F484604

General Info

Members Datasets Scaffolds Average Seq Length
883 513 1766 363

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0028178|Ga0496119_0028178_602_1867
Length 421
Sequence MVRLPTAHVESAGPGCVARYPHNSCEIDASRPEPPISHESPGLDRRAHAYAGTMRVLAAMSGGVDSAVAAARAVEAGHDVVGVHLALSRQPGTLRTGARGCCTIEDSMDARRAATMLGIPFYVWDFSERFQLDVVDDFVAEYAAGRTPNPCLRCNERIKFAALLERALALGFDAVATGHYASIVTDQHGNRELHRAADWAKDQSYVLGVLTAEQLAHAMFPLGATPSKAEVRAEAAARGLTVAQKPDSHDICFIPDGDTRGWLAGRIEAEEGAILDQAGERIGTHAGAAAFTVXXRKGLSIGVPAPDGRPRFVLEVRPRSNEVVVGPREALAVAELAGSRISWAGIPPEDAAAGFACEVQVRAHGDPVPATAVLRDGELVIRPDAALDGVAPGQSAVLYRGTRVLGQCTIDRTVSAVPLPA

Samples

Sample ID Description Type Environment
1 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
168 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
169 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
176 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
177 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
194 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
209 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
210 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
211 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
212 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
213 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
214 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
215 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
216 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
217 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
218 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
219 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
220 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
221 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
222 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
237 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
317 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
320 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
321 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
322 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
323 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
324 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
325 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
326 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
330 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
331 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
332 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
333 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
334 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
335 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 2527291627 Frankia casuarinae Thr Isolate Nodule
337 2527291629 Frankia sp. BMG5.23 Isolate Nodule
338 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
339 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
340 2558860280 Kutzneria sp. 744 Isolate Unclassified
341 2576861822 Frankia sp. CeD Isolate Nodule
342 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
343 2582580736 Prauserella sp. Am3 Isolate Unclassified
344 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
345 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
346 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
347 2619618881 Frankia sp. ACN1ag Isolate Unclassified
348 2619619003 Frankia sp. CpI1-P Isolate Nodule
349 2626541554 Frankia sp. AvcI.1 Isolate Nodule
350 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
351 2643221546 Microbacterium sp. Root53 Isolate Unclassified
352 2643221553 Microbacterium sp. Root553 Isolate Unclassified
353 2643221566 Microbacterium sp. Root166 Isolate Unclassified
354 2643221572 Leifsonia sp. Root60 Isolate Unclassified
355 2643221575 Microbacterium sp. Root61 Isolate Unclassified
356 2643221597 Microbacterium sp. Root180 Isolate Unclassified
357 2643221616 Leifsonia sp. Root227 Isolate Unclassified
358 2643221630 Microbacterium sp. Root322 Isolate Unclassified
359 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
360 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
361 2643221649 Leifsonia sp. Root4 Isolate Unclassified
362 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
363 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
364 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
365 2671180195 Frankia sp. CcI49 Isolate Nodule
366 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
367 2684623036 Frankia sp. CgIM4 Isolate Nodule
368 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
369 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
370 2710264753 Frankia sp. KB5 Isolate Nodule
371 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
372 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
373 2739367653 Kocuria sp. OV113 Isolate Unclassified
374 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
375 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
376 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
377 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
378 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
379 2773857759 Microbacterium sp. 1294 Isolate Unclassified
380 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
381 2773857922 Frankia sp. CcI49 Isolate Nodule
382 2773857924 Frankia sp. CgIS1 Isolate Nodule
383 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
384 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
385 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
386 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
387 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
388 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
389 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
390 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
391 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
392 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
393 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
394 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
395 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
396 2808606372 Agromyces sp. 23-23 Isolate Unclassified
397 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
398 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
399 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
400 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
401 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
402 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
403 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
404 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
405 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
406 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
407 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
408 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
409 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
410 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
411 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
412 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
413 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
414 2857727296 Kocuria sp. R-72562 Isolate Unclassified
415 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
416 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
417 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
418 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
419 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
420 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
421 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
422 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
423 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
424 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
425 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
426 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
427 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
428 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
429 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
430 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
431 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
432 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
433 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
434 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
435 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
436 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
437 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
438 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
439 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
440 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
441 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
442 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
443 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
444 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
445 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
446 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
447 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
448 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
449 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
450 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
451 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
452 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
453 2919069694 Microbacterium sp. 1154 Isolate Unclassified
454 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
455 2919395869 Microbacterium resistens 2980 Isolate Unclassified
456 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
457 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
458 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
459 2920879853 Kocuria salina CV6 Isolate Unclassified
460 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
461 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
462 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
463 2928153084 Leifsonia sp. 563 Isolate Unclassified
464 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
465 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
466 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
467 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
468 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
469 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
470 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
471 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
472 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
473 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
474 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
475 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
476 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
477 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
478 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
479 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
480 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
481 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
482 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
483 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
484 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
485 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
486 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
487 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
488 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
489 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
490 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
491 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
492 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
493 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
494 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
495 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
496 637000116 Frankia casuarinae CcI3 Isolate Nodule
497 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
498 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
499 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
500 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
501 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
502 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
503 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
504 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
505 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
506 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
507 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
508 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
509 8054920844 Frankia tisae Agncl-8 Isolate Nodule
510 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
511 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
512 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
513 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.82
Metatranscriptomes 1.02
Isolates 20.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 8.95
Nodule 1.7
Rhizoplane 6.8
Rhizosphere 63.42
Stem 0
Stem Tuber 0.23
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496119_0028178 3300048922 Bacteria 3840
2 JGI24735J21928_10007406 3300002067 Bacteria 3581
3 JGI25154J39366_1002515 3300002738 Bacteria 4673
4 JGI25164J39214_1001093 3300002772 Bacteria 7831
5 JGI25152J39213_1000561 3300002773 Bacteria 20393
6 JGI25406J46586_10001347 3300003203 Bacteria 11559
7 JGI25165J46597_1000002 3300003214 Bacteria 765387
8 Ga0006562J51391_1026734 3300003578 Bacteria 6080
9 Ga0055539_1000058 3300003752 Bacteria 149354
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055525_1000180 3300003759 Bacteria 78601
12 Ga0055527_1000012 3300003760 Bacteria 348744
13 Ga0055542_1000017 3300003762 Bacteria 348744
14 Ga0055529_1000023 3300003763 Bacteria 314383
15 Ga0055541_1002122 3300003841 Bacteria 4042
16 Ga0070658_10053724 3300005327 Bacteria 3270
17 Ga0070658_10113879 3300005327 Bacteria 2242
18 Ga0070676_10007958 3300005328 Bacteria 5699
19 Ga0070677_10006775 3300005333 Bacteria 3811
20 Ga0070680_100374637 3300005336 Bacteria 1212
21 Ga0070682_100155348 3300005337 Bacteria 1574
22 Ga0068868_100015955 3300005338 Bacteria 5568
23 Ga0068868_100016436 3300005338 Bacteria 5495
24 Ga0070660_100005496 3300005339 Bacteria 8779
25 Ga0070661_100083416 3300005344 Bacteria 2360
26 Ga0070661_100231596 3300005344 Bacteria 1420
27 Ga0070668_100001439 3300005347 Bacteria 17177
28 Ga0070668_100005704 3300005347 Bacteria 9229
29 Ga0070668_100080137 3300005347 Bacteria 2558
30 Ga0070668_100362468 3300005347 Bacteria 1229
31 Ga0070669_100027516 3300005353 Bacteria 4092
32 Ga0070671_100016467 3300005355 Bacteria 5977
33 Ga0070671_100023747 3300005355 Bacteria 5019
34 Ga0070671_100110976 3300005355 Bacteria 2304
35 Ga0070674_100058505 3300005356 Bacteria 2680
36 Ga0070674_100063844 3300005356 Bacteria 2579
37 Ga0070673_100241887 3300005364 Bacteria 1570
38 Ga0070659_100000149 3300005366 Bacteria 53509
39 Ga0070659_100100044 3300005366 Bacteria 2333
40 Ga0070667_100008397 3300005367 Bacteria 8564
41 Ga0070713_100340762 3300005436 Bacteria 1389
42 Ga0070711_100014460 3300005439 Bacteria 4972
43 Ga0070705_100011393 3300005440 Bacteria 4486
44 Ga0070694_100087058 3300005444 Bacteria 2184
45 Ga0070663_100004837 3300005455 Bacteria 7942
46 Ga0070678_100003526 3300005456 Bacteria 8730
47 Ga0070678_100057466 3300005456 Bacteria 2850
48 Ga0070678_100153988 3300005456 Bacteria 1855
49 Ga0070685_10051002 3300005466 Bacteria 2392
50 Ga0070698_100070725 3300005471 Bacteria 3501
51 Ga0068853_100089231 3300005539 Bacteria 2707
52 Ga0070686_100199674 3300005544 Bacteria 1433
53 Ga0070696_100030879 3300005546 Bacteria 3670
54 Ga0070696_100218327 3300005546 Bacteria 1430
55 Ga0070693_100026653 3300005547 Bacteria 3122
56 Ga0070665_100001075 3300005548 Bacteria 34026
57 Ga0070665_100051843 3300005548 Bacteria 4115
58 Ga0070665_100102322 3300005548 Bacteria 2868
59 Ga0070704_100073944 3300005549 Bacteria 2484
60 Ga0068855_100002405 3300005563 Bacteria 23088
61 Ga0068855_100049036 3300005563 Bacteria 4982
62 Ga0068857_100000219 3300005577 Bacteria 37769
63 Ga0068856_100090806 3300005614 Bacteria 3039
64 Ga0070702_100130096 3300005615 Bacteria 1588
65 Ga0068852_100005903 3300005616 Bacteria 8804
66 Ga0068864_100174866 3300005618 Bacteria 1959
67 Ga0068851_10000014 3300005834 Bacteria 151675
68 Ga0068863_100042934 3300005841 Bacteria 4295
69 Ga0068863_100061381 3300005841 Bacteria 3554
70 Ga0068858_100000002 3300005842 Bacteria 351633
71 Ga0068858_100000893 3300005842 Bacteria 30963
72 Ga0068860_100020176 3300005843 Bacteria 6459
73 Ga0081455_10000005 3300005937 Bacteria 327136
74 Ga0081455_10000023 3300005937 Bacteria 159570
75 Ga0081539_10000128 3300005985 Bacteria 179041
76 Ga0075365_10004965 3300006038 Bacteria 7120
77 Ga0075365_10006540 3300006038 Bacteria 6421
78 Ga0075364_10008626 3300006051 Bacteria 6097
79 Ga0075364_10050492 3300006051 Bacteria 2715
80 Ga0075364_10060805 3300006051 Bacteria 2477
81 Ga0075364_10181743 3300006051 Bacteria 1423
82 Ga0075432_10000483 3300006058 Bacteria 11870
83 Ga0070712_100014076 3300006175 Bacteria 5129
84 Ga0075369_10009529 3300006186 Bacteria 3776
85 Ga0075369_10046212 3300006186 Bacteria 1874
86 Ga0097621_100083271 3300006237 Bacteria 2665
87 Ga0075370_10052247 3300006353 Bacteria 2318
88 Ga0068871_100031845 3300006358 Bacteria 4161
89 Ga0075428_100495747 3300006844 Bacteria 1307
90 Ga0075431_100226072 3300006847 Bacteria 1908
91 Ga0075434_100184885 3300006871 Bacteria 2104
92 Ga0068865_100060382 3300006881 Bacteria 2654
93 Ga0075435_100180385 3300007076 Bacteria 1784
94 Ga0105251_10012295 3300009011 Bacteria 4849
95 Ga0105244_10008476 3300009036 Bacteria 6415
96 Ga0105244_10014121 3300009036 Bacteria 4633
97 Ga0105244_10020912 3300009036 Bacteria 3626
98 Ga0105244_10052160 3300009036 Bacteria 2083
99 Ga0105247_10000014 3300009101 Bacteria 285043
100 Ga0105247_10114872 3300009101 Bacteria 1737
101 Ga0105243_10098614 3300009148 Bacteria 2421
102 Ga0105243_10122710 3300009148 Bacteria 2193
103 Ga0105242_10052786 3300009176 Bacteria 3318
104 Ga0105248_10000681 3300009177 Bacteria 38440
105 Ga0105248_10001871 3300009177 Bacteria 23331
106 Ga0105248_10037378 3300009177 Bacteria 5432
107 Ga0105248_10120909 3300009177 Bacteria 2954
108 Ga0105237_10000133 3300009545 Bacteria 104324
109 Ga0105237_10081066 3300009545 Bacteria 3235
110 Ga0105238_10003000 3300009551 Bacteria 16857
111 Ga0105238_10016957 3300009551 Bacteria 7391
112 Ga0105249_10097516 3300009553 Bacteria 2760
113 Ga0105239_10023056 3300010375 Bacteria 6863
114 Ga0105239_10181596 3300010375 Bacteria 2354
115 Ga0105239_10271162 3300010375 Bacteria 1909
116 Ga0105246_10001582 3300011119 Bacteria 13546
117 Ga0105246_10008958 3300011119 Bacteria 6161
118 Ga0105246_10057405 3300011119 Bacteria 2693
119 Ga0157373_10015772 3300013100 Bacteria 5518
120 Ga0157370_10005788 3300013104 Bacteria 13815
121 Ga0157370_10033683 3300013104 Bacteria 4994
122 Ga0157370_10053252 3300013104 Bacteria 3859
123 Ga0157370_10318471 3300013104 Bacteria 1435
124 Ga0157369_10000618 3300013105 Bacteria 46223
125 Ga0157369_10002164 3300013105 Bacteria 23689
126 Ga0157369_10036863 3300013105 Bacteria 5356
127 Ga0157369_10050715 3300013105 Bacteria 4492
128 Ga0157369_10164210 3300013105 Bacteria 2342
129 Ga0157369_10427402 3300013105 Bacteria 1373
130 Ga0171462_1003 3300013250 Bacteria 853796
131 Ga0157374_10020795 3300013296 Bacteria 5827
132 Ga0163162_10018367 3300013306 Bacteria 6851
133 Ga0163162_10143982 3300013306 Bacteria 2498
134 Ga0163162_10209105 3300013306 Bacteria 2081
135 Ga0157372_10377560 3300013307 Bacteria 1652
136 Ga0157375_10031909 3300013308 Bacteria 4990
137 Ga0157375_10155904 3300013308 Bacteria 2422
138 Ga0157375_10411191 3300013308 Bacteria 1519
139 Ga0163163_10023231 3300014325 Bacteria 5883
140 Ga0163163_10028866 3300014325 Bacteria 5332
141 Ga0163163_10052633 3300014325 Bacteria 4017
142 Ga0157380_10003034 3300014326 Bacteria 11437
143 Ga0157380_10114056 3300014326 Bacteria 2277
144 Ga0157379_10000007 3300014968 Bacteria 142402
145 Ga0157379_10020432 3300014968 Bacteria 5856
146 Ga0157379_10031326 3300014968 Bacteria 4737
147 Ga0163161_10038744 3300017792 Bacteria 3420
148 Ga0163161_10094567 3300017792 Bacteria 2216
149 Ga0163161_10108795 3300017792 Bacteria 2070
150 Ga0206354_10095331 3300020081 Bacteria 1199
151 Ga0206354_10946747 3300020081 Bacteria 1338
152 Ga0206354_11247678 3300020081 Bacteria 5225
153 Ga0206354_11438617 3300020081 Bacteria 1594
154 Ga0206353_10879647 3300020082 Bacteria 1926
155 Ga0213875_10030738 3300021388 Bacteria 2541
156 Ga0224712_10026130 3300022467 Bacteria 2061
157 Ga0209566_100026 3300025225 Bacteria 367457
158 Ga0209674_100001 3300025226 Bacteria 4013750
159 Ga0209672_100003 3300025228 Bacteria 1560476
160 Ga0209147_100309 3300025229 Bacteria 38478
161 Ga0209563_100001 3300025230 Bacteria 4013775
162 Ga0209563_100320 3300025230 Bacteria 19012
163 Ga0207427_100089 3300025231 Bacteria 135504
164 Ga0209646_1000099 3300025246 Bacteria 180436
165 Ga0209677_100001 3300025253 Bacteria 4013787
166 Ga0209677_100375 3300025253 Bacteria 27361
167 Ga0209148_1000004 3300025254 Bacteria 1844481
168 Ga0209148_1001580 3300025254 Bacteria 10786
169 Ga0209148_1001633 3300025254 Bacteria 10288
170 Ga0209129_1000176 3300025258 Bacteria 93584
171 Ga0209233_1000001 3300025261 Bacteria 2992747
172 Ga0209455_1000022 3300025272 Bacteria 688910
173 Ga0209025_1000655 3300025294 Bacteria 60278
174 Ga0209051_1004052 3300025303 Bacteria 9244
175 Ga0209051_1010018 3300025303 Bacteria 4825
176 Ga0207697_10010844 3300025315 Bacteria 3876
177 Ga0207656_10000002 3300025321 Bacteria 792178
178 Ga0207655_1005595 3300025728 Bacteria 8507
179 Ga0207655_1005782 3300025728 Bacteria 8332
180 Ga0207655_1008672 3300025728 Bacteria 6417
181 Ga0207655_1019558 3300025728 Bacteria 3530
182 Ga0207713_1034198 3300025735 Bacteria 2210
183 Ga0207682_10034204 3300025893 Bacteria 2048
184 Ga0207692_10007187 3300025898 Bacteria 4550
185 Ga0207692_10072606 3300025898 Bacteria 1818
186 Ga0207710_10000031 3300025900 Bacteria 285157
187 Ga0207688_10034610 3300025901 Bacteria 2798
188 Ga0207680_10203119 3300025903 Bacteria 1351
189 Ga0207647_10053726 3300025904 Bacteria 2481
190 Ga0207647_10083155 3300025904 Bacteria 1917
191 Ga0207645_10010060 3300025907 Bacteria 6512
192 Ga0207705_10000213 3300025909 Bacteria 58174
193 Ga0207705_10266719 3300025909 Bacteria 1308
194 Ga0207654_10000001 3300025911 Bacteria 1816198
195 Ga0207654_10064828 3300025911 Bacteria 2149
196 Ga0207695_10002493 3300025913 Bacteria 27109
197 Ga0207671_10000002 3300025914 Bacteria 1144816
198 Ga0207671_10119231 3300025914 Bacteria 2015
199 Ga0207671_10135540 3300025914 Bacteria 1893
200 Ga0207693_10005632 3300025915 Bacteria 10415
201 Ga0207657_10010407 3300025919 Bacteria 9286
202 Ga0207681_10304022 3300025923 Bacteria 1263
203 Ga0207694_10000115 3300025924 Bacteria 84427
204 Ga0207659_10068989 3300025926 Bacteria 2573
205 Ga0207687_10050506 3300025927 Bacteria 2895
206 Ga0207700_10157890 3300025928 Bacteria 1881
207 Ga0207664_10005752 3300025929 Bacteria 8477
208 Ga0207664_10221773 3300025929 Bacteria 1640
209 Ga0207644_10009795 3300025931 Bacteria 6301
210 Ga0207644_10086396 3300025931 Bacteria 2329
211 Ga0207644_10108405 3300025931 Bacteria 2096
212 Ga0207690_10001356 3300025932 Bacteria 15362
213 Ga0207706_10109976 3300025933 Bacteria 2425
214 Ga0207686_10030576 3300025934 Bacteria 3189
215 Ga0207709_10008571 3300025935 Bacteria 5651
216 Ga0207704_10148957 3300025938 Bacteria 1648
217 Ga0207691_10005490 3300025940 Bacteria 12245
218 Ga0207691_10293928 3300025940 Bacteria 1397
219 Ga0207711_10000953 3300025941 Bacteria 27732
220 Ga0207711_10008565 3300025941 Bacteria 8556
221 Ga0207711_10011662 3300025941 Bacteria 7302
222 Ga0207689_10005198 3300025942 Bacteria 11683
223 Ga0207667_10000272 3300025949 Bacteria 71730
224 Ga0207667_10006016 3300025949 Bacteria 14767
225 Ga0207651_10009995 3300025960 Bacteria 5231
226 Ga0207712_10016957 3300025961 Bacteria 4724
227 Ga0207668_10027781 3300025972 Bacteria 3690
228 Ga0207668_10027822 3300025972 Bacteria 3687
229 Ga0207668_10128863 3300025972 Bacteria 1929
230 Ga0207640_10027453 3300025981 Bacteria 3468
231 Ga0207658_10004963 3300025986 Bacteria 9173
232 Ga0207677_10004632 3300026023 Bacteria 7400
233 Ga0207677_10010190 3300026023 Bacteria 5311
234 Ga0207703_10000001 3300026035 Bacteria 822925
235 Ga0207703_10000141 3300026035 Bacteria 86068
236 Ga0207639_10016442 3300026041 Bacteria 5235
237 Ga0207639_10173257 3300026041 Bacteria 1829
238 Ga0207678_10001813 3300026067 Bacteria 19572
239 Ga0207678_10004951 3300026067 Bacteria 11956
240 Ga0207678_10018717 3300026067 Bacteria 6082
241 Ga0207702_10277484 3300026078 Bacteria 1583
242 Ga0207641_10229620 3300026088 Bacteria 1724
243 Ga0207676_10172380 3300026095 Bacteria 1886
244 Ga0207674_10001774 3300026116 Bacteria 27546
245 Ga0207675_100095368 3300026118 Bacteria 2799
246 Ga0207683_10000870 3300026121 Bacteria 27682
247 Ga0207683_10009666 3300026121 Bacteria 8219
248 Ga0207683_10215523 3300026121 Bacteria 1748
249 Ga0207698_10000162 3300026142 Bacteria 42850
250 Ga0207698_10013856 3300026142 Bacteria 5337
251 Ga0207428_10016776 3300027907 Bacteria 6297
252 Ga0268266_10012495 3300028379 Bacteria 7339
253 Ga0268266_10238000 3300028379 Bacteria 1679
254 Ga0268265_10173875 3300028380 Bacteria 1844
255 Ga0268264_10031458 3300028381 Bacteria 4351
256 Ga0265334_10001822 3300028573 Bacteria 10149
257 Ga0307515_10187584 3300028794 Bacteria 1991
258 Ga0265338_10050889 3300028800 Bacteria 3738
259 Ga0307511_10004862 3300030521 Bacteria 13730
260 Ga0307512_10017828 3300030522 Bacteria 6500
261 Ga0316177_1008392 3300030731 Bacteria 3879
262 Ga0265325_10068437 3300031241 Bacteria 1787
263 Ga0265340_10011501 3300031247 Bacteria 4703
264 Ga0307513_10270395 3300031456 Bacteria 1483
265 Ga0307509_10158196 3300031507 Bacteria 2168
266 Ga0307408_100011795 3300031548 Bacteria 5781
267 Ga0307408_100013141 3300031548 Bacteria 5495
268 Ga0307408_100018644 3300031548 Bacteria 4662
269 Ga0307408_100030278 3300031548 Bacteria 3757
270 Ga0307408_100033039 3300031548 Bacteria 3611
271 Ga0307408_100212044 3300031548 Bacteria 1574
272 Ga0307408_100297947 3300031548 Bacteria 1349
273 Ga0307514_10002541 3300031649 Bacteria 18815
274 Ga0307514_10006062 3300031649 Bacteria 10625
275 Ga0316575_10004373 3300031665 Bacteria 4970
276 Ga0316575_10063046 3300031665 Bacteria 1483
277 Ga0316579_10036120 3300031691 Bacteria 2279
278 Ga0316576_10151539 3300031727 Bacteria 1747
279 Ga0316578_10079092 3300031728 Bacteria 1954
280 Ga0307405_10001127 3300031731 Bacteria 10955
281 Ga0307405_10008938 3300031731 Bacteria 5112
282 Ga0307405_10045954 3300031731 Bacteria 2679
283 Ga0307405_10066773 3300031731 Bacteria 2294
284 Ga0307405_10130541 3300031731 Bacteria 1735
285 Ga0307405_10187822 3300031731 Bacteria 1489
286 Ga0307413_10018508 3300031824 Bacteria 3657
287 Ga0307413_10019685 3300031824 Bacteria 3572
288 Ga0307413_10025166 3300031824 Bacteria 3258
289 Ga0307413_10037358 3300031824 Bacteria 2805
290 Ga0307413_10056652 3300031824 Bacteria 2392
291 Ga0307413_10057968 3300031824 Bacteria 2371
292 Ga0307413_10065994 3300031824 Bacteria 2256
293 Ga0307518_10000118 3300031838 Bacteria 55183
294 Ga0307518_10080176 3300031838 Bacteria 2357
295 Ga0307410_10000610 3300031852 Bacteria 14708
296 Ga0307410_10001507 3300031852 Bacteria 10575
297 Ga0307410_10003399 3300031852 Bacteria 7980
298 Ga0307410_10019750 3300031852 Bacteria 4106
299 Ga0307410_10028199 3300031852 Bacteria 3558
300 Ga0307410_10033487 3300031852 Bacteria 3317
301 Ga0307410_10041516 3300031852 Bacteria 3035
302 Ga0307406_10000291 3300031901 Bacteria 29442
303 Ga0307406_10001710 3300031901 Bacteria 12067
304 Ga0307406_10005882 3300031901 Bacteria 6730
305 Ga0307406_10025847 3300031901 Bacteria 3519
306 Ga0307406_10068620 3300031901 Bacteria 2315
307 Ga0307406_10103204 3300031901 Bacteria 1947
308 Ga0307406_10259178 3300031901 Bacteria 1314
309 Ga0307407_10012752 3300031903 Bacteria 4053
310 Ga0307407_10050488 3300031903 Bacteria 2380
311 Ga0307412_10006405 3300031911 Bacteria 6655
312 Ga0307412_10006617 3300031911 Bacteria 6565
313 Ga0307412_10011608 3300031911 Bacteria 5108
314 Ga0307412_10012060 3300031911 Bacteria 5024
315 Ga0307412_10016875 3300031911 Bacteria 4360
316 Ga0307409_100006720 3300031995 Bacteria 6803
317 Ga0307409_100090009 3300031995 Bacteria 2510
318 Ga0307409_100100292 3300031995 Bacteria 2400
319 Ga0307409_100121563 3300031995 Bacteria 2212
320 Ga0307409_100137491 3300031995 Bacteria 2099
321 Ga0307416_100001802 3300032002 Bacteria 11898
322 Ga0307416_100007638 3300032002 Bacteria 6898
323 Ga0307416_100014301 3300032002 Bacteria 5431
324 Ga0307416_100048949 3300032002 Bacteria 3357
325 Ga0307416_100076940 3300032002 Bacteria 2800
326 Ga0307416_100077765 3300032002 Bacteria 2788
327 Ga0307414_10003755 3300032004 Bacteria 8157
328 Ga0307414_10007660 3300032004 Bacteria 6079
329 Ga0307414_10066184 3300032004 Bacteria 2582
330 Ga0307414_10134507 3300032004 Bacteria 1925
331 Ga0307411_10001659 3300032005 Bacteria 9302
332 Ga0307411_10004841 3300032005 Bacteria 6531
333 Ga0307415_100059924 3300032126 Bacteria 2628
334 Ga0307415_100195372 3300032126 Bacteria 1600
335 Ga0307415_100200500 3300032126 Bacteria 1583
336 Ga0316583_10001286 3300032133 Bacteria 8297
337 Ga0316583_10026558 3300032133 Bacteria 2067
338 Ga0316580_10001184 3300032139 Bacteria 6637
339 Ga0307507_10007702 3300033179 Bacteria 15397
340 Ga0307507_10016334 3300033179 Bacteria 8641
341 Ga0373932_0012417 3300035112 Bacteria 2098
342 Ga0373960_0009369 3300035121 Bacteria 2371
343 Ga0373942_0013866 3300035207 Bacteria 1944
344 Ga0316574_0003636 3300035398 Bacteria 7974
345 Ga0316574_0007310 3300035398 Bacteria 6047
346 Ga0316582_0187447 3300036647 Bacteria 1408
347 Ga0316584_0001862 3300036712 Bacteria 13067
348 Ga0395899_0015808 3300037312 Bacteria 5754
349 Ga0395899_0069082 3300037312 Bacteria 2588
350 Ga0395900_0012427 3300037418 Bacteria 8706
351 Ga0395900_0157080 3300037418 Bacteria 2323
352 Ga0395900_0382528 3300037418 Bacteria 1375
353 Ga0395898_0000473 3300037466 Bacteria 80586
354 Ga0395898_0023859 3300037466 Bacteria 6174
355 Ga0395898_0048649 3300037466 Bacteria 4157
356 Ga0395898_0063943 3300037466 Bacteria 3570
357 Ga0395898_0156686 3300037466 Bacteria 2178
358 Ga0395905_0015372 3300037471 Bacteria 7275
359 Ga0316581_0000693 3300037588 Bacteria 6850
360 Ga0436364_1296832 3300037853 Bacteria 11797
361 Ga0395901_0005071 3300038443 Bacteria 13302
362 Ga0395901_0014138 3300038443 Bacteria 8126
363 Ga0395901_0015467 3300038443 Bacteria 7769
364 Ga0395901_0029013 3300038443 Bacteria 5692
365 Ga0395901_0035072 3300038443 Bacteria 5184
366 Ga0395901_0081883 3300038443 Bacteria 3371
367 Ga0395901_0165026 3300038443 Bacteria 2326
368 Ga0395901_0168535 3300038443 Bacteria 2298
369 Ga0439436_0001133 3300041404 Bacteria 7552
370 Ga0439436_0003953 3300041404 Bacteria 4542
371 Ga0439438_034365 3300041405 Bacteria 1336
372 Ga0439439_0001046 3300041406 Bacteria 5242
373 Ga0439461_0000851 3300041410 Bacteria 4512
374 Ga0439466_0000106 3300041411 Bacteria 31870
375 Ga0439466_0050298 3300041411 Bacteria 1367
376 Ga0439465_0020183 3300041413 Bacteria 2086
377 Ga0439433_0000182 3300041999 Bacteria 10020
378 Ga0439433_0001171 3300041999 Bacteria 5374
379 Ga0439433_0009700 3300041999 Bacteria 2101
380 Ga0439442_000001 3300042002 Bacteria 161142
381 Ga0439442_000094 3300042002 Bacteria 21387
382 Ga0439442_002050 3300042002 Bacteria 3961
383 Ga0439449_0000108 3300042007 Bacteria 26950
384 Ga0439449_0008787 3300042007 Bacteria 3832
385 Ga0439449_0020381 3300042007 Bacteria 2485
386 Ga0439449_0029441 3300042007 Bacteria 2047
387 Ga0439452_001202 3300042010 Bacteria 11115
388 Ga0439457_002900 3300042014 Bacteria 4779
389 Ga0439462_0001082 3300042015 Bacteria 5872
390 Ga0450919_000229 3300042121 Bacteria 6268
391 Ga0450920_000216 3300042122 Bacteria 8575
392 Ga0450907_000562 3300042146 Bacteria 10043
393 Ga0450907_005907 3300042146 Bacteria 2054
394 Ga0439434_0000056 3300042435 Bacteria 27697
395 Ga0439434_0004265 3300042435 Bacteria 4178
396 Ga0439434_0004328 3300042435 Bacteria 4151
397 Ga0450918_000178 3300042531 Bacteria 14220
398 Ga0466969_0008896 3300044656 Bacteria 5325
399 Ga0466972_0003731 3300044658 Bacteria 7576
400 Ga0466972_0014668 3300044658 Bacteria 3922
401 Ga0466972_0037196 3300044658 Bacteria 2379
402 Ga0466972_0076858 3300044658 Bacteria 1590
403 Ga0466965_0000009 3300044683 Bacteria 122488
404 Ga0466965_0010802 3300044683 Bacteria 4270
405 Ga0466965_0016108 3300044683 Bacteria 3552
406 Ga0466965_0049058 3300044683 Bacteria 2092
407 Ga0466961_0076601 3300044693 Bacteria 2119
408 Ga0466961_0118716 3300044693 Bacteria 1661
409 Ga0466968_0015933 3300044735 Bacteria 2986
410 Ga0466968_0029774 3300044735 Bacteria 2259
411 Ga0466968_0034654 3300044735 Bacteria 2108
412 Ga0466968_0100089 3300044735 Bacteria 1293
413 Ga0466970_0000106 3300044765 Bacteria 36774
414 Ga0466970_0012825 3300044765 Bacteria 4290
415 Ga0466970_0030132 3300044765 Bacteria 2860
416 Ga0466970_0033464 3300044765 Bacteria 2717
417 Ga0466970_0043247 3300044765 Bacteria 2397
418 Ga0466970_0094156 3300044765 Bacteria 1627
419 Ga0466970_0115063 3300044765 Bacteria 1470
420 Ga0466970_0118785 3300044765 Bacteria 1447
421 Ga0466970_0170579 3300044765 Bacteria 1206
422 Ga0466957_0183506 3300044842 Bacteria 1367
423 Ga0466957_0216416 3300044842 Bacteria 1263
424 Ga0466960_0002504 3300044901 Bacteria 6910
425 Ga0466960_0005117 3300044901 Bacteria 5186
426 Ga0466959_0009825 3300045049 Bacteria 6817
427 Ga0466959_0134577 3300045049 Bacteria 1750
428 Ga0466958_0039067 3300045836 Bacteria 2850
429 Ga0466967_0003086 3300045976 Bacteria 10709
430 Ga0495627_001253 3300046453 Bacteria 15714
431 Ga0495590_0000242 3300046457 Bacteria 29848
432 Ga0495653_0003116 3300046463 Bacteria 13285
433 Ga0495650_0001013 3300046471 Bacteria 31698
434 Ga0495582_0071401 3300046473 Bacteria 1921
435 Ga0495582_0110520 3300046473 Bacteria 1544
436 Ga0495664_0007200 3300046477 Bacteria 6169
437 Ga0495594_0008387 3300046499 Bacteria 5325
438 Ga0495630_0270040 3300046517 Bacteria 1299
439 Ga0495665_0026740 3300046531 Bacteria 3098
440 Ga0495586_0002562 3300046535 Bacteria 9835
441 Ga0495586_0009781 3300046535 Bacteria 5105
442 Ga0495586_0048587 3300046535 Bacteria 2293
443 Ga0495587_0002797 3300046536 Bacteria 11661
444 Ga0495645_0000572 3300046543 Bacteria 25208
445 Ga0495645_0002606 3300046543 Bacteria 12259
446 Ga0495667_0075201 3300046559 Bacteria 2198
447 Ga0495668_0103214 3300046616 Bacteria 1560
448 Ga0495588_0002007 3300046674 Bacteria 8700
449 Ga0495657_0011157 3300046675 Bacteria 6731
450 Ga0495600_0007923 3300046809 Bacteria 6509
451 Ga0495581_0014701 3300047315 Bacteria 4540
452 Ga0495581_0033760 3300047315 Bacteria 2961
453 Ga0495581_0036242 3300047315 Bacteria 2854
454 Ga0495581_0038937 3300047315 Bacteria 2752
455 Ga0495672_0005490 3300047320 Bacteria 10049
456 Ga0495672_0056671 3300047320 Bacteria 2278
457 Ga0495680_0046582 3300047322 Bacteria 3418
458 Ga0495684_0201912 3300047471 Bacteria 1465
459 Ga0495593_0013807 3300047673 Bacteria 4601
460 Ga0496100_0002695 3300048903 Bacteria 9062
461 Ga0496101_0015966 3300048904 Bacteria 5066
462 Ga0496101_0016204 3300048904 Bacteria 5030
463 Ga0496101_0111997 3300048904 Bacteria 2055
464 Ga0496102_0000408 3300048905 Bacteria 49838
465 Ga0496102_0034336 3300048905 Bacteria 4561
466 Ga0496102_0145371 3300048905 Bacteria 2225
467 Ga0496102_0298556 3300048905 Bacteria 1518
468 Ga0496102_0435702 3300048905 Bacteria 1230
469 Ga0496103_0000068 3300048906 Bacteria 121996
470 Ga0496103_0004736 3300048906 Bacteria 8229
471 Ga0496103_0013184 3300048906 Bacteria 4900
472 Ga0496103_0023370 3300048906 Bacteria 3727
473 Ga0496103_0024376 3300048906 Bacteria 3652
474 Ga0496103_0028748 3300048906 Bacteria 3376
475 Ga0496104_0011688 3300048907 Bacteria 7872
476 Ga0496104_0016669 3300048907 Bacteria 6677
477 Ga0496104_0028567 3300048907 Bacteria 5169
478 Ga0496104_0052147 3300048907 Bacteria 3863
479 Ga0496104_0062484 3300048907 Bacteria 3531
480 Ga0496104_0087946 3300048907 Bacteria 2968
481 Ga0496105_0006436 3300048908 Bacteria 9029
482 Ga0496105_0020633 3300048908 Bacteria 5325
483 Ga0496105_0044585 3300048908 Bacteria 3658
484 Ga0496105_0066439 3300048908 Bacteria 2977
485 Ga0496105_0094341 3300048908 Bacteria 2471
486 Ga0496105_0171492 3300048908 Bacteria 1778
487 Ga0496106_0075218 3300048909 Bacteria 2586
488 Ga0496107_0179601 3300048910 Bacteria 1571
489 Ga0496107_0190867 3300048910 Bacteria 1522
490 Ga0496108_0022373 3300048911 Bacteria 5196
491 Ga0496108_0084549 3300048911 Bacteria 2693
492 Ga0496108_0104157 3300048911 Bacteria 2421
493 Ga0496109_0035173 3300048912 Bacteria 4517
494 Ga0496109_0114365 3300048912 Bacteria 2510
495 Ga0496109_0114793 3300048912 Bacteria 2505
496 Ga0496109_0287151 3300048912 Bacteria 1551
497 Ga0496110_0023039 3300048913 Bacteria 5295
498 Ga0496110_0027910 3300048913 Bacteria 4842
499 Ga0496110_0034418 3300048913 Bacteria 4388
500 Ga0496110_0078495 3300048913 Bacteria 2939
501 Ga0496111_0023083 3300048914 Bacteria 4363
502 Ga0496111_0049922 3300048914 Bacteria 3016
503 Ga0496111_0203937 3300048914 Bacteria 1469
504 Ga0496112_0027934 3300048915 Bacteria 5443
505 Ga0496112_0030951 3300048915 Bacteria 5185
506 Ga0496112_0031814 3300048915 Bacteria 5119
507 Ga0496112_0090919 3300048915 Bacteria 3021
508 Ga0496113_0100028 3300048916 Bacteria 2246
509 Ga0496114_0008452 3300048917 Bacteria 8156
510 Ga0496114_0023869 3300048917 Bacteria 4990
511 Ga0496114_0039026 3300048917 Bacteria 3930
512 Ga0496114_0042044 3300048917 Bacteria 3787
513 Ga0496114_0151152 3300048917 Bacteria 2014
514 Ga0496114_0180069 3300048917 Bacteria 1845
515 Ga0496115_0011477 3300048918 Bacteria 6643
516 Ga0496115_0023496 3300048918 Bacteria 4784
517 Ga0496115_0033165 3300048918 Bacteria 4076
518 Ga0496115_0105723 3300048918 Bacteria 2310
519 Ga0496116_0000152 3300048919 Bacteria 141311
520 Ga0496116_0008426 3300048919 Bacteria 8947
521 Ga0496117_0000053 3300048920 Bacteria 279396
522 Ga0496117_0000615 3300048920 Bacteria 57676
523 Ga0496117_0000884 3300048920 Bacteria 46176
524 Ga0496117_0001576 3300048920 Bacteria 32370
525 Ga0496117_0005515 3300048920 Bacteria 13253
526 Ga0496117_0156462 3300048920 Bacteria 1341
527 Ga0496118_0001720 3300048921 Bacteria 31922
528 Ga0496118_0004019 3300048921 Bacteria 17890
529 Ga0496118_0080661 3300048921 Bacteria 2289
530 Ga0496118_0131884 3300048921 Bacteria 1603
531 Ga0496119_0002707 3300048922 Bacteria 19137
532 Ga0496119_0003914 3300048922 Bacteria 15123
533 Ga0496119_0004238 3300048922 Bacteria 14385
534 Ga0496119_0005861 3300048922 Bacteria 11600
535 Ga0496119_0015787 3300048922 Bacteria 5786
536 Ga0496119_0019313 3300048922 Bacteria 5026
537 Ga0496119_0019704 3300048922 Bacteria 4952
538 Ga0496119_0044528 3300048922 Bacteria 2793
539 Ga0496119_0052140 3300048922 Bacteria 2508
540 Ga0496120_0000426 3300048923 Bacteria 66901
541 Ga0496120_0001117 3300048923 Bacteria 34800
542 Ga0496120_0002915 3300048923 Bacteria 16342
543 Ga0496120_0004892 3300048923 Bacteria 10910
544 Ga0496120_0010133 3300048923 Bacteria 6604
545 Ga0496120_0024234 3300048923 Bacteria 3787
546 Ga0496120_0032590 3300048923 Bacteria 3140
547 Ga0496120_0033662 3300048923 Bacteria 3077
548 Ga0496120_0043224 3300048923 Bacteria 2626
549 Ga0496120_0085748 3300048923 Bacteria 1694
550 Ga0496121_0000891 3300048924 Bacteria 53863
551 Ga0496121_0021970 3300048924 Bacteria 6218
552 Ga0496122_0000031 3300048925 Bacteria 329726
553 Ga0496122_0000194 3300048925 Bacteria 139191
554 Ga0496122_0014104 3300048925 Bacteria 7753
555 Ga0496122_0019167 3300048925 Bacteria 6267
556 Ga0496122_0031624 3300048925 Bacteria 4399
557 Ga0496123_0000013 3300048926 Bacteria 439694
558 Ga0496123_0000350 3300048926 Bacteria 86569
559 Ga0496123_0000681 3300048926 Bacteria 56018
560 Ga0496123_0062673 3300048926 Bacteria 2380
561 Ga0496123_0120583 3300048926 Bacteria 1476
562 Ga0496124_0003767 3300048927 Bacteria 18240
563 Ga0496124_0004053 3300048927 Bacteria 17370
564 Ga0496124_0008895 3300048927 Bacteria 10415
565 Ga0496124_0020624 3300048927 Bacteria 6083
566 Ga0496124_0022562 3300048927 Bacteria 5766
567 Ga0496124_0027130 3300048927 Bacteria 5147
568 Ga0496124_0071353 3300048927 Bacteria 2879
569 Ga0496125_0000077 3300048928 Bacteria 232629
570 Ga0496125_0017043 3300048928 Bacteria 6943
571 Ga0496125_0020810 3300048928 Bacteria 6144
572 Ga0496125_0022371 3300048928 Bacteria 5872
573 Ga0496125_0029221 3300048928 Bacteria 4958
574 Ga0496125_0045042 3300048928 Bacteria 3719
575 Ga0496125_0066821 3300048928 Bacteria 2838
576 Ga0496126_0001071 3300048929 Bacteria 46057
577 Ga0496126_0014786 3300048929 Bacteria 7873
578 Ga0496126_0015636 3300048929 Bacteria 7625
579 Ga0496126_0044891 3300048929 Bacteria 4066
580 Ga0496126_0046767 3300048929 Bacteria 3965
581 Ga0496126_0065144 3300048929 Bacteria 3261
582 Ga0496126_0125426 3300048929 Bacteria 2222
583 Ga0501317_004320 3300049533 Bacteria 1472
584 Ga0501031_0004368 3300049568 Bacteria 9155
585 Ga0501032_0000407 3300049569 Bacteria 35505
586 Ga0501032_0001556 3300049569 Bacteria 18312
587 Ga0501032_0044841 3300049569 Bacteria 2992
588 Ga0501033_0002659 3300049570 Bacteria 15010
589 Ga0501033_0003000 3300049570 Bacteria 14091
590 Ga0501033_0026246 3300049570 Bacteria 4385
591 Ga0501033_0218791 3300049570 Bacteria 1356
592 Ga0501033_0234027 3300049570 Bacteria 1304
593 Ga0501034_0000051 3300049571 Bacteria 210960
594 Ga0501034_0009471 3300049571 Bacteria 10195
595 Ga0501034_0012979 3300049571 Bacteria 8587
596 Ga0501034_0123262 3300049571 Bacteria 2577
597 Ga0501034_0125558 3300049571 Bacteria 2551
598 Ga0501034_0170959 3300049571 Bacteria 2140
599 Ga0501034_0192471 3300049571 Bacteria 2001
600 Ga0501034_0470729 3300049571 Bacteria 1172
601 Ga0501036_0001633 3300049572 Bacteria 17371
602 Ga0501036_0008562 3300049572 Bacteria 8389
603 Ga0501037_0002752 3300049573 Bacteria 12719
604 Ga0501038_0001166 3300049574 Bacteria 23863
605 Ga0501038_0011688 3300049574 Bacteria 8008
606 Ga0501038_0031268 3300049574 Bacteria 4705
607 Ga0501038_0037307 3300049574 Bacteria 4261
608 Ga0501038_0046616 3300049574 Bacteria 3758
609 Ga0501038_0067627 3300049574 Bacteria 3039
610 Ga0501038_0104621 3300049574 Bacteria 2352
611 Ga0501038_0119097 3300049574 Bacteria 2179
612 Ga0501039_0000287 3300049575 Bacteria 35995
613 Ga0501039_0030904 3300049575 Bacteria 4129
614 Ga0501039_0036106 3300049575 Bacteria 3813
615 Ga0501039_0036234 3300049575 Bacteria 3806
616 Ga0501039_0110768 3300049575 Bacteria 2146
617 Ga0501042_0111215 3300049578 Bacteria 1972
618 Ga0501043_0004673 3300049579 Bacteria 11100
619 Ga0501043_0024971 3300049579 Bacteria 4689
620 Ga0501043_0036081 3300049579 Bacteria 3889
621 Ga0501043_0040866 3300049579 Bacteria 3645
622 Ga0501043_0056599 3300049579 Bacteria 3080
623 Ga0501043_0059257 3300049579 Bacteria 3004
624 Ga0501043_0166676 3300049579 Bacteria 1720
625 Ga0501046_0001394 3300049580 Bacteria 23269
626 Ga0501046_0010495 3300049580 Bacteria 7950
627 Ga0501046_0013854 3300049580 Bacteria 6810
628 Ga0501047_0011806 3300049581 Bacteria 8261
629 Ga0501047_0042644 3300049581 Bacteria 4384
630 Ga0501047_0073102 3300049581 Bacteria 3301
631 Ga0501047_0103344 3300049581 Bacteria 2729
632 Ga0501048_0008296 3300049582 Bacteria 7859
633 Ga0501048_0225880 3300049582 Bacteria 1328
634 Ga0501068_0094082 3300049584 Bacteria 1852
635 Ga0501069_0031136 3300049585 Bacteria 2933
636 Ga0501070_0000100 3300049586 Bacteria 75001
637 Ga0501070_0003131 3300049586 Bacteria 14404
638 Ga0501070_0005309 3300049586 Bacteria 10990
639 Ga0501070_0006307 3300049586 Bacteria 10093
640 Ga0501070_0008918 3300049586 Bacteria 8477
641 Ga0501070_0122487 3300049586 Bacteria 2149
642 Ga0501071_0000167 3300049587 Bacteria 28392
643 Ga0501073_0000223 3300049589 Bacteria 37267
644 Ga0501073_0007116 3300049589 Bacteria 8333
645 Ga0501073_0018072 3300049589 Bacteria 5099
646 Ga0501080_0000083 3300049742 Bacteria 63863
647 Ga0501080_0134879 3300049742 Bacteria 2285
648 Ga0501083_0000031 3300049744 Bacteria 104819
649 Ga0501083_0016779 3300049744 Bacteria 5114
650 Ga0501035_0009248 3300049822 Bacteria 9162
651 Ga0501035_0020033 3300049822 Bacteria 6144
652 Ga0501044_0001905 3300049823 Bacteria 24138
653 Ga0501044_0005242 3300049823 Bacteria 14418
654 Ga0501044_0015200 3300049823 Bacteria 8291
655 Ga0501044_0197739 3300049823 Bacteria 1969
656 Ga0501044_0200763 3300049823 Bacteria 1952
657 nmdc:mga00v17_144755_c1 3300050491 Bacteria 1525
658 nmdc:mga00v17_203407_c1 3300050491 Bacteria 1280
659 nmdc:mga00v17_23464_c1 3300050491 Bacteria 3568
660 nmdc:mga00v17_24870_c1 3300050491 Bacteria 3476
661 nmdc:mga00v17_75373_c1 3300050491 Bacteria 2097
662 nmdc:mga0yw44_6157_c1 3300050492 Bacteria 5768
663 nmdc:mga0yw44_98172_c1 3300050492 Bacteria 1862
664 nmdc:mga06z11_47437_c1 3300050494 Bacteria 2182
665 nmdc:mga07m45_62837_c1 3300050496 Bacteria 2105
666 nmdc:mga09592_147895_c1 3300050508 Bacteria 2026
667 nmdc:mga06r32_464786_c1 3300050510 Bacteria 1244
668 nmdc:mga08x19_59847_c1 3300050514 Bacteria 2466
669 nmdc:mga0sz30_10818_c1 3300050516 Bacteria 2455
670 nmdc:mga0sz30_45661_c1 3300050516 Bacteria 1848
671 Ga0495601_0037212 3300053077 Bacteria 3042
672 Ga0500635_0000010 3300053080 Bacteria 147500
673 Ga0500635_0027739 3300053080 Bacteria 1802
674 Ga0495655_0004033 3300053083 Bacteria 2481
675 Ga0495619_0028662 3300053085 Bacteria 3593
676 Ga0500643_000072 3300053087 Bacteria 112810
677 Ga0500651_0000194 3300053093 Bacteria 38826
678 Ga0500650_0000328 3300053098 Bacteria 11421
679 Ga0500556_0000001 3300053104 Bacteria 1135060
680 Ga0500556_0000086 3300053104 Bacteria 87063
681 Ga0500562_000397 3300053108 Bacteria 10573
682 Ga0500562_005543 3300053108 Bacteria 3171
683 Ga0500593_005225 3300053117 Bacteria 5091
684 Ga0500652_103382 3300053131 Bacteria 1191
685 Ga0500655_002645 3300053133 Bacteria 3245
686 Ga0500559_0000063 3300053136 Bacteria 87005
687 Ga0500559_0003102 3300053136 Bacteria 8275
688 Ga0500559_0004023 3300053136 Bacteria 7060
689 Ga0500559_0010658 3300053136 Bacteria 3940
690 Ga0500559_0058052 3300053136 Bacteria 1720
691 Ga0500568_0000006 3300053139 Bacteria 522235
692 Ga0500568_0000028 3300053139 Bacteria 161589
693 Ga0500568_0000102 3300053139 Bacteria 78197
694 Ga0500568_0009694 3300053139 Bacteria 4560
695 Ga0500573_0000001 3300053140 Bacteria 436394
696 Ga0500573_0004401 3300053140 Bacteria 7415
697 Ga0500573_0037680 3300053140 Bacteria 2794
698 Ga0500573_0046834 3300053140 Bacteria 2491
699 Ga0500577_0076724 3300053142 Bacteria 1323
700 Ga0500590_032099 3300053148 Bacteria 2723
701 Ga0500616_0000078 3300053153 Bacteria 202009
702 Ga0500616_0000427 3300053153 Bacteria 56111
703 Ga0500620_000233 3300053155 Bacteria 11018
704 Ga0500645_028229 3300053730 Bacteria 1699
705 Ga0587072_003666 3300059643 Bacteria 2176
706 2528202901 2527291627 Bacteria 5309833
707 2528213422 2527291629 Bacteria 5267418
708 2546947861 2546825537 Bacteria 5389291
709 2555231377 2554235227 Bacteria 3637389
710 2559429475 2558860280 Bacteria 11429938
711 2579749523 2576861822 Bacteria 5004595
712 2579855753 2579778521 Bacteria 7624758
713 2583150313 2582580736 Bacteria 5325865
714 2586058970 2585427649 Bacteria 9053857
715 2587863330 2585428094 Bacteria 3604039
716 2588108991 2585428157 Bacteria 3018951
717 2619857529 2619618881 Bacteria 7521104
718 2620353408 2619619003 Bacteria 7619552
719 2626635223 2626541554 Bacteria 7741902
720 2643733823 2643221542 Bacteria 3563959
721 2643753387 2643221546 Bacteria 2910897
722 2643785581 2643221553 Bacteria 3544260
723 2643848547 2643221566 Bacteria 3460379
724 2643875529 2643221572 Bacteria 3614809
725 2643885246 2643221575 Bacteria 4022601
726 2643996040 2643221597 Bacteria 3347721
727 2644095777 2643221616 Bacteria 4066575
728 2644170404 2643221630 Bacteria 3601215
729 2644183097 2643221632 Bacteria 3406696
730 2644198755 2643221635 Bacteria 2632343
731 2644277073 2643221649 Bacteria 3867359
732 2644382584 2643221669 Bacteria 3611286
733 2644679995 2643221724 Bacteria 3593515
734 2655033041 2654587600 Bacteria 3911798
735 2671839984 2671180195 Bacteria 9757215
736 2686535399 2684623035 Bacteria 8032739
737 2686542584 2684623036 Bacteria 5199090
738 2689990728 2687453743 Bacteria 8361025
739 2691514598 2690315906 Bacteria 4517044
740 2710602411 2710264753 Bacteria 5455564
741 2729908974 2728369276 Bacteria 5610032
742 2730229493 2728369380 Bacteria 3620317
743 2739602736 2739367653 Bacteria 2780952
744 2747951843 2747842429 Bacteria 3914386
745 2753070607 2751185734 Bacteria 8863695
746 2753301181 2751185788 Bacteria 4541048
747 2758225913 2757320536 Bacteria 3629334
748 2774380223 2773857758 Bacteria 3592392
749 2774384320 2773857759 Bacteria 2963774
750 2774399344 2773857763 Bacteria 4180068
751 2774858140 2773857922 Bacteria 9757215
752 2774864614 2773857924 Bacteria 5256821
753 2775655066 2775506735 Bacteria 4556596
754 2776371507 2775506925 Bacteria 7237746
755 2784471734 2784132109 Bacteria 3141763
756 2791910733 2791354901 Bacteria 8322202
757 2795783634 2795385470 Bacteria 8317180
758 2795794271 2795385472 Bacteria 6627535
759 2799185291 2799112218 Bacteria 4315149
760 2808631056 2808606306 Bacteria 3608896
761 2808827709 2808606357 Bacteria 4466944
762 2808853063 2808606360 Bacteria 4404006
763 2808878435 2808606366 Bacteria 4415912
764 2808885767 2808606368 Bacteria 3174172
765 2808897046 2808606371 Bacteria 4251511
766 2808901811 2808606372 Bacteria 4649509
767 2809592278 2808606522 Bacteria 9488490
768 2810364225 2808606700 Bacteria 3482157
769 2812320528 2811994871 Bacteria 4497550
770 2812323360 2811994872 Bacteria 4121241
771 2817508765 2816332305 Bacteria 2697803
772 2819426688 2818991318 Bacteria 5266538
773 2821270143 2821268502 Bacteria 3750023
774 2833711107 2833709550 Bacteria 4008291
775 2844842150 2844841374 Bacteria 3917147
776 2844849551 2844849076 Bacteria 4091819
777 2852645945 2852643534 Bacteria 3013378
778 2852647431 2852646457 Bacteria 3408613
779 2852665111 2852663356 Bacteria 4090475
780 2857481086 2857479173 Bacteria 2469263
781 2857634595 2857632687 Bacteria 2448521
782 2857720168 2857720070 Bacteria 3189373
783 2857723633 2857723135 Bacteria 4217853
784 2857727665 2857727296 Bacteria 2745552
785 2857730115 2857729791 Bacteria 4040535
786 2857733908 2857733635 Bacteria 3532004
787 2857737832 2857737099 Bacteria 3104305
788 2857741322 2857740372 Bacteria 4782044
789 2862995059 2862993130 Bacteria 3860849
790 2863070929 2863067949 Bacteria 8541735
791 2866552775 2866552031 Bacteria 5824618
792 2866616516 2866612099 Bacteria 7543886
793 2870624200 2870622029 Bacteria 3643329
794 2870630499 2870628048 Bacteria 3696012
795 2870726834 2870721527 Bacteria 9689237
796 2870802160 2870801768 Bacteria 2710986
797 2870806534 2870804320 Bacteria 2552467
798 2883824866 2883821847 Bacteria 5121194
799 2884765140 2884763398 Bacteria 4091164
800 2891326718 2891326441 Bacteria 6439512
801 2895887081 2895880812 Bacteria 11255272
802 2897564414 2897561785 Bacteria 3256946
803 2899362138 2899359706 Bacteria 10940472
804 2899372603 2899370129 Bacteria 6781179
805 2904430910 2904430863 Bacteria 3486923
806 2904499797 2904497146 Bacteria 4731781
807 2904503569 2904501621 Bacteria 3401437
808 2904511848 2904509784 Bacteria 3520416
809 2904776638 2904776348 Bacteria 4658726
810 2905927750 2905926851 Bacteria 4423176
811 2906800554 2906799679 Bacteria 4031749
812 2908675216 2908674828 Bacteria 3382763
813 2908680765 2908678064 Bacteria 3482747
814 2909075467 2909074476 Bacteria 3436050
815 2910814190 2910809715 Bacteria 4982797
816 2915769195 2915768154 Bacteria 8424322
817 2917743458 2917736166 Bacteria 9690793
818 2919036193 2919034639 Bacteria 4763403
819 2919039895 2919039151 Bacteria 3391018
820 2919045157 2919042368 Bacteria 3905917
821 2919057796 2919055335 Bacteria 3875751
822 2919061693 2919059106 Bacteria 4991624
823 2919071686 2919069694 Bacteria 3622919
824 2919391450 2919391150 Bacteria 4884741
825 2919396476 2919395869 Bacteria 3704152
826 2919446458 2919443155 Bacteria 4072969
827 2919524197 2919523602 Bacteria 3788128
828 2919542170 2919538618 Bacteria 4677069
829 2920882269 2920879853 Bacteria 4216831
830 2928092001 2928090899 Bacteria 3158267
831 2928108413 2928104781 Bacteria 3877447
832 2928123339 2928121344 Bacteria 3972376
833 2928155635 2928153084 Bacteria 4020257
834 2928501237 2928500415 Bacteria 3384541
835 2932429241 2932426870 Bacteria 4547726
836 2933420723 2933418574 Bacteria 4476724
837 2939598678 2939598168 Bacteria 4687164
838 2939648859 2939647034 Bacteria 4681660
839 2939658677 2939657138 Bacteria 3740283
840 2939662632 2939660829 Bacteria 3784848
841 2939676062 2939674588 Bacteria 4844420
842 2945918288 2945916053 Bacteria 4555517
843 2945921426 2945920336 Bacteria 4501603
844 2945942391 2945941187 Bacteria 4682474
845 2945971943 2945968032 Bacteria 4111363
846 2946005363 2946003308 Bacteria 3857229
847 2946026423 2946024296 Bacteria 3508095
848 2946033940 2946033335 Bacteria 3835514
849 2946038334 2946037020 Bacteria 4900426
850 2946044026 2946041624 Bacteria 4191385
851 2946062141 2946059875 Bacteria 4386623
852 2946081103 2946080515 Bacteria 4310960
853 2953999609 2953998280 Bacteria 4812144
854 2966925815 2966924647 Bacteria 3268643
855 2974297311 2974294766 Bacteria 3767688
856 2974306320 2974302888 Bacteria 4369871
857 2974326450 2974324384 Bacteria 3750535
858 2977231561 2977228692 Bacteria 3450105
859 2977236915 2977236895 Bacteria 3569373
860 2977254093 2977251589 Bacteria 2952848
861 2977266787 2977264416 Bacteria 3750737
862 2984545295 2984542743 Bacteria 3569378
863 2984553358 2984551494 Bacteria 3877562
864 2984581232 2984580707 Bacteria 3351387
865 2995727730 2995726249 Bacteria 3470435
866 637880972 637000116 Bacteria 5433628
867 8002811783 8002811521 Bacteria 2942897
868 8003316203 8003314358 Bacteria 10575343
869 8004023469 8004021418 Bacteria 4313954
870 8004026448 8004025490 Bacteria 4327753
871 8004185304 8004182704 Bacteria 3391155
872 8016257400 8016254467 Bacteria 3797036
873 8045831731 8045830549 Bacteria 4444727
874 8046353103 8046352972 Bacteria 3613806
875 8047715479 8047710418 Bacteria 11023148
876 8054111028 8054107350 Bacteria 5022511
877 8054476767 8054472261 Bacteria 7464355
878 8054919773 8054913762 Bacteria 7713009
879 8054925864 8054920844 Bacteria 7068637
880 8055162946 8055157932 Bacteria 6429399
881 8056038954 8056037122 Bacteria 3854319
882 8056211875 8056207758 Bacteria 8639239
883 8057347864 8057345674 Bacteria 4160394
884 Ga0496119_0028178
885 JGI24735J21928_10007406
886 JGI25154J39366_1002515
887 JGI25164J39214_1001093
888 JGI25152J39213_1000561
889 JGI25406J46586_10001347
890 JGI25165J46597_1000002
891 Ga0006562J51391_1026734
892 Ga0055539_1000058
893 Ga0055533_1000001
894 Ga0055525_1000180
895 Ga0055527_1000012
896 Ga0055542_1000017
897 Ga0055529_1000023
898 Ga0055541_1002122
899 Ga0070658_10053724
900 Ga0070658_10113879
901 Ga0070676_10007958
902 Ga0070677_10006775
903 Ga0070680_100374637
904 Ga0070682_100155348
905 Ga0068868_100015955
906 Ga0068868_100016436
907 Ga0070660_100005496
908 Ga0070661_100083416
909 Ga0070661_100231596
910 Ga0070668_100001439
911 Ga0070668_100005704
912 Ga0070668_100080137
913 Ga0070668_100362468
914 Ga0070669_100027516
915 Ga0070671_100016467
916 Ga0070671_100023747
917 Ga0070671_100110976
918 Ga0070674_100058505
919 Ga0070674_100063844
920 Ga0070673_100241887
921 Ga0070659_100000149
922 Ga0070659_100100044
923 Ga0070667_100008397
924 Ga0070713_100340762
925 Ga0070711_100014460
926 Ga0070705_100011393
927 Ga0070694_100087058
928 Ga0070663_100004837
929 Ga0070678_100003526
930 Ga0070678_100057466
931 Ga0070678_100153988
932 Ga0070685_10051002
933 Ga0070698_100070725
934 Ga0068853_100089231
935 Ga0070686_100199674
936 Ga0070696_100030879
937 Ga0070696_100218327
938 Ga0070693_100026653
939 Ga0070665_100001075
940 Ga0070665_100051843
941 Ga0070665_100102322
942 Ga0070704_100073944
943 Ga0068855_100002405
944 Ga0068855_100049036
945 Ga0068857_100000219
946 Ga0068856_100090806
947 Ga0070702_100130096
948 Ga0068852_100005903
949 Ga0068864_100174866
950 Ga0068851_10000014
951 Ga0068863_100042934
952 Ga0068863_100061381
953 Ga0068858_100000002
954 Ga0068858_100000893
955 Ga0068860_100020176
956 Ga0081455_10000005
957 Ga0081455_10000023
958 Ga0081539_10000128
959 Ga0075365_10004965
960 Ga0075365_10006540
961 Ga0075364_10008626
962 Ga0075364_10050492
963 Ga0075364_10060805
964 Ga0075364_10181743
965 Ga0075432_10000483
966 Ga0070712_100014076
967 Ga0075369_10009529
968 Ga0075369_10046212
969 Ga0097621_100083271
970 Ga0075370_10052247
971 Ga0068871_100031845
972 Ga0075428_100495747
973 Ga0075431_100226072
974 Ga0075434_100184885
975 Ga0068865_100060382
976 Ga0075435_100180385
977 Ga0105251_10012295
978 Ga0105244_10008476
979 Ga0105244_10014121
980 Ga0105244_10020912
981 Ga0105244_10052160
982 Ga0105247_10000014
983 Ga0105247_10114872
984 Ga0105243_10098614
985 Ga0105243_10122710
986 Ga0105242_10052786
987 Ga0105248_10000681
988 Ga0105248_10001871
989 Ga0105248_10037378
990 Ga0105248_10120909
991 Ga0105237_10000133
992 Ga0105237_10081066
993 Ga0105238_10003000
994 Ga0105238_10016957
995 Ga0105249_10097516
996 Ga0105239_10023056
997 Ga0105239_10181596
998 Ga0105239_10271162
999 Ga0105246_10001582
1000 Ga0105246_10008958
1001 Ga0105246_10057405
1002 Ga0157373_10015772
1003 Ga0157370_10005788
1004 Ga0157370_10033683
1005 Ga0157370_10053252
1006 Ga0157370_10318471
1007 Ga0157369_10000618
1008 Ga0157369_10002164
1009 Ga0157369_10036863
1010 Ga0157369_10050715
1011 Ga0157369_10164210
1012 Ga0157369_10427402
1013 Ga0171462_1003
1014 Ga0157374_10020795
1015 Ga0163162_10018367
1016 Ga0163162_10143982
1017 Ga0163162_10209105
1018 Ga0157372_10377560
1019 Ga0157375_10031909
1020 Ga0157375_10155904
1021 Ga0157375_10411191
1022 Ga0163163_10023231
1023 Ga0163163_10028866
1024 Ga0163163_10052633
1025 Ga0157380_10003034
1026 Ga0157380_10114056
1027 Ga0157379_10000007
1028 Ga0157379_10020432
1029 Ga0157379_10031326
1030 Ga0163161_10038744
1031 Ga0163161_10094567
1032 Ga0163161_10108795
1033 Ga0206354_10095331
1034 Ga0206354_10946747
1035 Ga0206354_11247678
1036 Ga0206354_11438617
1037 Ga0206353_10879647
1038 Ga0213875_10030738
1039 Ga0224712_10026130
1040 Ga0209566_100026
1041 Ga0209674_100001
1042 Ga0209672_100003
1043 Ga0209147_100309
1044 Ga0209563_100001
1045 Ga0209563_100320
1046 Ga0207427_100089
1047 Ga0209646_1000099
1048 Ga0209677_100001
1049 Ga0209677_100375
1050 Ga0209148_1000004
1051 Ga0209148_1001580
1052 Ga0209148_1001633
1053 Ga0209129_1000176
1054 Ga0209233_1000001
1055 Ga0209455_1000022
1056 Ga0209025_1000655
1057 Ga0209051_1004052
1058 Ga0209051_1010018
1059 Ga0207697_10010844
1060 Ga0207656_10000002
1061 Ga0207655_1005595
1062 Ga0207655_1005782
1063 Ga0207655_1008672
1064 Ga0207655_1019558
1065 Ga0207713_1034198
1066 Ga0207682_10034204
1067 Ga0207692_10007187
1068 Ga0207692_10072606
1069 Ga0207710_10000031
1070 Ga0207688_10034610
1071 Ga0207680_10203119
1072 Ga0207647_10053726
1073 Ga0207647_10083155
1074 Ga0207645_10010060
1075 Ga0207705_10000213
1076 Ga0207705_10266719
1077 Ga0207654_10000001
1078 Ga0207654_10064828
1079 Ga0207695_10002493
1080 Ga0207671_10000002
1081 Ga0207671_10119231
1082 Ga0207671_10135540
1083 Ga0207693_10005632
1084 Ga0207657_10010407
1085 Ga0207681_10304022
1086 Ga0207694_10000115
1087 Ga0207659_10068989
1088 Ga0207687_10050506
1089 Ga0207700_10157890
1090 Ga0207664_10005752
1091 Ga0207664_10221773
1092 Ga0207644_10009795
1093 Ga0207644_10086396
1094 Ga0207644_10108405
1095 Ga0207690_10001356
1096 Ga0207706_10109976
1097 Ga0207686_10030576
1098 Ga0207709_10008571
1099 Ga0207704_10148957
1100 Ga0207691_10005490
1101 Ga0207691_10293928
1102 Ga0207711_10000953
1103 Ga0207711_10008565
1104 Ga0207711_10011662
1105 Ga0207689_10005198
1106 Ga0207667_10000272
1107 Ga0207667_10006016
1108 Ga0207651_10009995
1109 Ga0207712_10016957
1110 Ga0207668_10027781
1111 Ga0207668_10027822
1112 Ga0207668_10128863
1113 Ga0207640_10027453
1114 Ga0207658_10004963
1115 Ga0207677_10004632
1116 Ga0207677_10010190
1117 Ga0207703_10000001
1118 Ga0207703_10000141
1119 Ga0207639_10016442
1120 Ga0207639_10173257
1121 Ga0207678_10001813
1122 Ga0207678_10004951
1123 Ga0207678_10018717
1124 Ga0207702_10277484
1125 Ga0207641_10229620
1126 Ga0207676_10172380
1127 Ga0207674_10001774
1128 Ga0207675_100095368
1129 Ga0207683_10000870
1130 Ga0207683_10009666
1131 Ga0207683_10215523
1132 Ga0207698_10000162
1133 Ga0207698_10013856
1134 Ga0207428_10016776
1135 Ga0268266_10012495
1136 Ga0268266_10238000
1137 Ga0268265_10173875
1138 Ga0268264_10031458
1139 Ga0265334_10001822
1140 Ga0307515_10187584
1141 Ga0265338_10050889
1142 Ga0307511_10004862
1143 Ga0307512_10017828
1144 Ga0316177_1008392
1145 Ga0265325_10068437
1146 Ga0265340_10011501
1147 Ga0307513_10270395
1148 Ga0307509_10158196
1149 Ga0307408_100011795
1150 Ga0307408_100013141
1151 Ga0307408_100018644
1152 Ga0307408_100030278
1153 Ga0307408_100033039
1154 Ga0307408_100212044
1155 Ga0307408_100297947
1156 Ga0307514_10002541
1157 Ga0307514_10006062
1158 Ga0316575_10004373
1159 Ga0316575_10063046
1160 Ga0316579_10036120
1161 Ga0316576_10151539
1162 Ga0316578_10079092
1163 Ga0307405_10001127
1164 Ga0307405_10008938
1165 Ga0307405_10045954
1166 Ga0307405_10066773
1167 Ga0307405_10130541
1168 Ga0307405_10187822
1169 Ga0307413_10018508
1170 Ga0307413_10019685
1171 Ga0307413_10025166
1172 Ga0307413_10037358
1173 Ga0307413_10056652
1174 Ga0307413_10057968
1175 Ga0307413_10065994
1176 Ga0307518_10000118
1177 Ga0307518_10080176
1178 Ga0307410_10000610
1179 Ga0307410_10001507
1180 Ga0307410_10003399
1181 Ga0307410_10019750
1182 Ga0307410_10028199
1183 Ga0307410_10033487
1184 Ga0307410_10041516
1185 Ga0307406_10000291
1186 Ga0307406_10001710
1187 Ga0307406_10005882
1188 Ga0307406_10025847
1189 Ga0307406_10068620
1190 Ga0307406_10103204
1191 Ga0307406_10259178
1192 Ga0307407_10012752
1193 Ga0307407_10050488
1194 Ga0307412_10006405
1195 Ga0307412_10006617
1196 Ga0307412_10011608
1197 Ga0307412_10012060
1198 Ga0307412_10016875
1199 Ga0307409_100006720
1200 Ga0307409_100090009
1201 Ga0307409_100100292
1202 Ga0307409_100121563
1203 Ga0307409_100137491
1204 Ga0307416_100001802
1205 Ga0307416_100007638
1206 Ga0307416_100014301
1207 Ga0307416_100048949
1208 Ga0307416_100076940
1209 Ga0307416_100077765
1210 Ga0307414_10003755
1211 Ga0307414_10007660
1212 Ga0307414_10066184
1213 Ga0307414_10134507
1214 Ga0307411_10001659
1215 Ga0307411_10004841
1216 Ga0307415_100059924
1217 Ga0307415_100195372
1218 Ga0307415_100200500
1219 Ga0316583_10001286
1220 Ga0316583_10026558
1221 Ga0316580_10001184
1222 Ga0307507_10007702
1223 Ga0307507_10016334
1224 Ga0373932_0012417
1225 Ga0373960_0009369
1226 Ga0373942_0013866
1227 Ga0316574_0003636
1228 Ga0316574_0007310
1229 Ga0316582_0187447
1230 Ga0316584_0001862
1231 Ga0395899_0015808
1232 Ga0395899_0069082
1233 Ga0395900_0012427
1234 Ga0395900_0157080
1235 Ga0395900_0382528
1236 Ga0395898_0000473
1237 Ga0395898_0023859
1238 Ga0395898_0048649
1239 Ga0395898_0063943
1240 Ga0395898_0156686
1241 Ga0395905_0015372
1242 Ga0316581_0000693
1243 Ga0436364_1296832
1244 Ga0395901_0005071
1245 Ga0395901_0014138
1246 Ga0395901_0015467
1247 Ga0395901_0029013
1248 Ga0395901_0035072
1249 Ga0395901_0081883
1250 Ga0395901_0165026
1251 Ga0395901_0168535
1252 Ga0439436_0001133
1253 Ga0439436_0003953
1254 Ga0439438_034365
1255 Ga0439439_0001046
1256 Ga0439461_0000851
1257 Ga0439466_0000106
1258 Ga0439466_0050298
1259 Ga0439465_0020183
1260 Ga0439433_0000182
1261 Ga0439433_0001171
1262 Ga0439433_0009700
1263 Ga0439442_000001
1264 Ga0439442_000094
1265 Ga0439442_002050
1266 Ga0439449_0000108
1267 Ga0439449_0008787
1268 Ga0439449_0020381
1269 Ga0439449_0029441
1270 Ga0439452_001202
1271 Ga0439457_002900
1272 Ga0439462_0001082
1273 Ga0450919_000229
1274 Ga0450920_000216
1275 Ga0450907_000562
1276 Ga0450907_005907
1277 Ga0439434_0000056
1278 Ga0439434_0004265
1279 Ga0439434_0004328
1280 Ga0450918_000178
1281 Ga0466969_0008896
1282 Ga0466972_0003731
1283 Ga0466972_0014668
1284 Ga0466972_0037196
1285 Ga0466972_0076858
1286 Ga0466965_0000009
1287 Ga0466965_0010802
1288 Ga0466965_0016108
1289 Ga0466965_0049058
1290 Ga0466961_0076601
1291 Ga0466961_0118716
1292 Ga0466968_0015933
1293 Ga0466968_0029774
1294 Ga0466968_0034654
1295 Ga0466968_0100089
1296 Ga0466970_0000106
1297 Ga0466970_0012825
1298 Ga0466970_0030132
1299 Ga0466970_0033464
1300 Ga0466970_0043247
1301 Ga0466970_0094156
1302 Ga0466970_0115063
1303 Ga0466970_0118785
1304 Ga0466970_0170579
1305 Ga0466957_0183506
1306 Ga0466957_0216416
1307 Ga0466960_0002504
1308 Ga0466960_0005117
1309 Ga0466959_0009825
1310 Ga0466959_0134577
1311 Ga0466958_0039067
1312 Ga0466967_0003086
1313 Ga0495627_001253
1314 Ga0495590_0000242
1315 Ga0495653_0003116
1316 Ga0495650_0001013
1317 Ga0495582_0071401
1318 Ga0495582_0110520
1319 Ga0495664_0007200
1320 Ga0495594_0008387
1321 Ga0495630_0270040
1322 Ga0495665_0026740
1323 Ga0495586_0002562
1324 Ga0495586_0009781
1325 Ga0495586_0048587
1326 Ga0495587_0002797
1327 Ga0495645_0000572
1328 Ga0495645_0002606
1329 Ga0495667_0075201
1330 Ga0495668_0103214
1331 Ga0495588_0002007
1332 Ga0495657_0011157
1333 Ga0495600_0007923
1334 Ga0495581_0014701
1335 Ga0495581_0033760
1336 Ga0495581_0036242
1337 Ga0495581_0038937
1338 Ga0495672_0005490
1339 Ga0495672_0056671
1340 Ga0495680_0046582
1341 Ga0495684_0201912
1342 Ga0495593_0013807
1343 Ga0496100_0002695
1344 Ga0496101_0015966
1345 Ga0496101_0016204
1346 Ga0496101_0111997
1347 Ga0496102_0000408
1348 Ga0496102_0034336
1349 Ga0496102_0145371
1350 Ga0496102_0298556
1351 Ga0496102_0435702
1352 Ga0496103_0000068
1353 Ga0496103_0004736
1354 Ga0496103_0013184
1355 Ga0496103_0023370
1356 Ga0496103_0024376
1357 Ga0496103_0028748
1358 Ga0496104_0011688
1359 Ga0496104_0016669
1360 Ga0496104_0028567
1361 Ga0496104_0052147
1362 Ga0496104_0062484
1363 Ga0496104_0087946
1364 Ga0496105_0006436
1365 Ga0496105_0020633
1366 Ga0496105_0044585
1367 Ga0496105_0066439
1368 Ga0496105_0094341
1369 Ga0496105_0171492
1370 Ga0496106_0075218
1371 Ga0496107_0179601
1372 Ga0496107_0190867
1373 Ga0496108_0022373
1374 Ga0496108_0084549
1375 Ga0496108_0104157
1376 Ga0496109_0035173
1377 Ga0496109_0114365
1378 Ga0496109_0114793
1379 Ga0496109_0287151
1380 Ga0496110_0023039
1381 Ga0496110_0027910
1382 Ga0496110_0034418
1383 Ga0496110_0078495
1384 Ga0496111_0023083
1385 Ga0496111_0049922
1386 Ga0496111_0203937
1387 Ga0496112_0027934
1388 Ga0496112_0030951
1389 Ga0496112_0031814
1390 Ga0496112_0090919
1391 Ga0496113_0100028
1392 Ga0496114_0008452
1393 Ga0496114_0023869
1394 Ga0496114_0039026
1395 Ga0496114_0042044
1396 Ga0496114_0151152
1397 Ga0496114_0180069
1398 Ga0496115_0011477
1399 Ga0496115_0023496
1400 Ga0496115_0033165
1401 Ga0496115_0105723
1402 Ga0496116_0000152
1403 Ga0496116_0008426
1404 Ga0496117_0000053
1405 Ga0496117_0000615
1406 Ga0496117_0000884
1407 Ga0496117_0001576
1408 Ga0496117_0005515
1409 Ga0496117_0156462
1410 Ga0496118_0001720
1411 Ga0496118_0004019
1412 Ga0496118_0080661
1413 Ga0496118_0131884
1414 Ga0496119_0002707
1415 Ga0496119_0003914
1416 Ga0496119_0004238
1417 Ga0496119_0005861
1418 Ga0496119_0015787
1419 Ga0496119_0019313
1420 Ga0496119_0019704
1421 Ga0496119_0044528
1422 Ga0496119_0052140
1423 Ga0496120_0000426
1424 Ga0496120_0001117
1425 Ga0496120_0002915
1426 Ga0496120_0004892
1427 Ga0496120_0010133
1428 Ga0496120_0024234
1429 Ga0496120_0032590
1430 Ga0496120_0033662
1431 Ga0496120_0043224
1432 Ga0496120_0085748
1433 Ga0496121_0000891
1434 Ga0496121_0021970
1435 Ga0496122_0000031
1436 Ga0496122_0000194
1437 Ga0496122_0014104
1438 Ga0496122_0019167
1439 Ga0496122_0031624
1440 Ga0496123_0000013
1441 Ga0496123_0000350
1442 Ga0496123_0000681
1443 Ga0496123_0062673
1444 Ga0496123_0120583
1445 Ga0496124_0003767
1446 Ga0496124_0004053
1447 Ga0496124_0008895
1448 Ga0496124_0020624
1449 Ga0496124_0022562
1450 Ga0496124_0027130
1451 Ga0496124_0071353
1452 Ga0496125_0000077
1453 Ga0496125_0017043
1454 Ga0496125_0020810
1455 Ga0496125_0022371
1456 Ga0496125_0029221
1457 Ga0496125_0045042
1458 Ga0496125_0066821
1459 Ga0496126_0001071
1460 Ga0496126_0014786
1461 Ga0496126_0015636
1462 Ga0496126_0044891
1463 Ga0496126_0046767
1464 Ga0496126_0065144
1465 Ga0496126_0125426
1466 Ga0501317_004320
1467 Ga0501031_0004368
1468 Ga0501032_0000407
1469 Ga0501032_0001556
1470 Ga0501032_0044841
1471 Ga0501033_0002659
1472 Ga0501033_0003000
1473 Ga0501033_0026246
1474 Ga0501033_0218791
1475 Ga0501033_0234027
1476 Ga0501034_0000051
1477 Ga0501034_0009471
1478 Ga0501034_0012979
1479 Ga0501034_0123262
1480 Ga0501034_0125558
1481 Ga0501034_0170959
1482 Ga0501034_0192471
1483 Ga0501034_0470729
1484 Ga0501036_0001633
1485 Ga0501036_0008562
1486 Ga0501037_0002752
1487 Ga0501038_0001166
1488 Ga0501038_0011688
1489 Ga0501038_0031268
1490 Ga0501038_0037307
1491 Ga0501038_0046616
1492 Ga0501038_0067627
1493 Ga0501038_0104621
1494 Ga0501038_0119097
1495 Ga0501039_0000287
1496 Ga0501039_0030904
1497 Ga0501039_0036106
1498 Ga0501039_0036234
1499 Ga0501039_0110768
1500 Ga0501042_0111215
1501 Ga0501043_0004673
1502 Ga0501043_0024971
1503 Ga0501043_0036081
1504 Ga0501043_0040866
1505 Ga0501043_0056599
1506 Ga0501043_0059257
1507 Ga0501043_0166676
1508 Ga0501046_0001394
1509 Ga0501046_0010495
1510 Ga0501046_0013854
1511 Ga0501047_0011806
1512 Ga0501047_0042644
1513 Ga0501047_0073102
1514 Ga0501047_0103344
1515 Ga0501048_0008296
1516 Ga0501048_0225880
1517 Ga0501068_0094082
1518 Ga0501069_0031136
1519 Ga0501070_0000100
1520 Ga0501070_0003131
1521 Ga0501070_0005309
1522 Ga0501070_0006307
1523 Ga0501070_0008918
1524 Ga0501070_0122487
1525 Ga0501071_0000167
1526 Ga0501073_0000223
1527 Ga0501073_0007116
1528 Ga0501073_0018072
1529 Ga0501080_0000083
1530 Ga0501080_0134879
1531 Ga0501083_0000031
1532 Ga0501083_0016779
1533 Ga0501035_0009248
1534 Ga0501035_0020033
1535 Ga0501044_0001905
1536 Ga0501044_0005242
1537 Ga0501044_0015200
1538 Ga0501044_0197739
1539 Ga0501044_0200763
1540 nmdc:mga00v17_144755_c1
1541 nmdc:mga00v17_203407_c1
1542 nmdc:mga00v17_23464_c1
1543 nmdc:mga00v17_24870_c1
1544 nmdc:mga00v17_75373_c1
1545 nmdc:mga0yw44_6157_c1
1546 nmdc:mga0yw44_98172_c1
1547 nmdc:mga06z11_47437_c1
1548 nmdc:mga07m45_62837_c1
1549 nmdc:mga09592_147895_c1
1550 nmdc:mga06r32_464786_c1
1551 nmdc:mga08x19_59847_c1
1552 nmdc:mga0sz30_10818_c1
1553 nmdc:mga0sz30_45661_c1
1554 Ga0495601_0037212
1555 Ga0500635_0000010
1556 Ga0500635_0027739
1557 Ga0495655_0004033
1558 Ga0495619_0028662
1559 Ga0500643_000072
1560 Ga0500651_0000194
1561 Ga0500650_0000328
1562 Ga0500556_0000001
1563 Ga0500556_0000086
1564 Ga0500562_000397
1565 Ga0500562_005543
1566 Ga0500593_005225
1567 Ga0500652_103382
1568 Ga0500655_002645
1569 Ga0500559_0000063
1570 Ga0500559_0003102
1571 Ga0500559_0004023
1572 Ga0500559_0010658
1573 Ga0500559_0058052
1574 Ga0500568_0000006
1575 Ga0500568_0000028
1576 Ga0500568_0000102
1577 Ga0500568_0009694
1578 Ga0500573_0000001
1579 Ga0500573_0004401
1580 Ga0500573_0037680
1581 Ga0500573_0046834
1582 Ga0500577_0076724
1583 Ga0500590_032099
1584 Ga0500616_0000078
1585 Ga0500616_0000427
1586 Ga0500620_000233
1587 Ga0500645_028229
1588 Ga0587072_003666
1589 2528202901
1590 2528213422
1591 2546947861
1592 2555231377
1593 2559429475
1594 2579749523
1595 2579855753
1596 2583150313
1597 2586058970
1598 2587863330
1599 2588108991
1600 2619857529
1601 2620353408
1602 2626635223
1603 2643733823
1604 2643753387
1605 2643785581
1606 2643848547
1607 2643875529
1608 2643885246
1609 2643996040
1610 2644095777
1611 2644170404
1612 2644183097
1613 2644198755
1614 2644277073
1615 2644382584
1616 2644679995
1617 2655033041
1618 2671839984
1619 2686535399
1620 2686542584
1621 2689990728
1622 2691514598
1623 2710602411
1624 2729908974
1625 2730229493
1626 2739602736
1627 2747951843
1628 2753070607
1629 2753301181
1630 2758225913
1631 2774380223
1632 2774384320
1633 2774399344
1634 2774858140
1635 2774864614
1636 2775655066
1637 2776371507
1638 2784471734
1639 2791910733
1640 2795783634
1641 2795794271
1642 2799185291
1643 2808631056
1644 2808827709
1645 2808853063
1646 2808878435
1647 2808885767
1648 2808897046
1649 2808901811
1650 2809592278
1651 2810364225
1652 2812320528
1653 2812323360
1654 2817508765
1655 2819426688
1656 2821270143
1657 2833711107
1658 2844842150
1659 2844849551
1660 2852645945
1661 2852647431
1662 2852665111
1663 2857481086
1664 2857634595
1665 2857720168
1666 2857723633
1667 2857727665
1668 2857730115
1669 2857733908
1670 2857737832
1671 2857741322
1672 2862995059
1673 2863070929
1674 2866552775
1675 2866616516
1676 2870624200
1677 2870630499
1678 2870726834
1679 2870802160
1680 2870806534
1681 2883824866
1682 2884765140
1683 2891326718
1684 2895887081
1685 2897564414
1686 2899362138
1687 2899372603
1688 2904430910
1689 2904499797
1690 2904503569
1691 2904511848
1692 2904776638
1693 2905927750
1694 2906800554
1695 2908675216
1696 2908680765
1697 2909075467
1698 2910814190
1699 2915769195
1700 2917743458
1701 2919036193
1702 2919039895
1703 2919045157
1704 2919057796
1705 2919061693
1706 2919071686
1707 2919391450
1708 2919396476
1709 2919446458
1710 2919524197
1711 2919542170
1712 2920882269
1713 2928092001
1714 2928108413
1715 2928123339
1716 2928155635
1717 2928501237
1718 2932429241
1719 2933420723
1720 2939598678
1721 2939648859
1722 2939658677
1723 2939662632
1724 2939676062
1725 2945918288
1726 2945921426
1727 2945942391
1728 2945971943
1729 2946005363
1730 2946026423
1731 2946033940
1732 2946038334
1733 2946044026
1734 2946062141
1735 2946081103
1736 2953999609
1737 2966925815
1738 2974297311
1739 2974306320
1740 2974326450
1741 2977231561
1742 2977236915
1743 2977254093
1744 2977266787
1745 2984545295
1746 2984553358
1747 2984581232
1748 2995727730
1749 637880972
1750 8002811783
1751 8003316203
1752 8004023469
1753 8004026448
1754 8004185304
1755 8016257400
1756 8045831731
1757 8046353103
1758 8047715479
1759 8054111028
1760 8054476767
1761 8054919773
1762 8054925864
1763 8055162946
1764 8056038954
1765 8056211875
1766 8057347864

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03054

tRNA_Me_trans

tRNA methyl transferase HUP domain

54

256

0.98

PF20259

tRNA_Me_trans_M

tRNA methyl transferase PRC-barrel domain

260

327

0.96

PF20258

tRNA_Me_trans_C

Aminomethyltransferase beta-barrel domain

333

410

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hma-assembly1.cif.gz_A-2 the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae 0.8821 1 359
2der-assembly1.cif.gz_A cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state 0.8745 1 360
2der-assembly1.cif.gz_A cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state 0.8558 1 360
2hma-assembly1.cif.gz_A-2 the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae 0.8523 1 359
2deu-assembly2.cif.gz_B cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state 0.8477 1 360
ID Description Score Start End Superfamily
af_P9WJS5_208_272_2.30.30.280 Mainly Beta;Roll;SH3 type barrels.;Adenine nucleotide alpha hydrolases-like domains 0.9453 210 269 2.30.30.280
af_O13947_324_410_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9412 272 355 2.40.30.10
af_P9WJS5_1_205_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9382 1 204 3.40.50.620
2derA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9212 1 182 3.40.50.620
af_O75648_300_387_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9137 272 355 2.40.30.10
ID Description Score Start End GO Terms
AF-I0R128-F1-model_v4 tRNA-uridine 2-sulfurtransferase (EC 2.8.1.13) 0.9735 49 358 GO:0000049
GO:0002143
GO:0005524
GO:0103016
AF-A0A4R9AZP6-F1-model_v4 tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) 0.9654 1 360 GO:0000049
GO:0002143
GO:0005524
GO:0005737
GO:0103016
AF-A0A4R9AZP6-F1-model_v4 tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) 0.9628 1 360 GO:0000049
GO:0002143
GO:0005524
GO:0005737
GO:0103016
AF-J7LWG0-F1-model_v4 deleted 0.9605 1 354
AF-I0R128-F1-model_v4 tRNA-uridine 2-sulfurtransferase (EC 2.8.1.13) 0.9583 49 358 GO:0000049
GO:0002143
GO:0005524
GO:0103016

Map