F484606
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 883 | 406 | 1766 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300049587|Ga0501071_0160527|Ga0501071_0160527_588_1385 |
| Length | 265 |
| Sequence | MAQYEDFVRHVLENGVPKEDRTGTGTVSVFGYQMRFDLGAGFPLVTTKKVHFKSIAVELLWFLRGDSNVRWLQEQGVTIWDEWADADGELGPVYGVQWRSWPTPDGGHVDQIAEVVRLLREDPDSRRIVVSAWNVADIPRMALAPCHAFFQFHVGGGTRLSCQIYQRSADAFLGVPFNIASYALLTHMLAQQCDLEVGDLVWTGGDCHIYDNHREQVETLLGRDPFPYPSLRLTRRPPSIFDYAFEDFEVVGYEHHPAIRAPVAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 119 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 198 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 205 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 233 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 234 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 235 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 236 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 237 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 238 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 239 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 240 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 241 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 242 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 243 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 244 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 245 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 246 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 247 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 251 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 252 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 253 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 290 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 291 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 292 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 293 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 294 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 295 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 329 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 336 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 337 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 339 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 341 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 342 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 343 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 344 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 347 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 348 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 349 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 350 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 351 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 352 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 353 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 354 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 355 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 356 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 357 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 358 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 359 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 360 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 361 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 362 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 363 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 364 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 365 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 366 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 367 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 368 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 369 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 370 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 371 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 372 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 373 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 374 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 375 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 376 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 377 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 378 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 379 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 380 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 381 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 382 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 383 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 384 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 385 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 386 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 387 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 388 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 389 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 390 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 391 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 392 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 393 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 394 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 395 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 396 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 397 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 398 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 399 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 400 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 401 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 402 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 403 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 404 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 405 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 406 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.98 |
| Metatranscriptomes | 0.34 |
| Isolates | 6.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.13 |
| Nodule | 0.11 |
| Rhizoplane | 5.89 |
| Rhizosphere | 79.84 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501071_0160527 | 3300049587 | Bacteria | 1680 |
| 2 | MRS1b_contig_2095048 | 2162886011 | Unclassified | 919 |
| 3 | LJQas_1000928 | 3300000549 | Bacteria | 4554 |
| 4 | JGI24742J22300_10014285 | 3300002244 | Bacteria | 1334 |
| 5 | JGI25164J39214_1000974 | 3300002772 | Bacteria | 9129 |
| 6 | JGI25151J46595_10000156 | 3300003187 | Bacteria | 88722 |
| 7 | JGI25165J46597_1000004 | 3300003214 | Bacteria | 667510 |
| 8 | Ga0055527_1000001 | 3300003760 | Bacteria | 850044 |
| 9 | Ga0055542_1009411 | 3300003762 | Bacteria | 1845 |
| 10 | Ga0055529_1000019 | 3300003763 | Bacteria | 332786 |
| 11 | Ga0055526_1000293 | 3300003771 | Bacteria | 41865 |
| 12 | Ga0055540_1002727 | 3300003792 | Bacteria | 9079 |
| 13 | Ga0055531_10000078 | 3300003794 | Bacteria | 105599 |
| 14 | Ga0055531_10002166 | 3300003794 | Bacteria | 13420 |
| 15 | Ga0065707_10228158 | 3300005295 | Bacteria | 1199 |
| 16 | Ga0070658_10049549 | 3300005327 | Bacteria | 3403 |
| 17 | Ga0070658_10080848 | 3300005327 | Bacteria | 2669 |
| 18 | Ga0070658_10473109 | 3300005327 | Bacteria | 1081 |
| 19 | Ga0070683_100089986 | 3300005329 | Bacteria | 2881 |
| 20 | Ga0070683_100125566 | 3300005329 | Bacteria | 2426 |
| 21 | Ga0070683_100421179 | 3300005329 | Bacteria | 1274 |
| 22 | Ga0070690_100011765 | 3300005330 | Bacteria | 5130 |
| 23 | Ga0070670_100150132 | 3300005331 | Bacteria | 2017 |
| 24 | Ga0070677_10139964 | 3300005333 | Bacteria | 1115 |
| 25 | Ga0068869_100087693 | 3300005334 | Bacteria | 2335 |
| 26 | Ga0070666_10214394 | 3300005335 | Bacteria | 1357 |
| 27 | Ga0070680_100005109 | 3300005336 | Bacteria | 9903 |
| 28 | Ga0070680_100017277 | 3300005336 | Bacteria | 5685 |
| 29 | Ga0070682_100002922 | 3300005337 | Bacteria | 9476 |
| 30 | Ga0070682_100027069 | 3300005337 | Bacteria | 3438 |
| 31 | Ga0070682_100032951 | 3300005337 | Bacteria | 3144 |
| 32 | Ga0070682_100039128 | 3300005337 | Bacteria | 2912 |
| 33 | Ga0070682_100042118 | 3300005337 | Bacteria | 2817 |
| 34 | Ga0070682_100221705 | 3300005337 | Viruses | 1346 |
| 35 | Ga0068868_100010275 | 3300005338 | Bacteria | 6769 |
| 36 | Ga0068868_100052341 | 3300005338 | Bacteria | 3214 |
| 37 | Ga0068868_100136638 | 3300005338 | Bacteria | 2010 |
| 38 | Ga0070660_100004961 | 3300005339 | Bacteria | 9202 |
| 39 | Ga0070660_100366557 | 3300005339 | Bacteria | 1188 |
| 40 | Ga0070689_100022952 | 3300005340 | Bacteria | 4666 |
| 41 | Ga0070689_100023186 | 3300005340 | Bacteria | 4644 |
| 42 | Ga0070691_10158650 | 3300005341 | Bacteria | 1165 |
| 43 | Ga0070661_100006246 | 3300005344 | Bacteria | 8219 |
| 44 | Ga0070661_100008803 | 3300005344 | Bacteria | 6986 |
| 45 | Ga0070661_100047421 | 3300005344 | Bacteria | 3144 |
| 46 | Ga0070661_100252453 | 3300005344 | Bacteria | 1361 |
| 47 | Ga0070692_10072857 | 3300005345 | Bacteria | 1834 |
| 48 | Ga0070668_100004324 | 3300005347 | Bacteria | 10540 |
| 49 | Ga0070669_100022894 | 3300005353 | Bacteria | 4469 |
| 50 | Ga0070675_100114893 | 3300005354 | Bacteria | 2281 |
| 51 | Ga0070675_100242529 | 3300005354 | Bacteria | 1575 |
| 52 | Ga0070675_100329318 | 3300005354 | Bacteria | 1350 |
| 53 | Ga0070671_100035374 | 3300005355 | Bacteria | 4138 |
| 54 | Ga0070671_100044909 | 3300005355 | Bacteria | 3671 |
| 55 | Ga0070671_100081797 | 3300005355 | Bacteria | 2700 |
| 56 | Ga0070671_100129926 | 3300005355 | Bacteria | 2121 |
| 57 | Ga0070674_100004266 | 3300005356 | Bacteria | 8133 |
| 58 | Ga0070674_100067388 | 3300005356 | Bacteria | 2517 |
| 59 | Ga0070674_100214348 | 3300005356 | Bacteria | 1494 |
| 60 | Ga0070673_100076407 | 3300005364 | Bacteria | 2704 |
| 61 | Ga0070673_100313496 | 3300005364 | Bacteria | 1384 |
| 62 | Ga0070667_100000008 | 3300005367 | Bacteria | 285591 |
| 63 | Ga0070667_100010404 | 3300005367 | Bacteria | 7678 |
| 64 | Ga0070667_100192215 | 3300005367 | Bacteria | 1808 |
| 65 | Ga0070714_100099982 | 3300005435 | Bacteria | 2554 |
| 66 | Ga0070714_100579851 | 3300005435 | Bacteria | 1076 |
| 67 | Ga0070701_10002941 | 3300005438 | Bacteria | 6650 |
| 68 | Ga0070701_10025823 | 3300005438 | Bacteria | 2857 |
| 69 | Ga0070701_10041361 | 3300005438 | Bacteria | 2348 |
| 70 | Ga0070711_100206607 | 3300005439 | Bacteria | 1518 |
| 71 | Ga0070711_100297100 | 3300005439 | Bacteria | 1283 |
| 72 | Ga0070711_100403710 | 3300005439 | Bacteria | 1110 |
| 73 | Ga0070705_100005615 | 3300005440 | Bacteria | 6121 |
| 74 | Ga0070700_100013330 | 3300005441 | Bacteria | 4617 |
| 75 | Ga0070700_100042777 | 3300005441 | Bacteria | 2783 |
| 76 | Ga0070694_100037308 | 3300005444 | Bacteria | 3223 |
| 77 | Ga0070663_100000355 | 3300005455 | Bacteria | 24103 |
| 78 | Ga0070678_100016769 | 3300005456 | Bacteria | 4695 |
| 79 | Ga0070678_100150478 | 3300005456 | Bacteria | 1874 |
| 80 | Ga0070681_10002979 | 3300005458 | Bacteria | 15707 |
| 81 | Ga0070681_10011372 | 3300005458 | Bacteria | 8806 |
| 82 | Ga0070681_10061424 | 3300005458 | Bacteria | 3732 |
| 83 | Ga0068867_100000062 | 3300005459 | Bacteria | 65188 |
| 84 | Ga0068867_100000675 | 3300005459 | Bacteria | 22603 |
| 85 | Ga0068867_100016982 | 3300005459 | Bacteria | 5172 |
| 86 | Ga0068867_100018227 | 3300005459 | Bacteria | 4988 |
| 87 | Ga0068867_100059364 | 3300005459 | Bacteria | 2836 |
| 88 | Ga0070685_10146862 | 3300005466 | Bacteria | 1490 |
| 89 | Ga0070685_10158865 | 3300005466 | Bacteria | 1439 |
| 90 | Ga0070698_100220594 | 3300005471 | Bacteria | 1830 |
| 91 | Ga0070679_100001081 | 3300005530 | Bacteria | 23804 |
| 92 | Ga0070679_100004413 | 3300005530 | Bacteria | 13012 |
| 93 | Ga0070684_100021170 | 3300005535 | Bacteria | 5405 |
| 94 | Ga0070684_100131004 | 3300005535 | Bacteria | 2262 |
| 95 | Ga0070684_100280975 | 3300005535 | Bacteria | 1525 |
| 96 | Ga0068853_100019247 | 3300005539 | Bacteria | 5658 |
| 97 | Ga0068853_100037636 | 3300005539 | Bacteria | 4117 |
| 98 | Ga0068853_100047061 | 3300005539 | Bacteria | 3701 |
| 99 | Ga0068853_100098424 | 3300005539 | Bacteria | 2583 |
| 100 | Ga0070672_100032355 | 3300005543 | Bacteria | 3946 |
| 101 | Ga0070672_100128402 | 3300005543 | Bacteria | 2081 |
| 102 | Ga0070672_100212240 | 3300005543 | Bacteria | 1621 |
| 103 | Ga0070672_100256899 | 3300005543 | Bacteria | 1473 |
| 104 | Ga0070672_100259004 | 3300005543 | Bacteria | 1466 |
| 105 | Ga0070672_100412910 | 3300005543 | Bacteria | 1158 |
| 106 | Ga0070686_100011866 | 3300005544 | Bacteria | 4952 |
| 107 | Ga0070695_100109718 | 3300005545 | Bacteria | 1870 |
| 108 | Ga0070696_100000773 | 3300005546 | Bacteria | 20568 |
| 109 | Ga0070693_100038455 | 3300005547 | Bacteria | 2674 |
| 110 | Ga0070693_100074747 | 3300005547 | Bacteria | 2005 |
| 111 | Ga0070665_100002002 | 3300005548 | Bacteria | 22928 |
| 112 | Ga0070665_100004489 | 3300005548 | Bacteria | 14649 |
| 113 | Ga0070704_100001401 | 3300005549 | Bacteria | 12837 |
| 114 | Ga0068855_100009516 | 3300005563 | Bacteria | 11735 |
| 115 | Ga0068855_100034076 | 3300005563 | Bacteria | 6075 |
| 116 | Ga0070664_100033357 | 3300005564 | Bacteria | 4312 |
| 117 | Ga0070664_100074127 | 3300005564 | Bacteria | 2921 |
| 118 | Ga0068857_100032455 | 3300005577 | Bacteria | 4617 |
| 119 | Ga0068854_100006057 | 3300005578 | Bacteria | 7667 |
| 120 | Ga0068854_100067159 | 3300005578 | Bacteria | 2612 |
| 121 | Ga0068854_100162915 | 3300005578 | Bacteria | 1729 |
| 122 | Ga0068856_100053527 | 3300005614 | Bacteria | 3980 |
| 123 | Ga0068856_100189944 | 3300005614 | Bacteria | 2068 |
| 124 | Ga0068856_100216857 | 3300005614 | Bacteria | 1929 |
| 125 | Ga0068856_100356838 | 3300005614 | Bacteria | 1481 |
| 126 | Ga0070702_100001389 | 3300005615 | Bacteria | 9898 |
| 127 | Ga0070702_100007685 | 3300005615 | Bacteria | 5174 |
| 128 | Ga0070702_100228503 | 3300005615 | Bacteria | 1249 |
| 129 | Ga0068852_100007382 | 3300005616 | Bacteria | 8021 |
| 130 | Ga0068859_100001285 | 3300005617 | Bacteria | 25633 |
| 131 | Ga0068859_100085198 | 3300005617 | Bacteria | 3205 |
| 132 | Ga0068859_100178560 | 3300005617 | Bacteria | 2205 |
| 133 | Ga0068859_100247261 | 3300005617 | Bacteria | 1873 |
| 134 | Ga0068859_100320565 | 3300005617 | Bacteria | 1644 |
| 135 | Ga0068859_100636357 | 3300005617 | Bacteria | 1159 |
| 136 | Ga0068861_100032965 | 3300005719 | Bacteria | 3818 |
| 137 | Ga0068861_100034550 | 3300005719 | Bacteria | 3739 |
| 138 | Ga0068861_100093196 | 3300005719 | Bacteria | 2381 |
| 139 | Ga0068861_100127803 | 3300005719 | Bacteria | 2059 |
| 140 | Ga0068861_100403256 | 3300005719 | Bacteria | 1214 |
| 141 | Ga0068863_100049842 | 3300005841 | Bacteria | 3970 |
| 142 | Ga0068863_100549147 | 3300005841 | Bacteria | 1141 |
| 143 | Ga0068858_100027232 | 3300005842 | Bacteria | 5311 |
| 144 | Ga0068860_100054821 | 3300005843 | Bacteria | 3789 |
| 145 | Ga0068860_100092759 | 3300005843 | Bacteria | 2877 |
| 146 | Ga0068860_100396467 | 3300005843 | Bacteria | 1365 |
| 147 | Ga0068862_100005211 | 3300005844 | Bacteria | 10923 |
| 148 | Ga0068862_100038065 | 3300005844 | Bacteria | 4078 |
| 149 | Ga0081455_10037738 | 3300005937 | Bacteria | 4285 |
| 150 | Ga0075365_10081904 | 3300006038 | Bacteria | 2188 |
| 151 | Ga0075363_100003316 | 3300006048 | Bacteria | 6824 |
| 152 | Ga0075363_100274267 | 3300006048 | Bacteria | 975 |
| 153 | Ga0075364_10000522 | 3300006051 | Bacteria | 19550 |
| 154 | Ga0075364_10001885 | 3300006051 | Bacteria | 11651 |
| 155 | Ga0075364_10039815 | 3300006051 | Bacteria | 3048 |
| 156 | Ga0075364_10041738 | 3300006051 | Bacteria | 2979 |
| 157 | Ga0075364_10059166 | 3300006051 | Bacteria | 2511 |
| 158 | Ga0075364_10161499 | 3300006051 | Bacteria | 1512 |
| 159 | Ga0075364_10196528 | 3300006051 | Bacteria | 1367 |
| 160 | Ga0075432_10002065 | 3300006058 | Bacteria | 6678 |
| 161 | Ga0070715_10090782 | 3300006163 | Bacteria | 1405 |
| 162 | Ga0070712_100021643 | 3300006175 | Bacteria | 4226 |
| 163 | Ga0075366_10083444 | 3300006195 | Bacteria | 1910 |
| 164 | Ga0075366_10160404 | 3300006195 | Bacteria | 1363 |
| 165 | Ga0097621_100023231 | 3300006237 | Bacteria | 4823 |
| 166 | Ga0097621_100295486 | 3300006237 | Bacteria | 1429 |
| 167 | Ga0075370_10000712 | 3300006353 | Bacteria | 13154 |
| 168 | Ga0075370_10013593 | 3300006353 | Bacteria | 4332 |
| 169 | Ga0068871_100022719 | 3300006358 | Bacteria | 4840 |
| 170 | Ga0068871_100046838 | 3300006358 | Bacteria | 3484 |
| 171 | Ga0068871_100398231 | 3300006358 | Bacteria | 1226 |
| 172 | Ga0075428_100062670 | 3300006844 | Bacteria | 4070 |
| 173 | Ga0075431_100080184 | 3300006847 | Bacteria | 3370 |
| 174 | Ga0068865_100026457 | 3300006881 | Bacteria | 3825 |
| 175 | Ga0068865_100053528 | 3300006881 | Bacteria | 2800 |
| 176 | Ga0075436_100001954 | 3300006914 | Bacteria | 14208 |
| 177 | Ga0097620_100001285 | 3300006931 | Bacteria | 25633 |
| 178 | Ga0097620_100085195 | 3300006931 | Bacteria | 3205 |
| 179 | Ga0097620_100178561 | 3300006931 | Bacteria | 2205 |
| 180 | Ga0097620_100247270 | 3300006931 | Bacteria | 1873 |
| 181 | Ga0097620_100320547 | 3300006931 | Bacteria | 1644 |
| 182 | Ga0097620_100636428 | 3300006931 | Bacteria | 1159 |
| 183 | Ga0105244_10007496 | 3300009036 | Bacteria | 6930 |
| 184 | Ga0105240_10006132 | 3300009093 | Bacteria | 17731 |
| 185 | Ga0105240_10012361 | 3300009093 | Bacteria | 11789 |
| 186 | Ga0105240_10015317 | 3300009093 | Bacteria | 10431 |
| 187 | Ga0105240_10196167 | 3300009093 | Bacteria | 2370 |
| 188 | Ga0111539_10211181 | 3300009094 | Bacteria | 2262 |
| 189 | Ga0111539_10212037 | 3300009094 | Bacteria | 2256 |
| 190 | Ga0111539_10350694 | 3300009094 | Bacteria | 1718 |
| 191 | Ga0105245_10007025 | 3300009098 | Bacteria | 9879 |
| 192 | Ga0105245_10243298 | 3300009098 | Bacteria | 1745 |
| 193 | Ga0105247_10001547 | 3300009101 | Bacteria | 16404 |
| 194 | Ga0105247_10003369 | 3300009101 | Bacteria | 10455 |
| 195 | Ga0105247_10013257 | 3300009101 | Bacteria | 4947 |
| 196 | Ga0105247_10045532 | 3300009101 | Bacteria | 2692 |
| 197 | Ga0114129_10037345 | 3300009147 | Bacteria | 6859 |
| 198 | Ga0114129_10093003 | 3300009147 | Bacteria | 4178 |
| 199 | Ga0114129_10149653 | 3300009147 | Bacteria | 3195 |
| 200 | Ga0114129_10558531 | 3300009147 | Bacteria | 1488 |
| 201 | Ga0105243_10002846 | 3300009148 | Bacteria | 14356 |
| 202 | Ga0105243_10032381 | 3300009148 | Bacteria | 4039 |
| 203 | Ga0105243_10130275 | 3300009148 | Bacteria | 2133 |
| 204 | Ga0105243_10213831 | 3300009148 | Bacteria | 1699 |
| 205 | Ga0105243_10316223 | 3300009148 | Bacteria | 1421 |
| 206 | Ga0105243_10349658 | 3300009148 | Bacteria | 1357 |
| 207 | Ga0105241_10015631 | 3300009174 | Bacteria | 5561 |
| 208 | Ga0105242_10005276 | 3300009176 | Bacteria | 9978 |
| 209 | Ga0105248_10024774 | 3300009177 | Bacteria | 6673 |
| 210 | Ga0105248_10067887 | 3300009177 | Bacteria | 4003 |
| 211 | Ga0105237_10005469 | 3300009545 | Bacteria | 14334 |
| 212 | Ga0105237_10008525 | 3300009545 | Bacteria | 11083 |
| 213 | Ga0105237_10016653 | 3300009545 | Bacteria | 7635 |
| 214 | Ga0105237_10107336 | 3300009545 | Bacteria | 2784 |
| 215 | Ga0105237_10155191 | 3300009545 | Bacteria | 2286 |
| 216 | Ga0105238_10056195 | 3300009551 | Bacteria | 3949 |
| 217 | Ga0105249_10001615 | 3300009553 | Bacteria | 19734 |
| 218 | Ga0105249_10182421 | 3300009553 | Bacteria | 2043 |
| 219 | Ga0105249_10617884 | 3300009553 | Bacteria | 1139 |
| 220 | Ga0105239_10012611 | 3300010375 | Bacteria | 9405 |
| 221 | Ga0105239_10029163 | 3300010375 | Bacteria | 6066 |
| 222 | Ga0105239_10038886 | 3300010375 | Bacteria | 5212 |
| 223 | Ga0105239_10075481 | 3300010375 | Bacteria | 3707 |
| 224 | Ga0105239_10235805 | 3300010375 | Bacteria | 2053 |
| 225 | Ga0105246_10002960 | 3300011119 | Bacteria | 10295 |
| 226 | Ga0105246_10115557 | 3300011119 | Bacteria | 1979 |
| 227 | Ga0105246_10181510 | 3300011119 | Bacteria | 1621 |
| 228 | Ga0157373_10194599 | 3300013100 | Bacteria | 1429 |
| 229 | Ga0157371_10047597 | 3300013102 | Bacteria | 3049 |
| 230 | Ga0157371_10151000 | 3300013102 | Bacteria | 1657 |
| 231 | Ga0157369_10004228 | 3300013105 | Bacteria | 17006 |
| 232 | Ga0157369_10088461 | 3300013105 | Bacteria | 3306 |
| 233 | Ga0157369_10167091 | 3300013105 | Bacteria | 2320 |
| 234 | Ga0157369_10405524 | 3300013105 | Bacteria | 1414 |
| 235 | Ga0157374_10006773 | 3300013296 | Bacteria | 9742 |
| 236 | Ga0157374_10014955 | 3300013296 | Bacteria | 6800 |
| 237 | Ga0157374_10054338 | 3300013296 | Bacteria | 3736 |
| 238 | Ga0157374_10187661 | 3300013296 | Bacteria | 2022 |
| 239 | Ga0157378_10013225 | 3300013297 | Bacteria | 7216 |
| 240 | Ga0157378_10065174 | 3300013297 | Bacteria | 3260 |
| 241 | Ga0157378_10244783 | 3300013297 | Bacteria | 1715 |
| 242 | Ga0163162_10010063 | 3300013306 | Bacteria | 9195 |
| 243 | Ga0163162_10052990 | 3300013306 | Bacteria | 4077 |
| 244 | Ga0163162_10125176 | 3300013306 | Bacteria | 2676 |
| 245 | Ga0163162_10171681 | 3300013306 | Bacteria | 2293 |
| 246 | Ga0163162_10831317 | 3300013306 | Bacteria | 1040 |
| 247 | Ga0157372_10006463 | 3300013307 | Bacteria | 12479 |
| 248 | Ga0157372_10043580 | 3300013307 | Bacteria | 4968 |
| 249 | Ga0157372_10138304 | 3300013307 | Bacteria | 2805 |
| 250 | Ga0157372_10164748 | 3300013307 | Bacteria | 2563 |
| 251 | Ga0157372_10387090 | 3300013307 | Bacteria | 1629 |
| 252 | Ga0157375_10009390 | 3300013308 | Bacteria | 8586 |
| 253 | Ga0157375_10011713 | 3300013308 | Bacteria | 7751 |
| 254 | Ga0157375_10091545 | 3300013308 | Bacteria | 3103 |
| 255 | Ga0157375_10267273 | 3300013308 | Bacteria | 1872 |
| 256 | Ga0157375_10532289 | 3300013308 | Bacteria | 1338 |
| 257 | Ga0157375_10958873 | 3300013308 | Bacteria | 997 |
| 258 | Ga0163163_10102409 | 3300014325 | Bacteria | 2887 |
| 259 | Ga0157380_10002734 | 3300014326 | Bacteria | 11979 |
| 260 | Ga0157380_10046254 | 3300014326 | Bacteria | 3417 |
| 261 | Ga0157380_10048707 | 3300014326 | Bacteria | 3339 |
| 262 | Ga0157380_10176264 | 3300014326 | Bacteria | 1874 |
| 263 | Ga0157380_10263625 | 3300014326 | Bacteria | 1566 |
| 264 | Ga0157380_10355125 | 3300014326 | Bacteria | 1373 |
| 265 | Ga0157380_10572866 | 3300014326 | Bacteria | 1112 |
| 266 | Ga0157380_10874733 | 3300014326 | Bacteria | 922 |
| 267 | Ga0157379_10030835 | 3300014968 | Bacteria | 4775 |
| 268 | Ga0157379_10034941 | 3300014968 | Bacteria | 4481 |
| 269 | Ga0157379_10149067 | 3300014968 | Bacteria | 2110 |
| 270 | Ga0157376_10006548 | 3300014969 | Bacteria | 8241 |
| 271 | Ga0157376_10417558 | 3300014969 | Bacteria | 1301 |
| 272 | Ga0157376_10423457 | 3300014969 | Bacteria | 1293 |
| 273 | Ga0163161_10004372 | 3300017792 | Bacteria | 9850 |
| 274 | Ga0163161_10134521 | 3300017792 | Bacteria | 1868 |
| 275 | Ga0163161_10177895 | 3300017792 | Bacteria | 1629 |
| 276 | Ga0206356_10016337 | 3300020070 | Bacteria | 2524 |
| 277 | Ga0206356_10536592 | 3300020070 | Bacteria | 1458 |
| 278 | Ga0206353_10861374 | 3300020082 | Bacteria | 5391 |
| 279 | Ga0213872_10000074 | 3300021361 | Bacteria | 90986 |
| 280 | Ga0213872_10000409 | 3300021361 | Bacteria | 35220 |
| 281 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 282 | Ga0209147_100699 | 3300025229 | Bacteria | 17130 |
| 283 | Ga0207427_100010 | 3300025231 | Bacteria | 648610 |
| 284 | Ga0209437_100216 | 3300025233 | Bacteria | 106353 |
| 285 | Ga0209258_101354 | 3300025242 | Bacteria | 8916 |
| 286 | Ga0207425_1000158 | 3300025245 | Bacteria | 57310 |
| 287 | Ga0209148_1000015 | 3300025254 | Bacteria | 850103 |
| 288 | Ga0209148_1003211 | 3300025254 | Bacteria | 4682 |
| 289 | Ga0209129_1000169 | 3300025258 | Bacteria | 96253 |
| 290 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 291 | Ga0209455_1000013 | 3300025272 | Bacteria | 850103 |
| 292 | Ga0209673_1006885 | 3300025273 | Bacteria | 5384 |
| 293 | Ga0209025_1000019 | 3300025294 | Bacteria | 631548 |
| 294 | Ga0209564_1000057 | 3300025295 | Bacteria | 340400 |
| 295 | Ga0209758_1000461 | 3300025297 | Bacteria | 67480 |
| 296 | Ga0209758_1001104 | 3300025297 | Bacteria | 34835 |
| 297 | Ga0209050_1009414 | 3300025298 | Bacteria | 5004 |
| 298 | Ga0209051_1000136 | 3300025303 | Bacteria | 138015 |
| 299 | Ga0209051_1009285 | 3300025303 | Bacteria | 5083 |
| 300 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 301 | Ga0209257_1000055 | 3300025304 | Bacteria | 415534 |
| 302 | Ga0207697_10016969 | 3300025315 | Bacteria | 2994 |
| 303 | Ga0207655_1092409 | 3300025728 | Bacteria | 1062 |
| 304 | Ga0207692_10023134 | 3300025898 | Bacteria | 2870 |
| 305 | Ga0207710_10004119 | 3300025900 | Bacteria | 6387 |
| 306 | Ga0207710_10006561 | 3300025900 | Bacteria | 4960 |
| 307 | Ga0207680_10012655 | 3300025903 | Bacteria | 4306 |
| 308 | Ga0207680_10078937 | 3300025903 | Bacteria | 2063 |
| 309 | Ga0207647_10014906 | 3300025904 | Bacteria | 5342 |
| 310 | Ga0207647_10017033 | 3300025904 | Bacteria | 4947 |
| 311 | Ga0207647_10045604 | 3300025904 | Bacteria | 2734 |
| 312 | Ga0207685_10010204 | 3300025905 | Bacteria | 2762 |
| 313 | Ga0207699_10090585 | 3300025906 | Bacteria | 1919 |
| 314 | Ga0207645_10055143 | 3300025907 | Bacteria | 2538 |
| 315 | Ga0207643_10123455 | 3300025908 | Bacteria | 1536 |
| 316 | Ga0207705_10134850 | 3300025909 | Bacteria | 1840 |
| 317 | Ga0207705_10209896 | 3300025909 | Bacteria | 1477 |
| 318 | Ga0207707_10014181 | 3300025912 | Bacteria | 6943 |
| 319 | Ga0207707_10036847 | 3300025912 | Bacteria | 4274 |
| 320 | Ga0207707_10057360 | 3300025912 | Bacteria | 3389 |
| 321 | Ga0207707_10331329 | 3300025912 | Bacteria | 1313 |
| 322 | Ga0207695_10012431 | 3300025913 | Bacteria | 10221 |
| 323 | Ga0207695_10017318 | 3300025913 | Bacteria | 8389 |
| 324 | Ga0207695_10149008 | 3300025913 | Bacteria | 2280 |
| 325 | Ga0207695_10246561 | 3300025913 | Bacteria | 1686 |
| 326 | Ga0207671_10000298 | 3300025914 | Bacteria | 73044 |
| 327 | Ga0207671_10000531 | 3300025914 | Bacteria | 51420 |
| 328 | Ga0207671_10009743 | 3300025914 | Bacteria | 7997 |
| 329 | Ga0207671_10065482 | 3300025914 | Bacteria | 2703 |
| 330 | Ga0207663_10000354 | 3300025916 | Bacteria | 19988 |
| 331 | Ga0207660_10052066 | 3300025917 | Bacteria | 2913 |
| 332 | Ga0207660_10296353 | 3300025917 | Bacteria | 1287 |
| 333 | Ga0207660_10304181 | 3300025917 | Bacteria | 1270 |
| 334 | Ga0207662_10048350 | 3300025918 | Bacteria | 2520 |
| 335 | Ga0207657_10009492 | 3300025919 | Bacteria | 9774 |
| 336 | Ga0207649_10007727 | 3300025920 | Bacteria | 5850 |
| 337 | Ga0207649_10059727 | 3300025920 | Bacteria | 2393 |
| 338 | Ga0207649_10062939 | 3300025920 | Bacteria | 2340 |
| 339 | Ga0207652_10024066 | 3300025921 | Bacteria | 5051 |
| 340 | Ga0207652_10028517 | 3300025921 | Bacteria | 4658 |
| 341 | Ga0207652_10260757 | 3300025921 | Bacteria | 1563 |
| 342 | Ga0207681_10204777 | 3300025923 | Bacteria | 1517 |
| 343 | Ga0207694_10132563 | 3300025924 | Bacteria | 1998 |
| 344 | Ga0207659_10101311 | 3300025926 | Bacteria | 2172 |
| 345 | Ga0207659_10171194 | 3300025926 | Bacteria | 1713 |
| 346 | Ga0207659_10179176 | 3300025926 | Bacteria | 1677 |
| 347 | Ga0207687_10003626 | 3300025927 | Bacteria | 10404 |
| 348 | Ga0207687_10291522 | 3300025927 | Bacteria | 1311 |
| 349 | Ga0207644_10046203 | 3300025931 | Bacteria | 3101 |
| 350 | Ga0207644_10120084 | 3300025931 | Bacteria | 2000 |
| 351 | Ga0207644_10289394 | 3300025931 | Bacteria | 1317 |
| 352 | Ga0207690_10043829 | 3300025932 | Bacteria | 2946 |
| 353 | Ga0207690_10230557 | 3300025932 | Bacteria | 1421 |
| 354 | Ga0207706_10005428 | 3300025933 | Bacteria | 11881 |
| 355 | Ga0207709_10000015 | 3300025935 | Bacteria | 493221 |
| 356 | Ga0207709_10039670 | 3300025935 | Bacteria | 2814 |
| 357 | Ga0207709_10090315 | 3300025935 | Bacteria | 2000 |
| 358 | Ga0207709_10108931 | 3300025935 | Bacteria | 1848 |
| 359 | Ga0207709_10151848 | 3300025935 | Bacteria | 1605 |
| 360 | Ga0207709_10211734 | 3300025935 | Bacteria | 1392 |
| 361 | Ga0207709_10347609 | 3300025935 | Bacteria | 1118 |
| 362 | Ga0207670_10056413 | 3300025936 | Bacteria | 2659 |
| 363 | Ga0207669_10089918 | 3300025937 | Bacteria | 1995 |
| 364 | Ga0207669_10401761 | 3300025937 | Bacteria | 1073 |
| 365 | Ga0207704_10017638 | 3300025938 | Bacteria | 3707 |
| 366 | Ga0207691_10000649 | 3300025940 | Bacteria | 34369 |
| 367 | Ga0207691_10044818 | 3300025940 | Bacteria | 4070 |
| 368 | Ga0207691_10091498 | 3300025940 | Bacteria | 2726 |
| 369 | Ga0207691_10408426 | 3300025940 | Bacteria | 1158 |
| 370 | Ga0207711_10037926 | 3300025941 | Bacteria | 4096 |
| 371 | Ga0207689_10071436 | 3300025942 | Bacteria | 2851 |
| 372 | Ga0207689_10118624 | 3300025942 | Bacteria | 2176 |
| 373 | Ga0207661_10001700 | 3300025944 | Bacteria | 15014 |
| 374 | Ga0207661_10107336 | 3300025944 | Bacteria | 2355 |
| 375 | Ga0207661_10160298 | 3300025944 | Bacteria | 1951 |
| 376 | Ga0207661_10540949 | 3300025944 | Bacteria | 1066 |
| 377 | Ga0207679_10058180 | 3300025945 | Bacteria | 2863 |
| 378 | Ga0207679_10081258 | 3300025945 | Bacteria | 2478 |
| 379 | Ga0207667_10257789 | 3300025949 | Bacteria | 1783 |
| 380 | Ga0207651_10008075 | 3300025960 | Bacteria | 5653 |
| 381 | Ga0207651_10319701 | 3300025960 | Bacteria | 1297 |
| 382 | Ga0207651_10377601 | 3300025960 | Bacteria | 1200 |
| 383 | Ga0207712_10154929 | 3300025961 | Bacteria | 1774 |
| 384 | Ga0207712_10508790 | 3300025961 | Bacteria | 1030 |
| 385 | Ga0207640_10006698 | 3300025981 | Bacteria | 6329 |
| 386 | Ga0207640_10020142 | 3300025981 | Bacteria | 3956 |
| 387 | Ga0207658_10000030 | 3300025986 | Bacteria | 168693 |
| 388 | Ga0207658_10023960 | 3300025986 | Bacteria | 4265 |
| 389 | Ga0207658_10130242 | 3300025986 | Bacteria | 2020 |
| 390 | Ga0207658_10409862 | 3300025986 | Bacteria | 1193 |
| 391 | Ga0207677_10004032 | 3300026023 | Bacteria | 7841 |
| 392 | Ga0207677_10106932 | 3300026023 | Bacteria | 2074 |
| 393 | Ga0207677_10229822 | 3300026023 | Bacteria | 1493 |
| 394 | Ga0207639_10162456 | 3300026041 | Bacteria | 1883 |
| 395 | Ga0207639_10226107 | 3300026041 | Bacteria | 1619 |
| 396 | Ga0207678_10001274 | 3300026067 | Bacteria | 23306 |
| 397 | Ga0207678_10527791 | 3300026067 | Bacteria | 1031 |
| 398 | Ga0207708_10003996 | 3300026075 | Bacteria | 10851 |
| 399 | Ga0207708_10022120 | 3300026075 | Bacteria | 4802 |
| 400 | Ga0207708_10154181 | 3300026075 | Bacteria | 1811 |
| 401 | Ga0207708_10201076 | 3300026075 | Bacteria | 1590 |
| 402 | Ga0207702_10001783 | 3300026078 | Bacteria | 21204 |
| 403 | Ga0207702_10036365 | 3300026078 | Bacteria | 4119 |
| 404 | Ga0207702_10212942 | 3300026078 | Bacteria | 1797 |
| 405 | Ga0207641_10002088 | 3300026088 | Bacteria | 18922 |
| 406 | Ga0207641_10421546 | 3300026088 | Bacteria | 1285 |
| 407 | Ga0207648_10000308 | 3300026089 | Bacteria | 53542 |
| 408 | Ga0207648_10011691 | 3300026089 | Bacteria | 8260 |
| 409 | Ga0207648_10039040 | 3300026089 | Bacteria | 4176 |
| 410 | Ga0207648_10062502 | 3300026089 | Bacteria | 3246 |
| 411 | Ga0207648_10269309 | 3300026089 | Bacteria | 1521 |
| 412 | Ga0207676_10509248 | 3300026095 | Bacteria | 1144 |
| 413 | Ga0207674_10013815 | 3300026116 | Bacteria | 8933 |
| 414 | Ga0207674_10063688 | 3300026116 | Bacteria | 3721 |
| 415 | Ga0207675_100019521 | 3300026118 | Bacteria | 6326 |
| 416 | Ga0207675_100037495 | 3300026118 | Bacteria | 4521 |
| 417 | Ga0207675_100109812 | 3300026118 | Bacteria | 2602 |
| 418 | Ga0207683_10026364 | 3300026121 | Bacteria | 5016 |
| 419 | Ga0207683_10257665 | 3300026121 | Bacteria | 1593 |
| 420 | Ga0207698_10012402 | 3300026142 | Bacteria | 5575 |
| 421 | Ga0209974_10019930 | 3300027876 | Bacteria | 2223 |
| 422 | Ga0268266_10003633 | 3300028379 | Bacteria | 15260 |
| 423 | Ga0268266_10003842 | 3300028379 | Bacteria | 14665 |
| 424 | Ga0268266_10020043 | 3300028379 | Bacteria | 5700 |
| 425 | Ga0268266_10042458 | 3300028379 | Bacteria | 3884 |
| 426 | Ga0268266_10090247 | 3300028379 | Bacteria | 2686 |
| 427 | Ga0268265_10023681 | 3300028380 | Bacteria | 4332 |
| 428 | Ga0268265_10099463 | 3300028380 | Bacteria | 2345 |
| 429 | Ga0268265_10245461 | 3300028380 | Bacteria | 1582 |
| 430 | Ga0268264_10113523 | 3300028381 | Bacteria | 2377 |
| 431 | Ga0265337_1006251 | 3300028556 | Bacteria | 4619 |
| 432 | Ga0265334_10044564 | 3300028573 | Bacteria | 1722 |
| 433 | Ga0307515_10000469 | 3300028794 | Bacteria | 96345 |
| 434 | Ga0307515_10000902 | 3300028794 | Bacteria | 68371 |
| 435 | Ga0307515_10001683 | 3300028794 | Bacteria | 49294 |
| 436 | Ga0307515_10023814 | 3300028794 | Bacteria | 10705 |
| 437 | Ga0307515_10066900 | 3300028794 | Bacteria | 4967 |
| 438 | Ga0265338_10012629 | 3300028800 | Bacteria | 9617 |
| 439 | Ga0307512_10182329 | 3300030522 | Bacteria | 1177 |
| 440 | Ga0265332_10009134 | 3300031238 | Bacteria | 4433 |
| 441 | Ga0265327_10000006 | 3300031251 | Bacteria | 693716 |
| 442 | Ga0307513_10009513 | 3300031456 | Bacteria | 12291 |
| 443 | Ga0307513_10013150 | 3300031456 | Bacteria | 10171 |
| 444 | Ga0307513_10040324 | 3300031456 | Bacteria | 5165 |
| 445 | Ga0307513_10143501 | 3300031456 | Bacteria | 2309 |
| 446 | Ga0307509_10469293 | 3300031507 | Bacteria | 949 |
| 447 | Ga0307408_100031909 | 3300031548 | Bacteria | 3670 |
| 448 | Ga0307408_100039139 | 3300031548 | Bacteria | 3349 |
| 449 | Ga0307408_100075319 | 3300031548 | Bacteria | 2507 |
| 450 | Ga0307408_100425666 | 3300031548 | Bacteria | 1146 |
| 451 | Ga0307408_100563352 | 3300031548 | Bacteria | 1007 |
| 452 | Ga0265314_10001118 | 3300031711 | Bacteria | 30992 |
| 453 | Ga0316576_10003801 | 3300031727 | Bacteria | 8930 |
| 454 | Ga0316576_10007014 | 3300031727 | Bacteria | 7053 |
| 455 | Ga0316578_10151641 | 3300031728 | Bacteria | 1396 |
| 456 | Ga0307405_10027682 | 3300031731 | Bacteria | 3291 |
| 457 | Ga0307405_10061776 | 3300031731 | Bacteria | 2369 |
| 458 | Ga0307405_10124955 | 3300031731 | Bacteria | 1767 |
| 459 | Ga0307405_10244355 | 3300031731 | Bacteria | 1331 |
| 460 | Ga0316577_10250444 | 3300031733 | Bacteria | 1002 |
| 461 | Ga0307413_10010467 | 3300031824 | Bacteria | 4501 |
| 462 | Ga0307413_10019310 | 3300031824 | Bacteria | 3598 |
| 463 | Ga0307413_10085244 | 3300031824 | Bacteria | 2039 |
| 464 | Ga0307413_10085932 | 3300031824 | Bacteria | 2033 |
| 465 | Ga0307413_10148021 | 3300031824 | Bacteria | 1632 |
| 466 | Ga0307410_10003842 | 3300031852 | Bacteria | 7632 |
| 467 | Ga0307410_10008303 | 3300031852 | Bacteria | 5753 |
| 468 | Ga0307410_10016794 | 3300031852 | Bacteria | 4376 |
| 469 | Ga0307410_10061993 | 3300031852 | Bacteria | 2561 |
| 470 | Ga0307410_10074718 | 3300031852 | Bacteria | 2361 |
| 471 | Ga0307410_10631706 | 3300031852 | Bacteria | 896 |
| 472 | Ga0307406_10000263 | 3300031901 | Bacteria | 31677 |
| 473 | Ga0307406_10018481 | 3300031901 | Bacteria | 4074 |
| 474 | Ga0307406_10122421 | 3300031901 | Bacteria | 1811 |
| 475 | Ga0307407_10136041 | 3300031903 | Bacteria | 1579 |
| 476 | Ga0307412_10008293 | 3300031911 | Bacteria | 5922 |
| 477 | Ga0307412_10010075 | 3300031911 | Bacteria | 5436 |
| 478 | Ga0307412_10011134 | 3300031911 | Bacteria | 5202 |
| 479 | Ga0307412_10181761 | 3300031911 | Bacteria | 1582 |
| 480 | Ga0307409_100024429 | 3300031995 | Bacteria | 4214 |
| 481 | Ga0307409_100029498 | 3300031995 | Bacteria | 3927 |
| 482 | Ga0307409_100066905 | 3300031995 | Bacteria | 2835 |
| 483 | Ga0307409_100478094 | 3300031995 | Bacteria | 1208 |
| 484 | Ga0307416_100022095 | 3300032002 | Bacteria | 4583 |
| 485 | Ga0307416_100024457 | 3300032002 | Bacteria | 4410 |
| 486 | Ga0307416_100094063 | 3300032002 | Bacteria | 2583 |
| 487 | Ga0307416_100134059 | 3300032002 | Bacteria | 2236 |
| 488 | Ga0307416_100151995 | 3300032002 | Bacteria | 2124 |
| 489 | Ga0307416_100165595 | 3300032002 | Bacteria | 2050 |
| 490 | Ga0307416_100279004 | 3300032002 | Bacteria | 1646 |
| 491 | Ga0307414_10009829 | 3300032004 | Bacteria | 5516 |
| 492 | Ga0307414_10594131 | 3300032004 | Bacteria | 992 |
| 493 | Ga0307415_100066941 | 3300032126 | Bacteria | 2509 |
| 494 | Ga0307415_100164484 | 3300032126 | Bacteria | 1724 |
| 495 | Ga0307415_100167014 | 3300032126 | Bacteria | 1712 |
| 496 | Ga0307415_100204068 | 3300032126 | Bacteria | 1571 |
| 497 | Ga0307510_10026590 | 3300033180 | Bacteria | 6647 |
| 498 | Ga0307510_10214430 | 3300033180 | Bacteria | 1444 |
| 499 | Ga0316574_0003199 | 3300035398 | Bacteria | 8387 |
| 500 | Ga0316574_0010713 | 3300035398 | Bacteria | 5191 |
| 501 | Ga0316574_0012049 | 3300035398 | Bacteria | 4935 |
| 502 | Ga0316574_0014079 | 3300035398 | Bacteria | 4614 |
| 503 | Ga0316574_0022777 | 3300035398 | Bacteria | 3735 |
| 504 | Ga0316574_0028264 | 3300035398 | Bacteria | 3381 |
| 505 | Ga0316574_0051034 | 3300035398 | Bacteria | 2577 |
| 506 | Ga0373931_0048290 | 3300035691 | Bacteria | 2256 |
| 507 | Ga0316582_0308537 | 3300036647 | Bacteria | 1088 |
| 508 | Ga0316584_0012638 | 3300036712 | Bacteria | 5956 |
| 509 | Ga0316584_0076136 | 3300036712 | Bacteria | 2514 |
| 510 | Ga0316584_0176109 | 3300036712 | Bacteria | 1585 |
| 511 | Ga0316584_0319696 | 3300036712 | Bacteria | 1120 |
| 512 | Ga0395899_0000006 | 3300037312 | Bacteria | 666341 |
| 513 | Ga0395899_0033199 | 3300037312 | Bacteria | 3877 |
| 514 | Ga0395899_0068763 | 3300037312 | Bacteria | 2596 |
| 515 | Ga0395900_0000378 | 3300037418 | Bacteria | 64374 |
| 516 | Ga0395900_0000774 | 3300037418 | Bacteria | 42584 |
| 517 | Ga0395900_0010538 | 3300037418 | Bacteria | 9456 |
| 518 | Ga0395900_0012591 | 3300037418 | Bacteria | 8654 |
| 519 | Ga0395900_0032840 | 3300037418 | Bacteria | 5338 |
| 520 | Ga0395900_0071874 | 3300037418 | Bacteria | 3557 |
| 521 | Ga0395900_0301695 | 3300037418 | Bacteria | 1588 |
| 522 | Ga0395900_0386464 | 3300037418 | Bacteria | 1366 |
| 523 | Ga0395898_0000015 | 3300037466 | Bacteria | 439819 |
| 524 | Ga0395898_0009381 | 3300037466 | Bacteria | 10277 |
| 525 | Ga0395898_0013268 | 3300037466 | Bacteria | 8487 |
| 526 | Ga0395898_0183554 | 3300037466 | Bacteria | 1999 |
| 527 | Ga0395898_0519631 | 3300037466 | Bacteria | 1132 |
| 528 | Ga0395905_0005120 | 3300037471 | Bacteria | 13467 |
| 529 | Ga0395905_0071188 | 3300037471 | Bacteria | 3260 |
| 530 | Ga0395905_0093212 | 3300037471 | Bacteria | 2824 |
| 531 | Ga0395905_0204943 | 3300037471 | Bacteria | 1849 |
| 532 | Ga0395905_0205552 | 3300037471 | Bacteria | 1845 |
| 533 | Ga0395905_0294667 | 3300037471 | Bacteria | 1509 |
| 534 | Ga0395905_0315639 | 3300037471 | Bacteria | 1452 |
| 535 | Ga0395901_0022015 | 3300038443 | Bacteria | 6533 |
| 536 | Ga0395901_0117043 | 3300038443 | Bacteria | 2800 |
| 537 | Ga0395901_0190305 | 3300038443 | Bacteria | 2152 |
| 538 | Ga0395901_0247183 | 3300038443 | Bacteria | 1859 |
| 539 | Ga0395901_0302510 | 3300038443 | Bacteria | 1658 |
| 540 | Ga0436361_0082864 | 3300039447 | Bacteria | 107951 |
| 541 | Ga0436361_0507289 | 3300039447 | Bacteria | 4197 |
| 542 | Ga0436361_0554943 | 3300039447 | Bacteria | 41374 |
| 543 | Ga0436361_0632651 | 3300039447 | Bacteria | 49929 |
| 544 | Ga0436361_0703210 | 3300039447 | Bacteria | 30399 |
| 545 | Ga0436361_0939166 | 3300039447 | Bacteria | 85026 |
| 546 | Ga0439466_0006490 | 3300041411 | Bacteria | 4445 |
| 547 | Ga0439466_0015492 | 3300041411 | Bacteria | 2768 |
| 548 | Ga0439466_0027865 | 3300041411 | Bacteria | 1954 |
| 549 | Ga0439465_0000389 | 3300041413 | Bacteria | 12717 |
| 550 | Ga0439465_0002292 | 3300041413 | Bacteria | 6284 |
| 551 | Ga0439465_0010657 | 3300041413 | Bacteria | 2885 |
| 552 | Ga0439465_0040528 | 3300041413 | Bacteria | 1505 |
| 553 | Ga0451793_1258867 | 3300041452 | Bacteria | 1799 |
| 554 | Ga0451798_0349143 | 3300041458 | Bacteria | 1050 |
| 555 | Ga0451837_0927302 | 3300041494 | Bacteria | 2473 |
| 556 | Ga0439431_0004103 | 3300041997 | Bacteria | 3204 |
| 557 | Ga0439433_0003863 | 3300041999 | Bacteria | 3222 |
| 558 | Ga0439442_000527 | 3300042002 | Bacteria | 8486 |
| 559 | Ga0439442_012156 | 3300042002 | Bacteria | 1758 |
| 560 | Ga0439442_012287 | 3300042002 | Bacteria | 1749 |
| 561 | Ga0439442_023952 | 3300042002 | Bacteria | 1269 |
| 562 | Ga0439445_0012253 | 3300042004 | Bacteria | 2058 |
| 563 | Ga0439449_0000164 | 3300042007 | Bacteria | 22799 |
| 564 | Ga0439449_0043085 | 3300042007 | Bacteria | 1676 |
| 565 | Ga0439452_038971 | 3300042010 | Bacteria | 1126 |
| 566 | Ga0439457_003181 | 3300042014 | Bacteria | 4522 |
| 567 | Ga0439462_0030965 | 3300042015 | Bacteria | 1416 |
| 568 | Ga0450917_000828 | 3300042120 | Bacteria | 2278 |
| 569 | Ga0439434_0003103 | 3300042435 | Bacteria | 4878 |
| 570 | Ga0439434_0005703 | 3300042435 | Bacteria | 3635 |
| 571 | Ga0439434_0009319 | 3300042435 | Bacteria | 2884 |
| 572 | Ga0451577_0002513 | 3300042876 | Bacteria | 21729 |
| 573 | Ga0451577_0014967 | 3300042876 | Bacteria | 7220 |
| 574 | Ga0466969_0000907 | 3300044656 | Bacteria | 16021 |
| 575 | Ga0466969_0066399 | 3300044656 | Bacteria | 1741 |
| 576 | Ga0466972_0000621 | 3300044658 | Bacteria | 17291 |
| 577 | Ga0466972_0108596 | 3300044658 | Bacteria | 1311 |
| 578 | Ga0466975_0058573 | 3300044661 | Bacteria | 2749 |
| 579 | Ga0466965_0019432 | 3300044683 | Bacteria | 3261 |
| 580 | Ga0466965_0025746 | 3300044683 | Bacteria | 2849 |
| 581 | Ga0466965_0031866 | 3300044683 | Bacteria | 2573 |
| 582 | Ga0466965_0223275 | 3300044683 | Bacteria | 1004 |
| 583 | Ga0466966_0010499 | 3300044684 | Bacteria | 6153 |
| 584 | Ga0466966_0014910 | 3300044684 | Bacteria | 5143 |
| 585 | Ga0466961_0001812 | 3300044693 | Bacteria | 13246 |
| 586 | Ga0466963_0060835 | 3300044694 | Bacteria | 2523 |
| 587 | Ga0466971_0071938 | 3300044719 | Bacteria | 1570 |
| 588 | Ga0466971_0140610 | 3300044719 | Bacteria | 1124 |
| 589 | Ga0466968_0109006 | 3300044735 | Bacteria | 1243 |
| 590 | Ga0466970_0000146 | 3300044765 | Bacteria | 32667 |
| 591 | Ga0466970_0094723 | 3300044765 | Bacteria | 1622 |
| 592 | Ga0466970_0124513 | 3300044765 | Bacteria | 1413 |
| 593 | Ga0466970_0174860 | 3300044765 | Bacteria | 1190 |
| 594 | Ga0466957_0259190 | 3300044842 | Bacteria | 1158 |
| 595 | Ga0466960_0018489 | 3300044901 | Bacteria | 3056 |
| 596 | Ga0466960_0026202 | 3300044901 | Bacteria | 2646 |
| 597 | Ga0466959_0000098 | 3300045049 | Bacteria | 55148 |
| 598 | Ga0466959_0000102 | 3300045049 | Bacteria | 54850 |
| 599 | Ga0466959_0091898 | 3300045049 | Bacteria | 2179 |
| 600 | Ga0466959_0345613 | 3300045049 | Bacteria | 1015 |
| 601 | Ga0451576_0000862 | 3300045051 | Bacteria | 58528 |
| 602 | Ga0466958_0016108 | 3300045836 | Bacteria | 4300 |
| 603 | Ga0466958_0024823 | 3300045836 | Bacteria | 3528 |
| 604 | Ga0466967_0029601 | 3300045976 | Bacteria | 4585 |
| 605 | Ga0466967_0233271 | 3300045976 | Bacteria | 1753 |
| 606 | Ga0466967_0457875 | 3300045976 | Bacteria | 1247 |
| 607 | Ga0495638_0009388 | 3300046460 | Bacteria | 6876 |
| 608 | Ga0495638_0020374 | 3300046460 | Bacteria | 4383 |
| 609 | Ga0495641_0110487 | 3300046461 | Bacteria | 1227 |
| 610 | Ga0495620_0034401 | 3300046515 | Bacteria | 2290 |
| 611 | Ga0495621_0045623 | 3300046539 | Bacteria | 1553 |
| 612 | Ga0495645_0115300 | 3300046543 | Bacteria | 1898 |
| 613 | Ga0495656_0031620 | 3300046615 | Bacteria | 2149 |
| 614 | Ga0495668_0090608 | 3300046616 | Bacteria | 1676 |
| 615 | Ga0495668_0231014 | 3300046616 | Bacteria | 1013 |
| 616 | Ga0495625_0008483 | 3300046660 | Bacteria | 8766 |
| 617 | Ga0495625_0121914 | 3300046660 | Bacteria | 1773 |
| 618 | Ga0495670_0094684 | 3300046691 | Bacteria | 1532 |
| 619 | Ga0495649_0144092 | 3300046694 | Bacteria | 1253 |
| 620 | Ga0495681_0137939 | 3300047470 | Bacteria | 1033 |
| 621 | Ga0495686_0067472 | 3300047472 | Bacteria | 2208 |
| 622 | Ga0495615_0004505 | 3300048090 | Bacteria | 2437 |
| 623 | Ga0495626_0056494 | 3300048091 | Bacteria | 1797 |
| 624 | Ga0496100_0007899 | 3300048903 | Bacteria | 5909 |
| 625 | Ga0496101_0092767 | 3300048904 | Bacteria | 2249 |
| 626 | Ga0496102_0000062 | 3300048905 | Bacteria | 165967 |
| 627 | Ga0496102_0035590 | 3300048905 | Bacteria | 4482 |
| 628 | Ga0496102_0046319 | 3300048905 | Bacteria | 3949 |
| 629 | Ga0496102_0069524 | 3300048905 | Bacteria | 3232 |
| 630 | Ga0496102_0091413 | 3300048905 | Bacteria | 2817 |
| 631 | Ga0496102_0106309 | 3300048905 | Bacteria | 2612 |
| 632 | Ga0496102_0231786 | 3300048905 | Bacteria | 1741 |
| 633 | Ga0496103_0000073 | 3300048906 | Bacteria | 118430 |
| 634 | Ga0496103_0001937 | 3300048906 | Bacteria | 13411 |
| 635 | Ga0496103_0180154 | 3300048906 | Bacteria | 1358 |
| 636 | Ga0496104_0007030 | 3300048907 | Bacteria | 9925 |
| 637 | Ga0496104_0050527 | 3300048907 | Bacteria | 3923 |
| 638 | Ga0496104_0059485 | 3300048907 | Bacteria | 3618 |
| 639 | Ga0496105_0025022 | 3300048908 | Bacteria | 4853 |
| 640 | Ga0496105_0094126 | 3300048908 | Bacteria | 2474 |
| 641 | Ga0496105_0212352 | 3300048908 | Bacteria | 1577 |
| 642 | Ga0496105_0328982 | 3300048908 | Bacteria | 1223 |
| 643 | Ga0496106_0007098 | 3300048909 | Bacteria | 8279 |
| 644 | Ga0496107_0004432 | 3300048910 | Bacteria | 9512 |
| 645 | Ga0496107_0031928 | 3300048910 | Bacteria | 3761 |
| 646 | Ga0496107_0033057 | 3300048910 | Bacteria | 3700 |
| 647 | Ga0496108_0005584 | 3300048911 | Bacteria | 10175 |
| 648 | Ga0496108_0121770 | 3300048911 | Bacteria | 2238 |
| 649 | Ga0496108_0188504 | 3300048911 | Bacteria | 1787 |
| 650 | Ga0496109_0001477 | 3300048912 | Bacteria | 19508 |
| 651 | Ga0496111_0015488 | 3300048914 | Bacteria | 5236 |
| 652 | Ga0496111_0036377 | 3300048914 | Bacteria | 3519 |
| 653 | Ga0496111_0164669 | 3300048914 | Bacteria | 1647 |
| 654 | Ga0496112_0003172 | 3300048915 | Bacteria | 13509 |
| 655 | Ga0496112_0038956 | 3300048915 | Bacteria | 4643 |
| 656 | Ga0496112_0274336 | 3300048915 | Bacteria | 1634 |
| 657 | Ga0496112_0389977 | 3300048915 | Bacteria | 1333 |
| 658 | Ga0496113_0049741 | 3300048916 | Bacteria | 3123 |
| 659 | Ga0496113_0079297 | 3300048916 | Bacteria | 2513 |
| 660 | Ga0496113_0233364 | 3300048916 | Bacteria | 1467 |
| 661 | Ga0496114_0013081 | 3300048917 | Bacteria | 6648 |
| 662 | Ga0496114_0013950 | 3300048917 | Bacteria | 6443 |
| 663 | Ga0496114_0033560 | 3300048917 | Bacteria | 4230 |
| 664 | Ga0496114_0176388 | 3300048917 | Bacteria | 1865 |
| 665 | Ga0496114_0258860 | 3300048917 | Bacteria | 1532 |
| 666 | Ga0496114_0356052 | 3300048917 | Bacteria | 1295 |
| 667 | Ga0496115_0000007 | 3300048918 | Bacteria | 244991 |
| 668 | Ga0496115_0017205 | 3300048918 | Bacteria | 5519 |
| 669 | Ga0496115_0017578 | 3300048918 | Bacteria | 5472 |
| 670 | Ga0496115_0026223 | 3300048918 | Bacteria | 4546 |
| 671 | Ga0496115_0046881 | 3300048918 | Bacteria | 3456 |
| 672 | Ga0496115_0073685 | 3300048918 | Bacteria | 2772 |
| 673 | Ga0496115_0086080 | 3300048918 | Bacteria | 2564 |
| 674 | Ga0496116_0127774 | 3300048919 | Bacteria | 1456 |
| 675 | Ga0496117_0262000 | 3300048920 | Bacteria | 936 |
| 676 | Ga0496118_0002736 | 3300048921 | Bacteria | 23202 |
| 677 | Ga0496118_0032397 | 3300048921 | Bacteria | 4306 |
| 678 | Ga0496118_0039700 | 3300048921 | Bacteria | 3753 |
| 679 | Ga0496119_0063673 | 3300048922 | Bacteria | 2192 |
| 680 | Ga0496119_0111933 | 3300048922 | Bacteria | 1514 |
| 681 | Ga0496120_0055816 | 3300048923 | Bacteria | 2232 |
| 682 | Ga0496120_0062142 | 3300048923 | Bacteria | 2082 |
| 683 | Ga0496121_0004907 | 3300048924 | Bacteria | 17555 |
| 684 | Ga0496122_0001065 | 3300048925 | Bacteria | 47730 |
| 685 | Ga0496125_0000172 | 3300048928 | Bacteria | 144915 |
| 686 | Ga0496125_0001022 | 3300048928 | Bacteria | 43463 |
| 687 | Ga0496125_0005135 | 3300048928 | Bacteria | 14724 |
| 688 | Ga0496125_0007209 | 3300048928 | Bacteria | 11852 |
| 689 | Ga0496125_0033316 | 3300048928 | Bacteria | 4560 |
| 690 | Ga0496126_0109972 | 3300048929 | Bacteria | 2401 |
| 691 | Ga0496126_0207657 | 3300048929 | Bacteria | 1650 |
| 692 | Ga0501300_011365 | 3300049523 | Bacteria | 1298 |
| 693 | Ga0501032_0005612 | 3300049569 | Bacteria | 9293 |
| 694 | Ga0501032_0009393 | 3300049569 | Bacteria | 7084 |
| 695 | Ga0501032_0038012 | 3300049569 | Bacteria | 3279 |
| 696 | Ga0501032_0127799 | 3300049569 | Bacteria | 1678 |
| 697 | Ga0501033_0004704 | 3300049570 | Bacteria | 10925 |
| 698 | Ga0501033_0015456 | 3300049570 | Bacteria | 5789 |
| 699 | Ga0501033_0017624 | 3300049570 | Bacteria | 5395 |
| 700 | Ga0501033_0141414 | 3300049570 | Bacteria | 1739 |
| 701 | Ga0501033_0151036 | 3300049570 | Bacteria | 1676 |
| 702 | Ga0501034_0000328 | 3300049571 | Bacteria | 83532 |
| 703 | Ga0501034_0011883 | 3300049571 | Bacteria | 9007 |
| 704 | Ga0501034_0051779 | 3300049571 | Bacteria | 4139 |
| 705 | Ga0501034_0064905 | 3300049571 | Bacteria | 3664 |
| 706 | Ga0501034_0118149 | 3300049571 | Bacteria | 2639 |
| 707 | Ga0501036_0016622 | 3300049572 | Bacteria | 6143 |
| 708 | Ga0501036_0053274 | 3300049572 | Bacteria | 3426 |
| 709 | Ga0501036_0139080 | 3300049572 | Bacteria | 2049 |
| 710 | Ga0501037_0006594 | 3300049573 | Bacteria | 8488 |
| 711 | Ga0501037_0006643 | 3300049573 | Bacteria | 8460 |
| 712 | Ga0501037_0008276 | 3300049573 | Bacteria | 7626 |
| 713 | Ga0501037_0161100 | 3300049573 | Bacteria | 1599 |
| 714 | Ga0501038_0052528 | 3300049574 | Bacteria | 3513 |
| 715 | Ga0501038_0066983 | 3300049574 | Bacteria | 3056 |
| 716 | Ga0501038_0070908 | 3300049574 | Bacteria | 2957 |
| 717 | Ga0501038_0072057 | 3300049574 | Bacteria | 2928 |
| 718 | Ga0501038_0086439 | 3300049574 | Bacteria | 2634 |
| 719 | Ga0501038_0221498 | 3300049574 | Bacteria | 1509 |
| 720 | Ga0501040_0043233 | 3300049576 | Bacteria | 3070 |
| 721 | Ga0501040_0287968 | 3300049576 | Bacteria | 1174 |
| 722 | Ga0501041_0058796 | 3300049577 | Bacteria | 2352 |
| 723 | Ga0501042_0036384 | 3300049578 | Bacteria | 3492 |
| 724 | Ga0501042_0130890 | 3300049578 | Bacteria | 1808 |
| 725 | Ga0501043_0001612 | 3300049579 | Bacteria | 19645 |
| 726 | Ga0501043_0011287 | 3300049579 | Bacteria | 6991 |
| 727 | Ga0501043_0028035 | 3300049579 | Bacteria | 4420 |
| 728 | Ga0501043_0238345 | 3300049579 | Bacteria | 1403 |
| 729 | Ga0501046_0004162 | 3300049580 | Bacteria | 13172 |
| 730 | Ga0501046_0031840 | 3300049580 | Bacteria | 4272 |
| 731 | Ga0501046_0093539 | 3300049580 | Bacteria | 2311 |
| 732 | Ga0501046_0323109 | 3300049580 | Bacteria | 1124 |
| 733 | Ga0501047_0008384 | 3300049581 | Bacteria | 9754 |
| 734 | Ga0501047_0010011 | 3300049581 | Bacteria | 8963 |
| 735 | Ga0501047_0030400 | 3300049581 | Bacteria | 5207 |
| 736 | Ga0501047_0031541 | 3300049581 | Bacteria | 5111 |
| 737 | Ga0501047_0037405 | 3300049581 | Bacteria | 4694 |
| 738 | Ga0501047_0363697 | 3300049581 | Bacteria | 1282 |
| 739 | Ga0501048_0002639 | 3300049582 | Bacteria | 13702 |
| 740 | Ga0501048_0003083 | 3300049582 | Bacteria | 12706 |
| 741 | Ga0501048_0042899 | 3300049582 | Bacteria | 3238 |
| 742 | Ga0501048_0081917 | 3300049582 | Bacteria | 2276 |
| 743 | Ga0501068_0001059 | 3300049584 | Bacteria | 14585 |
| 744 | Ga0501068_0013838 | 3300049584 | Bacteria | 4598 |
| 745 | Ga0501068_0167563 | 3300049584 | Bacteria | 1385 |
| 746 | Ga0501069_0054002 | 3300049585 | Bacteria | 2238 |
| 747 | Ga0501069_0055396 | 3300049585 | Bacteria | 2209 |
| 748 | Ga0501070_0000167 | 3300049586 | Bacteria | 60680 |
| 749 | Ga0501070_0006114 | 3300049586 | Bacteria | 10262 |
| 750 | Ga0501070_0021300 | 3300049586 | Bacteria | 5440 |
| 751 | Ga0501070_0030519 | 3300049586 | Bacteria | 4517 |
| 752 | Ga0501070_0030556 | 3300049586 | Bacteria | 4514 |
| 753 | Ga0501070_0144986 | 3300049586 | Bacteria | 1960 |
| 754 | Ga0501070_0293230 | 3300049586 | Bacteria | 1326 |
| 755 | Ga0501070_0326041 | 3300049586 | Bacteria | 1248 |
| 756 | Ga0501071_0048477 | 3300049587 | Bacteria | 3055 |
| 757 | Ga0501071_0062813 | 3300049587 | Bacteria | 2691 |
| 758 | Ga0501071_0300378 | 3300049587 | Bacteria | 1217 |
| 759 | Ga0501072_0312500 | 3300049588 | Bacteria | 1249 |
| 760 | Ga0501073_0072520 | 3300049589 | Bacteria | 2398 |
| 761 | Ga0501073_0247110 | 3300049589 | Bacteria | 1232 |
| 762 | Ga0501074_0020405 | 3300049590 | Bacteria | 4816 |
| 763 | Ga0501075_0148567 | 3300049591 | Bacteria | 1786 |
| 764 | Ga0501076_0018938 | 3300049592 | Bacteria | 5253 |
| 765 | Ga0501076_0069686 | 3300049592 | Bacteria | 2810 |
| 766 | Ga0501076_0088928 | 3300049592 | Bacteria | 2483 |
| 767 | Ga0501076_0666593 | 3300049592 | Bacteria | 859 |
| 768 | Ga0501077_0028561 | 3300049593 | Bacteria | 3545 |
| 769 | Ga0501077_0034990 | 3300049593 | Bacteria | 3197 |
| 770 | Ga0501077_0042589 | 3300049593 | Bacteria | 2886 |
| 771 | Ga0501077_0254612 | 3300049593 | Bacteria | 1117 |
| 772 | Ga0501235_020082 | 3300049669 | Bacteria | 1483 |
| 773 | Ga0501079_0016624 | 3300049741 | Bacteria | 5619 |
| 774 | Ga0501079_0056334 | 3300049741 | Bacteria | 3033 |
| 775 | Ga0501080_0013966 | 3300049742 | Bacteria | 7391 |
| 776 | Ga0501080_0020887 | 3300049742 | Bacteria | 6059 |
| 777 | Ga0501083_0000003 | 3300049744 | Bacteria | 235949 |
| 778 | Ga0501083_0010150 | 3300049744 | Bacteria | 6636 |
| 779 | Ga0501035_0009611 | 3300049822 | Bacteria | 8993 |
| 780 | Ga0501035_0010726 | 3300049822 | Bacteria | 8483 |
| 781 | Ga0501035_0023799 | 3300049822 | Bacteria | 5619 |
| 782 | Ga0501035_0086695 | 3300049822 | Bacteria | 2759 |
| 783 | Ga0501035_0111626 | 3300049822 | Bacteria | 2396 |
| 784 | Ga0501035_0389213 | 3300049822 | Bacteria | 1161 |
| 785 | Ga0501044_0010663 | 3300049823 | Bacteria | 9971 |
| 786 | Ga0501044_0012841 | 3300049823 | Bacteria | 9068 |
| 787 | Ga0501044_0020376 | 3300049823 | Bacteria | 7081 |
| 788 | Ga0501044_0021144 | 3300049823 | Bacteria | 6946 |
| 789 | Ga0501044_0105217 | 3300049823 | Bacteria | 2835 |
| 790 | Ga0501044_0177084 | 3300049823 | Bacteria | 2101 |
| 791 | Ga0501044_0339283 | 3300049823 | Bacteria | 1424 |
| 792 | nmdc:mga00v17_12115_c1 | 3300050491 | Bacteria | 4751 |
| 793 | nmdc:mga00v17_16089_c1 | 3300050491 | Bacteria | 4211 |
| 794 | nmdc:mga00v17_2429_c1 | 3300050491 | Bacteria | 9527 |
| 795 | nmdc:mga00v17_5501_c1 | 3300050491 | Bacteria | 6672 |
| 796 | nmdc:mga00v17_70333_c1 | 3300050491 | Bacteria | 2167 |
| 797 | nmdc:mga00v17_78187_c1 | 3300050491 | Bacteria | 2061 |
| 798 | nmdc:mga0k408_253058_c1 | 3300050493 | Bacteria | 1052 |
| 799 | nmdc:mga07m45_175839_c1 | 3300050496 | Bacteria | 1245 |
| 800 | nmdc:mga07m45_29150_c1 | 3300050496 | Bacteria | 3050 |
| 801 | nmdc:mga05p37_132926_c1 | 3300050507 | Bacteria | 3052 |
| 802 | nmdc:mga05p37_25564_c1 | 3300050507 | Bacteria | 7183 |
| 803 | nmdc:mga05p37_52655_c1 | 3300050507 | Bacteria | 5004 |
| 804 | nmdc:mga09592_72293_c1 | 3300050508 | Bacteria | 2929 |
| 805 | nmdc:mga06r32_40760_c1 | 3300050510 | Bacteria | 4410 |
| 806 | nmdc:mga08y16_293051_c1 | 3300050511 | Bacteria | 1678 |
| 807 | nmdc:mga08y16_470033_c1 | 3300050511 | Bacteria | 1280 |
| 808 | nmdc:mga08y16_60365_c1 | 3300050511 | Bacteria | 3961 |
| 809 | nmdc:mga08y16_95695_c1 | 3300050511 | Bacteria | 3093 |
| 810 | nmdc:mga08x19_19_c1 | 3300050514 | Bacteria | 315774 |
| 811 | nmdc:mga0sz30_8826_c1 | 3300050516 | Bacteria | 3819 |
| 812 | Ga0500635_0000028 | 3300053080 | Bacteria | 104398 |
| 813 | Ga0500644_0001599 | 3300053088 | Bacteria | 5927 |
| 814 | Ga0500651_0083613 | 3300053093 | Bacteria | 1975 |
| 815 | Ga0500556_0001502 | 3300053104 | Bacteria | 9630 |
| 816 | Ga0500568_0004559 | 3300053139 | Bacteria | 7385 |
| 817 | Ga0500600_0036594 | 3300053149 | Bacteria | 2852 |
| 818 | Ga0500611_033160 | 3300053727 | Bacteria | 1085 |
| 819 | Ga0500645_002561 | 3300053730 | Bacteria | 8007 |
| 820 | Ga0501084_0065741 | 3300054114 | Bacteria | 3034 |
| 821 | Ga0501082_0259165 | 3300060353 | Bacteria | 1513 |
| 822 | Ga0501082_0363420 | 3300060353 | Bacteria | 1262 |
| 823 | Ga0466962_0057997 | 3300061719 | Bacteria | 1848 |
| 824 | Ga0530510_0076960 | 3300061734 | Bacteria | 2425 |
| 825 | 2552110827 | 2551306166 | Bacteria | 9731570 |
| 826 | 2587755536 | 2585428062 | Bacteria | 6842168 |
| 827 | 2643746498 | 2643221544 | Bacteria | 5886209 |
| 828 | 2643754190 | 2643221546 | Bacteria | 2910897 |
| 829 | 2643785438 | 2643221553 | Bacteria | 3544260 |
| 830 | 2644097119 | 2643221616 | Bacteria | 4066575 |
| 831 | 2644220899 | 2643221639 | Bacteria | 6649903 |
| 832 | 2644259746 | 2643221646 | Bacteria | 6433402 |
| 833 | 2644304105 | 2643221654 | Bacteria | 5273570 |
| 834 | 2644337536 | 2643221660 | Bacteria | 4208257 |
| 835 | 2644446477 | 2643221679 | Bacteria | 3839507 |
| 836 | 2644486327 | 2643221687 | Bacteria | 6500351 |
| 837 | 2644637410 | 2643221715 | Bacteria | 6671032 |
| 838 | 2644679793 | 2643221724 | Bacteria | 3593515 |
| 839 | 2691514866 | 2690315906 | Bacteria | 4517044 |
| 840 | 2730229319 | 2728369380 | Bacteria | 3620317 |
| 841 | 2747952674 | 2747842429 | Bacteria | 3914386 |
| 842 | 2775654793 | 2775506735 | Bacteria | 4556596 |
| 843 | 2808631585 | 2808606306 | Bacteria | 3608896 |
| 844 | 2808902608 | 2808606372 | Bacteria | 4649509 |
| 845 | 2812320256 | 2811994871 | Bacteria | 4497550 |
| 846 | 2852647031 | 2852646457 | Bacteria | 3408613 |
| 847 | 2852664897 | 2852663356 | Bacteria | 4090475 |
| 848 | 2857741044 | 2857740372 | Bacteria | 4782044 |
| 849 | 2881105398 | 2881101125 | Bacteria | 4590519 |
| 850 | 2884765687 | 2884763398 | Bacteria | 4091164 |
| 851 | 2894026734 | 2894023352 | Bacteria | 5167372 |
| 852 | 2895660977 | 2895660088 | Bacteria | 3782833 |
| 853 | 2899367668 | 2899359706 | Bacteria | 10940472 |
| 854 | 2902815401 | 2902810491 | Bacteria | 6794147 |
| 855 | 2902840256 | 2902837492 | Bacteria | 6697721 |
| 856 | 2904500276 | 2904497146 | Bacteria | 4731781 |
| 857 | 2904776928 | 2904776348 | Bacteria | 4658726 |
| 858 | 2910810984 | 2910809715 | Bacteria | 4982797 |
| 859 | 2919036465 | 2919034639 | Bacteria | 4763403 |
| 860 | 2919059523 | 2919059106 | Bacteria | 4991624 |
| 861 | 2919392902 | 2919391150 | Bacteria | 4884741 |
| 862 | 2919443210 | 2919443155 | Bacteria | 4072969 |
| 863 | 2919540925 | 2919538618 | Bacteria | 4677069 |
| 864 | 2919717040 | 2919713450 | Bacteria | 7431245 |
| 865 | 2928115391 | 2928115317 | Bacteria | 6477646 |
| 866 | 2929215086 | 2929212328 | Bacteria | 7708288 |
| 867 | 2932427060 | 2932426870 | Bacteria | 4547726 |
| 868 | 2933419688 | 2933418574 | Bacteria | 4476724 |
| 869 | 2939587442 | 2939582691 | Bacteria | 7088898 |
| 870 | 2939649913 | 2939647034 | Bacteria | 4681660 |
| 871 | 2939663769 | 2939660829 | Bacteria | 3784848 |
| 872 | 2939677360 | 2939674588 | Bacteria | 4844420 |
| 873 | 2945918004 | 2945916053 | Bacteria | 4555517 |
| 874 | 2945960140 | 2945956166 | Bacteria | 5110334 |
| 875 | 2945971483 | 2945968032 | Bacteria | 4111363 |
| 876 | 2946034112 | 2946033335 | Bacteria | 3835514 |
| 877 | 2956941601 | 2956939328 | Bacteria | 3474458 |
| 878 | 2974306040 | 2974302888 | Bacteria | 4369871 |
| 879 | 3001119985 | 3001119090 | Bacteria | 3449530 |
| 880 | 8002392874 | 8002392321 | Bacteria | 4159911 |
| 881 | 8048747062 | 8048746797 | Bacteria | 3557226 |
| 882 | 8054110658 | 8054107350 | Bacteria | 5022511 |
| 883 | 8055038050 | 8055037949 | Bacteria | 3337834 |
| 884 | Ga0501071_0160527 | |||
| 885 | MRS1b_contig_2095048 | |||
| 886 | LJQas_1000928 | |||
| 887 | JGI24742J22300_10014285 | |||
| 888 | JGI25164J39214_1000974 | |||
| 889 | JGI25151J46595_10000156 | |||
| 890 | JGI25165J46597_1000004 | |||
| 891 | Ga0055527_1000001 | |||
| 892 | Ga0055542_1009411 | |||
| 893 | Ga0055529_1000019 | |||
| 894 | Ga0055526_1000293 | |||
| 895 | Ga0055540_1002727 | |||
| 896 | Ga0055531_10000078 | |||
| 897 | Ga0055531_10002166 | |||
| 898 | Ga0065707_10228158 | |||
| 899 | Ga0070658_10049549 | |||
| 900 | Ga0070658_10080848 | |||
| 901 | Ga0070658_10473109 | |||
| 902 | Ga0070683_100089986 | |||
| 903 | Ga0070683_100125566 | |||
| 904 | Ga0070683_100421179 | |||
| 905 | Ga0070690_100011765 | |||
| 906 | Ga0070670_100150132 | |||
| 907 | Ga0070677_10139964 | |||
| 908 | Ga0068869_100087693 | |||
| 909 | Ga0070666_10214394 | |||
| 910 | Ga0070680_100005109 | |||
| 911 | Ga0070680_100017277 | |||
| 912 | Ga0070682_100002922 | |||
| 913 | Ga0070682_100027069 | |||
| 914 | Ga0070682_100032951 | |||
| 915 | Ga0070682_100039128 | |||
| 916 | Ga0070682_100042118 | |||
| 917 | Ga0070682_100221705 | |||
| 918 | Ga0068868_100010275 | |||
| 919 | Ga0068868_100052341 | |||
| 920 | Ga0068868_100136638 | |||
| 921 | Ga0070660_100004961 | |||
| 922 | Ga0070660_100366557 | |||
| 923 | Ga0070689_100022952 | |||
| 924 | Ga0070689_100023186 | |||
| 925 | Ga0070691_10158650 | |||
| 926 | Ga0070661_100006246 | |||
| 927 | Ga0070661_100008803 | |||
| 928 | Ga0070661_100047421 | |||
| 929 | Ga0070661_100252453 | |||
| 930 | Ga0070692_10072857 | |||
| 931 | Ga0070668_100004324 | |||
| 932 | Ga0070669_100022894 | |||
| 933 | Ga0070675_100114893 | |||
| 934 | Ga0070675_100242529 | |||
| 935 | Ga0070675_100329318 | |||
| 936 | Ga0070671_100035374 | |||
| 937 | Ga0070671_100044909 | |||
| 938 | Ga0070671_100081797 | |||
| 939 | Ga0070671_100129926 | |||
| 940 | Ga0070674_100004266 | |||
| 941 | Ga0070674_100067388 | |||
| 942 | Ga0070674_100214348 | |||
| 943 | Ga0070673_100076407 | |||
| 944 | Ga0070673_100313496 | |||
| 945 | Ga0070667_100000008 | |||
| 946 | Ga0070667_100010404 | |||
| 947 | Ga0070667_100192215 | |||
| 948 | Ga0070714_100099982 | |||
| 949 | Ga0070714_100579851 | |||
| 950 | Ga0070701_10002941 | |||
| 951 | Ga0070701_10025823 | |||
| 952 | Ga0070701_10041361 | |||
| 953 | Ga0070711_100206607 | |||
| 954 | Ga0070711_100297100 | |||
| 955 | Ga0070711_100403710 | |||
| 956 | Ga0070705_100005615 | |||
| 957 | Ga0070700_100013330 | |||
| 958 | Ga0070700_100042777 | |||
| 959 | Ga0070694_100037308 | |||
| 960 | Ga0070663_100000355 | |||
| 961 | Ga0070678_100016769 | |||
| 962 | Ga0070678_100150478 | |||
| 963 | Ga0070681_10002979 | |||
| 964 | Ga0070681_10011372 | |||
| 965 | Ga0070681_10061424 | |||
| 966 | Ga0068867_100000062 | |||
| 967 | Ga0068867_100000675 | |||
| 968 | Ga0068867_100016982 | |||
| 969 | Ga0068867_100018227 | |||
| 970 | Ga0068867_100059364 | |||
| 971 | Ga0070685_10146862 | |||
| 972 | Ga0070685_10158865 | |||
| 973 | Ga0070698_100220594 | |||
| 974 | Ga0070679_100001081 | |||
| 975 | Ga0070679_100004413 | |||
| 976 | Ga0070684_100021170 | |||
| 977 | Ga0070684_100131004 | |||
| 978 | Ga0070684_100280975 | |||
| 979 | Ga0068853_100019247 | |||
| 980 | Ga0068853_100037636 | |||
| 981 | Ga0068853_100047061 | |||
| 982 | Ga0068853_100098424 | |||
| 983 | Ga0070672_100032355 | |||
| 984 | Ga0070672_100128402 | |||
| 985 | Ga0070672_100212240 | |||
| 986 | Ga0070672_100256899 | |||
| 987 | Ga0070672_100259004 | |||
| 988 | Ga0070672_100412910 | |||
| 989 | Ga0070686_100011866 | |||
| 990 | Ga0070695_100109718 | |||
| 991 | Ga0070696_100000773 | |||
| 992 | Ga0070693_100038455 | |||
| 993 | Ga0070693_100074747 | |||
| 994 | Ga0070665_100002002 | |||
| 995 | Ga0070665_100004489 | |||
| 996 | Ga0070704_100001401 | |||
| 997 | Ga0068855_100009516 | |||
| 998 | Ga0068855_100034076 | |||
| 999 | Ga0070664_100033357 | |||
| 1000 | Ga0070664_100074127 | |||
| 1001 | Ga0068857_100032455 | |||
| 1002 | Ga0068854_100006057 | |||
| 1003 | Ga0068854_100067159 | |||
| 1004 | Ga0068854_100162915 | |||
| 1005 | Ga0068856_100053527 | |||
| 1006 | Ga0068856_100189944 | |||
| 1007 | Ga0068856_100216857 | |||
| 1008 | Ga0068856_100356838 | |||
| 1009 | Ga0070702_100001389 | |||
| 1010 | Ga0070702_100007685 | |||
| 1011 | Ga0070702_100228503 | |||
| 1012 | Ga0068852_100007382 | |||
| 1013 | Ga0068859_100001285 | |||
| 1014 | Ga0068859_100085198 | |||
| 1015 | Ga0068859_100178560 | |||
| 1016 | Ga0068859_100247261 | |||
| 1017 | Ga0068859_100320565 | |||
| 1018 | Ga0068859_100636357 | |||
| 1019 | Ga0068861_100032965 | |||
| 1020 | Ga0068861_100034550 | |||
| 1021 | Ga0068861_100093196 | |||
| 1022 | Ga0068861_100127803 | |||
| 1023 | Ga0068861_100403256 | |||
| 1024 | Ga0068863_100049842 | |||
| 1025 | Ga0068863_100549147 | |||
| 1026 | Ga0068858_100027232 | |||
| 1027 | Ga0068860_100054821 | |||
| 1028 | Ga0068860_100092759 | |||
| 1029 | Ga0068860_100396467 | |||
| 1030 | Ga0068862_100005211 | |||
| 1031 | Ga0068862_100038065 | |||
| 1032 | Ga0081455_10037738 | |||
| 1033 | Ga0075365_10081904 | |||
| 1034 | Ga0075363_100003316 | |||
| 1035 | Ga0075363_100274267 | |||
| 1036 | Ga0075364_10000522 | |||
| 1037 | Ga0075364_10001885 | |||
| 1038 | Ga0075364_10039815 | |||
| 1039 | Ga0075364_10041738 | |||
| 1040 | Ga0075364_10059166 | |||
| 1041 | Ga0075364_10161499 | |||
| 1042 | Ga0075364_10196528 | |||
| 1043 | Ga0075432_10002065 | |||
| 1044 | Ga0070715_10090782 | |||
| 1045 | Ga0070712_100021643 | |||
| 1046 | Ga0075366_10083444 | |||
| 1047 | Ga0075366_10160404 | |||
| 1048 | Ga0097621_100023231 | |||
| 1049 | Ga0097621_100295486 | |||
| 1050 | Ga0075370_10000712 | |||
| 1051 | Ga0075370_10013593 | |||
| 1052 | Ga0068871_100022719 | |||
| 1053 | Ga0068871_100046838 | |||
| 1054 | Ga0068871_100398231 | |||
| 1055 | Ga0075428_100062670 | |||
| 1056 | Ga0075431_100080184 | |||
| 1057 | Ga0068865_100026457 | |||
| 1058 | Ga0068865_100053528 | |||
| 1059 | Ga0075436_100001954 | |||
| 1060 | Ga0097620_100001285 | |||
| 1061 | Ga0097620_100085195 | |||
| 1062 | Ga0097620_100178561 | |||
| 1063 | Ga0097620_100247270 | |||
| 1064 | Ga0097620_100320547 | |||
| 1065 | Ga0097620_100636428 | |||
| 1066 | Ga0105244_10007496 | |||
| 1067 | Ga0105240_10006132 | |||
| 1068 | Ga0105240_10012361 | |||
| 1069 | Ga0105240_10015317 | |||
| 1070 | Ga0105240_10196167 | |||
| 1071 | Ga0111539_10211181 | |||
| 1072 | Ga0111539_10212037 | |||
| 1073 | Ga0111539_10350694 | |||
| 1074 | Ga0105245_10007025 | |||
| 1075 | Ga0105245_10243298 | |||
| 1076 | Ga0105247_10001547 | |||
| 1077 | Ga0105247_10003369 | |||
| 1078 | Ga0105247_10013257 | |||
| 1079 | Ga0105247_10045532 | |||
| 1080 | Ga0114129_10037345 | |||
| 1081 | Ga0114129_10093003 | |||
| 1082 | Ga0114129_10149653 | |||
| 1083 | Ga0114129_10558531 | |||
| 1084 | Ga0105243_10002846 | |||
| 1085 | Ga0105243_10032381 | |||
| 1086 | Ga0105243_10130275 | |||
| 1087 | Ga0105243_10213831 | |||
| 1088 | Ga0105243_10316223 | |||
| 1089 | Ga0105243_10349658 | |||
| 1090 | Ga0105241_10015631 | |||
| 1091 | Ga0105242_10005276 | |||
| 1092 | Ga0105248_10024774 | |||
| 1093 | Ga0105248_10067887 | |||
| 1094 | Ga0105237_10005469 | |||
| 1095 | Ga0105237_10008525 | |||
| 1096 | Ga0105237_10016653 | |||
| 1097 | Ga0105237_10107336 | |||
| 1098 | Ga0105237_10155191 | |||
| 1099 | Ga0105238_10056195 | |||
| 1100 | Ga0105249_10001615 | |||
| 1101 | Ga0105249_10182421 | |||
| 1102 | Ga0105249_10617884 | |||
| 1103 | Ga0105239_10012611 | |||
| 1104 | Ga0105239_10029163 | |||
| 1105 | Ga0105239_10038886 | |||
| 1106 | Ga0105239_10075481 | |||
| 1107 | Ga0105239_10235805 | |||
| 1108 | Ga0105246_10002960 | |||
| 1109 | Ga0105246_10115557 | |||
| 1110 | Ga0105246_10181510 | |||
| 1111 | Ga0157373_10194599 | |||
| 1112 | Ga0157371_10047597 | |||
| 1113 | Ga0157371_10151000 | |||
| 1114 | Ga0157369_10004228 | |||
| 1115 | Ga0157369_10088461 | |||
| 1116 | Ga0157369_10167091 | |||
| 1117 | Ga0157369_10405524 | |||
| 1118 | Ga0157374_10006773 | |||
| 1119 | Ga0157374_10014955 | |||
| 1120 | Ga0157374_10054338 | |||
| 1121 | Ga0157374_10187661 | |||
| 1122 | Ga0157378_10013225 | |||
| 1123 | Ga0157378_10065174 | |||
| 1124 | Ga0157378_10244783 | |||
| 1125 | Ga0163162_10010063 | |||
| 1126 | Ga0163162_10052990 | |||
| 1127 | Ga0163162_10125176 | |||
| 1128 | Ga0163162_10171681 | |||
| 1129 | Ga0163162_10831317 | |||
| 1130 | Ga0157372_10006463 | |||
| 1131 | Ga0157372_10043580 | |||
| 1132 | Ga0157372_10138304 | |||
| 1133 | Ga0157372_10164748 | |||
| 1134 | Ga0157372_10387090 | |||
| 1135 | Ga0157375_10009390 | |||
| 1136 | Ga0157375_10011713 | |||
| 1137 | Ga0157375_10091545 | |||
| 1138 | Ga0157375_10267273 | |||
| 1139 | Ga0157375_10532289 | |||
| 1140 | Ga0157375_10958873 | |||
| 1141 | Ga0163163_10102409 | |||
| 1142 | Ga0157380_10002734 | |||
| 1143 | Ga0157380_10046254 | |||
| 1144 | Ga0157380_10048707 | |||
| 1145 | Ga0157380_10176264 | |||
| 1146 | Ga0157380_10263625 | |||
| 1147 | Ga0157380_10355125 | |||
| 1148 | Ga0157380_10572866 | |||
| 1149 | Ga0157380_10874733 | |||
| 1150 | Ga0157379_10030835 | |||
| 1151 | Ga0157379_10034941 | |||
| 1152 | Ga0157379_10149067 | |||
| 1153 | Ga0157376_10006548 | |||
| 1154 | Ga0157376_10417558 | |||
| 1155 | Ga0157376_10423457 | |||
| 1156 | Ga0163161_10004372 | |||
| 1157 | Ga0163161_10134521 | |||
| 1158 | Ga0163161_10177895 | |||
| 1159 | Ga0206356_10016337 | |||
| 1160 | Ga0206356_10536592 | |||
| 1161 | Ga0206353_10861374 | |||
| 1162 | Ga0213872_10000074 | |||
| 1163 | Ga0213872_10000409 | |||
| 1164 | Ga0209672_100006 | |||
| 1165 | Ga0209147_100699 | |||
| 1166 | Ga0207427_100010 | |||
| 1167 | Ga0209437_100216 | |||
| 1168 | Ga0209258_101354 | |||
| 1169 | Ga0207425_1000158 | |||
| 1170 | Ga0209148_1000015 | |||
| 1171 | Ga0209148_1003211 | |||
| 1172 | Ga0209129_1000169 | |||
| 1173 | Ga0209233_1000001 | |||
| 1174 | Ga0209455_1000013 | |||
| 1175 | Ga0209673_1006885 | |||
| 1176 | Ga0209025_1000019 | |||
| 1177 | Ga0209564_1000057 | |||
| 1178 | Ga0209758_1000461 | |||
| 1179 | Ga0209758_1001104 | |||
| 1180 | Ga0209050_1009414 | |||
| 1181 | Ga0209051_1000136 | |||
| 1182 | Ga0209051_1009285 | |||
| 1183 | Ga0209257_1000032 | |||
| 1184 | Ga0209257_1000055 | |||
| 1185 | Ga0207697_10016969 | |||
| 1186 | Ga0207655_1092409 | |||
| 1187 | Ga0207692_10023134 | |||
| 1188 | Ga0207710_10004119 | |||
| 1189 | Ga0207710_10006561 | |||
| 1190 | Ga0207680_10012655 | |||
| 1191 | Ga0207680_10078937 | |||
| 1192 | Ga0207647_10014906 | |||
| 1193 | Ga0207647_10017033 | |||
| 1194 | Ga0207647_10045604 | |||
| 1195 | Ga0207685_10010204 | |||
| 1196 | Ga0207699_10090585 | |||
| 1197 | Ga0207645_10055143 | |||
| 1198 | Ga0207643_10123455 | |||
| 1199 | Ga0207705_10134850 | |||
| 1200 | Ga0207705_10209896 | |||
| 1201 | Ga0207707_10014181 | |||
| 1202 | Ga0207707_10036847 | |||
| 1203 | Ga0207707_10057360 | |||
| 1204 | Ga0207707_10331329 | |||
| 1205 | Ga0207695_10012431 | |||
| 1206 | Ga0207695_10017318 | |||
| 1207 | Ga0207695_10149008 | |||
| 1208 | Ga0207695_10246561 | |||
| 1209 | Ga0207671_10000298 | |||
| 1210 | Ga0207671_10000531 | |||
| 1211 | Ga0207671_10009743 | |||
| 1212 | Ga0207671_10065482 | |||
| 1213 | Ga0207663_10000354 | |||
| 1214 | Ga0207660_10052066 | |||
| 1215 | Ga0207660_10296353 | |||
| 1216 | Ga0207660_10304181 | |||
| 1217 | Ga0207662_10048350 | |||
| 1218 | Ga0207657_10009492 | |||
| 1219 | Ga0207649_10007727 | |||
| 1220 | Ga0207649_10059727 | |||
| 1221 | Ga0207649_10062939 | |||
| 1222 | Ga0207652_10024066 | |||
| 1223 | Ga0207652_10028517 | |||
| 1224 | Ga0207652_10260757 | |||
| 1225 | Ga0207681_10204777 | |||
| 1226 | Ga0207694_10132563 | |||
| 1227 | Ga0207659_10101311 | |||
| 1228 | Ga0207659_10171194 | |||
| 1229 | Ga0207659_10179176 | |||
| 1230 | Ga0207687_10003626 | |||
| 1231 | Ga0207687_10291522 | |||
| 1232 | Ga0207644_10046203 | |||
| 1233 | Ga0207644_10120084 | |||
| 1234 | Ga0207644_10289394 | |||
| 1235 | Ga0207690_10043829 | |||
| 1236 | Ga0207690_10230557 | |||
| 1237 | Ga0207706_10005428 | |||
| 1238 | Ga0207709_10000015 | |||
| 1239 | Ga0207709_10039670 | |||
| 1240 | Ga0207709_10090315 | |||
| 1241 | Ga0207709_10108931 | |||
| 1242 | Ga0207709_10151848 | |||
| 1243 | Ga0207709_10211734 | |||
| 1244 | Ga0207709_10347609 | |||
| 1245 | Ga0207670_10056413 | |||
| 1246 | Ga0207669_10089918 | |||
| 1247 | Ga0207669_10401761 | |||
| 1248 | Ga0207704_10017638 | |||
| 1249 | Ga0207691_10000649 | |||
| 1250 | Ga0207691_10044818 | |||
| 1251 | Ga0207691_10091498 | |||
| 1252 | Ga0207691_10408426 | |||
| 1253 | Ga0207711_10037926 | |||
| 1254 | Ga0207689_10071436 | |||
| 1255 | Ga0207689_10118624 | |||
| 1256 | Ga0207661_10001700 | |||
| 1257 | Ga0207661_10107336 | |||
| 1258 | Ga0207661_10160298 | |||
| 1259 | Ga0207661_10540949 | |||
| 1260 | Ga0207679_10058180 | |||
| 1261 | Ga0207679_10081258 | |||
| 1262 | Ga0207667_10257789 | |||
| 1263 | Ga0207651_10008075 | |||
| 1264 | Ga0207651_10319701 | |||
| 1265 | Ga0207651_10377601 | |||
| 1266 | Ga0207712_10154929 | |||
| 1267 | Ga0207712_10508790 | |||
| 1268 | Ga0207640_10006698 | |||
| 1269 | Ga0207640_10020142 | |||
| 1270 | Ga0207658_10000030 | |||
| 1271 | Ga0207658_10023960 | |||
| 1272 | Ga0207658_10130242 | |||
| 1273 | Ga0207658_10409862 | |||
| 1274 | Ga0207677_10004032 | |||
| 1275 | Ga0207677_10106932 | |||
| 1276 | Ga0207677_10229822 | |||
| 1277 | Ga0207639_10162456 | |||
| 1278 | Ga0207639_10226107 | |||
| 1279 | Ga0207678_10001274 | |||
| 1280 | Ga0207678_10527791 | |||
| 1281 | Ga0207708_10003996 | |||
| 1282 | Ga0207708_10022120 | |||
| 1283 | Ga0207708_10154181 | |||
| 1284 | Ga0207708_10201076 | |||
| 1285 | Ga0207702_10001783 | |||
| 1286 | Ga0207702_10036365 | |||
| 1287 | Ga0207702_10212942 | |||
| 1288 | Ga0207641_10002088 | |||
| 1289 | Ga0207641_10421546 | |||
| 1290 | Ga0207648_10000308 | |||
| 1291 | Ga0207648_10011691 | |||
| 1292 | Ga0207648_10039040 | |||
| 1293 | Ga0207648_10062502 | |||
| 1294 | Ga0207648_10269309 | |||
| 1295 | Ga0207676_10509248 | |||
| 1296 | Ga0207674_10013815 | |||
| 1297 | Ga0207674_10063688 | |||
| 1298 | Ga0207675_100019521 | |||
| 1299 | Ga0207675_100037495 | |||
| 1300 | Ga0207675_100109812 | |||
| 1301 | Ga0207683_10026364 | |||
| 1302 | Ga0207683_10257665 | |||
| 1303 | Ga0207698_10012402 | |||
| 1304 | Ga0209974_10019930 | |||
| 1305 | Ga0268266_10003633 | |||
| 1306 | Ga0268266_10003842 | |||
| 1307 | Ga0268266_10020043 | |||
| 1308 | Ga0268266_10042458 | |||
| 1309 | Ga0268266_10090247 | |||
| 1310 | Ga0268265_10023681 | |||
| 1311 | Ga0268265_10099463 | |||
| 1312 | Ga0268265_10245461 | |||
| 1313 | Ga0268264_10113523 | |||
| 1314 | Ga0265337_1006251 | |||
| 1315 | Ga0265334_10044564 | |||
| 1316 | Ga0307515_10000469 | |||
| 1317 | Ga0307515_10000902 | |||
| 1318 | Ga0307515_10001683 | |||
| 1319 | Ga0307515_10023814 | |||
| 1320 | Ga0307515_10066900 | |||
| 1321 | Ga0265338_10012629 | |||
| 1322 | Ga0307512_10182329 | |||
| 1323 | Ga0265332_10009134 | |||
| 1324 | Ga0265327_10000006 | |||
| 1325 | Ga0307513_10009513 | |||
| 1326 | Ga0307513_10013150 | |||
| 1327 | Ga0307513_10040324 | |||
| 1328 | Ga0307513_10143501 | |||
| 1329 | Ga0307509_10469293 | |||
| 1330 | Ga0307408_100031909 | |||
| 1331 | Ga0307408_100039139 | |||
| 1332 | Ga0307408_100075319 | |||
| 1333 | Ga0307408_100425666 | |||
| 1334 | Ga0307408_100563352 | |||
| 1335 | Ga0265314_10001118 | |||
| 1336 | Ga0316576_10003801 | |||
| 1337 | Ga0316576_10007014 | |||
| 1338 | Ga0316578_10151641 | |||
| 1339 | Ga0307405_10027682 | |||
| 1340 | Ga0307405_10061776 | |||
| 1341 | Ga0307405_10124955 | |||
| 1342 | Ga0307405_10244355 | |||
| 1343 | Ga0316577_10250444 | |||
| 1344 | Ga0307413_10010467 | |||
| 1345 | Ga0307413_10019310 | |||
| 1346 | Ga0307413_10085244 | |||
| 1347 | Ga0307413_10085932 | |||
| 1348 | Ga0307413_10148021 | |||
| 1349 | Ga0307410_10003842 | |||
| 1350 | Ga0307410_10008303 | |||
| 1351 | Ga0307410_10016794 | |||
| 1352 | Ga0307410_10061993 | |||
| 1353 | Ga0307410_10074718 | |||
| 1354 | Ga0307410_10631706 | |||
| 1355 | Ga0307406_10000263 | |||
| 1356 | Ga0307406_10018481 | |||
| 1357 | Ga0307406_10122421 | |||
| 1358 | Ga0307407_10136041 | |||
| 1359 | Ga0307412_10008293 | |||
| 1360 | Ga0307412_10010075 | |||
| 1361 | Ga0307412_10011134 | |||
| 1362 | Ga0307412_10181761 | |||
| 1363 | Ga0307409_100024429 | |||
| 1364 | Ga0307409_100029498 | |||
| 1365 | Ga0307409_100066905 | |||
| 1366 | Ga0307409_100478094 | |||
| 1367 | Ga0307416_100022095 | |||
| 1368 | Ga0307416_100024457 | |||
| 1369 | Ga0307416_100094063 | |||
| 1370 | Ga0307416_100134059 | |||
| 1371 | Ga0307416_100151995 | |||
| 1372 | Ga0307416_100165595 | |||
| 1373 | Ga0307416_100279004 | |||
| 1374 | Ga0307414_10009829 | |||
| 1375 | Ga0307414_10594131 | |||
| 1376 | Ga0307415_100066941 | |||
| 1377 | Ga0307415_100164484 | |||
| 1378 | Ga0307415_100167014 | |||
| 1379 | Ga0307415_100204068 | |||
| 1380 | Ga0307510_10026590 | |||
| 1381 | Ga0307510_10214430 | |||
| 1382 | Ga0316574_0003199 | |||
| 1383 | Ga0316574_0010713 | |||
| 1384 | Ga0316574_0012049 | |||
| 1385 | Ga0316574_0014079 | |||
| 1386 | Ga0316574_0022777 | |||
| 1387 | Ga0316574_0028264 | |||
| 1388 | Ga0316574_0051034 | |||
| 1389 | Ga0373931_0048290 | |||
| 1390 | Ga0316582_0308537 | |||
| 1391 | Ga0316584_0012638 | |||
| 1392 | Ga0316584_0076136 | |||
| 1393 | Ga0316584_0176109 | |||
| 1394 | Ga0316584_0319696 | |||
| 1395 | Ga0395899_0000006 | |||
| 1396 | Ga0395899_0033199 | |||
| 1397 | Ga0395899_0068763 | |||
| 1398 | Ga0395900_0000378 | |||
| 1399 | Ga0395900_0000774 | |||
| 1400 | Ga0395900_0010538 | |||
| 1401 | Ga0395900_0012591 | |||
| 1402 | Ga0395900_0032840 | |||
| 1403 | Ga0395900_0071874 | |||
| 1404 | Ga0395900_0301695 | |||
| 1405 | Ga0395900_0386464 | |||
| 1406 | Ga0395898_0000015 | |||
| 1407 | Ga0395898_0009381 | |||
| 1408 | Ga0395898_0013268 | |||
| 1409 | Ga0395898_0183554 | |||
| 1410 | Ga0395898_0519631 | |||
| 1411 | Ga0395905_0005120 | |||
| 1412 | Ga0395905_0071188 | |||
| 1413 | Ga0395905_0093212 | |||
| 1414 | Ga0395905_0204943 | |||
| 1415 | Ga0395905_0205552 | |||
| 1416 | Ga0395905_0294667 | |||
| 1417 | Ga0395905_0315639 | |||
| 1418 | Ga0395901_0022015 | |||
| 1419 | Ga0395901_0117043 | |||
| 1420 | Ga0395901_0190305 | |||
| 1421 | Ga0395901_0247183 | |||
| 1422 | Ga0395901_0302510 | |||
| 1423 | Ga0436361_0082864 | |||
| 1424 | Ga0436361_0507289 | |||
| 1425 | Ga0436361_0554943 | |||
| 1426 | Ga0436361_0632651 | |||
| 1427 | Ga0436361_0703210 | |||
| 1428 | Ga0436361_0939166 | |||
| 1429 | Ga0439466_0006490 | |||
| 1430 | Ga0439466_0015492 | |||
| 1431 | Ga0439466_0027865 | |||
| 1432 | Ga0439465_0000389 | |||
| 1433 | Ga0439465_0002292 | |||
| 1434 | Ga0439465_0010657 | |||
| 1435 | Ga0439465_0040528 | |||
| 1436 | Ga0451793_1258867 | |||
| 1437 | Ga0451798_0349143 | |||
| 1438 | Ga0451837_0927302 | |||
| 1439 | Ga0439431_0004103 | |||
| 1440 | Ga0439433_0003863 | |||
| 1441 | Ga0439442_000527 | |||
| 1442 | Ga0439442_012156 | |||
| 1443 | Ga0439442_012287 | |||
| 1444 | Ga0439442_023952 | |||
| 1445 | Ga0439445_0012253 | |||
| 1446 | Ga0439449_0000164 | |||
| 1447 | Ga0439449_0043085 | |||
| 1448 | Ga0439452_038971 | |||
| 1449 | Ga0439457_003181 | |||
| 1450 | Ga0439462_0030965 | |||
| 1451 | Ga0450917_000828 | |||
| 1452 | Ga0439434_0003103 | |||
| 1453 | Ga0439434_0005703 | |||
| 1454 | Ga0439434_0009319 | |||
| 1455 | Ga0451577_0002513 | |||
| 1456 | Ga0451577_0014967 | |||
| 1457 | Ga0466969_0000907 | |||
| 1458 | Ga0466969_0066399 | |||
| 1459 | Ga0466972_0000621 | |||
| 1460 | Ga0466972_0108596 | |||
| 1461 | Ga0466975_0058573 | |||
| 1462 | Ga0466965_0019432 | |||
| 1463 | Ga0466965_0025746 | |||
| 1464 | Ga0466965_0031866 | |||
| 1465 | Ga0466965_0223275 | |||
| 1466 | Ga0466966_0010499 | |||
| 1467 | Ga0466966_0014910 | |||
| 1468 | Ga0466961_0001812 | |||
| 1469 | Ga0466963_0060835 | |||
| 1470 | Ga0466971_0071938 | |||
| 1471 | Ga0466971_0140610 | |||
| 1472 | Ga0466968_0109006 | |||
| 1473 | Ga0466970_0000146 | |||
| 1474 | Ga0466970_0094723 | |||
| 1475 | Ga0466970_0124513 | |||
| 1476 | Ga0466970_0174860 | |||
| 1477 | Ga0466957_0259190 | |||
| 1478 | Ga0466960_0018489 | |||
| 1479 | Ga0466960_0026202 | |||
| 1480 | Ga0466959_0000098 | |||
| 1481 | Ga0466959_0000102 | |||
| 1482 | Ga0466959_0091898 | |||
| 1483 | Ga0466959_0345613 | |||
| 1484 | Ga0451576_0000862 | |||
| 1485 | Ga0466958_0016108 | |||
| 1486 | Ga0466958_0024823 | |||
| 1487 | Ga0466967_0029601 | |||
| 1488 | Ga0466967_0233271 | |||
| 1489 | Ga0466967_0457875 | |||
| 1490 | Ga0495638_0009388 | |||
| 1491 | Ga0495638_0020374 | |||
| 1492 | Ga0495641_0110487 | |||
| 1493 | Ga0495620_0034401 | |||
| 1494 | Ga0495621_0045623 | |||
| 1495 | Ga0495645_0115300 | |||
| 1496 | Ga0495656_0031620 | |||
| 1497 | Ga0495668_0090608 | |||
| 1498 | Ga0495668_0231014 | |||
| 1499 | Ga0495625_0008483 | |||
| 1500 | Ga0495625_0121914 | |||
| 1501 | Ga0495670_0094684 | |||
| 1502 | Ga0495649_0144092 | |||
| 1503 | Ga0495681_0137939 | |||
| 1504 | Ga0495686_0067472 | |||
| 1505 | Ga0495615_0004505 | |||
| 1506 | Ga0495626_0056494 | |||
| 1507 | Ga0496100_0007899 | |||
| 1508 | Ga0496101_0092767 | |||
| 1509 | Ga0496102_0000062 | |||
| 1510 | Ga0496102_0035590 | |||
| 1511 | Ga0496102_0046319 | |||
| 1512 | Ga0496102_0069524 | |||
| 1513 | Ga0496102_0091413 | |||
| 1514 | Ga0496102_0106309 | |||
| 1515 | Ga0496102_0231786 | |||
| 1516 | Ga0496103_0000073 | |||
| 1517 | Ga0496103_0001937 | |||
| 1518 | Ga0496103_0180154 | |||
| 1519 | Ga0496104_0007030 | |||
| 1520 | Ga0496104_0050527 | |||
| 1521 | Ga0496104_0059485 | |||
| 1522 | Ga0496105_0025022 | |||
| 1523 | Ga0496105_0094126 | |||
| 1524 | Ga0496105_0212352 | |||
| 1525 | Ga0496105_0328982 | |||
| 1526 | Ga0496106_0007098 | |||
| 1527 | Ga0496107_0004432 | |||
| 1528 | Ga0496107_0031928 | |||
| 1529 | Ga0496107_0033057 | |||
| 1530 | Ga0496108_0005584 | |||
| 1531 | Ga0496108_0121770 | |||
| 1532 | Ga0496108_0188504 | |||
| 1533 | Ga0496109_0001477 | |||
| 1534 | Ga0496111_0015488 | |||
| 1535 | Ga0496111_0036377 | |||
| 1536 | Ga0496111_0164669 | |||
| 1537 | Ga0496112_0003172 | |||
| 1538 | Ga0496112_0038956 | |||
| 1539 | Ga0496112_0274336 | |||
| 1540 | Ga0496112_0389977 | |||
| 1541 | Ga0496113_0049741 | |||
| 1542 | Ga0496113_0079297 | |||
| 1543 | Ga0496113_0233364 | |||
| 1544 | Ga0496114_0013081 | |||
| 1545 | Ga0496114_0013950 | |||
| 1546 | Ga0496114_0033560 | |||
| 1547 | Ga0496114_0176388 | |||
| 1548 | Ga0496114_0258860 | |||
| 1549 | Ga0496114_0356052 | |||
| 1550 | Ga0496115_0000007 | |||
| 1551 | Ga0496115_0017205 | |||
| 1552 | Ga0496115_0017578 | |||
| 1553 | Ga0496115_0026223 | |||
| 1554 | Ga0496115_0046881 | |||
| 1555 | Ga0496115_0073685 | |||
| 1556 | Ga0496115_0086080 | |||
| 1557 | Ga0496116_0127774 | |||
| 1558 | Ga0496117_0262000 | |||
| 1559 | Ga0496118_0002736 | |||
| 1560 | Ga0496118_0032397 | |||
| 1561 | Ga0496118_0039700 | |||
| 1562 | Ga0496119_0063673 | |||
| 1563 | Ga0496119_0111933 | |||
| 1564 | Ga0496120_0055816 | |||
| 1565 | Ga0496120_0062142 | |||
| 1566 | Ga0496121_0004907 | |||
| 1567 | Ga0496122_0001065 | |||
| 1568 | Ga0496125_0000172 | |||
| 1569 | Ga0496125_0001022 | |||
| 1570 | Ga0496125_0005135 | |||
| 1571 | Ga0496125_0007209 | |||
| 1572 | Ga0496125_0033316 | |||
| 1573 | Ga0496126_0109972 | |||
| 1574 | Ga0496126_0207657 | |||
| 1575 | Ga0501300_011365 | |||
| 1576 | Ga0501032_0005612 | |||
| 1577 | Ga0501032_0009393 | |||
| 1578 | Ga0501032_0038012 | |||
| 1579 | Ga0501032_0127799 | |||
| 1580 | Ga0501033_0004704 | |||
| 1581 | Ga0501033_0015456 | |||
| 1582 | Ga0501033_0017624 | |||
| 1583 | Ga0501033_0141414 | |||
| 1584 | Ga0501033_0151036 | |||
| 1585 | Ga0501034_0000328 | |||
| 1586 | Ga0501034_0011883 | |||
| 1587 | Ga0501034_0051779 | |||
| 1588 | Ga0501034_0064905 | |||
| 1589 | Ga0501034_0118149 | |||
| 1590 | Ga0501036_0016622 | |||
| 1591 | Ga0501036_0053274 | |||
| 1592 | Ga0501036_0139080 | |||
| 1593 | Ga0501037_0006594 | |||
| 1594 | Ga0501037_0006643 | |||
| 1595 | Ga0501037_0008276 | |||
| 1596 | Ga0501037_0161100 | |||
| 1597 | Ga0501038_0052528 | |||
| 1598 | Ga0501038_0066983 | |||
| 1599 | Ga0501038_0070908 | |||
| 1600 | Ga0501038_0072057 | |||
| 1601 | Ga0501038_0086439 | |||
| 1602 | Ga0501038_0221498 | |||
| 1603 | Ga0501040_0043233 | |||
| 1604 | Ga0501040_0287968 | |||
| 1605 | Ga0501041_0058796 | |||
| 1606 | Ga0501042_0036384 | |||
| 1607 | Ga0501042_0130890 | |||
| 1608 | Ga0501043_0001612 | |||
| 1609 | Ga0501043_0011287 | |||
| 1610 | Ga0501043_0028035 | |||
| 1611 | Ga0501043_0238345 | |||
| 1612 | Ga0501046_0004162 | |||
| 1613 | Ga0501046_0031840 | |||
| 1614 | Ga0501046_0093539 | |||
| 1615 | Ga0501046_0323109 | |||
| 1616 | Ga0501047_0008384 | |||
| 1617 | Ga0501047_0010011 | |||
| 1618 | Ga0501047_0030400 | |||
| 1619 | Ga0501047_0031541 | |||
| 1620 | Ga0501047_0037405 | |||
| 1621 | Ga0501047_0363697 | |||
| 1622 | Ga0501048_0002639 | |||
| 1623 | Ga0501048_0003083 | |||
| 1624 | Ga0501048_0042899 | |||
| 1625 | Ga0501048_0081917 | |||
| 1626 | Ga0501068_0001059 | |||
| 1627 | Ga0501068_0013838 | |||
| 1628 | Ga0501068_0167563 | |||
| 1629 | Ga0501069_0054002 | |||
| 1630 | Ga0501069_0055396 | |||
| 1631 | Ga0501070_0000167 | |||
| 1632 | Ga0501070_0006114 | |||
| 1633 | Ga0501070_0021300 | |||
| 1634 | Ga0501070_0030519 | |||
| 1635 | Ga0501070_0030556 | |||
| 1636 | Ga0501070_0144986 | |||
| 1637 | Ga0501070_0293230 | |||
| 1638 | Ga0501070_0326041 | |||
| 1639 | Ga0501071_0048477 | |||
| 1640 | Ga0501071_0062813 | |||
| 1641 | Ga0501071_0300378 | |||
| 1642 | Ga0501072_0312500 | |||
| 1643 | Ga0501073_0072520 | |||
| 1644 | Ga0501073_0247110 | |||
| 1645 | Ga0501074_0020405 | |||
| 1646 | Ga0501075_0148567 | |||
| 1647 | Ga0501076_0018938 | |||
| 1648 | Ga0501076_0069686 | |||
| 1649 | Ga0501076_0088928 | |||
| 1650 | Ga0501076_0666593 | |||
| 1651 | Ga0501077_0028561 | |||
| 1652 | Ga0501077_0034990 | |||
| 1653 | Ga0501077_0042589 | |||
| 1654 | Ga0501077_0254612 | |||
| 1655 | Ga0501235_020082 | |||
| 1656 | Ga0501079_0016624 | |||
| 1657 | Ga0501079_0056334 | |||
| 1658 | Ga0501080_0013966 | |||
| 1659 | Ga0501080_0020887 | |||
| 1660 | Ga0501083_0000003 | |||
| 1661 | Ga0501083_0010150 | |||
| 1662 | Ga0501035_0009611 | |||
| 1663 | Ga0501035_0010726 | |||
| 1664 | Ga0501035_0023799 | |||
| 1665 | Ga0501035_0086695 | |||
| 1666 | Ga0501035_0111626 | |||
| 1667 | Ga0501035_0389213 | |||
| 1668 | Ga0501044_0010663 | |||
| 1669 | Ga0501044_0012841 | |||
| 1670 | Ga0501044_0020376 | |||
| 1671 | Ga0501044_0021144 | |||
| 1672 | Ga0501044_0105217 | |||
| 1673 | Ga0501044_0177084 | |||
| 1674 | Ga0501044_0339283 | |||
| 1675 | nmdc:mga00v17_12115_c1 | |||
| 1676 | nmdc:mga00v17_16089_c1 | |||
| 1677 | nmdc:mga00v17_2429_c1 | |||
| 1678 | nmdc:mga00v17_5501_c1 | |||
| 1679 | nmdc:mga00v17_70333_c1 | |||
| 1680 | nmdc:mga00v17_78187_c1 | |||
| 1681 | nmdc:mga0k408_253058_c1 | |||
| 1682 | nmdc:mga07m45_175839_c1 | |||
| 1683 | nmdc:mga07m45_29150_c1 | |||
| 1684 | nmdc:mga05p37_132926_c1 | |||
| 1685 | nmdc:mga05p37_25564_c1 | |||
| 1686 | nmdc:mga05p37_52655_c1 | |||
| 1687 | nmdc:mga09592_72293_c1 | |||
| 1688 | nmdc:mga06r32_40760_c1 | |||
| 1689 | nmdc:mga08y16_293051_c1 | |||
| 1690 | nmdc:mga08y16_470033_c1 | |||
| 1691 | nmdc:mga08y16_60365_c1 | |||
| 1692 | nmdc:mga08y16_95695_c1 | |||
| 1693 | nmdc:mga08x19_19_c1 | |||
| 1694 | nmdc:mga0sz30_8826_c1 | |||
| 1695 | Ga0500635_0000028 | |||
| 1696 | Ga0500644_0001599 | |||
| 1697 | Ga0500651_0083613 | |||
| 1698 | Ga0500556_0001502 | |||
| 1699 | Ga0500568_0004559 | |||
| 1700 | Ga0500600_0036594 | |||
| 1701 | Ga0500611_033160 | |||
| 1702 | Ga0500645_002561 | |||
| 1703 | Ga0501084_0065741 | |||
| 1704 | Ga0501082_0259165 | |||
| 1705 | Ga0501082_0363420 | |||
| 1706 | Ga0466962_0057997 | |||
| 1707 | Ga0530510_0076960 | |||
| 1708 | 2552110827 | |||
| 1709 | 2587755536 | |||
| 1710 | 2643746498 | |||
| 1711 | 2643754190 | |||
| 1712 | 2643785438 | |||
| 1713 | 2644097119 | |||
| 1714 | 2644220899 | |||
| 1715 | 2644259746 | |||
| 1716 | 2644304105 | |||
| 1717 | 2644337536 | |||
| 1718 | 2644446477 | |||
| 1719 | 2644486327 | |||
| 1720 | 2644637410 | |||
| 1721 | 2644679793 | |||
| 1722 | 2691514866 | |||
| 1723 | 2730229319 | |||
| 1724 | 2747952674 | |||
| 1725 | 2775654793 | |||
| 1726 | 2808631585 | |||
| 1727 | 2808902608 | |||
| 1728 | 2812320256 | |||
| 1729 | 2852647031 | |||
| 1730 | 2852664897 | |||
| 1731 | 2857741044 | |||
| 1732 | 2881105398 | |||
| 1733 | 2884765687 | |||
| 1734 | 2894026734 | |||
| 1735 | 2895660977 | |||
| 1736 | 2899367668 | |||
| 1737 | 2902815401 | |||
| 1738 | 2902840256 | |||
| 1739 | 2904500276 | |||
| 1740 | 2904776928 | |||
| 1741 | 2910810984 | |||
| 1742 | 2919036465 | |||
| 1743 | 2919059523 | |||
| 1744 | 2919392902 | |||
| 1745 | 2919443210 | |||
| 1746 | 2919540925 | |||
| 1747 | 2919717040 | |||
| 1748 | 2928115391 | |||
| 1749 | 2929215086 | |||
| 1750 | 2932427060 | |||
| 1751 | 2933419688 | |||
| 1752 | 2939587442 | |||
| 1753 | 2939649913 | |||
| 1754 | 2939663769 | |||
| 1755 | 2939677360 | |||
| 1756 | 2945918004 | |||
| 1757 | 2945960140 | |||
| 1758 | 2945971483 | |||
| 1759 | 2946034112 | |||
| 1760 | 2956941601 | |||
| 1761 | 2974306040 | |||
| 1762 | 3001119985 | |||
| 1763 | 8002392874 | |||
| 1764 | 8048747062 | |||
| 1765 | 8054110658 | |||
| 1766 | 8055038050 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6auj-assembly1.cif.gz_A-2 | crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 | 0.982 | 1 | 251 |
| 3qj7-assembly2.cif.gz_B | crystal structure of the mycobacterium tuberculosis thymidylate synthase (thya) bound to dump | 0.9793 | 1 | 261 |
| 3ix6-assembly1.cif.gz_A | crystal structure of thymidylate synthase thya from brucella melitensis | 0.9789 | 1 | 251 |
| 3bfi-assembly1.cif.gz_A-2 | e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump | 0.9777 | 3 | 264 |
| 3ix6-assembly1.cif.gz_B | crystal structure of thymidylate synthase thya from brucella melitensis | 0.9777 | 2 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9777 | 2 | 251 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9661 | 2 | 264 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.959 | 2 | 264 | 3.30.572.10 |
| 6qyaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9546 | 4 | 262 | 3.30.572.10 |
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9505 | 2 | 251 | 3.30.572.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B8HDY4-F1-model_v4 | deleted | 0.9955 | 119 | 249 |
|
| AF-A0A377CVI5-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9936 | 99 | 229 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A1G0F8E3-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9922 | 66 | 204 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A7V2EYC0-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9918 | 116 | 264 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A353WQK4-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9913 | 91 | 264 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |