F484606

General Info

Members Datasets Scaffolds Average Seq Length
883 406 1766 269

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0160527|Ga0501071_0160527_588_1385
Length 265
Sequence MAQYEDFVRHVLENGVPKEDRTGTGTVSVFGYQMRFDLGAGFPLVTTKKVHFKSIAVELLWFLRGDSNVRWLQEQGVTIWDEWADADGELGPVYGVQWRSWPTPDGGHVDQIAEVVRLLREDPDSRRIVVSAWNVADIPRMALAPCHAFFQFHVGGGTRLSCQIYQRSADAFLGVPFNIASYALLTHMLAQQCDLEVGDLVWTGGDCHIYDNHREQVETLLGRDPFPYPSLRLTRRPPSIFDYAFEDFEVVGYEHHPAIRAPVAV

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
205 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
231 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
232 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
233 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
234 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
235 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
236 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
237 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
242 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
252 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
253 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
263 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
270 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
329 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
336 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
337 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
338 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
339 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
340 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
341 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
342 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
343 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
344 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
347 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
348 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
349 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
350 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
351 2643221546 Microbacterium sp. Root53 Isolate Unclassified
352 2643221553 Microbacterium sp. Root553 Isolate Unclassified
353 2643221616 Leifsonia sp. Root227 Isolate Unclassified
354 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
355 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
356 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
357 2643221660 Methylibium sp. Root1272 Isolate Unclassified
358 2643221679 Angustibacter sp. Root456 Isolate Unclassified
359 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
360 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
361 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
362 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
363 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
364 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
365 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
366 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
367 2808606372 Agromyces sp. 23-23 Isolate Unclassified
368 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
369 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
370 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
371 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
372 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
373 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
374 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
375 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
376 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
377 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
378 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
379 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
380 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
381 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
382 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
383 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
384 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
385 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
386 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
387 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
388 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
389 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
390 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
391 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
392 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
393 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
394 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
395 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
396 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
397 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
398 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
399 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
400 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
401 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
402 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
403 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
404 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
405 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
406 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.98
Metatranscriptomes 0.34
Isolates 6.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.13
Nodule 0.11
Rhizoplane 5.89
Rhizosphere 79.84
Stem 0
Stem Tuber 0.11
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0160527 3300049587 Bacteria 1680
2 MRS1b_contig_2095048 2162886011 Unclassified 919
3 LJQas_1000928 3300000549 Bacteria 4554
4 JGI24742J22300_10014285 3300002244 Bacteria 1334
5 JGI25164J39214_1000974 3300002772 Bacteria 9129
6 JGI25151J46595_10000156 3300003187 Bacteria 88722
7 JGI25165J46597_1000004 3300003214 Bacteria 667510
8 Ga0055527_1000001 3300003760 Bacteria 850044
9 Ga0055542_1009411 3300003762 Bacteria 1845
10 Ga0055529_1000019 3300003763 Bacteria 332786
11 Ga0055526_1000293 3300003771 Bacteria 41865
12 Ga0055540_1002727 3300003792 Bacteria 9079
13 Ga0055531_10000078 3300003794 Bacteria 105599
14 Ga0055531_10002166 3300003794 Bacteria 13420
15 Ga0065707_10228158 3300005295 Bacteria 1199
16 Ga0070658_10049549 3300005327 Bacteria 3403
17 Ga0070658_10080848 3300005327 Bacteria 2669
18 Ga0070658_10473109 3300005327 Bacteria 1081
19 Ga0070683_100089986 3300005329 Bacteria 2881
20 Ga0070683_100125566 3300005329 Bacteria 2426
21 Ga0070683_100421179 3300005329 Bacteria 1274
22 Ga0070690_100011765 3300005330 Bacteria 5130
23 Ga0070670_100150132 3300005331 Bacteria 2017
24 Ga0070677_10139964 3300005333 Bacteria 1115
25 Ga0068869_100087693 3300005334 Bacteria 2335
26 Ga0070666_10214394 3300005335 Bacteria 1357
27 Ga0070680_100005109 3300005336 Bacteria 9903
28 Ga0070680_100017277 3300005336 Bacteria 5685
29 Ga0070682_100002922 3300005337 Bacteria 9476
30 Ga0070682_100027069 3300005337 Bacteria 3438
31 Ga0070682_100032951 3300005337 Bacteria 3144
32 Ga0070682_100039128 3300005337 Bacteria 2912
33 Ga0070682_100042118 3300005337 Bacteria 2817
34 Ga0070682_100221705 3300005337 Viruses 1346
35 Ga0068868_100010275 3300005338 Bacteria 6769
36 Ga0068868_100052341 3300005338 Bacteria 3214
37 Ga0068868_100136638 3300005338 Bacteria 2010
38 Ga0070660_100004961 3300005339 Bacteria 9202
39 Ga0070660_100366557 3300005339 Bacteria 1188
40 Ga0070689_100022952 3300005340 Bacteria 4666
41 Ga0070689_100023186 3300005340 Bacteria 4644
42 Ga0070691_10158650 3300005341 Bacteria 1165
43 Ga0070661_100006246 3300005344 Bacteria 8219
44 Ga0070661_100008803 3300005344 Bacteria 6986
45 Ga0070661_100047421 3300005344 Bacteria 3144
46 Ga0070661_100252453 3300005344 Bacteria 1361
47 Ga0070692_10072857 3300005345 Bacteria 1834
48 Ga0070668_100004324 3300005347 Bacteria 10540
49 Ga0070669_100022894 3300005353 Bacteria 4469
50 Ga0070675_100114893 3300005354 Bacteria 2281
51 Ga0070675_100242529 3300005354 Bacteria 1575
52 Ga0070675_100329318 3300005354 Bacteria 1350
53 Ga0070671_100035374 3300005355 Bacteria 4138
54 Ga0070671_100044909 3300005355 Bacteria 3671
55 Ga0070671_100081797 3300005355 Bacteria 2700
56 Ga0070671_100129926 3300005355 Bacteria 2121
57 Ga0070674_100004266 3300005356 Bacteria 8133
58 Ga0070674_100067388 3300005356 Bacteria 2517
59 Ga0070674_100214348 3300005356 Bacteria 1494
60 Ga0070673_100076407 3300005364 Bacteria 2704
61 Ga0070673_100313496 3300005364 Bacteria 1384
62 Ga0070667_100000008 3300005367 Bacteria 285591
63 Ga0070667_100010404 3300005367 Bacteria 7678
64 Ga0070667_100192215 3300005367 Bacteria 1808
65 Ga0070714_100099982 3300005435 Bacteria 2554
66 Ga0070714_100579851 3300005435 Bacteria 1076
67 Ga0070701_10002941 3300005438 Bacteria 6650
68 Ga0070701_10025823 3300005438 Bacteria 2857
69 Ga0070701_10041361 3300005438 Bacteria 2348
70 Ga0070711_100206607 3300005439 Bacteria 1518
71 Ga0070711_100297100 3300005439 Bacteria 1283
72 Ga0070711_100403710 3300005439 Bacteria 1110
73 Ga0070705_100005615 3300005440 Bacteria 6121
74 Ga0070700_100013330 3300005441 Bacteria 4617
75 Ga0070700_100042777 3300005441 Bacteria 2783
76 Ga0070694_100037308 3300005444 Bacteria 3223
77 Ga0070663_100000355 3300005455 Bacteria 24103
78 Ga0070678_100016769 3300005456 Bacteria 4695
79 Ga0070678_100150478 3300005456 Bacteria 1874
80 Ga0070681_10002979 3300005458 Bacteria 15707
81 Ga0070681_10011372 3300005458 Bacteria 8806
82 Ga0070681_10061424 3300005458 Bacteria 3732
83 Ga0068867_100000062 3300005459 Bacteria 65188
84 Ga0068867_100000675 3300005459 Bacteria 22603
85 Ga0068867_100016982 3300005459 Bacteria 5172
86 Ga0068867_100018227 3300005459 Bacteria 4988
87 Ga0068867_100059364 3300005459 Bacteria 2836
88 Ga0070685_10146862 3300005466 Bacteria 1490
89 Ga0070685_10158865 3300005466 Bacteria 1439
90 Ga0070698_100220594 3300005471 Bacteria 1830
91 Ga0070679_100001081 3300005530 Bacteria 23804
92 Ga0070679_100004413 3300005530 Bacteria 13012
93 Ga0070684_100021170 3300005535 Bacteria 5405
94 Ga0070684_100131004 3300005535 Bacteria 2262
95 Ga0070684_100280975 3300005535 Bacteria 1525
96 Ga0068853_100019247 3300005539 Bacteria 5658
97 Ga0068853_100037636 3300005539 Bacteria 4117
98 Ga0068853_100047061 3300005539 Bacteria 3701
99 Ga0068853_100098424 3300005539 Bacteria 2583
100 Ga0070672_100032355 3300005543 Bacteria 3946
101 Ga0070672_100128402 3300005543 Bacteria 2081
102 Ga0070672_100212240 3300005543 Bacteria 1621
103 Ga0070672_100256899 3300005543 Bacteria 1473
104 Ga0070672_100259004 3300005543 Bacteria 1466
105 Ga0070672_100412910 3300005543 Bacteria 1158
106 Ga0070686_100011866 3300005544 Bacteria 4952
107 Ga0070695_100109718 3300005545 Bacteria 1870
108 Ga0070696_100000773 3300005546 Bacteria 20568
109 Ga0070693_100038455 3300005547 Bacteria 2674
110 Ga0070693_100074747 3300005547 Bacteria 2005
111 Ga0070665_100002002 3300005548 Bacteria 22928
112 Ga0070665_100004489 3300005548 Bacteria 14649
113 Ga0070704_100001401 3300005549 Bacteria 12837
114 Ga0068855_100009516 3300005563 Bacteria 11735
115 Ga0068855_100034076 3300005563 Bacteria 6075
116 Ga0070664_100033357 3300005564 Bacteria 4312
117 Ga0070664_100074127 3300005564 Bacteria 2921
118 Ga0068857_100032455 3300005577 Bacteria 4617
119 Ga0068854_100006057 3300005578 Bacteria 7667
120 Ga0068854_100067159 3300005578 Bacteria 2612
121 Ga0068854_100162915 3300005578 Bacteria 1729
122 Ga0068856_100053527 3300005614 Bacteria 3980
123 Ga0068856_100189944 3300005614 Bacteria 2068
124 Ga0068856_100216857 3300005614 Bacteria 1929
125 Ga0068856_100356838 3300005614 Bacteria 1481
126 Ga0070702_100001389 3300005615 Bacteria 9898
127 Ga0070702_100007685 3300005615 Bacteria 5174
128 Ga0070702_100228503 3300005615 Bacteria 1249
129 Ga0068852_100007382 3300005616 Bacteria 8021
130 Ga0068859_100001285 3300005617 Bacteria 25633
131 Ga0068859_100085198 3300005617 Bacteria 3205
132 Ga0068859_100178560 3300005617 Bacteria 2205
133 Ga0068859_100247261 3300005617 Bacteria 1873
134 Ga0068859_100320565 3300005617 Bacteria 1644
135 Ga0068859_100636357 3300005617 Bacteria 1159
136 Ga0068861_100032965 3300005719 Bacteria 3818
137 Ga0068861_100034550 3300005719 Bacteria 3739
138 Ga0068861_100093196 3300005719 Bacteria 2381
139 Ga0068861_100127803 3300005719 Bacteria 2059
140 Ga0068861_100403256 3300005719 Bacteria 1214
141 Ga0068863_100049842 3300005841 Bacteria 3970
142 Ga0068863_100549147 3300005841 Bacteria 1141
143 Ga0068858_100027232 3300005842 Bacteria 5311
144 Ga0068860_100054821 3300005843 Bacteria 3789
145 Ga0068860_100092759 3300005843 Bacteria 2877
146 Ga0068860_100396467 3300005843 Bacteria 1365
147 Ga0068862_100005211 3300005844 Bacteria 10923
148 Ga0068862_100038065 3300005844 Bacteria 4078
149 Ga0081455_10037738 3300005937 Bacteria 4285
150 Ga0075365_10081904 3300006038 Bacteria 2188
151 Ga0075363_100003316 3300006048 Bacteria 6824
152 Ga0075363_100274267 3300006048 Bacteria 975
153 Ga0075364_10000522 3300006051 Bacteria 19550
154 Ga0075364_10001885 3300006051 Bacteria 11651
155 Ga0075364_10039815 3300006051 Bacteria 3048
156 Ga0075364_10041738 3300006051 Bacteria 2979
157 Ga0075364_10059166 3300006051 Bacteria 2511
158 Ga0075364_10161499 3300006051 Bacteria 1512
159 Ga0075364_10196528 3300006051 Bacteria 1367
160 Ga0075432_10002065 3300006058 Bacteria 6678
161 Ga0070715_10090782 3300006163 Bacteria 1405
162 Ga0070712_100021643 3300006175 Bacteria 4226
163 Ga0075366_10083444 3300006195 Bacteria 1910
164 Ga0075366_10160404 3300006195 Bacteria 1363
165 Ga0097621_100023231 3300006237 Bacteria 4823
166 Ga0097621_100295486 3300006237 Bacteria 1429
167 Ga0075370_10000712 3300006353 Bacteria 13154
168 Ga0075370_10013593 3300006353 Bacteria 4332
169 Ga0068871_100022719 3300006358 Bacteria 4840
170 Ga0068871_100046838 3300006358 Bacteria 3484
171 Ga0068871_100398231 3300006358 Bacteria 1226
172 Ga0075428_100062670 3300006844 Bacteria 4070
173 Ga0075431_100080184 3300006847 Bacteria 3370
174 Ga0068865_100026457 3300006881 Bacteria 3825
175 Ga0068865_100053528 3300006881 Bacteria 2800
176 Ga0075436_100001954 3300006914 Bacteria 14208
177 Ga0097620_100001285 3300006931 Bacteria 25633
178 Ga0097620_100085195 3300006931 Bacteria 3205
179 Ga0097620_100178561 3300006931 Bacteria 2205
180 Ga0097620_100247270 3300006931 Bacteria 1873
181 Ga0097620_100320547 3300006931 Bacteria 1644
182 Ga0097620_100636428 3300006931 Bacteria 1159
183 Ga0105244_10007496 3300009036 Bacteria 6930
184 Ga0105240_10006132 3300009093 Bacteria 17731
185 Ga0105240_10012361 3300009093 Bacteria 11789
186 Ga0105240_10015317 3300009093 Bacteria 10431
187 Ga0105240_10196167 3300009093 Bacteria 2370
188 Ga0111539_10211181 3300009094 Bacteria 2262
189 Ga0111539_10212037 3300009094 Bacteria 2256
190 Ga0111539_10350694 3300009094 Bacteria 1718
191 Ga0105245_10007025 3300009098 Bacteria 9879
192 Ga0105245_10243298 3300009098 Bacteria 1745
193 Ga0105247_10001547 3300009101 Bacteria 16404
194 Ga0105247_10003369 3300009101 Bacteria 10455
195 Ga0105247_10013257 3300009101 Bacteria 4947
196 Ga0105247_10045532 3300009101 Bacteria 2692
197 Ga0114129_10037345 3300009147 Bacteria 6859
198 Ga0114129_10093003 3300009147 Bacteria 4178
199 Ga0114129_10149653 3300009147 Bacteria 3195
200 Ga0114129_10558531 3300009147 Bacteria 1488
201 Ga0105243_10002846 3300009148 Bacteria 14356
202 Ga0105243_10032381 3300009148 Bacteria 4039
203 Ga0105243_10130275 3300009148 Bacteria 2133
204 Ga0105243_10213831 3300009148 Bacteria 1699
205 Ga0105243_10316223 3300009148 Bacteria 1421
206 Ga0105243_10349658 3300009148 Bacteria 1357
207 Ga0105241_10015631 3300009174 Bacteria 5561
208 Ga0105242_10005276 3300009176 Bacteria 9978
209 Ga0105248_10024774 3300009177 Bacteria 6673
210 Ga0105248_10067887 3300009177 Bacteria 4003
211 Ga0105237_10005469 3300009545 Bacteria 14334
212 Ga0105237_10008525 3300009545 Bacteria 11083
213 Ga0105237_10016653 3300009545 Bacteria 7635
214 Ga0105237_10107336 3300009545 Bacteria 2784
215 Ga0105237_10155191 3300009545 Bacteria 2286
216 Ga0105238_10056195 3300009551 Bacteria 3949
217 Ga0105249_10001615 3300009553 Bacteria 19734
218 Ga0105249_10182421 3300009553 Bacteria 2043
219 Ga0105249_10617884 3300009553 Bacteria 1139
220 Ga0105239_10012611 3300010375 Bacteria 9405
221 Ga0105239_10029163 3300010375 Bacteria 6066
222 Ga0105239_10038886 3300010375 Bacteria 5212
223 Ga0105239_10075481 3300010375 Bacteria 3707
224 Ga0105239_10235805 3300010375 Bacteria 2053
225 Ga0105246_10002960 3300011119 Bacteria 10295
226 Ga0105246_10115557 3300011119 Bacteria 1979
227 Ga0105246_10181510 3300011119 Bacteria 1621
228 Ga0157373_10194599 3300013100 Bacteria 1429
229 Ga0157371_10047597 3300013102 Bacteria 3049
230 Ga0157371_10151000 3300013102 Bacteria 1657
231 Ga0157369_10004228 3300013105 Bacteria 17006
232 Ga0157369_10088461 3300013105 Bacteria 3306
233 Ga0157369_10167091 3300013105 Bacteria 2320
234 Ga0157369_10405524 3300013105 Bacteria 1414
235 Ga0157374_10006773 3300013296 Bacteria 9742
236 Ga0157374_10014955 3300013296 Bacteria 6800
237 Ga0157374_10054338 3300013296 Bacteria 3736
238 Ga0157374_10187661 3300013296 Bacteria 2022
239 Ga0157378_10013225 3300013297 Bacteria 7216
240 Ga0157378_10065174 3300013297 Bacteria 3260
241 Ga0157378_10244783 3300013297 Bacteria 1715
242 Ga0163162_10010063 3300013306 Bacteria 9195
243 Ga0163162_10052990 3300013306 Bacteria 4077
244 Ga0163162_10125176 3300013306 Bacteria 2676
245 Ga0163162_10171681 3300013306 Bacteria 2293
246 Ga0163162_10831317 3300013306 Bacteria 1040
247 Ga0157372_10006463 3300013307 Bacteria 12479
248 Ga0157372_10043580 3300013307 Bacteria 4968
249 Ga0157372_10138304 3300013307 Bacteria 2805
250 Ga0157372_10164748 3300013307 Bacteria 2563
251 Ga0157372_10387090 3300013307 Bacteria 1629
252 Ga0157375_10009390 3300013308 Bacteria 8586
253 Ga0157375_10011713 3300013308 Bacteria 7751
254 Ga0157375_10091545 3300013308 Bacteria 3103
255 Ga0157375_10267273 3300013308 Bacteria 1872
256 Ga0157375_10532289 3300013308 Bacteria 1338
257 Ga0157375_10958873 3300013308 Bacteria 997
258 Ga0163163_10102409 3300014325 Bacteria 2887
259 Ga0157380_10002734 3300014326 Bacteria 11979
260 Ga0157380_10046254 3300014326 Bacteria 3417
261 Ga0157380_10048707 3300014326 Bacteria 3339
262 Ga0157380_10176264 3300014326 Bacteria 1874
263 Ga0157380_10263625 3300014326 Bacteria 1566
264 Ga0157380_10355125 3300014326 Bacteria 1373
265 Ga0157380_10572866 3300014326 Bacteria 1112
266 Ga0157380_10874733 3300014326 Bacteria 922
267 Ga0157379_10030835 3300014968 Bacteria 4775
268 Ga0157379_10034941 3300014968 Bacteria 4481
269 Ga0157379_10149067 3300014968 Bacteria 2110
270 Ga0157376_10006548 3300014969 Bacteria 8241
271 Ga0157376_10417558 3300014969 Bacteria 1301
272 Ga0157376_10423457 3300014969 Bacteria 1293
273 Ga0163161_10004372 3300017792 Bacteria 9850
274 Ga0163161_10134521 3300017792 Bacteria 1868
275 Ga0163161_10177895 3300017792 Bacteria 1629
276 Ga0206356_10016337 3300020070 Bacteria 2524
277 Ga0206356_10536592 3300020070 Bacteria 1458
278 Ga0206353_10861374 3300020082 Bacteria 5391
279 Ga0213872_10000074 3300021361 Bacteria 90986
280 Ga0213872_10000409 3300021361 Bacteria 35220
281 Ga0209672_100006 3300025228 Bacteria 1004497
282 Ga0209147_100699 3300025229 Bacteria 17130
283 Ga0207427_100010 3300025231 Bacteria 648610
284 Ga0209437_100216 3300025233 Bacteria 106353
285 Ga0209258_101354 3300025242 Bacteria 8916
286 Ga0207425_1000158 3300025245 Bacteria 57310
287 Ga0209148_1000015 3300025254 Bacteria 850103
288 Ga0209148_1003211 3300025254 Bacteria 4682
289 Ga0209129_1000169 3300025258 Bacteria 96253
290 Ga0209233_1000001 3300025261 Bacteria 2992747
291 Ga0209455_1000013 3300025272 Bacteria 850103
292 Ga0209673_1006885 3300025273 Bacteria 5384
293 Ga0209025_1000019 3300025294 Bacteria 631548
294 Ga0209564_1000057 3300025295 Bacteria 340400
295 Ga0209758_1000461 3300025297 Bacteria 67480
296 Ga0209758_1001104 3300025297 Bacteria 34835
297 Ga0209050_1009414 3300025298 Bacteria 5004
298 Ga0209051_1000136 3300025303 Bacteria 138015
299 Ga0209051_1009285 3300025303 Bacteria 5083
300 Ga0209257_1000032 3300025304 Bacteria 680354
301 Ga0209257_1000055 3300025304 Bacteria 415534
302 Ga0207697_10016969 3300025315 Bacteria 2994
303 Ga0207655_1092409 3300025728 Bacteria 1062
304 Ga0207692_10023134 3300025898 Bacteria 2870
305 Ga0207710_10004119 3300025900 Bacteria 6387
306 Ga0207710_10006561 3300025900 Bacteria 4960
307 Ga0207680_10012655 3300025903 Bacteria 4306
308 Ga0207680_10078937 3300025903 Bacteria 2063
309 Ga0207647_10014906 3300025904 Bacteria 5342
310 Ga0207647_10017033 3300025904 Bacteria 4947
311 Ga0207647_10045604 3300025904 Bacteria 2734
312 Ga0207685_10010204 3300025905 Bacteria 2762
313 Ga0207699_10090585 3300025906 Bacteria 1919
314 Ga0207645_10055143 3300025907 Bacteria 2538
315 Ga0207643_10123455 3300025908 Bacteria 1536
316 Ga0207705_10134850 3300025909 Bacteria 1840
317 Ga0207705_10209896 3300025909 Bacteria 1477
318 Ga0207707_10014181 3300025912 Bacteria 6943
319 Ga0207707_10036847 3300025912 Bacteria 4274
320 Ga0207707_10057360 3300025912 Bacteria 3389
321 Ga0207707_10331329 3300025912 Bacteria 1313
322 Ga0207695_10012431 3300025913 Bacteria 10221
323 Ga0207695_10017318 3300025913 Bacteria 8389
324 Ga0207695_10149008 3300025913 Bacteria 2280
325 Ga0207695_10246561 3300025913 Bacteria 1686
326 Ga0207671_10000298 3300025914 Bacteria 73044
327 Ga0207671_10000531 3300025914 Bacteria 51420
328 Ga0207671_10009743 3300025914 Bacteria 7997
329 Ga0207671_10065482 3300025914 Bacteria 2703
330 Ga0207663_10000354 3300025916 Bacteria 19988
331 Ga0207660_10052066 3300025917 Bacteria 2913
332 Ga0207660_10296353 3300025917 Bacteria 1287
333 Ga0207660_10304181 3300025917 Bacteria 1270
334 Ga0207662_10048350 3300025918 Bacteria 2520
335 Ga0207657_10009492 3300025919 Bacteria 9774
336 Ga0207649_10007727 3300025920 Bacteria 5850
337 Ga0207649_10059727 3300025920 Bacteria 2393
338 Ga0207649_10062939 3300025920 Bacteria 2340
339 Ga0207652_10024066 3300025921 Bacteria 5051
340 Ga0207652_10028517 3300025921 Bacteria 4658
341 Ga0207652_10260757 3300025921 Bacteria 1563
342 Ga0207681_10204777 3300025923 Bacteria 1517
343 Ga0207694_10132563 3300025924 Bacteria 1998
344 Ga0207659_10101311 3300025926 Bacteria 2172
345 Ga0207659_10171194 3300025926 Bacteria 1713
346 Ga0207659_10179176 3300025926 Bacteria 1677
347 Ga0207687_10003626 3300025927 Bacteria 10404
348 Ga0207687_10291522 3300025927 Bacteria 1311
349 Ga0207644_10046203 3300025931 Bacteria 3101
350 Ga0207644_10120084 3300025931 Bacteria 2000
351 Ga0207644_10289394 3300025931 Bacteria 1317
352 Ga0207690_10043829 3300025932 Bacteria 2946
353 Ga0207690_10230557 3300025932 Bacteria 1421
354 Ga0207706_10005428 3300025933 Bacteria 11881
355 Ga0207709_10000015 3300025935 Bacteria 493221
356 Ga0207709_10039670 3300025935 Bacteria 2814
357 Ga0207709_10090315 3300025935 Bacteria 2000
358 Ga0207709_10108931 3300025935 Bacteria 1848
359 Ga0207709_10151848 3300025935 Bacteria 1605
360 Ga0207709_10211734 3300025935 Bacteria 1392
361 Ga0207709_10347609 3300025935 Bacteria 1118
362 Ga0207670_10056413 3300025936 Bacteria 2659
363 Ga0207669_10089918 3300025937 Bacteria 1995
364 Ga0207669_10401761 3300025937 Bacteria 1073
365 Ga0207704_10017638 3300025938 Bacteria 3707
366 Ga0207691_10000649 3300025940 Bacteria 34369
367 Ga0207691_10044818 3300025940 Bacteria 4070
368 Ga0207691_10091498 3300025940 Bacteria 2726
369 Ga0207691_10408426 3300025940 Bacteria 1158
370 Ga0207711_10037926 3300025941 Bacteria 4096
371 Ga0207689_10071436 3300025942 Bacteria 2851
372 Ga0207689_10118624 3300025942 Bacteria 2176
373 Ga0207661_10001700 3300025944 Bacteria 15014
374 Ga0207661_10107336 3300025944 Bacteria 2355
375 Ga0207661_10160298 3300025944 Bacteria 1951
376 Ga0207661_10540949 3300025944 Bacteria 1066
377 Ga0207679_10058180 3300025945 Bacteria 2863
378 Ga0207679_10081258 3300025945 Bacteria 2478
379 Ga0207667_10257789 3300025949 Bacteria 1783
380 Ga0207651_10008075 3300025960 Bacteria 5653
381 Ga0207651_10319701 3300025960 Bacteria 1297
382 Ga0207651_10377601 3300025960 Bacteria 1200
383 Ga0207712_10154929 3300025961 Bacteria 1774
384 Ga0207712_10508790 3300025961 Bacteria 1030
385 Ga0207640_10006698 3300025981 Bacteria 6329
386 Ga0207640_10020142 3300025981 Bacteria 3956
387 Ga0207658_10000030 3300025986 Bacteria 168693
388 Ga0207658_10023960 3300025986 Bacteria 4265
389 Ga0207658_10130242 3300025986 Bacteria 2020
390 Ga0207658_10409862 3300025986 Bacteria 1193
391 Ga0207677_10004032 3300026023 Bacteria 7841
392 Ga0207677_10106932 3300026023 Bacteria 2074
393 Ga0207677_10229822 3300026023 Bacteria 1493
394 Ga0207639_10162456 3300026041 Bacteria 1883
395 Ga0207639_10226107 3300026041 Bacteria 1619
396 Ga0207678_10001274 3300026067 Bacteria 23306
397 Ga0207678_10527791 3300026067 Bacteria 1031
398 Ga0207708_10003996 3300026075 Bacteria 10851
399 Ga0207708_10022120 3300026075 Bacteria 4802
400 Ga0207708_10154181 3300026075 Bacteria 1811
401 Ga0207708_10201076 3300026075 Bacteria 1590
402 Ga0207702_10001783 3300026078 Bacteria 21204
403 Ga0207702_10036365 3300026078 Bacteria 4119
404 Ga0207702_10212942 3300026078 Bacteria 1797
405 Ga0207641_10002088 3300026088 Bacteria 18922
406 Ga0207641_10421546 3300026088 Bacteria 1285
407 Ga0207648_10000308 3300026089 Bacteria 53542
408 Ga0207648_10011691 3300026089 Bacteria 8260
409 Ga0207648_10039040 3300026089 Bacteria 4176
410 Ga0207648_10062502 3300026089 Bacteria 3246
411 Ga0207648_10269309 3300026089 Bacteria 1521
412 Ga0207676_10509248 3300026095 Bacteria 1144
413 Ga0207674_10013815 3300026116 Bacteria 8933
414 Ga0207674_10063688 3300026116 Bacteria 3721
415 Ga0207675_100019521 3300026118 Bacteria 6326
416 Ga0207675_100037495 3300026118 Bacteria 4521
417 Ga0207675_100109812 3300026118 Bacteria 2602
418 Ga0207683_10026364 3300026121 Bacteria 5016
419 Ga0207683_10257665 3300026121 Bacteria 1593
420 Ga0207698_10012402 3300026142 Bacteria 5575
421 Ga0209974_10019930 3300027876 Bacteria 2223
422 Ga0268266_10003633 3300028379 Bacteria 15260
423 Ga0268266_10003842 3300028379 Bacteria 14665
424 Ga0268266_10020043 3300028379 Bacteria 5700
425 Ga0268266_10042458 3300028379 Bacteria 3884
426 Ga0268266_10090247 3300028379 Bacteria 2686
427 Ga0268265_10023681 3300028380 Bacteria 4332
428 Ga0268265_10099463 3300028380 Bacteria 2345
429 Ga0268265_10245461 3300028380 Bacteria 1582
430 Ga0268264_10113523 3300028381 Bacteria 2377
431 Ga0265337_1006251 3300028556 Bacteria 4619
432 Ga0265334_10044564 3300028573 Bacteria 1722
433 Ga0307515_10000469 3300028794 Bacteria 96345
434 Ga0307515_10000902 3300028794 Bacteria 68371
435 Ga0307515_10001683 3300028794 Bacteria 49294
436 Ga0307515_10023814 3300028794 Bacteria 10705
437 Ga0307515_10066900 3300028794 Bacteria 4967
438 Ga0265338_10012629 3300028800 Bacteria 9617
439 Ga0307512_10182329 3300030522 Bacteria 1177
440 Ga0265332_10009134 3300031238 Bacteria 4433
441 Ga0265327_10000006 3300031251 Bacteria 693716
442 Ga0307513_10009513 3300031456 Bacteria 12291
443 Ga0307513_10013150 3300031456 Bacteria 10171
444 Ga0307513_10040324 3300031456 Bacteria 5165
445 Ga0307513_10143501 3300031456 Bacteria 2309
446 Ga0307509_10469293 3300031507 Bacteria 949
447 Ga0307408_100031909 3300031548 Bacteria 3670
448 Ga0307408_100039139 3300031548 Bacteria 3349
449 Ga0307408_100075319 3300031548 Bacteria 2507
450 Ga0307408_100425666 3300031548 Bacteria 1146
451 Ga0307408_100563352 3300031548 Bacteria 1007
452 Ga0265314_10001118 3300031711 Bacteria 30992
453 Ga0316576_10003801 3300031727 Bacteria 8930
454 Ga0316576_10007014 3300031727 Bacteria 7053
455 Ga0316578_10151641 3300031728 Bacteria 1396
456 Ga0307405_10027682 3300031731 Bacteria 3291
457 Ga0307405_10061776 3300031731 Bacteria 2369
458 Ga0307405_10124955 3300031731 Bacteria 1767
459 Ga0307405_10244355 3300031731 Bacteria 1331
460 Ga0316577_10250444 3300031733 Bacteria 1002
461 Ga0307413_10010467 3300031824 Bacteria 4501
462 Ga0307413_10019310 3300031824 Bacteria 3598
463 Ga0307413_10085244 3300031824 Bacteria 2039
464 Ga0307413_10085932 3300031824 Bacteria 2033
465 Ga0307413_10148021 3300031824 Bacteria 1632
466 Ga0307410_10003842 3300031852 Bacteria 7632
467 Ga0307410_10008303 3300031852 Bacteria 5753
468 Ga0307410_10016794 3300031852 Bacteria 4376
469 Ga0307410_10061993 3300031852 Bacteria 2561
470 Ga0307410_10074718 3300031852 Bacteria 2361
471 Ga0307410_10631706 3300031852 Bacteria 896
472 Ga0307406_10000263 3300031901 Bacteria 31677
473 Ga0307406_10018481 3300031901 Bacteria 4074
474 Ga0307406_10122421 3300031901 Bacteria 1811
475 Ga0307407_10136041 3300031903 Bacteria 1579
476 Ga0307412_10008293 3300031911 Bacteria 5922
477 Ga0307412_10010075 3300031911 Bacteria 5436
478 Ga0307412_10011134 3300031911 Bacteria 5202
479 Ga0307412_10181761 3300031911 Bacteria 1582
480 Ga0307409_100024429 3300031995 Bacteria 4214
481 Ga0307409_100029498 3300031995 Bacteria 3927
482 Ga0307409_100066905 3300031995 Bacteria 2835
483 Ga0307409_100478094 3300031995 Bacteria 1208
484 Ga0307416_100022095 3300032002 Bacteria 4583
485 Ga0307416_100024457 3300032002 Bacteria 4410
486 Ga0307416_100094063 3300032002 Bacteria 2583
487 Ga0307416_100134059 3300032002 Bacteria 2236
488 Ga0307416_100151995 3300032002 Bacteria 2124
489 Ga0307416_100165595 3300032002 Bacteria 2050
490 Ga0307416_100279004 3300032002 Bacteria 1646
491 Ga0307414_10009829 3300032004 Bacteria 5516
492 Ga0307414_10594131 3300032004 Bacteria 992
493 Ga0307415_100066941 3300032126 Bacteria 2509
494 Ga0307415_100164484 3300032126 Bacteria 1724
495 Ga0307415_100167014 3300032126 Bacteria 1712
496 Ga0307415_100204068 3300032126 Bacteria 1571
497 Ga0307510_10026590 3300033180 Bacteria 6647
498 Ga0307510_10214430 3300033180 Bacteria 1444
499 Ga0316574_0003199 3300035398 Bacteria 8387
500 Ga0316574_0010713 3300035398 Bacteria 5191
501 Ga0316574_0012049 3300035398 Bacteria 4935
502 Ga0316574_0014079 3300035398 Bacteria 4614
503 Ga0316574_0022777 3300035398 Bacteria 3735
504 Ga0316574_0028264 3300035398 Bacteria 3381
505 Ga0316574_0051034 3300035398 Bacteria 2577
506 Ga0373931_0048290 3300035691 Bacteria 2256
507 Ga0316582_0308537 3300036647 Bacteria 1088
508 Ga0316584_0012638 3300036712 Bacteria 5956
509 Ga0316584_0076136 3300036712 Bacteria 2514
510 Ga0316584_0176109 3300036712 Bacteria 1585
511 Ga0316584_0319696 3300036712 Bacteria 1120
512 Ga0395899_0000006 3300037312 Bacteria 666341
513 Ga0395899_0033199 3300037312 Bacteria 3877
514 Ga0395899_0068763 3300037312 Bacteria 2596
515 Ga0395900_0000378 3300037418 Bacteria 64374
516 Ga0395900_0000774 3300037418 Bacteria 42584
517 Ga0395900_0010538 3300037418 Bacteria 9456
518 Ga0395900_0012591 3300037418 Bacteria 8654
519 Ga0395900_0032840 3300037418 Bacteria 5338
520 Ga0395900_0071874 3300037418 Bacteria 3557
521 Ga0395900_0301695 3300037418 Bacteria 1588
522 Ga0395900_0386464 3300037418 Bacteria 1366
523 Ga0395898_0000015 3300037466 Bacteria 439819
524 Ga0395898_0009381 3300037466 Bacteria 10277
525 Ga0395898_0013268 3300037466 Bacteria 8487
526 Ga0395898_0183554 3300037466 Bacteria 1999
527 Ga0395898_0519631 3300037466 Bacteria 1132
528 Ga0395905_0005120 3300037471 Bacteria 13467
529 Ga0395905_0071188 3300037471 Bacteria 3260
530 Ga0395905_0093212 3300037471 Bacteria 2824
531 Ga0395905_0204943 3300037471 Bacteria 1849
532 Ga0395905_0205552 3300037471 Bacteria 1845
533 Ga0395905_0294667 3300037471 Bacteria 1509
534 Ga0395905_0315639 3300037471 Bacteria 1452
535 Ga0395901_0022015 3300038443 Bacteria 6533
536 Ga0395901_0117043 3300038443 Bacteria 2800
537 Ga0395901_0190305 3300038443 Bacteria 2152
538 Ga0395901_0247183 3300038443 Bacteria 1859
539 Ga0395901_0302510 3300038443 Bacteria 1658
540 Ga0436361_0082864 3300039447 Bacteria 107951
541 Ga0436361_0507289 3300039447 Bacteria 4197
542 Ga0436361_0554943 3300039447 Bacteria 41374
543 Ga0436361_0632651 3300039447 Bacteria 49929
544 Ga0436361_0703210 3300039447 Bacteria 30399
545 Ga0436361_0939166 3300039447 Bacteria 85026
546 Ga0439466_0006490 3300041411 Bacteria 4445
547 Ga0439466_0015492 3300041411 Bacteria 2768
548 Ga0439466_0027865 3300041411 Bacteria 1954
549 Ga0439465_0000389 3300041413 Bacteria 12717
550 Ga0439465_0002292 3300041413 Bacteria 6284
551 Ga0439465_0010657 3300041413 Bacteria 2885
552 Ga0439465_0040528 3300041413 Bacteria 1505
553 Ga0451793_1258867 3300041452 Bacteria 1799
554 Ga0451798_0349143 3300041458 Bacteria 1050
555 Ga0451837_0927302 3300041494 Bacteria 2473
556 Ga0439431_0004103 3300041997 Bacteria 3204
557 Ga0439433_0003863 3300041999 Bacteria 3222
558 Ga0439442_000527 3300042002 Bacteria 8486
559 Ga0439442_012156 3300042002 Bacteria 1758
560 Ga0439442_012287 3300042002 Bacteria 1749
561 Ga0439442_023952 3300042002 Bacteria 1269
562 Ga0439445_0012253 3300042004 Bacteria 2058
563 Ga0439449_0000164 3300042007 Bacteria 22799
564 Ga0439449_0043085 3300042007 Bacteria 1676
565 Ga0439452_038971 3300042010 Bacteria 1126
566 Ga0439457_003181 3300042014 Bacteria 4522
567 Ga0439462_0030965 3300042015 Bacteria 1416
568 Ga0450917_000828 3300042120 Bacteria 2278
569 Ga0439434_0003103 3300042435 Bacteria 4878
570 Ga0439434_0005703 3300042435 Bacteria 3635
571 Ga0439434_0009319 3300042435 Bacteria 2884
572 Ga0451577_0002513 3300042876 Bacteria 21729
573 Ga0451577_0014967 3300042876 Bacteria 7220
574 Ga0466969_0000907 3300044656 Bacteria 16021
575 Ga0466969_0066399 3300044656 Bacteria 1741
576 Ga0466972_0000621 3300044658 Bacteria 17291
577 Ga0466972_0108596 3300044658 Bacteria 1311
578 Ga0466975_0058573 3300044661 Bacteria 2749
579 Ga0466965_0019432 3300044683 Bacteria 3261
580 Ga0466965_0025746 3300044683 Bacteria 2849
581 Ga0466965_0031866 3300044683 Bacteria 2573
582 Ga0466965_0223275 3300044683 Bacteria 1004
583 Ga0466966_0010499 3300044684 Bacteria 6153
584 Ga0466966_0014910 3300044684 Bacteria 5143
585 Ga0466961_0001812 3300044693 Bacteria 13246
586 Ga0466963_0060835 3300044694 Bacteria 2523
587 Ga0466971_0071938 3300044719 Bacteria 1570
588 Ga0466971_0140610 3300044719 Bacteria 1124
589 Ga0466968_0109006 3300044735 Bacteria 1243
590 Ga0466970_0000146 3300044765 Bacteria 32667
591 Ga0466970_0094723 3300044765 Bacteria 1622
592 Ga0466970_0124513 3300044765 Bacteria 1413
593 Ga0466970_0174860 3300044765 Bacteria 1190
594 Ga0466957_0259190 3300044842 Bacteria 1158
595 Ga0466960_0018489 3300044901 Bacteria 3056
596 Ga0466960_0026202 3300044901 Bacteria 2646
597 Ga0466959_0000098 3300045049 Bacteria 55148
598 Ga0466959_0000102 3300045049 Bacteria 54850
599 Ga0466959_0091898 3300045049 Bacteria 2179
600 Ga0466959_0345613 3300045049 Bacteria 1015
601 Ga0451576_0000862 3300045051 Bacteria 58528
602 Ga0466958_0016108 3300045836 Bacteria 4300
603 Ga0466958_0024823 3300045836 Bacteria 3528
604 Ga0466967_0029601 3300045976 Bacteria 4585
605 Ga0466967_0233271 3300045976 Bacteria 1753
606 Ga0466967_0457875 3300045976 Bacteria 1247
607 Ga0495638_0009388 3300046460 Bacteria 6876
608 Ga0495638_0020374 3300046460 Bacteria 4383
609 Ga0495641_0110487 3300046461 Bacteria 1227
610 Ga0495620_0034401 3300046515 Bacteria 2290
611 Ga0495621_0045623 3300046539 Bacteria 1553
612 Ga0495645_0115300 3300046543 Bacteria 1898
613 Ga0495656_0031620 3300046615 Bacteria 2149
614 Ga0495668_0090608 3300046616 Bacteria 1676
615 Ga0495668_0231014 3300046616 Bacteria 1013
616 Ga0495625_0008483 3300046660 Bacteria 8766
617 Ga0495625_0121914 3300046660 Bacteria 1773
618 Ga0495670_0094684 3300046691 Bacteria 1532
619 Ga0495649_0144092 3300046694 Bacteria 1253
620 Ga0495681_0137939 3300047470 Bacteria 1033
621 Ga0495686_0067472 3300047472 Bacteria 2208
622 Ga0495615_0004505 3300048090 Bacteria 2437
623 Ga0495626_0056494 3300048091 Bacteria 1797
624 Ga0496100_0007899 3300048903 Bacteria 5909
625 Ga0496101_0092767 3300048904 Bacteria 2249
626 Ga0496102_0000062 3300048905 Bacteria 165967
627 Ga0496102_0035590 3300048905 Bacteria 4482
628 Ga0496102_0046319 3300048905 Bacteria 3949
629 Ga0496102_0069524 3300048905 Bacteria 3232
630 Ga0496102_0091413 3300048905 Bacteria 2817
631 Ga0496102_0106309 3300048905 Bacteria 2612
632 Ga0496102_0231786 3300048905 Bacteria 1741
633 Ga0496103_0000073 3300048906 Bacteria 118430
634 Ga0496103_0001937 3300048906 Bacteria 13411
635 Ga0496103_0180154 3300048906 Bacteria 1358
636 Ga0496104_0007030 3300048907 Bacteria 9925
637 Ga0496104_0050527 3300048907 Bacteria 3923
638 Ga0496104_0059485 3300048907 Bacteria 3618
639 Ga0496105_0025022 3300048908 Bacteria 4853
640 Ga0496105_0094126 3300048908 Bacteria 2474
641 Ga0496105_0212352 3300048908 Bacteria 1577
642 Ga0496105_0328982 3300048908 Bacteria 1223
643 Ga0496106_0007098 3300048909 Bacteria 8279
644 Ga0496107_0004432 3300048910 Bacteria 9512
645 Ga0496107_0031928 3300048910 Bacteria 3761
646 Ga0496107_0033057 3300048910 Bacteria 3700
647 Ga0496108_0005584 3300048911 Bacteria 10175
648 Ga0496108_0121770 3300048911 Bacteria 2238
649 Ga0496108_0188504 3300048911 Bacteria 1787
650 Ga0496109_0001477 3300048912 Bacteria 19508
651 Ga0496111_0015488 3300048914 Bacteria 5236
652 Ga0496111_0036377 3300048914 Bacteria 3519
653 Ga0496111_0164669 3300048914 Bacteria 1647
654 Ga0496112_0003172 3300048915 Bacteria 13509
655 Ga0496112_0038956 3300048915 Bacteria 4643
656 Ga0496112_0274336 3300048915 Bacteria 1634
657 Ga0496112_0389977 3300048915 Bacteria 1333
658 Ga0496113_0049741 3300048916 Bacteria 3123
659 Ga0496113_0079297 3300048916 Bacteria 2513
660 Ga0496113_0233364 3300048916 Bacteria 1467
661 Ga0496114_0013081 3300048917 Bacteria 6648
662 Ga0496114_0013950 3300048917 Bacteria 6443
663 Ga0496114_0033560 3300048917 Bacteria 4230
664 Ga0496114_0176388 3300048917 Bacteria 1865
665 Ga0496114_0258860 3300048917 Bacteria 1532
666 Ga0496114_0356052 3300048917 Bacteria 1295
667 Ga0496115_0000007 3300048918 Bacteria 244991
668 Ga0496115_0017205 3300048918 Bacteria 5519
669 Ga0496115_0017578 3300048918 Bacteria 5472
670 Ga0496115_0026223 3300048918 Bacteria 4546
671 Ga0496115_0046881 3300048918 Bacteria 3456
672 Ga0496115_0073685 3300048918 Bacteria 2772
673 Ga0496115_0086080 3300048918 Bacteria 2564
674 Ga0496116_0127774 3300048919 Bacteria 1456
675 Ga0496117_0262000 3300048920 Bacteria 936
676 Ga0496118_0002736 3300048921 Bacteria 23202
677 Ga0496118_0032397 3300048921 Bacteria 4306
678 Ga0496118_0039700 3300048921 Bacteria 3753
679 Ga0496119_0063673 3300048922 Bacteria 2192
680 Ga0496119_0111933 3300048922 Bacteria 1514
681 Ga0496120_0055816 3300048923 Bacteria 2232
682 Ga0496120_0062142 3300048923 Bacteria 2082
683 Ga0496121_0004907 3300048924 Bacteria 17555
684 Ga0496122_0001065 3300048925 Bacteria 47730
685 Ga0496125_0000172 3300048928 Bacteria 144915
686 Ga0496125_0001022 3300048928 Bacteria 43463
687 Ga0496125_0005135 3300048928 Bacteria 14724
688 Ga0496125_0007209 3300048928 Bacteria 11852
689 Ga0496125_0033316 3300048928 Bacteria 4560
690 Ga0496126_0109972 3300048929 Bacteria 2401
691 Ga0496126_0207657 3300048929 Bacteria 1650
692 Ga0501300_011365 3300049523 Bacteria 1298
693 Ga0501032_0005612 3300049569 Bacteria 9293
694 Ga0501032_0009393 3300049569 Bacteria 7084
695 Ga0501032_0038012 3300049569 Bacteria 3279
696 Ga0501032_0127799 3300049569 Bacteria 1678
697 Ga0501033_0004704 3300049570 Bacteria 10925
698 Ga0501033_0015456 3300049570 Bacteria 5789
699 Ga0501033_0017624 3300049570 Bacteria 5395
700 Ga0501033_0141414 3300049570 Bacteria 1739
701 Ga0501033_0151036 3300049570 Bacteria 1676
702 Ga0501034_0000328 3300049571 Bacteria 83532
703 Ga0501034_0011883 3300049571 Bacteria 9007
704 Ga0501034_0051779 3300049571 Bacteria 4139
705 Ga0501034_0064905 3300049571 Bacteria 3664
706 Ga0501034_0118149 3300049571 Bacteria 2639
707 Ga0501036_0016622 3300049572 Bacteria 6143
708 Ga0501036_0053274 3300049572 Bacteria 3426
709 Ga0501036_0139080 3300049572 Bacteria 2049
710 Ga0501037_0006594 3300049573 Bacteria 8488
711 Ga0501037_0006643 3300049573 Bacteria 8460
712 Ga0501037_0008276 3300049573 Bacteria 7626
713 Ga0501037_0161100 3300049573 Bacteria 1599
714 Ga0501038_0052528 3300049574 Bacteria 3513
715 Ga0501038_0066983 3300049574 Bacteria 3056
716 Ga0501038_0070908 3300049574 Bacteria 2957
717 Ga0501038_0072057 3300049574 Bacteria 2928
718 Ga0501038_0086439 3300049574 Bacteria 2634
719 Ga0501038_0221498 3300049574 Bacteria 1509
720 Ga0501040_0043233 3300049576 Bacteria 3070
721 Ga0501040_0287968 3300049576 Bacteria 1174
722 Ga0501041_0058796 3300049577 Bacteria 2352
723 Ga0501042_0036384 3300049578 Bacteria 3492
724 Ga0501042_0130890 3300049578 Bacteria 1808
725 Ga0501043_0001612 3300049579 Bacteria 19645
726 Ga0501043_0011287 3300049579 Bacteria 6991
727 Ga0501043_0028035 3300049579 Bacteria 4420
728 Ga0501043_0238345 3300049579 Bacteria 1403
729 Ga0501046_0004162 3300049580 Bacteria 13172
730 Ga0501046_0031840 3300049580 Bacteria 4272
731 Ga0501046_0093539 3300049580 Bacteria 2311
732 Ga0501046_0323109 3300049580 Bacteria 1124
733 Ga0501047_0008384 3300049581 Bacteria 9754
734 Ga0501047_0010011 3300049581 Bacteria 8963
735 Ga0501047_0030400 3300049581 Bacteria 5207
736 Ga0501047_0031541 3300049581 Bacteria 5111
737 Ga0501047_0037405 3300049581 Bacteria 4694
738 Ga0501047_0363697 3300049581 Bacteria 1282
739 Ga0501048_0002639 3300049582 Bacteria 13702
740 Ga0501048_0003083 3300049582 Bacteria 12706
741 Ga0501048_0042899 3300049582 Bacteria 3238
742 Ga0501048_0081917 3300049582 Bacteria 2276
743 Ga0501068_0001059 3300049584 Bacteria 14585
744 Ga0501068_0013838 3300049584 Bacteria 4598
745 Ga0501068_0167563 3300049584 Bacteria 1385
746 Ga0501069_0054002 3300049585 Bacteria 2238
747 Ga0501069_0055396 3300049585 Bacteria 2209
748 Ga0501070_0000167 3300049586 Bacteria 60680
749 Ga0501070_0006114 3300049586 Bacteria 10262
750 Ga0501070_0021300 3300049586 Bacteria 5440
751 Ga0501070_0030519 3300049586 Bacteria 4517
752 Ga0501070_0030556 3300049586 Bacteria 4514
753 Ga0501070_0144986 3300049586 Bacteria 1960
754 Ga0501070_0293230 3300049586 Bacteria 1326
755 Ga0501070_0326041 3300049586 Bacteria 1248
756 Ga0501071_0048477 3300049587 Bacteria 3055
757 Ga0501071_0062813 3300049587 Bacteria 2691
758 Ga0501071_0300378 3300049587 Bacteria 1217
759 Ga0501072_0312500 3300049588 Bacteria 1249
760 Ga0501073_0072520 3300049589 Bacteria 2398
761 Ga0501073_0247110 3300049589 Bacteria 1232
762 Ga0501074_0020405 3300049590 Bacteria 4816
763 Ga0501075_0148567 3300049591 Bacteria 1786
764 Ga0501076_0018938 3300049592 Bacteria 5253
765 Ga0501076_0069686 3300049592 Bacteria 2810
766 Ga0501076_0088928 3300049592 Bacteria 2483
767 Ga0501076_0666593 3300049592 Bacteria 859
768 Ga0501077_0028561 3300049593 Bacteria 3545
769 Ga0501077_0034990 3300049593 Bacteria 3197
770 Ga0501077_0042589 3300049593 Bacteria 2886
771 Ga0501077_0254612 3300049593 Bacteria 1117
772 Ga0501235_020082 3300049669 Bacteria 1483
773 Ga0501079_0016624 3300049741 Bacteria 5619
774 Ga0501079_0056334 3300049741 Bacteria 3033
775 Ga0501080_0013966 3300049742 Bacteria 7391
776 Ga0501080_0020887 3300049742 Bacteria 6059
777 Ga0501083_0000003 3300049744 Bacteria 235949
778 Ga0501083_0010150 3300049744 Bacteria 6636
779 Ga0501035_0009611 3300049822 Bacteria 8993
780 Ga0501035_0010726 3300049822 Bacteria 8483
781 Ga0501035_0023799 3300049822 Bacteria 5619
782 Ga0501035_0086695 3300049822 Bacteria 2759
783 Ga0501035_0111626 3300049822 Bacteria 2396
784 Ga0501035_0389213 3300049822 Bacteria 1161
785 Ga0501044_0010663 3300049823 Bacteria 9971
786 Ga0501044_0012841 3300049823 Bacteria 9068
787 Ga0501044_0020376 3300049823 Bacteria 7081
788 Ga0501044_0021144 3300049823 Bacteria 6946
789 Ga0501044_0105217 3300049823 Bacteria 2835
790 Ga0501044_0177084 3300049823 Bacteria 2101
791 Ga0501044_0339283 3300049823 Bacteria 1424
792 nmdc:mga00v17_12115_c1 3300050491 Bacteria 4751
793 nmdc:mga00v17_16089_c1 3300050491 Bacteria 4211
794 nmdc:mga00v17_2429_c1 3300050491 Bacteria 9527
795 nmdc:mga00v17_5501_c1 3300050491 Bacteria 6672
796 nmdc:mga00v17_70333_c1 3300050491 Bacteria 2167
797 nmdc:mga00v17_78187_c1 3300050491 Bacteria 2061
798 nmdc:mga0k408_253058_c1 3300050493 Bacteria 1052
799 nmdc:mga07m45_175839_c1 3300050496 Bacteria 1245
800 nmdc:mga07m45_29150_c1 3300050496 Bacteria 3050
801 nmdc:mga05p37_132926_c1 3300050507 Bacteria 3052
802 nmdc:mga05p37_25564_c1 3300050507 Bacteria 7183
803 nmdc:mga05p37_52655_c1 3300050507 Bacteria 5004
804 nmdc:mga09592_72293_c1 3300050508 Bacteria 2929
805 nmdc:mga06r32_40760_c1 3300050510 Bacteria 4410
806 nmdc:mga08y16_293051_c1 3300050511 Bacteria 1678
807 nmdc:mga08y16_470033_c1 3300050511 Bacteria 1280
808 nmdc:mga08y16_60365_c1 3300050511 Bacteria 3961
809 nmdc:mga08y16_95695_c1 3300050511 Bacteria 3093
810 nmdc:mga08x19_19_c1 3300050514 Bacteria 315774
811 nmdc:mga0sz30_8826_c1 3300050516 Bacteria 3819
812 Ga0500635_0000028 3300053080 Bacteria 104398
813 Ga0500644_0001599 3300053088 Bacteria 5927
814 Ga0500651_0083613 3300053093 Bacteria 1975
815 Ga0500556_0001502 3300053104 Bacteria 9630
816 Ga0500568_0004559 3300053139 Bacteria 7385
817 Ga0500600_0036594 3300053149 Bacteria 2852
818 Ga0500611_033160 3300053727 Bacteria 1085
819 Ga0500645_002561 3300053730 Bacteria 8007
820 Ga0501084_0065741 3300054114 Bacteria 3034
821 Ga0501082_0259165 3300060353 Bacteria 1513
822 Ga0501082_0363420 3300060353 Bacteria 1262
823 Ga0466962_0057997 3300061719 Bacteria 1848
824 Ga0530510_0076960 3300061734 Bacteria 2425
825 2552110827 2551306166 Bacteria 9731570
826 2587755536 2585428062 Bacteria 6842168
827 2643746498 2643221544 Bacteria 5886209
828 2643754190 2643221546 Bacteria 2910897
829 2643785438 2643221553 Bacteria 3544260
830 2644097119 2643221616 Bacteria 4066575
831 2644220899 2643221639 Bacteria 6649903
832 2644259746 2643221646 Bacteria 6433402
833 2644304105 2643221654 Bacteria 5273570
834 2644337536 2643221660 Bacteria 4208257
835 2644446477 2643221679 Bacteria 3839507
836 2644486327 2643221687 Bacteria 6500351
837 2644637410 2643221715 Bacteria 6671032
838 2644679793 2643221724 Bacteria 3593515
839 2691514866 2690315906 Bacteria 4517044
840 2730229319 2728369380 Bacteria 3620317
841 2747952674 2747842429 Bacteria 3914386
842 2775654793 2775506735 Bacteria 4556596
843 2808631585 2808606306 Bacteria 3608896
844 2808902608 2808606372 Bacteria 4649509
845 2812320256 2811994871 Bacteria 4497550
846 2852647031 2852646457 Bacteria 3408613
847 2852664897 2852663356 Bacteria 4090475
848 2857741044 2857740372 Bacteria 4782044
849 2881105398 2881101125 Bacteria 4590519
850 2884765687 2884763398 Bacteria 4091164
851 2894026734 2894023352 Bacteria 5167372
852 2895660977 2895660088 Bacteria 3782833
853 2899367668 2899359706 Bacteria 10940472
854 2902815401 2902810491 Bacteria 6794147
855 2902840256 2902837492 Bacteria 6697721
856 2904500276 2904497146 Bacteria 4731781
857 2904776928 2904776348 Bacteria 4658726
858 2910810984 2910809715 Bacteria 4982797
859 2919036465 2919034639 Bacteria 4763403
860 2919059523 2919059106 Bacteria 4991624
861 2919392902 2919391150 Bacteria 4884741
862 2919443210 2919443155 Bacteria 4072969
863 2919540925 2919538618 Bacteria 4677069
864 2919717040 2919713450 Bacteria 7431245
865 2928115391 2928115317 Bacteria 6477646
866 2929215086 2929212328 Bacteria 7708288
867 2932427060 2932426870 Bacteria 4547726
868 2933419688 2933418574 Bacteria 4476724
869 2939587442 2939582691 Bacteria 7088898
870 2939649913 2939647034 Bacteria 4681660
871 2939663769 2939660829 Bacteria 3784848
872 2939677360 2939674588 Bacteria 4844420
873 2945918004 2945916053 Bacteria 4555517
874 2945960140 2945956166 Bacteria 5110334
875 2945971483 2945968032 Bacteria 4111363
876 2946034112 2946033335 Bacteria 3835514
877 2956941601 2956939328 Bacteria 3474458
878 2974306040 2974302888 Bacteria 4369871
879 3001119985 3001119090 Bacteria 3449530
880 8002392874 8002392321 Bacteria 4159911
881 8048747062 8048746797 Bacteria 3557226
882 8054110658 8054107350 Bacteria 5022511
883 8055038050 8055037949 Bacteria 3337834
884 Ga0501071_0160527
885 MRS1b_contig_2095048
886 LJQas_1000928
887 JGI24742J22300_10014285
888 JGI25164J39214_1000974
889 JGI25151J46595_10000156
890 JGI25165J46597_1000004
891 Ga0055527_1000001
892 Ga0055542_1009411
893 Ga0055529_1000019
894 Ga0055526_1000293
895 Ga0055540_1002727
896 Ga0055531_10000078
897 Ga0055531_10002166
898 Ga0065707_10228158
899 Ga0070658_10049549
900 Ga0070658_10080848
901 Ga0070658_10473109
902 Ga0070683_100089986
903 Ga0070683_100125566
904 Ga0070683_100421179
905 Ga0070690_100011765
906 Ga0070670_100150132
907 Ga0070677_10139964
908 Ga0068869_100087693
909 Ga0070666_10214394
910 Ga0070680_100005109
911 Ga0070680_100017277
912 Ga0070682_100002922
913 Ga0070682_100027069
914 Ga0070682_100032951
915 Ga0070682_100039128
916 Ga0070682_100042118
917 Ga0070682_100221705
918 Ga0068868_100010275
919 Ga0068868_100052341
920 Ga0068868_100136638
921 Ga0070660_100004961
922 Ga0070660_100366557
923 Ga0070689_100022952
924 Ga0070689_100023186
925 Ga0070691_10158650
926 Ga0070661_100006246
927 Ga0070661_100008803
928 Ga0070661_100047421
929 Ga0070661_100252453
930 Ga0070692_10072857
931 Ga0070668_100004324
932 Ga0070669_100022894
933 Ga0070675_100114893
934 Ga0070675_100242529
935 Ga0070675_100329318
936 Ga0070671_100035374
937 Ga0070671_100044909
938 Ga0070671_100081797
939 Ga0070671_100129926
940 Ga0070674_100004266
941 Ga0070674_100067388
942 Ga0070674_100214348
943 Ga0070673_100076407
944 Ga0070673_100313496
945 Ga0070667_100000008
946 Ga0070667_100010404
947 Ga0070667_100192215
948 Ga0070714_100099982
949 Ga0070714_100579851
950 Ga0070701_10002941
951 Ga0070701_10025823
952 Ga0070701_10041361
953 Ga0070711_100206607
954 Ga0070711_100297100
955 Ga0070711_100403710
956 Ga0070705_100005615
957 Ga0070700_100013330
958 Ga0070700_100042777
959 Ga0070694_100037308
960 Ga0070663_100000355
961 Ga0070678_100016769
962 Ga0070678_100150478
963 Ga0070681_10002979
964 Ga0070681_10011372
965 Ga0070681_10061424
966 Ga0068867_100000062
967 Ga0068867_100000675
968 Ga0068867_100016982
969 Ga0068867_100018227
970 Ga0068867_100059364
971 Ga0070685_10146862
972 Ga0070685_10158865
973 Ga0070698_100220594
974 Ga0070679_100001081
975 Ga0070679_100004413
976 Ga0070684_100021170
977 Ga0070684_100131004
978 Ga0070684_100280975
979 Ga0068853_100019247
980 Ga0068853_100037636
981 Ga0068853_100047061
982 Ga0068853_100098424
983 Ga0070672_100032355
984 Ga0070672_100128402
985 Ga0070672_100212240
986 Ga0070672_100256899
987 Ga0070672_100259004
988 Ga0070672_100412910
989 Ga0070686_100011866
990 Ga0070695_100109718
991 Ga0070696_100000773
992 Ga0070693_100038455
993 Ga0070693_100074747
994 Ga0070665_100002002
995 Ga0070665_100004489
996 Ga0070704_100001401
997 Ga0068855_100009516
998 Ga0068855_100034076
999 Ga0070664_100033357
1000 Ga0070664_100074127
1001 Ga0068857_100032455
1002 Ga0068854_100006057
1003 Ga0068854_100067159
1004 Ga0068854_100162915
1005 Ga0068856_100053527
1006 Ga0068856_100189944
1007 Ga0068856_100216857
1008 Ga0068856_100356838
1009 Ga0070702_100001389
1010 Ga0070702_100007685
1011 Ga0070702_100228503
1012 Ga0068852_100007382
1013 Ga0068859_100001285
1014 Ga0068859_100085198
1015 Ga0068859_100178560
1016 Ga0068859_100247261
1017 Ga0068859_100320565
1018 Ga0068859_100636357
1019 Ga0068861_100032965
1020 Ga0068861_100034550
1021 Ga0068861_100093196
1022 Ga0068861_100127803
1023 Ga0068861_100403256
1024 Ga0068863_100049842
1025 Ga0068863_100549147
1026 Ga0068858_100027232
1027 Ga0068860_100054821
1028 Ga0068860_100092759
1029 Ga0068860_100396467
1030 Ga0068862_100005211
1031 Ga0068862_100038065
1032 Ga0081455_10037738
1033 Ga0075365_10081904
1034 Ga0075363_100003316
1035 Ga0075363_100274267
1036 Ga0075364_10000522
1037 Ga0075364_10001885
1038 Ga0075364_10039815
1039 Ga0075364_10041738
1040 Ga0075364_10059166
1041 Ga0075364_10161499
1042 Ga0075364_10196528
1043 Ga0075432_10002065
1044 Ga0070715_10090782
1045 Ga0070712_100021643
1046 Ga0075366_10083444
1047 Ga0075366_10160404
1048 Ga0097621_100023231
1049 Ga0097621_100295486
1050 Ga0075370_10000712
1051 Ga0075370_10013593
1052 Ga0068871_100022719
1053 Ga0068871_100046838
1054 Ga0068871_100398231
1055 Ga0075428_100062670
1056 Ga0075431_100080184
1057 Ga0068865_100026457
1058 Ga0068865_100053528
1059 Ga0075436_100001954
1060 Ga0097620_100001285
1061 Ga0097620_100085195
1062 Ga0097620_100178561
1063 Ga0097620_100247270
1064 Ga0097620_100320547
1065 Ga0097620_100636428
1066 Ga0105244_10007496
1067 Ga0105240_10006132
1068 Ga0105240_10012361
1069 Ga0105240_10015317
1070 Ga0105240_10196167
1071 Ga0111539_10211181
1072 Ga0111539_10212037
1073 Ga0111539_10350694
1074 Ga0105245_10007025
1075 Ga0105245_10243298
1076 Ga0105247_10001547
1077 Ga0105247_10003369
1078 Ga0105247_10013257
1079 Ga0105247_10045532
1080 Ga0114129_10037345
1081 Ga0114129_10093003
1082 Ga0114129_10149653
1083 Ga0114129_10558531
1084 Ga0105243_10002846
1085 Ga0105243_10032381
1086 Ga0105243_10130275
1087 Ga0105243_10213831
1088 Ga0105243_10316223
1089 Ga0105243_10349658
1090 Ga0105241_10015631
1091 Ga0105242_10005276
1092 Ga0105248_10024774
1093 Ga0105248_10067887
1094 Ga0105237_10005469
1095 Ga0105237_10008525
1096 Ga0105237_10016653
1097 Ga0105237_10107336
1098 Ga0105237_10155191
1099 Ga0105238_10056195
1100 Ga0105249_10001615
1101 Ga0105249_10182421
1102 Ga0105249_10617884
1103 Ga0105239_10012611
1104 Ga0105239_10029163
1105 Ga0105239_10038886
1106 Ga0105239_10075481
1107 Ga0105239_10235805
1108 Ga0105246_10002960
1109 Ga0105246_10115557
1110 Ga0105246_10181510
1111 Ga0157373_10194599
1112 Ga0157371_10047597
1113 Ga0157371_10151000
1114 Ga0157369_10004228
1115 Ga0157369_10088461
1116 Ga0157369_10167091
1117 Ga0157369_10405524
1118 Ga0157374_10006773
1119 Ga0157374_10014955
1120 Ga0157374_10054338
1121 Ga0157374_10187661
1122 Ga0157378_10013225
1123 Ga0157378_10065174
1124 Ga0157378_10244783
1125 Ga0163162_10010063
1126 Ga0163162_10052990
1127 Ga0163162_10125176
1128 Ga0163162_10171681
1129 Ga0163162_10831317
1130 Ga0157372_10006463
1131 Ga0157372_10043580
1132 Ga0157372_10138304
1133 Ga0157372_10164748
1134 Ga0157372_10387090
1135 Ga0157375_10009390
1136 Ga0157375_10011713
1137 Ga0157375_10091545
1138 Ga0157375_10267273
1139 Ga0157375_10532289
1140 Ga0157375_10958873
1141 Ga0163163_10102409
1142 Ga0157380_10002734
1143 Ga0157380_10046254
1144 Ga0157380_10048707
1145 Ga0157380_10176264
1146 Ga0157380_10263625
1147 Ga0157380_10355125
1148 Ga0157380_10572866
1149 Ga0157380_10874733
1150 Ga0157379_10030835
1151 Ga0157379_10034941
1152 Ga0157379_10149067
1153 Ga0157376_10006548
1154 Ga0157376_10417558
1155 Ga0157376_10423457
1156 Ga0163161_10004372
1157 Ga0163161_10134521
1158 Ga0163161_10177895
1159 Ga0206356_10016337
1160 Ga0206356_10536592
1161 Ga0206353_10861374
1162 Ga0213872_10000074
1163 Ga0213872_10000409
1164 Ga0209672_100006
1165 Ga0209147_100699
1166 Ga0207427_100010
1167 Ga0209437_100216
1168 Ga0209258_101354
1169 Ga0207425_1000158
1170 Ga0209148_1000015
1171 Ga0209148_1003211
1172 Ga0209129_1000169
1173 Ga0209233_1000001
1174 Ga0209455_1000013
1175 Ga0209673_1006885
1176 Ga0209025_1000019
1177 Ga0209564_1000057
1178 Ga0209758_1000461
1179 Ga0209758_1001104
1180 Ga0209050_1009414
1181 Ga0209051_1000136
1182 Ga0209051_1009285
1183 Ga0209257_1000032
1184 Ga0209257_1000055
1185 Ga0207697_10016969
1186 Ga0207655_1092409
1187 Ga0207692_10023134
1188 Ga0207710_10004119
1189 Ga0207710_10006561
1190 Ga0207680_10012655
1191 Ga0207680_10078937
1192 Ga0207647_10014906
1193 Ga0207647_10017033
1194 Ga0207647_10045604
1195 Ga0207685_10010204
1196 Ga0207699_10090585
1197 Ga0207645_10055143
1198 Ga0207643_10123455
1199 Ga0207705_10134850
1200 Ga0207705_10209896
1201 Ga0207707_10014181
1202 Ga0207707_10036847
1203 Ga0207707_10057360
1204 Ga0207707_10331329
1205 Ga0207695_10012431
1206 Ga0207695_10017318
1207 Ga0207695_10149008
1208 Ga0207695_10246561
1209 Ga0207671_10000298
1210 Ga0207671_10000531
1211 Ga0207671_10009743
1212 Ga0207671_10065482
1213 Ga0207663_10000354
1214 Ga0207660_10052066
1215 Ga0207660_10296353
1216 Ga0207660_10304181
1217 Ga0207662_10048350
1218 Ga0207657_10009492
1219 Ga0207649_10007727
1220 Ga0207649_10059727
1221 Ga0207649_10062939
1222 Ga0207652_10024066
1223 Ga0207652_10028517
1224 Ga0207652_10260757
1225 Ga0207681_10204777
1226 Ga0207694_10132563
1227 Ga0207659_10101311
1228 Ga0207659_10171194
1229 Ga0207659_10179176
1230 Ga0207687_10003626
1231 Ga0207687_10291522
1232 Ga0207644_10046203
1233 Ga0207644_10120084
1234 Ga0207644_10289394
1235 Ga0207690_10043829
1236 Ga0207690_10230557
1237 Ga0207706_10005428
1238 Ga0207709_10000015
1239 Ga0207709_10039670
1240 Ga0207709_10090315
1241 Ga0207709_10108931
1242 Ga0207709_10151848
1243 Ga0207709_10211734
1244 Ga0207709_10347609
1245 Ga0207670_10056413
1246 Ga0207669_10089918
1247 Ga0207669_10401761
1248 Ga0207704_10017638
1249 Ga0207691_10000649
1250 Ga0207691_10044818
1251 Ga0207691_10091498
1252 Ga0207691_10408426
1253 Ga0207711_10037926
1254 Ga0207689_10071436
1255 Ga0207689_10118624
1256 Ga0207661_10001700
1257 Ga0207661_10107336
1258 Ga0207661_10160298
1259 Ga0207661_10540949
1260 Ga0207679_10058180
1261 Ga0207679_10081258
1262 Ga0207667_10257789
1263 Ga0207651_10008075
1264 Ga0207651_10319701
1265 Ga0207651_10377601
1266 Ga0207712_10154929
1267 Ga0207712_10508790
1268 Ga0207640_10006698
1269 Ga0207640_10020142
1270 Ga0207658_10000030
1271 Ga0207658_10023960
1272 Ga0207658_10130242
1273 Ga0207658_10409862
1274 Ga0207677_10004032
1275 Ga0207677_10106932
1276 Ga0207677_10229822
1277 Ga0207639_10162456
1278 Ga0207639_10226107
1279 Ga0207678_10001274
1280 Ga0207678_10527791
1281 Ga0207708_10003996
1282 Ga0207708_10022120
1283 Ga0207708_10154181
1284 Ga0207708_10201076
1285 Ga0207702_10001783
1286 Ga0207702_10036365
1287 Ga0207702_10212942
1288 Ga0207641_10002088
1289 Ga0207641_10421546
1290 Ga0207648_10000308
1291 Ga0207648_10011691
1292 Ga0207648_10039040
1293 Ga0207648_10062502
1294 Ga0207648_10269309
1295 Ga0207676_10509248
1296 Ga0207674_10013815
1297 Ga0207674_10063688
1298 Ga0207675_100019521
1299 Ga0207675_100037495
1300 Ga0207675_100109812
1301 Ga0207683_10026364
1302 Ga0207683_10257665
1303 Ga0207698_10012402
1304 Ga0209974_10019930
1305 Ga0268266_10003633
1306 Ga0268266_10003842
1307 Ga0268266_10020043
1308 Ga0268266_10042458
1309 Ga0268266_10090247
1310 Ga0268265_10023681
1311 Ga0268265_10099463
1312 Ga0268265_10245461
1313 Ga0268264_10113523
1314 Ga0265337_1006251
1315 Ga0265334_10044564
1316 Ga0307515_10000469
1317 Ga0307515_10000902
1318 Ga0307515_10001683
1319 Ga0307515_10023814
1320 Ga0307515_10066900
1321 Ga0265338_10012629
1322 Ga0307512_10182329
1323 Ga0265332_10009134
1324 Ga0265327_10000006
1325 Ga0307513_10009513
1326 Ga0307513_10013150
1327 Ga0307513_10040324
1328 Ga0307513_10143501
1329 Ga0307509_10469293
1330 Ga0307408_100031909
1331 Ga0307408_100039139
1332 Ga0307408_100075319
1333 Ga0307408_100425666
1334 Ga0307408_100563352
1335 Ga0265314_10001118
1336 Ga0316576_10003801
1337 Ga0316576_10007014
1338 Ga0316578_10151641
1339 Ga0307405_10027682
1340 Ga0307405_10061776
1341 Ga0307405_10124955
1342 Ga0307405_10244355
1343 Ga0316577_10250444
1344 Ga0307413_10010467
1345 Ga0307413_10019310
1346 Ga0307413_10085244
1347 Ga0307413_10085932
1348 Ga0307413_10148021
1349 Ga0307410_10003842
1350 Ga0307410_10008303
1351 Ga0307410_10016794
1352 Ga0307410_10061993
1353 Ga0307410_10074718
1354 Ga0307410_10631706
1355 Ga0307406_10000263
1356 Ga0307406_10018481
1357 Ga0307406_10122421
1358 Ga0307407_10136041
1359 Ga0307412_10008293
1360 Ga0307412_10010075
1361 Ga0307412_10011134
1362 Ga0307412_10181761
1363 Ga0307409_100024429
1364 Ga0307409_100029498
1365 Ga0307409_100066905
1366 Ga0307409_100478094
1367 Ga0307416_100022095
1368 Ga0307416_100024457
1369 Ga0307416_100094063
1370 Ga0307416_100134059
1371 Ga0307416_100151995
1372 Ga0307416_100165595
1373 Ga0307416_100279004
1374 Ga0307414_10009829
1375 Ga0307414_10594131
1376 Ga0307415_100066941
1377 Ga0307415_100164484
1378 Ga0307415_100167014
1379 Ga0307415_100204068
1380 Ga0307510_10026590
1381 Ga0307510_10214430
1382 Ga0316574_0003199
1383 Ga0316574_0010713
1384 Ga0316574_0012049
1385 Ga0316574_0014079
1386 Ga0316574_0022777
1387 Ga0316574_0028264
1388 Ga0316574_0051034
1389 Ga0373931_0048290
1390 Ga0316582_0308537
1391 Ga0316584_0012638
1392 Ga0316584_0076136
1393 Ga0316584_0176109
1394 Ga0316584_0319696
1395 Ga0395899_0000006
1396 Ga0395899_0033199
1397 Ga0395899_0068763
1398 Ga0395900_0000378
1399 Ga0395900_0000774
1400 Ga0395900_0010538
1401 Ga0395900_0012591
1402 Ga0395900_0032840
1403 Ga0395900_0071874
1404 Ga0395900_0301695
1405 Ga0395900_0386464
1406 Ga0395898_0000015
1407 Ga0395898_0009381
1408 Ga0395898_0013268
1409 Ga0395898_0183554
1410 Ga0395898_0519631
1411 Ga0395905_0005120
1412 Ga0395905_0071188
1413 Ga0395905_0093212
1414 Ga0395905_0204943
1415 Ga0395905_0205552
1416 Ga0395905_0294667
1417 Ga0395905_0315639
1418 Ga0395901_0022015
1419 Ga0395901_0117043
1420 Ga0395901_0190305
1421 Ga0395901_0247183
1422 Ga0395901_0302510
1423 Ga0436361_0082864
1424 Ga0436361_0507289
1425 Ga0436361_0554943
1426 Ga0436361_0632651
1427 Ga0436361_0703210
1428 Ga0436361_0939166
1429 Ga0439466_0006490
1430 Ga0439466_0015492
1431 Ga0439466_0027865
1432 Ga0439465_0000389
1433 Ga0439465_0002292
1434 Ga0439465_0010657
1435 Ga0439465_0040528
1436 Ga0451793_1258867
1437 Ga0451798_0349143
1438 Ga0451837_0927302
1439 Ga0439431_0004103
1440 Ga0439433_0003863
1441 Ga0439442_000527
1442 Ga0439442_012156
1443 Ga0439442_012287
1444 Ga0439442_023952
1445 Ga0439445_0012253
1446 Ga0439449_0000164
1447 Ga0439449_0043085
1448 Ga0439452_038971
1449 Ga0439457_003181
1450 Ga0439462_0030965
1451 Ga0450917_000828
1452 Ga0439434_0003103
1453 Ga0439434_0005703
1454 Ga0439434_0009319
1455 Ga0451577_0002513
1456 Ga0451577_0014967
1457 Ga0466969_0000907
1458 Ga0466969_0066399
1459 Ga0466972_0000621
1460 Ga0466972_0108596
1461 Ga0466975_0058573
1462 Ga0466965_0019432
1463 Ga0466965_0025746
1464 Ga0466965_0031866
1465 Ga0466965_0223275
1466 Ga0466966_0010499
1467 Ga0466966_0014910
1468 Ga0466961_0001812
1469 Ga0466963_0060835
1470 Ga0466971_0071938
1471 Ga0466971_0140610
1472 Ga0466968_0109006
1473 Ga0466970_0000146
1474 Ga0466970_0094723
1475 Ga0466970_0124513
1476 Ga0466970_0174860
1477 Ga0466957_0259190
1478 Ga0466960_0018489
1479 Ga0466960_0026202
1480 Ga0466959_0000098
1481 Ga0466959_0000102
1482 Ga0466959_0091898
1483 Ga0466959_0345613
1484 Ga0451576_0000862
1485 Ga0466958_0016108
1486 Ga0466958_0024823
1487 Ga0466967_0029601
1488 Ga0466967_0233271
1489 Ga0466967_0457875
1490 Ga0495638_0009388
1491 Ga0495638_0020374
1492 Ga0495641_0110487
1493 Ga0495620_0034401
1494 Ga0495621_0045623
1495 Ga0495645_0115300
1496 Ga0495656_0031620
1497 Ga0495668_0090608
1498 Ga0495668_0231014
1499 Ga0495625_0008483
1500 Ga0495625_0121914
1501 Ga0495670_0094684
1502 Ga0495649_0144092
1503 Ga0495681_0137939
1504 Ga0495686_0067472
1505 Ga0495615_0004505
1506 Ga0495626_0056494
1507 Ga0496100_0007899
1508 Ga0496101_0092767
1509 Ga0496102_0000062
1510 Ga0496102_0035590
1511 Ga0496102_0046319
1512 Ga0496102_0069524
1513 Ga0496102_0091413
1514 Ga0496102_0106309
1515 Ga0496102_0231786
1516 Ga0496103_0000073
1517 Ga0496103_0001937
1518 Ga0496103_0180154
1519 Ga0496104_0007030
1520 Ga0496104_0050527
1521 Ga0496104_0059485
1522 Ga0496105_0025022
1523 Ga0496105_0094126
1524 Ga0496105_0212352
1525 Ga0496105_0328982
1526 Ga0496106_0007098
1527 Ga0496107_0004432
1528 Ga0496107_0031928
1529 Ga0496107_0033057
1530 Ga0496108_0005584
1531 Ga0496108_0121770
1532 Ga0496108_0188504
1533 Ga0496109_0001477
1534 Ga0496111_0015488
1535 Ga0496111_0036377
1536 Ga0496111_0164669
1537 Ga0496112_0003172
1538 Ga0496112_0038956
1539 Ga0496112_0274336
1540 Ga0496112_0389977
1541 Ga0496113_0049741
1542 Ga0496113_0079297
1543 Ga0496113_0233364
1544 Ga0496114_0013081
1545 Ga0496114_0013950
1546 Ga0496114_0033560
1547 Ga0496114_0176388
1548 Ga0496114_0258860
1549 Ga0496114_0356052
1550 Ga0496115_0000007
1551 Ga0496115_0017205
1552 Ga0496115_0017578
1553 Ga0496115_0026223
1554 Ga0496115_0046881
1555 Ga0496115_0073685
1556 Ga0496115_0086080
1557 Ga0496116_0127774
1558 Ga0496117_0262000
1559 Ga0496118_0002736
1560 Ga0496118_0032397
1561 Ga0496118_0039700
1562 Ga0496119_0063673
1563 Ga0496119_0111933
1564 Ga0496120_0055816
1565 Ga0496120_0062142
1566 Ga0496121_0004907
1567 Ga0496122_0001065
1568 Ga0496125_0000172
1569 Ga0496125_0001022
1570 Ga0496125_0005135
1571 Ga0496125_0007209
1572 Ga0496125_0033316
1573 Ga0496126_0109972
1574 Ga0496126_0207657
1575 Ga0501300_011365
1576 Ga0501032_0005612
1577 Ga0501032_0009393
1578 Ga0501032_0038012
1579 Ga0501032_0127799
1580 Ga0501033_0004704
1581 Ga0501033_0015456
1582 Ga0501033_0017624
1583 Ga0501033_0141414
1584 Ga0501033_0151036
1585 Ga0501034_0000328
1586 Ga0501034_0011883
1587 Ga0501034_0051779
1588 Ga0501034_0064905
1589 Ga0501034_0118149
1590 Ga0501036_0016622
1591 Ga0501036_0053274
1592 Ga0501036_0139080
1593 Ga0501037_0006594
1594 Ga0501037_0006643
1595 Ga0501037_0008276
1596 Ga0501037_0161100
1597 Ga0501038_0052528
1598 Ga0501038_0066983
1599 Ga0501038_0070908
1600 Ga0501038_0072057
1601 Ga0501038_0086439
1602 Ga0501038_0221498
1603 Ga0501040_0043233
1604 Ga0501040_0287968
1605 Ga0501041_0058796
1606 Ga0501042_0036384
1607 Ga0501042_0130890
1608 Ga0501043_0001612
1609 Ga0501043_0011287
1610 Ga0501043_0028035
1611 Ga0501043_0238345
1612 Ga0501046_0004162
1613 Ga0501046_0031840
1614 Ga0501046_0093539
1615 Ga0501046_0323109
1616 Ga0501047_0008384
1617 Ga0501047_0010011
1618 Ga0501047_0030400
1619 Ga0501047_0031541
1620 Ga0501047_0037405
1621 Ga0501047_0363697
1622 Ga0501048_0002639
1623 Ga0501048_0003083
1624 Ga0501048_0042899
1625 Ga0501048_0081917
1626 Ga0501068_0001059
1627 Ga0501068_0013838
1628 Ga0501068_0167563
1629 Ga0501069_0054002
1630 Ga0501069_0055396
1631 Ga0501070_0000167
1632 Ga0501070_0006114
1633 Ga0501070_0021300
1634 Ga0501070_0030519
1635 Ga0501070_0030556
1636 Ga0501070_0144986
1637 Ga0501070_0293230
1638 Ga0501070_0326041
1639 Ga0501071_0048477
1640 Ga0501071_0062813
1641 Ga0501071_0300378
1642 Ga0501072_0312500
1643 Ga0501073_0072520
1644 Ga0501073_0247110
1645 Ga0501074_0020405
1646 Ga0501075_0148567
1647 Ga0501076_0018938
1648 Ga0501076_0069686
1649 Ga0501076_0088928
1650 Ga0501076_0666593
1651 Ga0501077_0028561
1652 Ga0501077_0034990
1653 Ga0501077_0042589
1654 Ga0501077_0254612
1655 Ga0501235_020082
1656 Ga0501079_0016624
1657 Ga0501079_0056334
1658 Ga0501080_0013966
1659 Ga0501080_0020887
1660 Ga0501083_0000003
1661 Ga0501083_0010150
1662 Ga0501035_0009611
1663 Ga0501035_0010726
1664 Ga0501035_0023799
1665 Ga0501035_0086695
1666 Ga0501035_0111626
1667 Ga0501035_0389213
1668 Ga0501044_0010663
1669 Ga0501044_0012841
1670 Ga0501044_0020376
1671 Ga0501044_0021144
1672 Ga0501044_0105217
1673 Ga0501044_0177084
1674 Ga0501044_0339283
1675 nmdc:mga00v17_12115_c1
1676 nmdc:mga00v17_16089_c1
1677 nmdc:mga00v17_2429_c1
1678 nmdc:mga00v17_5501_c1
1679 nmdc:mga00v17_70333_c1
1680 nmdc:mga00v17_78187_c1
1681 nmdc:mga0k408_253058_c1
1682 nmdc:mga07m45_175839_c1
1683 nmdc:mga07m45_29150_c1
1684 nmdc:mga05p37_132926_c1
1685 nmdc:mga05p37_25564_c1
1686 nmdc:mga05p37_52655_c1
1687 nmdc:mga09592_72293_c1
1688 nmdc:mga06r32_40760_c1
1689 nmdc:mga08y16_293051_c1
1690 nmdc:mga08y16_470033_c1
1691 nmdc:mga08y16_60365_c1
1692 nmdc:mga08y16_95695_c1
1693 nmdc:mga08x19_19_c1
1694 nmdc:mga0sz30_8826_c1
1695 Ga0500635_0000028
1696 Ga0500644_0001599
1697 Ga0500651_0083613
1698 Ga0500556_0001502
1699 Ga0500568_0004559
1700 Ga0500600_0036594
1701 Ga0500611_033160
1702 Ga0500645_002561
1703 Ga0501084_0065741
1704 Ga0501082_0259165
1705 Ga0501082_0363420
1706 Ga0466962_0057997
1707 Ga0530510_0076960
1708 2552110827
1709 2587755536
1710 2643746498
1711 2643754190
1712 2643785438
1713 2644097119
1714 2644220899
1715 2644259746
1716 2644304105
1717 2644337536
1718 2644446477
1719 2644486327
1720 2644637410
1721 2644679793
1722 2691514866
1723 2730229319
1724 2747952674
1725 2775654793
1726 2808631585
1727 2808902608
1728 2812320256
1729 2852647031
1730 2852664897
1731 2857741044
1732 2881105398
1733 2884765687
1734 2894026734
1735 2895660977
1736 2899367668
1737 2902815401
1738 2902840256
1739 2904500276
1740 2904776928
1741 2910810984
1742 2919036465
1743 2919059523
1744 2919392902
1745 2919443210
1746 2919540925
1747 2919717040
1748 2928115391
1749 2929215086
1750 2932427060
1751 2933419688
1752 2939587442
1753 2939649913
1754 2939663769
1755 2939677360
1756 2945918004
1757 2945960140
1758 2945971483
1759 2946034112
1760 2956941601
1761 2974306040
1762 3001119985
1763 8002392874
1764 8048747062
1765 8054110658
1766 8055038050

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

2

265

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6auj-assembly1.cif.gz_A-2 crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 0.982 1 251
3qj7-assembly2.cif.gz_B crystal structure of the mycobacterium tuberculosis thymidylate synthase (thya) bound to dump 0.9793 1 261
3ix6-assembly1.cif.gz_A crystal structure of thymidylate synthase thya from brucella melitensis 0.9789 1 251
3bfi-assembly1.cif.gz_A-2 e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump 0.9777 3 264
3ix6-assembly1.cif.gz_B crystal structure of thymidylate synthase thya from brucella melitensis 0.9777 2 251
ID Description Score Start End Superfamily
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9777 2 251 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9661 2 264 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.959 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9546 4 262 3.30.572.10
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9505 2 251 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A3B8HDY4-F1-model_v4 deleted 0.9955 119 249
AF-A0A377CVI5-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9936 99 229 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A1G0F8E3-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9922 66 204 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A7V2EYC0-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9918 116 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A353WQK4-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9913 91 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Map