 616 | Ga0439431_0010641 | 3300041997 | Bacteria | 2089 |
| 617 | Ga0439442_002694 | 3300042002 | Bacteria | 3485 |
| 618 | Ga0439445_0001112 | 3300042004 | Bacteria | 5742 |
| 619 | Ga0439445_0195494 | 3300042004 | Bacteria | 596 |
| 620 | Ga0439448_0010891 | 3300042005 | Bacteria | 2704 |
| 621 | Ga0439432_000223 | 3300042006 | Bacteria | 20460 |
| 622 | Ga0439452_008518 | 3300042010 | Bacteria | 3083 |
| 623 | Ga0439452_018851 | 3300042010 | Bacteria | 1831 |
| 624 | Ga0439455_0006014 | 3300042012 | Bacteria | 2496 |
| 625 | Ga0439457_020990 | 3300042014 | Bacteria | 1448 |
| 626 | Ga0439462_0001077 | 3300042015 | Bacteria | 5894 |
| 627 | Ga0439462_0041159 | 3300042015 | Bacteria | 1234 |
| 628 | Ga0439462_0083675 | 3300042015 | Bacteria | 872 |
| 629 | Ga0450903_053513 | 3300042138 | Bacteria | 589 |
| 630 | Ga0450904_027242 | 3300042139 | Bacteria | 591 |
| 631 | Ga0450889_034631 | 3300042144 | Bacteria | 598 |
| 632 | Ga0450910_055980 | 3300042147 | Bacteria | 659 |
| 633 | Ga0439446_0150159 | 3300042156 | Bacteria | 766 |
| 634 | Ga0439434_0000659 | 3300042435 | Bacteria | 9905 |
| 635 | Ga0439434_0094754 | 3300042435 | Bacteria | 957 |
| 636 | Ga0466965_0818381 | 3300044683 | Bacteria | 540 |
| 637 | Ga0466963_0202177 | 3300044694 | Bacteria | 1390 |
| 638 | Ga0466968_0014423 | 3300044735 | Bacteria | 3123 |
| 639 | Ga0466960_0638627 | 3300044901 | Bacteria | 635 |
| 640 | Ga0466967_0349286 | 3300045976 | Bacteria | 1431 |
| 641 | Ga0466967_0543896 | 3300045976 | Bacteria | 1143 |
| 642 | Ga0495617_137933 | 3300046452 | Bacteria | 780 |
| 643 | Ga0495638_0014426 | 3300046460 | Bacteria | 5339 |
| 644 | Ga0495638_0019313 | 3300046460 | Bacteria | 4509 |
| 645 | Ga0495638_0351986 | 3300046460 | Bacteria | 778 |
| 646 | Ga0495638_0479471 | 3300046460 | Bacteria | 630 |
| 647 | Ga0495650_0000174 | 3300046471 | Bacteria | 142519 |
| 648 | Ga0495584_0032188 | 3300046491 | Bacteria | 2655 |
| 649 | Ga0495585_0006996 | 3300046492 | Bacteria | 6944 |
| 650 | Ga0495585_0086431 | 3300046492 | Bacteria | 1694 |
| 651 | Ga0495585_0311951 | 3300046492 | Bacteria | 771 |
| 652 | Ga0495596_0011201 | 3300046500 | Bacteria | 3877 |
| 653 | Ga0495607_0051847 | 3300046501 | Bacteria | 2380 |
| 654 | Ga0495607_0270607 | 3300046501 | Bacteria | 810 |
| 655 | Ga0495583_0000593 | 3300046506 | Bacteria | 49619 |
| 656 | Ga0495583_0001959 | 3300046506 | Bacteria | 18914 |
| 657 | Ga0495583_0004659 | 3300046506 | Bacteria | 9673 |
| 658 | Ga0495583_0019153 | 3300046506 | Bacteria | 3580 |
| 659 | Ga0495583_0078014 | 3300046506 | Bacteria | 1443 |
| 660 | Ga0495583_0197572 | 3300046506 | Bacteria | 818 |
| 661 | Ga0495606_0000306 | 3300046507 | Bacteria | 84561 |
| 662 | Ga0495606_0004735 | 3300046507 | Bacteria | 13401 |
| 663 | Ga0495606_0159453 | 3300046507 | Bacteria | 1317 |
| 664 | Ga0495606_0448865 | 3300046507 | Bacteria | 661 |
| 665 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 666 | Ga0495637_0000330 | 3300046520 | Bacteria | 36746 |
| 667 | Ga0495637_0013008 | 3300046520 | Bacteria | 3964 |
| 668 | Ga0495643_0000020 | 3300046522 | Bacteria | 294973 |
| 669 | Ga0495643_0001502 | 3300046522 | Bacteria | 21129 |
| 670 | Ga0495643_0034150 | 3300046522 | Bacteria | 2808 |
| 671 | Ga0495643_0034966 | 3300046522 | Bacteria | 2768 |
| 672 | Ga0495643_0058452 | 3300046522 | Bacteria | 2052 |
| 673 | Ga0495643_0158460 | 3300046522 | Bacteria | 1115 |
| 674 | Ga0495648_0000747 | 3300046524 | Bacteria | 34745 |
| 675 | Ga0495648_0009787 | 3300046524 | Bacteria | 7376 |
| 676 | Ga0495648_0052170 | 3300046524 | Bacteria | 2486 |
| 677 | Ga0495648_0123768 | 3300046524 | Bacteria | 1385 |
| 678 | Ga0495663_0000002 | 3300046525 | Bacteria | 495384 |
| 679 | Ga0495663_0012615 | 3300046525 | Bacteria | 2356 |
| 680 | Ga0495642_0033098 | 3300046528 | Bacteria | 2077 |
| 681 | Ga0495642_0116343 | 3300046528 | Bacteria | 1146 |
| 682 | Ga0495609_0181400 | 3300046538 | Bacteria | 886 |
| 683 | Ga0495621_0419509 | 3300046539 | Bacteria | 570 |
| 684 | Ga0495622_0177699 | 3300046557 | Bacteria | 955 |
| 685 | Ga0495633_0000213 | 3300046558 | Bacteria | 72710 |
| 686 | Ga0495633_0003218 | 3300046558 | Bacteria | 11022 |
| 687 | Ga0495633_0011499 | 3300046558 | Bacteria | 4767 |
| 688 | Ga0495633_0081609 | 3300046558 | Bacteria | 1504 |
| 689 | Ga0495668_0000072 | 3300046616 | Bacteria | 167170 |
| 690 | Ga0495668_0384034 | 3300046616 | Bacteria | 771 |
| 691 | Ga0495668_0493228 | 3300046616 | Bacteria | 675 |
| 692 | Ga0495611_0049263 | 3300046648 | Bacteria | 1895 |
| 693 | Ga0495625_0007192 | 3300046660 | Bacteria | 9749 |
| 694 | Ga0495625_0100566 | 3300046660 | Bacteria | 1987 |
| 695 | Ga0495625_0239627 | 3300046660 | Bacteria | 1181 |
| 696 | Ga0495625_0257377 | 3300046660 | Bacteria | 1131 |
| 697 | Ga0495625_0322017 | 3300046660 | Bacteria | 984 |
| 698 | Ga0495661_0062396 | 3300046665 | Bacteria | 2208 |
| 699 | Ga0495669_0000221 | 3300046684 | Bacteria | 34153 |
| 700 | Ga0495669_0430931 | 3300046684 | Bacteria | 640 |
| 701 | Ga0495670_0839631 | 3300046691 | Bacteria | 502 |
| 702 | Ga0495671_0000016 | 3300046692 | Bacteria | 294821 |
| 703 | Ga0495671_0043108 | 3300046692 | Bacteria | 2265 |
| 704 | Ga0495649_0151440 | 3300046694 | Bacteria | 1218 |
| 705 | Ga0495649_0209870 | 3300046694 | Bacteria | 1009 |
| 706 | Ga0495649_0286446 | 3300046694 | Bacteria | 841 |
| 707 | Ga0495649_0421522 | 3300046694 | Bacteria | 668 |
| 708 | Ga0495649_0437142 | 3300046694 | Bacteria | 654 |
| 709 | Ga0495600_0002120 | 3300046809 | Bacteria | 11231 |
| 710 | Ga0495683_0024341 | 3300047323 | Bacteria | 3108 |
| 711 | Ga0495683_0057651 | 3300047323 | Bacteria | 1930 |
| 712 | Ga0495687_000045 | 3300047443 | Bacteria | 211968 |
| 713 | Ga0495687_000240 | 3300047443 | Bacteria | 75621 |
| 714 | Ga0495677_0000736 | 3300047445 | Bacteria | 13209 |
| 715 | Ga0495673_0176366 | 3300047469 | Bacteria | 812 |
| 716 | Ga0495681_0003075 | 3300047470 | Bacteria | 11701 |
| 717 | Ga0495681_0036020 | 3300047470 | Bacteria | 2452 |
| 718 | Ga0495681_0039224 | 3300047470 | Bacteria | 2315 |
| 719 | Ga0495686_0013150 | 3300047472 | Bacteria | 5757 |
| 720 | Ga0495686_0032988 | 3300047472 | Bacteria | 3346 |
| 721 | Ga0495686_0042056 | 3300047472 | Bacteria | 2907 |
| 722 | Ga0495686_0048131 | 3300047472 | Bacteria | 2689 |
| 723 | Ga0495686_0393804 | 3300047472 | Bacteria | 745 |
| 724 | Ga0495686_0494382 | 3300047472 | Bacteria | 645 |
| 725 | Ga0496101_0487541 | 3300048904 | Bacteria | 973 |
| 726 | Ga0496102_0000043 | 3300048905 | Bacteria | 189201 |
| 727 | Ga0496102_0000689 | 3300048905 | Bacteria | 33586 |
| 728 | Ga0496102_1401467 | 3300048905 | Bacteria | 618 |
| 729 | Ga0496103_0000133 | 3300048906 | Bacteria | 78740 |
| 730 | Ga0496103_0000404 | 3300048906 | Bacteria | 38247 |
| 731 | Ga0496104_0034187 | 3300048907 | Bacteria | 4738 |
| 732 | Ga0496105_0001929 | 3300048908 | Bacteria | 14897 |
| 733 | Ga0496105_0170012 | 3300048908 | Bacteria | 1787 |
| 734 | Ga0496107_0073738 | 3300048910 | Bacteria | 2483 |
| 735 | Ga0496108_0003224 | 3300048911 | Bacteria | 13116 |
| 736 | Ga0496108_0708748 | 3300048911 | Bacteria | 872 |
| 737 | Ga0496109_0948778 | 3300048912 | Bacteria | 798 |
| 738 | Ga0496110_0122395 | 3300048913 | Bacteria | 2345 |
| 739 | Ga0496111_0019497 | 3300048914 | Bacteria | 4712 |
| 740 | Ga0496113_0072089 | 3300048916 | Bacteria | 2628 |
| 741 | Ga0496114_0001243 | 3300048917 | Bacteria | 19286 |
| 742 | Ga0496115_0000009 | 3300048918 | Bacteria | 234372 |
| 743 | Ga0496116_0000682 | 3300048919 | Bacteria | 44118 |
| 744 | Ga0496116_0011866 | 3300048919 | Bacteria | 7169 |
| 745 | Ga0496116_0128013 | 3300048919 | Bacteria | 1453 |
| 746 | Ga0496117_0000104 | 3300048920 | Bacteria | 189201 |
| 747 | Ga0496117_0000724 | 3300048920 | Bacteria | 51893 |
| 748 | Ga0496117_0020427 | 3300048920 | Bacteria | 5399 |
| 749 | Ga0496118_0000080 | 3300048921 | Bacteria | 189201 |
| 750 | Ga0496118_0000989 | 3300048921 | Bacteria | 44266 |
| 751 | Ga0496118_0001437 | 3300048921 | Bacteria | 35866 |
| 752 | Ga0496118_0045769 | 3300048921 | Bacteria | 3411 |
| 753 | Ga0496119_0005815 | 3300048922 | Bacteria | 11661 |
| 754 | Ga0496119_0041673 | 3300048922 | Bacteria | 2921 |
| 755 | Ga0496119_0054427 | 3300048922 | Bacteria | 2436 |
| 756 | Ga0496120_0035441 | 3300048923 | Bacteria | 2980 |
| 757 | Ga0496120_0039653 | 3300048923 | Bacteria | 2776 |
| 758 | Ga0496120_0080909 | 3300048923 | Bacteria | 1759 |
| 759 | Ga0496120_0149318 | 3300048923 | Bacteria | 1176 |
| 760 | Ga0496121_0000192 | 3300048924 | Bacteria | 136529 |
| 761 | Ga0496121_0002614 | 3300048924 | Bacteria | 27193 |
| 762 | Ga0496121_0014340 | 3300048924 | Bacteria | 8422 |
| 763 | Ga0496121_0062860 | 3300048924 | Bacteria | 3038 |
| 764 | Ga0496121_0065817 | 3300048924 | Bacteria | 2946 |
| 765 | Ga0496122_0011471 | 3300048925 | Bacteria | 8966 |
| 766 | Ga0496122_0020096 | 3300048925 | Bacteria | 6063 |
| 767 | Ga0496122_0025373 | 3300048925 | Bacteria | 5148 |
| 768 | Ga0496123_0017577 | 3300048926 | Bacteria | 5743 |
| 769 | Ga0496123_0031483 | 3300048926 | Bacteria | 3858 |
| 770 | Ga0496123_0038776 | 3300048926 | Bacteria | 3343 |
| 771 | Ga0496123_0511938 | 3300048926 | Bacteria | 522 |
| 772 | Ga0496124_0000050 | 3300048927 | Bacteria | 258041 |
| 773 | Ga0496124_0000093 | 3300048927 | Bacteria | 189201 |
| 774 | Ga0496124_0002396 | 3300048927 | Bacteria | 24661 |
| 775 | Ga0496124_0032581 | 3300048927 | Bacteria | 4599 |
| 776 | Ga0496124_0152508 | 3300048927 | Bacteria | 1810 |
| 777 | Ga0496125_0001515 | 3300048928 | Bacteria | 33290 |
| 778 | Ga0496125_0010490 | 3300048928 | Bacteria | 9369 |
| 779 | Ga0496125_0013525 | 3300048928 | Bacteria | 8018 |
| 780 | Ga0496125_0019149 | 3300048928 | Bacteria | 6470 |
| 781 | Ga0496125_0383470 | 3300048928 | Bacteria | 828 |
| 782 | Ga0496126_0000930 | 3300048929 | Bacteria | 50554 |
| 783 | Ga0496126_0018147 | 3300048929 | Bacteria | 6983 |
| 784 | Ga0496126_0246823 | 3300048929 | Bacteria | 1489 |
| 785 | Ga0496126_0446809 | 3300048929 | Bacteria | 1041 |
| 786 | Ga0496126_1063964 | 3300048929 | Bacteria | 603 |
| 787 | Ga0495682_0010956 | 3300049460 | Bacteria | 3495 |
| 788 | Ga0501290_000464 | 3300049513 | Bacteria | 6297 |
| 789 | Ga0501290_019445 | 3300049513 | Bacteria | 921 |
| 790 | Ga0501292_000026 | 3300049515 | Bacteria | 42153 |
| 791 | Ga0501294_000620 | 3300049517 | Bacteria | 4032 |
| 792 | Ga0501301_002495 | 3300049524 | Bacteria | 1220 |
| 793 | Ga0501034_0190481 | 3300049571 | Bacteria | 2013 |
| 794 | Ga0501034_1128492 | 3300049571 | Bacteria | 664 |
| 795 | Ga0501036_0953269 | 3300049572 | Bacteria | 703 |
| 796 | Ga0501038_0054714 | 3300049574 | Bacteria | 3431 |
| 797 | Ga0501069_0002940 | 3300049585 | Bacteria | 8754 |
| 798 | Ga0501070_0893115 | 3300049586 | Bacteria | 693 |
| 799 | Ga0501071_0150188 | 3300049587 | Bacteria | 1738 |
| 800 | Ga0501206_000824 | 3300049653 | Bacteria | 3798 |
| 801 | Ga0501206_001417 | 3300049653 | Bacteria | 2999 |
| 802 | Ga0501211_000775 | 3300049658 | Bacteria | 3285 |
| 803 | Ga0501222_000640 | 3300049662 | Bacteria | 5129 |
| 804 | Ga0501223_000004 | 3300049663 | Bacteria | 141027 |
| 805 | Ga0501223_019176 | 3300049663 | Bacteria | 1344 |
| 806 | Ga0501223_119122 | 3300049663 | Bacteria | 556 |
| 807 | Ga0501224_001500 | 3300049664 | Bacteria | 3101 |
| 808 | Ga0501227_002925 | 3300049665 | Bacteria | 3736 |
| 809 | Ga0501235_000242 | 3300049669 | Bacteria | 9987 |
| 810 | Ga0501235_001905 | 3300049669 | Bacteria | 4460 |
| 811 | Ga0501236_002479 | 3300049670 | Bacteria | 2120 |
| 812 | Ga0501243_074664 | 3300049675 | Bacteria | 650 |
| 813 | Ga0501246_000072 | 3300049676 | Bacteria | 5676 |
| 814 | Ga0501255_009478 | 3300049684 | Bacteria | 1081 |
| 815 | Ga0501256_030053 | 3300049685 | Bacteria | 608 |
| 816 | Ga0501257_000036 | 3300049686 | Bacteria | 38192 |
| 817 | Ga0501259_000268 | 3300049688 | Bacteria | 8191 |
| 818 | Ga0501261_000046 | 3300049690 | Bacteria | 24263 |
| 819 | Ga0501225_0000003 | 3300049705 | Bacteria | 141070 |
| 820 | Ga0501225_0000673 | 3300049705 | Bacteria | 10658 |
| 821 | Ga0501225_0019806 | 3300049705 | Bacteria | 1860 |
| 822 | Ga0501225_0023768 | 3300049705 | Bacteria | 1688 |
| 823 | Ga0501225_0179185 | 3300049705 | Unclassified | 661 |
| 824 | Ga0501245_001012 | 3300049708 | Bacteria | 3613 |
| 825 | Ga0501245_002795 | 3300049708 | Bacteria | 2346 |
| 826 | Ga0501080_0728551 | 3300049742 | Bacteria | 873 |
| 827 | Ga0501241_002337 | 3300049758 | Bacteria | 3672 |
| 828 | Ga0501263_083451 | 3300049760 | Bacteria | 531 |
| 829 | Ga0501271_013080 | 3300049768 | Bacteria | 906 |
| 830 | Ga0501273_056564 | 3300049770 | Bacteria | 610 |
| 831 | Ga0501279_000027 | 3300049775 | Bacteria | 40843 |
| 832 | Ga0501280_000044 | 3300049776 | Bacteria | 37121 |
| 833 | Ga0501281_00442 | 3300049777 | Bacteria | 4033 |
| 834 | Ga0501281_03489 | 3300049777 | Bacteria | 1125 |
| 835 | Ga0501282_000334 | 3300049778 | Bacteria | 5704 |
| 836 | Ga0501035_1063161 | 3300049822 | Bacteria | 634 |
| 837 | nmdc:mga07m45_137992_c1 | 3300050496 | Bacteria | 1412 |
| 838 | nmdc:mga0qj67_9482_c1 | 3300050509 | Bacteria | 7247 |
| 839 | Ga0500610_0002355 | 3300053079 | Bacteria | 6923 |
| 840 | Ga0500643_000215 | 3300053087 | Bacteria | 54391 |
| 841 | Ga0500643_017862 | 3300053087 | Bacteria | 2364 |
| 842 | Ga0500643_030093 | 3300053087 | Bacteria | 1666 |
| 843 | Ga0500643_063675 | 3300053087 | Bacteria | 1032 |
| 844 | Ga0500643_149542 | 3300053087 | Bacteria | 627 |
| 845 | Ga0500583_0168838 | 3300053092 | Bacteria | 1089 |
| 846 | Ga0500651_0183706 | 3300053093 | Bacteria | 1241 |
| 847 | Ga0500566_0011749 | 3300053094 | Bacteria | 5161 |
| 848 | Ga0500555_000889 | 3300053103 | Bacteria | 10630 |
| 849 | Ga0500555_091163 | 3300053103 | Bacteria | 782 |
| 850 | Ga0500592_000482 | 3300053116 | Bacteria | 6619 |
| 851 | Ga0500594_0049194 | 3300053118 | Bacteria | 1181 |
| 852 | Ga0500595_000578 | 3300053119 | Bacteria | 21839 |
| 853 | Ga0500597_021870 | 3300053120 | Bacteria | 2535 |
| 854 | Ga0500607_251570 | 3300053121 | Bacteria | 702 |
| 855 | Ga0500618_002362 | 3300053125 | Bacteria | 7206 |
| 856 | Ga0500642_0000646 | 3300053130 | Bacteria | 10383 |
| 857 | Ga0500658_0014254 | 3300053134 | Bacteria | 2941 |
| 858 | Ga0500658_0224339 | 3300053134 | Bacteria | 862 |
| 859 | Ga0500658_0225543 | 3300053134 | Bacteria | 859 |
| 860 | Ga0500559_0014974 | 3300053136 | Bacteria | 3278 |
| 861 | Ga0500568_0009185 | 3300053139 | Bacteria | 4714 |
| 862 | Ga0500568_0027124 | 3300053139 | Bacteria | 2397 |
| 863 | Ga0500577_0133299 | 3300053142 | Bacteria | 1043 |
| 864 | Ga0500604_0000018 | 3300053151 | Bacteria | 78699 |
| 865 | Ga0500604_0141903 | 3300053151 | Bacteria | 812 |
| 866 | Ga0500604_0272026 | 3300053151 | Bacteria | 587 |
| 867 | Ga0500616_0000419 | 3300053153 | Bacteria | 56812 |
| 868 | Ga0500616_0005521 | 3300053153 | Bacteria | 8567 |
| 869 | Ga0500624_000062 | 3300053157 | Bacteria | 66317 |
| 870 | Ga0500627_0108573 | 3300053158 | Bacteria | 1248 |
| 871 | Ga0500638_308795 | 3300053162 | Bacteria | 606 |
| 872 | Ga0500636_0004227 | 3300053177 | Bacteria | 8134 |
| 873 | Ga0500636_0098148 | 3300053177 | Bacteria | 1669 |
| 874 | Ga0500637_0000692 | 3300053178 | Bacteria | 13419 |
| 875 | Ga0500645_000138 | 3300053730 | Bacteria | 57099 |
| 876 | Ga0500609_010977 | 3300053731 | Bacteria | 1223 |
| 877 | Ga0500596_001649 | 3300053735 | Bacteria | 4510 |
| 878 | Ga0500587_003146 | 3300053739 | Bacteria | 2326 |
| 879 | Ga0501082_0306412 | 3300060353 | Bacteria | 1383 |
| 880 | 2644126085 | 2643221622 | Bacteria | 4212502 |
| 881 | 2778124431 | 2775507255 | Bacteria | 3945731 |
| 882 | 2919711043 | 2919709256 | Bacteria | 4318106 |
| 883 | 8057103651 | 8057101203 | Bacteria | 5034064 |
| 884 | Ga0307513_10358841 | |||
| 885 | SwRhRL2b_contig_2704254 | |||
| 886 | SwRhRL2b_contig_3171842 | |||
| 887 | ARcpr5yngRDRAFT_c004010 | |||
| 888 | ARCol0yngRDRAFT_1001507 | |||
| 889 | JGI24741J21665_1000228 | |||
| 890 | JGI24741J21665_1001726 | |||
| 891 | JGI24740J21852_10003943 | |||
| 892 | JGI24740J21852_10006052 | |||
| 893 | JGI24739J22299_10001727 | |||
| 894 | JGI24739J22299_10062269 | |||
| 895 | JGI24739J22299_10106652 | |||
| 896 | JGI24739J22299_10162518 | |||
| 897 | JGI24737J22298_10001061 | |||
| 898 | JGI24737J22298_10006500 | |||
| 899 | JGI24737J22298_10007233 | |||
| 900 | JGI24737J22298_10012547 | |||
| 901 | JGI24737J22298_10028582 | |||
| 902 | JGI24737J22298_10163449 | |||
| 903 | JGI24735J21928_10002009 | |||
| 904 | JGI24735J21928_10007545 | |||
| 905 | JGI24735J21928_10007736 | |||
| 906 | JGI24735J21928_10014606 | |||
| 907 | JGI24735J21928_10025048 | |||
| 908 | JGI24748J21848_1029298 | |||
| 909 | JGI24738J21930_10085601 | |||
| 910 | JGI24749J21850_1000076 | |||
| 911 | JGI24744J21845_10017741 | |||
| 912 | JGI24034J26672_10086268 | |||
| 913 | JGI24034J26672_10098801 | |||
| 914 | JGI24742J22300_10053852 | |||
| 915 | JGI24742J22300_10099262 | |||
| 916 | JGI24751J29686_10000195 | |||
| 917 | JGI25153J46596_10000002 | |||
| 918 | JGI25153J46596_10005653 | |||
| 919 | rootH2_10026085 | |||
| 920 | rootH1_10042232 | |||
| 921 | Ga0055542_1008070 | |||
| 922 | Ga0055542_1026022 | |||
| 923 | Ga0055529_1009231 | |||
| 924 | Ga0055526_1001039 | |||
| 925 | Ga0055537_1002318 | |||
| 926 | Ga0055537_1005551 | |||
| 927 | Ga0055524_1000056 | |||
| 928 | Ga0055530_10008426 | |||
| 929 | Ga0055530_10052238 | |||
| 930 | Ga0055531_10001973 | |||
| 931 | Ga0055543_1065149 | |||
| 932 | Ga0058859_11339750 | |||
| 933 | Ga0065165_1023324 | |||
| 934 | Ga0065165_1045828 | |||
| 935 | Ga0065704_10000880 | |||
| 936 | Ga0065704_10021576 | |||
| 937 | Ga0065704_10102515 | |||
| 938 | Ga0065707_10004914 | |||
| 939 | Ga0065707_10085091 | |||
| 940 | Ga0065707_10090551 | |||
| 941 | Ga0065707_10435780 | |||
| 942 | Ga0070658_10000002 | |||
| 943 | Ga0070658_10000608 | |||
| 944 | Ga0070658_10003163 | |||
| 945 | Ga0070658_10294785 | |||
| 946 | Ga0070676_10001330 | |||
| 947 | Ga0070670_100000033 | |||
| 948 | Ga0070670_100611841 | |||
| 949 | Ga0070670_101197457 | |||
| 950 | Ga0070677_10000317 | |||
| 951 | Ga0068869_100000539 | |||
| 952 | Ga0068869_100282971 | |||
| 953 | Ga0068869_100715426 | |||
| 954 | Ga0068869_101199531 | |||
| 955 | Ga0070666_10094384 | |||
| 956 | Ga0070666_10102081 | |||
| 957 | Ga0070682_100962338 | |||
| 958 | Ga0068868_100012870 | |||
| 959 | Ga0070660_100000137 | |||
| 960 | Ga0070660_100000561 | |||
| 961 | Ga0070660_100062727 | |||
| 962 | Ga0070660_100087481 | |||
| 963 | Ga0070660_100105325 | |||
| 964 | Ga0070661_100007643 | |||
| 965 | Ga0070661_100273053 | |||
| 966 | Ga0070661_100415539 | |||
| 967 | Ga0070692_10003203 | |||
| 968 | Ga0070668_100000018 | |||
| 969 | Ga0070668_100008256 | |||
| 970 | Ga0070668_100009296 | |||
| 971 | Ga0070668_100029208 | |||
| 972 | Ga0070668_100097071 | |||
| 973 | Ga0070668_100395096 | |||
| 974 | Ga0070668_100558380 | |||
| 975 | Ga0070668_102240225 | |||
| 976 | Ga0070669_100000005 | |||
| 977 | Ga0070669_100047551 | |||
| 978 | Ga0070669_100098822 | |||
| 979 | Ga0070669_100185357 | |||
| 980 | Ga0070669_100186036 | |||
| 981 | Ga0070669_100534466 | |||
| 982 | Ga0070675_100000664 | |||
| 983 | Ga0070675_100303583 | |||
| 984 | Ga0070675_101078977 | |||
| 985 | Ga0070675_101387591 | |||
| 986 | Ga0070671_100000189 | |||
| 987 | Ga0070671_100002574 | |||
| 988 | Ga0070671_100058331 | |||
| 989 | Ga0070671_100462264 | |||
| 990 | Ga0070671_101227681 | |||
| 991 | Ga0070674_100000527 | |||
| 992 | Ga0070674_100019659 | |||
| 993 | Ga0070674_100047101 | |||
| 994 | Ga0070674_100048838 | |||
| 995 | Ga0070673_100000007 | |||
| 996 | Ga0070673_102179771 | |||
| 997 | Ga0070659_100010029 | |||
| 998 | Ga0070659_100031864 | |||
| 999 | Ga0070659_100065018 | |||
| 1000 | Ga0070659_100102921 | |||
| 1001 | Ga0070659_100199063 | |||
| 1002 | Ga0070659_100282044 | |||
| 1003 | Ga0070659_100680563 | |||
| 1004 | Ga0070659_100937630 | |||
| 1005 | Ga0070667_100000089 | |||
| 1006 | Ga0070667_100005221 | |||
| 1007 | Ga0070667_100139378 | |||
| 1008 | Ga0070667_100327880 | |||
| 1009 | Ga0070667_101784883 | |||
| 1010 | Ga0070701_10177318 | |||
| 1011 | Ga0070701_10605475 | |||
| 1012 | Ga0070701_11045938 | |||
| 1013 | Ga0070663_100016292 | |||
| 1014 | Ga0070663_100220730 | |||
| 1015 | Ga0070663_100280633 | |||
| 1016 | Ga0070663_100342679 | |||
| 1017 | Ga0070678_100000271 | |||
| 1018 | Ga0070678_100007473 | |||
| 1019 | Ga0070662_100239416 | |||
| 1020 | Ga0070662_100262273 | |||
| 1021 | Ga0070662_100335230 | |||
| 1022 | Ga0070662_100903529 | |||
| 1023 | Ga0070662_100958247 | |||
| 1024 | Ga0070662_101342573 | |||
| 1025 | Ga0070681_11815822 | |||
| 1026 | Ga0068867_100000134 | |||
| 1027 | Ga0070685_10520041 | |||
| 1028 | Ga0070699_100729328 | |||
| 1029 | Ga0068853_100298564 | |||
| 1030 | Ga0068853_100715865 | |||
| 1031 | Ga0068853_100808760 | |||
| 1032 | Ga0068853_101336861 | |||
| 1033 | Ga0068853_101431514 | |||
| 1034 | Ga0070672_100009747 | |||
| 1035 | Ga0070672_100117631 | |||
| 1036 | Ga0070672_100244314 | |||
| 1037 | Ga0070672_100441548 | |||
| 1038 | Ga0070672_100483844 | |||
| 1039 | Ga0070696_100683838 | |||
| 1040 | Ga0070665_100000265 | |||
| 1041 | Ga0070665_100000493 | |||
| 1042 | Ga0070665_100028240 | |||
| 1043 | Ga0070665_100084455 | |||
| 1044 | Ga0070665_100264549 | |||
| 1045 | Ga0070665_100650171 | |||
| 1046 | Ga0070665_100668471 | |||
| 1047 | Ga0070665_102528454 | |||
| 1048 | Ga0068855_100000191 | |||
| 1049 | Ga0068855_100179242 | |||
| 1050 | Ga0068855_100476636 | |||
| 1051 | Ga0068855_100867477 | |||
| 1052 | Ga0070664_100031198 | |||
| 1053 | Ga0070664_100149494 | |||
| 1054 | Ga0070664_101034887 | |||
| 1055 | Ga0068857_100096788 | |||
| 1056 | Ga0068857_100170339 | |||
| 1057 | Ga0068857_100298447 | |||
| 1058 | Ga0068857_100813241 | |||
| 1059 | Ga0068857_101091141 | |||
| 1060 | Ga0068854_100070232 | |||
| 1061 | Ga0068854_100224649 | |||
| 1062 | Ga0068854_100771223 | |||
| 1063 | Ga0068854_100936697 | |||
| 1064 | Ga0068854_101020136 | |||
| 1065 | Ga0068856_100008621 | |||
| 1066 | Ga0068856_100311578 | |||
| 1067 | Ga0068852_100095289 | |||
| 1068 | Ga0068852_100134152 | |||
| 1069 | Ga0068852_100204240 | |||
| 1070 | Ga0068852_100740033 | |||
| 1071 | Ga0068859_100010744 | |||
| 1072 | Ga0068859_100011274 | |||
| 1073 | Ga0068859_100016302 | |||
| 1074 | Ga0068859_100268857 | |||
| 1075 | Ga0068859_101513920 | |||
| 1076 | Ga0068859_102256822 | |||
| 1077 | Ga0068864_100000042 | |||
| 1078 | Ga0068866_10128821 | |||
| 1079 | Ga0068861_100023975 | |||
| 1080 | Ga0068861_100065855 | |||
| 1081 | Ga0068861_100807385 | |||
| 1082 | Ga0068861_100904161 | |||
| 1083 | Ga0068861_101598729 | |||
| 1084 | Ga0068851_10037591 | |||
| 1085 | Ga0068851_10038999 | |||
| 1086 | Ga0068851_10447647 | |||
| 1087 | Ga0068851_10627986 | |||
| 1088 | Ga0068870_10529845 | |||
| 1089 | Ga0068863_100000030 | |||
| 1090 | Ga0068863_100001219 | |||
| 1091 | Ga0068863_100003973 | |||
| 1092 | Ga0068858_100488825 | |||
| 1093 | Ga0068860_100000148 | |||
| 1094 | Ga0068860_100002421 | |||
| 1095 | Ga0068860_100077492 | |||
| 1096 | Ga0068860_100943145 | |||
| 1097 | Ga0068860_101090979 | |||
| 1098 | Ga0068862_100000005 | |||
| 1099 | Ga0068862_100000149 | |||
| 1100 | Ga0068862_100014432 | |||
| 1101 | Ga0068862_100022099 | |||
| 1102 | Ga0068862_101350836 | |||
| 1103 | Ga0068862_102062504 | |||
| 1104 | Ga0081539_10165735 | |||
| 1105 | Ga0075432_10482713 | |||
| 1106 | Ga0097621_100062388 | |||
| 1107 | Ga0075370_10403154 | |||
| 1108 | Ga0075430_100035193 | |||
| 1109 | Ga0068865_100000008 | |||
| 1110 | Ga0068865_100840529 | |||
| 1111 | Ga0097620_100010744 | |||
| 1112 | Ga0097620_100011274 | |||
| 1113 | Ga0097620_100016302 | |||
| 1114 | Ga0097620_100268850 | |||
| 1115 | Ga0097620_101513960 | |||
| 1116 | Ga0097620_102256473 | |||
| 1117 | Ga0079104_1055173 | |||
| 1118 | Ga0099826_10421449 | |||
| 1119 | Ga0105251_10009288 | |||
| 1120 | Ga0105240_10120463 | |||
| 1121 | Ga0105240_10154472 | |||
| 1122 | Ga0111539_10670297 | |||
| 1123 | Ga0105245_10001922 | |||
| 1124 | Ga0105245_10095357 | |||
| 1125 | Ga0105245_10708213 | |||
| 1126 | Ga0105245_11127325 | |||
| 1127 | Ga0105247_10004166 | |||
| 1128 | Ga0105247_11233653 | |||
| 1129 | Ga0105243_10000213 | |||
| 1130 | Ga0105243_10003232 | |||
| 1131 | Ga0105243_10057527 | |||
| 1132 | Ga0105243_10413212 | |||
| 1133 | Ga0105243_11127751 | |||
| 1134 | Ga0105243_11800105 | |||
| 1135 | Ga0105241_10002321 | |||
| 1136 | Ga0105241_10012233 | |||
| 1137 | Ga0105241_11611788 | |||
| 1138 | Ga0105241_12668187 | |||
| 1139 | Ga0105242_10000437 | |||
| 1140 | Ga0105242_11245171 | |||
| 1141 | Ga0105242_11841882 | |||
| 1142 | Ga0105248_10000171 | |||
| 1143 | Ga0105248_10316025 | |||
| 1144 | Ga0105237_10046738 | |||
| 1145 | Ga0105237_10125051 | |||
| 1146 | Ga0105237_11493221 | |||
| 1147 | Ga0105237_12111537 | |||
| 1148 | Ga0105238_10110993 | |||
| 1149 | Ga0105238_10823291 | |||
| 1150 | Ga0105238_10835782 | |||
| 1151 | Ga0105238_11046774 | |||
| 1152 | Ga0105238_11126041 | |||
| 1153 | Ga0105238_11799142 | |||
| 1154 | Ga0105249_10000056 | |||
| 1155 | Ga0105249_10015107 | |||
| 1156 | Ga0105249_10019471 | |||
| 1157 | Ga0105249_10060847 | |||
| 1158 | Ga0105249_10904749 | |||
| 1159 | Ga0105148_100086 | |||
| 1160 | Ga0105147_105670 | |||
| 1161 | Ga0105239_10034267 | |||
| 1162 | Ga0105239_10239671 | |||
| 1163 | Ga0105246_10002390 | |||
| 1164 | Ga0105246_10041447 | |||
| 1165 | Ga0105246_11067787 | |||
| 1166 | Ga0157317_1002050 | |||
| 1167 | Ga0157327_1015475 | |||
| 1168 | Ga0157326_1000010 | |||
| 1169 | Ga0157373_10013087 | |||
| 1170 | Ga0157373_10015808 | |||
| 1171 | Ga0157373_10046169 | |||
| 1172 | Ga0157373_10061923 | |||
| 1173 | Ga0157371_10000059 | |||
| 1174 | Ga0157370_10016799 | |||
| 1175 | Ga0157370_10175173 | |||
| 1176 | Ga0157370_11074959 | |||
| 1177 | Ga0157369_10002550 | |||
| 1178 | Ga0157369_10147458 | |||
| 1179 | Ga0157369_10380251 | |||
| 1180 | Ga0157374_10019747 | |||
| 1181 | Ga0157374_10029189 | |||
| 1182 | Ga0157374_12265340 | |||
| 1183 | Ga0157378_10004325 | |||
| 1184 | Ga0163162_10068729 | |||
| 1185 | Ga0163162_10368425 | |||
| 1186 | Ga0163162_11082141 | |||
| 1187 | Ga0163162_12395927 | |||
| 1188 | Ga0157372_10358684 | |||
| 1189 | Ga0157372_10535199 | |||
| 1190 | Ga0157372_10537722 | |||
| 1191 | Ga0157372_10852825 | |||
| 1192 | Ga0157372_10991801 | |||
| 1193 | Ga0157372_12227023 | |||
| 1194 | Ga0157372_12313318 | |||
| 1195 | Ga0157375_10004295 | |||
| 1196 | Ga0157375_11334067 | |||
| 1197 | Ga0163163_10408569 | |||
| 1198 | Ga0163163_11842621 | |||
| 1199 | Ga0157380_10000084 | |||
| 1200 | Ga0157380_10006098 | |||
| 1201 | Ga0157380_11226862 | |||
| 1202 | Ga0157377_10046846 | |||
| 1203 | Ga0157376_10000315 | |||
| 1204 | Ga0157376_11007997 | |||
| 1205 | Ga0157376_11171708 | |||
| 1206 | Ga0163161_10003807 | |||
| 1207 | Ga0163161_10220521 | |||
| 1208 | Ga0163161_10238126 | |||
| 1209 | Ga0163161_10677675 | |||
| 1210 | Ga0206354_10227562 | |||
| 1211 | Ga0206353_11261817 | |||
| 1212 | Ga0213873_10000019 | |||
| 1213 | Ga0213874_10213503 | |||
| 1214 | Ga0213876_10000075 | |||
| 1215 | Ga0213876_10001526 | |||
| 1216 | Ga0213875_10000323 | |||
| 1217 | Ga0209674_103791 | |||
| 1218 | Ga0209563_100116 | |||
| 1219 | Ga0207425_1002702 | |||
| 1220 | Ga0209026_1012534 | |||
| 1221 | Ga0209677_104219 | |||
| 1222 | Ga0209148_1000398 | |||
| 1223 | Ga0209148_1001103 | |||
| 1224 | Ga0209233_1080964 | |||
| 1225 | Ga0209565_1000008 | |||
| 1226 | Ga0209565_1000244 | |||
| 1227 | Ga0209455_1001110 | |||
| 1228 | Ga0209673_1000569 | |||
| 1229 | Ga0209673_1006074 | |||
| 1230 | Ga0209564_1009843 | |||
| 1231 | Ga0209564_1030333 | |||
| 1232 | Ga0209758_1000001 | |||
| 1233 | Ga0209758_1002073 | |||
| 1234 | Ga0209050_1003166 | |||
| 1235 | Ga0209050_1038584 | |||
| 1236 | Ga0209256_1000009 | |||
| 1237 | Ga0209256_1000010 | |||
| 1238 | Ga0209257_1003147 | |||
| 1239 | Ga0207656_10006564 | |||
| 1240 | Ga0207713_1097285 | |||
| 1241 | Ga0207682_10000624 | |||
| 1242 | Ga0207642_10584665 | |||
| 1243 | Ga0207710_10007932 | |||
| 1244 | Ga0207680_10044629 | |||
| 1245 | Ga0207680_10087932 | |||
| 1246 | Ga0207647_10047708 | |||
| 1247 | Ga0207647_10059593 | |||
| 1248 | Ga0207647_10126621 | |||
| 1249 | Ga0207647_10136397 | |||
| 1250 | Ga0207647_10316887 | |||
| 1251 | Ga0207645_10001217 | |||
| 1252 | Ga0207645_10040611 | |||
| 1253 | Ga0207645_10829117 | |||
| 1254 | Ga0207705_10000008 | |||
| 1255 | Ga0207705_10000197 | |||
| 1256 | Ga0207705_10009236 | |||
| 1257 | Ga0207654_10001228 | |||
| 1258 | Ga0207707_10630770 | |||
| 1259 | Ga0207695_10029722 | |||
| 1260 | Ga0207695_10059676 | |||
| 1261 | Ga0207695_11195947 | |||
| 1262 | Ga0207671_10076484 | |||
| 1263 | Ga0207657_10001820 | |||
| 1264 | Ga0207657_10004655 | |||
| 1265 | Ga0207657_10021785 | |||
| 1266 | Ga0207657_10031380 | |||
| 1267 | Ga0207657_10065746 | |||
| 1268 | Ga0207657_10104067 | |||
| 1269 | Ga0207657_10355578 | |||
| 1270 | Ga0207649_10000225 | |||
| 1271 | Ga0207681_10000003 | |||
| 1272 | Ga0207681_10222448 | |||
| 1273 | Ga0207681_10261162 | |||
| 1274 | Ga0207681_10492107 | |||
| 1275 | Ga0207681_10862858 | |||
| 1276 | Ga0207681_11229633 | |||
| 1277 | Ga0207694_10008225 | |||
| 1278 | Ga0207694_10048518 | |||
| 1279 | Ga0207694_11066471 | |||
| 1280 | Ga0207694_11270717 | |||
| 1281 | Ga0207650_10000012 | |||
| 1282 | Ga0207650_10512520 | |||
| 1283 | Ga0207650_11203270 | |||
| 1284 | Ga0207659_10002169 | |||
| 1285 | Ga0207687_10004919 | |||
| 1286 | Ga0207687_10221646 | |||
| 1287 | Ga0207644_10000096 | |||
| 1288 | Ga0207644_10172545 | |||
| 1289 | Ga0207644_10280019 | |||
| 1290 | Ga0207644_11156170 | |||
| 1291 | Ga0207690_10003708 | |||
| 1292 | Ga0207690_10006876 | |||
| 1293 | Ga0207690_10020317 | |||
| 1294 | Ga0207690_10023602 | |||
| 1295 | Ga0207690_10403802 | |||
| 1296 | Ga0207690_11041125 | |||
| 1297 | Ga0207706_10073104 | |||
| 1298 | Ga0207706_10095684 | |||
| 1299 | Ga0207706_10234640 | |||
| 1300 | Ga0207706_10271714 | |||
| 1301 | Ga0207706_10320350 | |||
| 1302 | Ga0207706_10324756 | |||
| 1303 | Ga0207706_10575052 | |||
| 1304 | Ga0207686_10000908 | |||
| 1305 | Ga0207686_10914065 | |||
| 1306 | Ga0207686_11070967 | |||
| 1307 | Ga0207709_10000018 | |||
| 1308 | Ga0207709_10000399 | |||
| 1309 | Ga0207709_10056889 | |||
| 1310 | Ga0207709_10778053 | |||
| 1311 | Ga0207670_11146560 | |||
| 1312 | Ga0207669_10000068 | |||
| 1313 | Ga0207669_10097629 | |||
| 1314 | Ga0207669_10165796 | |||
| 1315 | Ga0207669_10193174 | |||
| 1316 | Ga0207704_10000013 | |||
| 1317 | Ga0207704_11104321 | |||
| 1318 | Ga0207691_10013456 | |||
| 1319 | Ga0207691_10334715 | |||
| 1320 | Ga0207691_10384679 | |||
| 1321 | Ga0207691_10459888 | |||
| 1322 | Ga0207711_10001461 | |||
| 1323 | Ga0207689_10000852 | |||
| 1324 | Ga0207689_10513223 | |||
| 1325 | Ga0207679_10096554 | |||
| 1326 | Ga0207679_10220374 | |||
| 1327 | Ga0207679_11237767 | |||
| 1328 | Ga0207667_10000107 | |||
| 1329 | Ga0207667_10000113 | |||
| 1330 | Ga0207667_10029652 | |||
| 1331 | Ga0207667_10040848 | |||
| 1332 | Ga0207667_10289671 | |||
| 1333 | Ga0207667_11944280 | |||
| 1334 | Ga0207651_10000013 | |||
| 1335 | Ga0207651_10856658 | |||
| 1336 | Ga0207712_10000015 | |||
| 1337 | Ga0207712_10007843 | |||
| 1338 | Ga0207712_10231975 | |||
| 1339 | Ga0207712_10282526 | |||
| 1340 | Ga0207668_10000082 | |||
| 1341 | Ga0207668_10002153 | |||
| 1342 | Ga0207668_10003245 | |||
| 1343 | Ga0207668_10094341 | |||
| 1344 | Ga0207668_10109849 | |||
| 1345 | Ga0207668_10277830 | |||
| 1346 | Ga0207668_10782422 | |||
| 1347 | Ga0207640_10013098 | |||
| 1348 | Ga0207640_10016371 | |||
| 1349 | Ga0207640_10745270 | |||
| 1350 | Ga0207640_10896765 | |||
| 1351 | Ga0207658_10000069 | |||
| 1352 | Ga0207658_10013699 | |||
| 1353 | Ga0207658_10176272 | |||
| 1354 | Ga0207658_11243804 | |||
| 1355 | Ga0207677_10007087 | |||
| 1356 | Ga0207703_10558857 | |||
| 1357 | Ga0207639_10000269 | |||
| 1358 | Ga0207639_10002666 | |||
| 1359 | Ga0207639_10078461 | |||
| 1360 | Ga0207639_10163513 | |||
| 1361 | Ga0207639_10209648 | |||
| 1362 | Ga0207639_10483699 | |||
| 1363 | Ga0207639_10657564 | |||
| 1364 | Ga0207639_11150271 | |||
| 1365 | Ga0207639_11429729 | |||
| 1366 | Ga0207678_10000400 | |||
| 1367 | Ga0207678_10041375 | |||
| 1368 | Ga0207678_10049909 | |||
| 1369 | Ga0207702_10001111 | |||
| 1370 | Ga0207702_10006623 | |||
| 1371 | Ga0207641_10000001 | |||
| 1372 | Ga0207641_10004476 | |||
| 1373 | Ga0207641_10004557 | |||
| 1374 | Ga0207648_10000382 | |||
| 1375 | Ga0207676_10000009 | |||
| 1376 | Ga0207674_10003571 | |||
| 1377 | Ga0207674_10036095 | |||
| 1378 | Ga0207674_10171019 | |||
| 1379 | Ga0207674_10273124 | |||
| 1380 | Ga0207674_11171166 | |||
| 1381 | Ga0207675_100001338 | |||
| 1382 | Ga0207675_101215545 | |||
| 1383 | Ga0207675_101375987 | |||
| 1384 | Ga0207683_10004636 | |||
| 1385 | Ga0207683_10031296 | |||
| 1386 | Ga0207698_10005545 | |||
| 1387 | Ga0207698_10007060 | |||
| 1388 | Ga0207698_10986946 | |||
| 1389 | Ga0207698_11546020 | |||
| 1390 | Ga0209282_1423339 | |||
| 1391 | Ga0209974_10150676 | |||
| 1392 | Ga0209974_10250693 | |||
| 1393 | Ga0268266_10000592 | |||
| 1394 | Ga0268266_10001249 | |||
| 1395 | Ga0268266_10043391 | |||
| 1396 | Ga0268266_10045446 | |||
| 1397 | Ga0268266_10529866 | |||
| 1398 | Ga0268266_10758684 | |||
| 1399 | Ga0268265_10000001 | |||
| 1400 | Ga0268265_10000021 | |||
| 1401 | Ga0268265_10084475 | |||
| 1402 | Ga0268265_11110522 | |||
| 1403 | Ga0268265_11147560 | |||
| 1404 | Ga0268265_11624645 | |||
| 1405 | Ga0268264_10000217 | |||
| 1406 | Ga0268264_10000820 | |||
| 1407 | Ga0268264_10073017 | |||
| 1408 | Ga0268264_10284417 | |||
| 1409 | Ga0268264_10785682 | |||
| 1410 | Ga0307517_10026887 | |||
| 1411 | Ga0307517_10247107 | |||
| 1412 | Ga0307513_10080483 | |||
| 1413 | Ga0307513_10096035 | |||
| 1414 | Ga0307513_10868071 | |||
| 1415 | Ga0307408_100003396 | |||
| 1416 | Ga0307408_100201703 | |||
| 1417 | Ga0307408_100383802 | |||
| 1418 | Ga0307408_100579505 | |||
| 1419 | Ga0307408_100591425 | |||
| 1420 | Ga0307408_101091131 | |||
| 1421 | Ga0307408_101260092 | |||
| 1422 | Ga0307405_10009363 | |||
| 1423 | Ga0307405_10069099 | |||
| 1424 | Ga0307405_10856583 | |||
| 1425 | Ga0307405_11789744 | |||
| 1426 | Ga0307413_10204967 | |||
| 1427 | Ga0307413_10358754 | |||
| 1428 | Ga0307413_10750588 | |||
| 1429 | Ga0307413_11171371 | |||
| 1430 | Ga0307410_10007333 | |||
| 1431 | Ga0307410_10251874 | |||
| 1432 | Ga0307410_10614952 | |||
| 1433 | Ga0307406_10020843 | |||
| 1434 | Ga0307406_10402458 | |||
| 1435 | Ga0307406_10614371 | |||
| 1436 | Ga0307406_10829038 | |||
| 1437 | Ga0307406_11067072 | |||
| 1438 | Ga0307406_11647363 | |||
| 1439 | Ga0307407_10637191 | |||
| 1440 | Ga0307412_10000933 | |||
| 1441 | Ga0307412_10006025 | |||
| 1442 | Ga0307412_10046102 | |||
| 1443 | Ga0307412_10237122 | |||
| 1444 | Ga0307412_10419986 | |||
| 1445 | Ga0307412_10729255 | |||
| 1446 | Ga0307409_100266740 | |||
| 1447 | Ga0307409_100504182 | |||
| 1448 | Ga0307409_100631410 | |||
| 1449 | Ga0307409_102880027 | |||
| 1450 | Ga0307416_100018226 | |||
| 1451 | Ga0307416_100501079 | |||
| 1452 | Ga0307416_100874634 | |||
| 1453 | Ga0307416_100932177 | |||
| 1454 | Ga0307416_100963417 | |||
| 1455 | Ga0307416_101748634 | |||
| 1456 | Ga0307416_102486638 | |||
| 1457 | Ga0307414_10081160 | |||
| 1458 | Ga0307414_10819924 | |||
| 1459 | Ga0307414_10898408 | |||
| 1460 | Ga0307411_10036109 | |||
| 1461 | Ga0307411_10167062 | |||
| 1462 | Ga0307411_10370592 | |||
| 1463 | Ga0307411_10849095 | |||
| 1464 | Ga0307411_11170128 | |||
| 1465 | Ga0307415_101378921 | |||
| 1466 | Ga0307415_101662381 | |||
| 1467 | Ga0307510_10498612 | |||
| 1468 | Ga0395905_0559065 | |||
| 1469 | Ga0436364_0129444 | |||
| 1470 | Ga0436364_1053529 | |||
| 1471 | Ga0395901_0078920 | |||
| 1472 | Ga0395901_0835766 | |||
| 1473 | Ga0436365_0069111 | |||
| 1474 | Ga0436365_0271953 | |||
| 1475 | Ga0436365_1058137 | |||
| 1476 | Ga0436365_1650613 | |||
| 1477 | Ga0436363_1210139 | |||
| 1478 | Ga0436363_1299169 | |||
| 1479 | Ga0436362_0592983 | |||
| 1480 | Ga0439436_0040324 | |||
| 1481 | Ga0439436_0121544 | |||
| 1482 | Ga0439439_0070566 | |||
| 1483 | Ga0439439_0091595 | |||
| 1484 | Ga0439461_0000104 | |||
| 1485 | Ga0439461_0036616 | |||
| 1486 | Ga0439465_0002958 | |||
| 1487 | Ga0439465_0083574 | |||
| 1488 | Ga0451791_0981418 | |||
| 1489 | Ga0451791_1334057 | |||
| 1490 | Ga0451793_0429151 | |||
| 1491 | Ga0451797_0399028 | |||
| 1492 | Ga0451806_030996 | |||
| 1493 | Ga0451807_1470937 | |||
| 1494 | Ga0451807_2479410 | |||
| 1495 | Ga0451841_0606824 | |||
| 1496 | Ga0451853_3256376 | |||
| 1497 | Ga0451853_3471798 | |||
| 1498 | Ga0439431_0001244 | |||
| 1499 | Ga0439431_0010641 | |||
| 1500 | Ga0439442_002694 | |||
| 1501 | Ga0439445_0001112 | |||
| 1502 | Ga0439445_0195494 | |||
| 1503 | Ga0439448_0010891 | |||
| 1504 | Ga0439432_000223 | |||
| 1505 | Ga0439452_008518 | |||
| 1506 | Ga0439452_018851 | |||
| 1507 | Ga0439455_0006014 | |||
| 1508 | Ga0439457_020990 | |||
| 1509 | Ga0439462_0001077 | |||
| 1510 | Ga0439462_0041159 | |||
| 1511 | Ga0439462_0083675 | |||
| 1512 | Ga0450903_053513 | |||
| 1513 | Ga0450904_027242 | |||
| 1514 | Ga0450889_034631 | |||
| 1515 | Ga0450910_055980 | |||
| 1516 | Ga0439446_0150159 | |||
| 1517 | Ga0439434_0000659 | |||
| 1518 | Ga0439434_0094754 | |||
| 1519 | Ga0466965_0818381 | |||
| 1520 | Ga0466963_0202177 | |||
| 1521 | Ga0466968_0014423 | |||
| 1522 | Ga0466960_0638627 | |||
| 1523 | Ga0466967_0349286 | |||
| 1524 | Ga0466967_0543896 | |||
| 1525 | Ga0495617_137933 | |||
| 1526 | Ga0495638_0014426 | |||
| 1527 | Ga0495638_0019313 | |||
| 1528 | Ga0495638_0351986 | |||
| 1529 | Ga0495638_0479471 | |||
| 1530 | Ga0495650_0000174 | |||
| 1531 | Ga0495584_0032188 | |||
| 1532 | Ga0495585_0006996 | |||
| 1533 | Ga0495585_0086431 | |||
| 1534 | Ga0495585_0311951 | |||
| 1535 | Ga0495596_0011201 | |||
| 1536 | Ga0495607_0051847 | |||
| 1537 | Ga0495607_0270607 | |||
| 1538 | Ga0495583_0000593 | |||
| 1539 | Ga0495583_0001959 | |||
| 1540 | Ga0495583_0004659 | |||
| 1541 | Ga0495583_0019153 | |||
| 1542 | Ga0495583_0078014 | |||
| 1543 | Ga0495583_0197572 | |||
| 1544 | Ga0495606_0000306 | |||
| 1545 | Ga0495606_0004735 | |||
| 1546 | Ga0495606_0159453 | |||
| 1547 | Ga0495606_0448865 | |||
| 1548 | Ga0495632_0000001 | |||
| 1549 | Ga0495637_0000330 | |||
| 1550 | Ga0495637_0013008 | |||
| 1551 | Ga0495643_0000020 | |||
| 1552 | Ga0495643_0001502 | |||
| 1553 | Ga0495643_0034150 | |||
| 1554 | Ga0495643_0034966 | |||
| 1555 | Ga0495643_0058452 | |||
| 1556 | Ga0495643_0158460 | |||
| 1557 | Ga0495648_0000747 | |||
| 1558 | Ga0495648_0009787 | |||
| 1559 | Ga0495648_0052170 | |||
| 1560 | Ga0495648_0123768 | |||
| 1561 | Ga0495663_0000002 | |||
| 1562 | Ga0495663_0012615 | |||
| 1563 | Ga0495642_0033098 | |||
| 1564 | Ga0495642_0116343 | |||
| 1565 | Ga0495609_0181400 | |||
| 1566 | Ga0495621_0419509 | |||
| 1567 | Ga0495622_0177699 | |||
| 1568 | Ga0495633_0000213 | |||
| 1569 | Ga0495633_0003218 | |||
| 1570 | Ga0495633_0011499 | |||
| 1571 | Ga0495633_0081609 | |||
| 1572 | Ga0495668_0000072 | |||
| 1573 | Ga0495668_0384034 | |||
| 1574 | Ga0495668_0493228 | |||
| 1575 | Ga0495611_0049263 | |||
| 1576 | Ga0495625_0007192 | |||
| 1577 | Ga0495625_0100566 | |||
| 1578 | Ga0495625_0239627 | |||
| 1579 | Ga0495625_0257377 | |||
| 1580 | Ga0495625_0322017 | |||
| 1581 | Ga0495661_0062396 | |||
| 1582 | Ga0495669_0000221 | |||
| 1583 | Ga0495669_0430931 | |||
| 1584 | Ga0495670_0839631 | |||
| 1585 | Ga0495671_0000016 | |||
| 1586 | Ga0495671_0043108 | |||
| 1587 | Ga0495649_0151440 | |||
| 1588 | Ga0495649_0209870 | |||
| 1589 | Ga0495649_0286446 | |||
| 1590 | Ga0495649_0421522 | |||
| 1591 | Ga0495649_0437142 | |||
| 1592 | Ga0495600_0002120 | |||
| 1593 | Ga0495683_0024341 | |||
| 1594 | Ga0495683_0057651 | |||
| 1595 | Ga0495687_000045 | |||
| 1596 | Ga0495687_000240 | |||
| 1597 | Ga0495677_0000736 | |||
| 1598 | Ga0495673_0176366 | |||
| 1599 | Ga0495681_0003075 | |||
| 1600 | Ga0495681_0036020 | |||
| 1601 | Ga0495681_0039224 | |||
| 1602 | Ga0495686_0013150 | |||
| 1603 | Ga0495686_0032988 | |||
| 1604 | Ga0495686_0042056 | |||
| 1605 | Ga0495686_0048131 | |||
| 1606 | Ga0495686_0393804 | |||
| 1607 | Ga0495686_0494382 | |||
| 1608 | Ga0496101_0487541 | |||
| 1609 | Ga0496102_0000043 | |||
| 1610 | Ga0496102_0000689 | |||
| 1611 | Ga0496102_1401467 | |||
| 1612 | Ga0496103_0000133 | |||
| 1613 | Ga0496103_0000404 | |||
| 1614 | Ga0496104_0034187 | |||
| 1615 | Ga0496105_0001929 | |||
| 1616 | Ga0496105_0170012 | |||
| 1617 | Ga0496107_0073738 | |||
| 1618 | Ga0496108_0003224 | |||
| 1619 | Ga0496108_0708748 | |||
| 1620 | Ga0496109_0948778 | |||
| 1621 | Ga0496110_0122395 | |||
| 1622 | Ga0496111_0019497 | |||
| 1623 | Ga0496113_0072089 | |||
| 1624 | Ga0496114_0001243 | |||
| 1625 | Ga0496115_0000009 | |||
| 1626 | Ga0496116_0000682 | |||
| 1627 | Ga0496116_0011866 | |||
| 1628 | Ga0496116_0128013 | |||
| 1629 | Ga0496117_0000104 | |||
| 1630 | Ga0496117_0000724 | |||
| 1631 | Ga0496117_0020427 | |||
| 1632 | Ga0496118_0000080 | |||
| 1633 | Ga0496118_0000989 | |||
| 1634 | Ga0496118_0001437 | |||
| 1635 | Ga0496118_0045769 | |||
| 1636 | Ga0496119_0005815 | |||
| 1637 | Ga0496119_0041673 | |||
| 1638 | Ga0496119_0054427 | |||
| 1639 | Ga0496120_0035441 | |||
| 1640 | Ga0496120_0039653 | |||
| 1641 | Ga0496120_0080909 | |||
| 1642 | Ga0496120_0149318 | |||
| 1643 | Ga0496121_0000192 | |||
| 1644 | Ga0496121_0002614 | |||
| 1645 | Ga0496121_0014340 | |||
| 1646 | Ga0496121_0062860 | |||
| 1647 | Ga0496121_0065817 | |||
| 1648 | Ga0496122_0011471 | |||
| 1649 | Ga0496122_0020096 | |||
| 1650 | Ga0496122_0025373 | |||
| 1651 | Ga0496123_0017577 | |||
| 1652 | Ga0496123_0031483 | |||
| 1653 | Ga0496123_0038776 | |||
| 1654 | Ga0496123_0511938 | |||
| 1655 | Ga0496124_0000050 | |||
| 1656 | Ga0496124_0000093 | |||
| 1657 | Ga0496124_0002396 | |||
| 1658 | Ga0496124_0032581 | |||
| 1659 | Ga0496124_0152508 | |||
| 1660 | Ga0496125_0001515 | |||
| 1661 | Ga0496125_0010490 | |||
| 1662 | Ga0496125_0013525 | |||
| 1663 | Ga0496125_0019149 | |||
| 1664 | Ga0496125_0383470 | |||
| 1665 | Ga0496126_0000930 | |||
| 1666 | Ga0496126_0018147 | |||
| 1667 | Ga0496126_0246823 | |||
| 1668 | Ga0496126_0446809 | |||
| 1669 | Ga0496126_1063964 | |||
| 1670 | Ga0495682_0010956 | |||
| 1671 | Ga0501290_000464 | |||
| 1672 | Ga0501290_019445 | |||
| 1673 | Ga0501292_000026 | |||
| 1674 | Ga0501294_000620 | |||
| 1675 | Ga0501301_002495 | |||
| 1676 | Ga0501034_0190481 | |||
| 1677 | Ga0501034_1128492 | |||
| 1678 | Ga0501036_0953269 | |||
| 1679 | Ga0501038_0054714 | |||
| 1680 | Ga0501069_0002940 | |||
| 1681 | Ga0501070_0893115 | |||
| 1682 | Ga0501071_0150188 | |||
| 1683 | Ga0501206_000824 | |||
| 1684 | Ga0501206_001417 | |||
| 1685 | Ga0501211_000775 | |||
| 1686 | Ga0501222_000640 | |||
| 1687 | Ga0501223_000004 | |||
| 1688 | Ga0501223_019176 | |||
| 1689 | Ga0501223_119122 | |||
| 1690 | Ga0501224_001500 | |||
| 1691 | Ga0501227_002925 | |||
| 1692 | Ga0501235_000242 | |||
| 1693 | Ga0501235_001905 | |||
| 1694 | Ga0501236_002479 | |||
| 1695 | Ga0501243_074664 | |||
| 1696 | Ga0501246_000072 | |||
| 1697 | Ga0501255_009478 | |||
| 1698 | Ga0501256_030053 | |||
| 1699 | Ga0501257_000036 | |||
| 1700 | Ga0501259_000268 | |||
| 1701 | Ga0501261_000046 | |||
| 1702 | Ga0501225_0000003 | |||
| 1703 | Ga0501225_0000673 | |||
| 1704 | Ga0501225_0019806 | |||
| 1705 | Ga0501225_0023768 | |||
| 1706 | Ga0501225_0179185 | |||
| 1707 | Ga0501245_001012 | |||
| 1708 | Ga0501245_002795 | |||
| 1709 | Ga0501080_0728551 | |||
| 1710 | Ga0501241_002337 | |||
| 1711 | Ga0501263_083451 | |||
| 1712 | Ga0501271_013080 | |||
| 1713 | Ga0501273_056564 | |||
| 1714 | Ga0501279_000027 | |||
| 1715 | Ga0501280_000044 | |||
| 1716 | Ga0501281_00442 | |||
| 1717 | Ga0501281_03489 | |||
| 1718 | Ga0501282_000334 | |||
| 1719 | Ga0501035_1063161 | |||
| 1720 | nmdc:mga07m45_137992_c1 | |||
| 1721 | nmdc:mga0qj67_9482_c1 | |||
| 1722 | Ga0500610_0002355 | |||
| 1723 | Ga0500643_000215 | |||
| 1724 | Ga0500643_017862 | |||
| 1725 | Ga0500643_030093 | |||
| 1726 | Ga0500643_063675 | |||
| 1727 | Ga0500643_149542 | |||
| 1728 | Ga0500583_0168838 | |||
| 1729 | Ga0500651_0183706 | |||
| 1730 | Ga0500566_0011749 | |||
| 1731 | Ga0500555_000889 | |||
| 1732 | Ga0500555_091163 | |||
| 1733 | Ga0500592_000482 | |||
| 1734 | Ga0500594_0049194 | |||
| 1735 | Ga0500595_000578 | |||
| 1736 | Ga0500597_021870 | |||
| 1737 | Ga0500607_251570 | |||
| 1738 | Ga0500618_002362 | |||
| 1739 | Ga0500642_0000646 | |||
| 1740 | Ga0500658_0014254 | |||
| 1741 | Ga0500658_0224339 | |||
| 1742 | Ga0500658_0225543 | |||
| 1743 | Ga0500559_0014974 | |||
| 1744 | Ga0500568_0009185 | |||
| 1745 | Ga0500568_0027124 | |||
| 1746 | Ga0500577_0133299 | |||
| 1747 | Ga0500604_0000018 | |||
| 1748 | Ga0500604_0141903 | |||
| 1749 | Ga0500604_0272026 | |||
| 1750 | Ga0500616_0000419 | |||
| 1751 | Ga0500616_0005521 | |||
| 1752 | Ga0500624_000062 | |||
| 1753 | Ga0500627_0108573 | |||
| 1754 | Ga0500638_308795 | |||
| 1755 | Ga0500636_0004227 | |||
| 1756 | Ga0500636_0098148 | |||
| 1757 | Ga0500637_0000692 | |||
| 1758 | Ga0500645_000138 | |||
| 1759 | Ga0500609_010977 | |||
| 1760 | Ga0500596_001649 | |||
| 1761 | Ga0500587_003146 | |||
| 1762 | Ga0501082_0306412 | |||
| 1763 | 2644126085 | |||
| 1764 | 2778124431 | |||
| 1765 | 2919711043 | |||
| 1766 | 8057103651 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4khb-assembly4.cif.gz_G | structure of the spt16d pob3n heterodimer | 0.7802 | 39 | 63 |
| 6xu6-assembly1.cif.gz_Ck | drosophila melanogaster testis 80s ribosome | 0.6658 | 32 | 60 |
| 4eiq-assembly2.cif.gz_B | chromopyrrolic acid-soaked rebc-10x with bound 7-carboxy-k252c | 0.6179 | 82 | 113 |
| 2r0c-assembly1.cif.gz_A | structure of the substrate-free form of the rebeccamycin biosynthetic enzyme rebc | 0.6142 | 82 | 113 |
| 2r0g-assembly1.cif.gz_A | chromopyrrolic acid-soaked rebc with bound 7-carboxy-k252c | 0.6131 | 82 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6DWZ1_6_279_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7971 | 44 | 73 | 3.30.420.40 |
| 4khbG00 | Mainly Beta;Roll;PH-domain like;FACT complex subunit Spt16p/Cdc68p | 0.7802 | 39 | 63 | 2.30.29.210 |
| af_Q4DQP0_62_285_3.30.1120.90 | Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain;Nucleosome assembly protein | 0.7658 | 40 | 74 | 3.30.1120.90 |
| af_A0A1D6L052_103_280_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7282 | 45 | 73 | 3.60.21.10 |
| af_A0A2R8RXK9_328_492_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.7055 | 45 | 73 | 2.60.120.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838MNA9-F1-model_v4 | DUF2794 domain-containing protein | 0.98 | 19 | 116 |
|
| AF-A0A3N9RSA3-F1-model_v4 | DUF2794 domain-containing protein | 0.9781 | 19 | 116 |
|
| AF-A0A838MNA9-F1-model_v4 | DUF2794 domain-containing protein | 0.9702 | 19 | 116 |
|
| AF-A0A3N9RSA3-F1-model_v4 | DUF2794 domain-containing protein | 0.9683 | 19 | 116 |
|
| AF-A0A1N7MQ27-F1-model_v4 | DM10 domain-containing protein | 0.9675 | 25 | 114 |
GO:0005737
GO:0005856 GO:0042995 |