F484608
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 883 | 338 | 1766 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300049823|Ga0501044_0007419|Ga0501044_0007419_2278_2724 |
| Length | 143 |
| Sequence | MHARPEGIDLAARSRARRRALQALYAWQLSGSHMNAVIEQFRHEQDMEVADLEYFEDLLHGVEKHVAELDALLRPYLDREPIERAALRLAAYELKHRPDVPYRVVINEAIEVTKRFGADHGHSYVNGVLDKLAGQLRSTEKRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 89 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 182 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 183 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 196 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 197 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 204 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 205 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 206 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 207 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 208 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 209 | 3300044662 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E | Metagenome | Unclassified |
| 210 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 211 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 212 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 218 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 219 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 272 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 273 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 274 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 275 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 276 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 277 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 278 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 279 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 280 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 281 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 282 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 283 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 309 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 310 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 311 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 312 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 313 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 314 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 318 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 319 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 320 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 321 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 322 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 323 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 324 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 325 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 326 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 327 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 328 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 329 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 330 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 331 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 332 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 333 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 334 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 335 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 336 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 337 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 338 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.7 |
| Metatranscriptomes | 1.93 |
| Isolates | 2.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.89 |
| Nodule | 0 |
| Rhizoplane | 3.06 |
| Rhizosphere | 72.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501044_0007419 | 3300049823 | Bacteria | 12063 |
| 2 | JGI24736J21556_1039259 | 3300001904 | Bacteria | 728 |
| 3 | JGI24741J21665_1002334 | 3300001915 | Bacteria | 4974 |
| 4 | JGI24741J21665_1002712 | 3300001915 | Bacteria | 4500 |
| 5 | JGI24740J21852_10000701 | 3300001979 | Bacteria | 14520 |
| 6 | JGI24739J22299_10009804 | 3300001989 | Bacteria | 3561 |
| 7 | JGI24737J22298_10026518 | 3300001990 | Bacteria | 1829 |
| 8 | JGI24737J22298_10081336 | 3300001990 | Bacteria | 964 |
| 9 | JGI24735J21928_10004013 | 3300002067 | Bacteria | 4980 |
| 10 | JGI24735J21928_10014324 | 3300002067 | Bacteria | 2485 |
| 11 | JGI24735J21928_10201559 | 3300002067 | Bacteria | 577 |
| 12 | JGI24738J21930_10015494 | 3300002075 | Bacteria | 1620 |
| 13 | JGI25162J39368_1001457 | 3300002737 | Bacteria | 12519 |
| 14 | JGI25162J39368_1002014 | 3300002737 | Bacteria | 9022 |
| 15 | JGI25162J39368_1004214 | 3300002737 | Bacteria | 3489 |
| 16 | JGI25162J39368_1010547 | 3300002737 | Bacteria | 1161 |
| 17 | JGI25154J39366_1007917 | 3300002738 | Bacteria | 1412 |
| 18 | JGI25154J39366_1008133 | 3300002738 | Bacteria | 1375 |
| 19 | JGI25154J39366_1014669 | 3300002738 | Bacteria | 821 |
| 20 | JGI25157J39369_1000224 | 3300002741 | Bacteria | 44715 |
| 21 | JGI25157J39369_1001100 | 3300002741 | Bacteria | 12060 |
| 22 | JGI25157J39369_1002245 | 3300002741 | Bacteria | 5204 |
| 23 | JGI25157J39369_1003667 | 3300002741 | Bacteria | 3041 |
| 24 | JGI25157J39369_1008184 | 3300002741 | Bacteria | 1466 |
| 25 | JGI25157J39369_1021350 | 3300002741 | Bacteria | 770 |
| 26 | JGI25163J39215_1001252 | 3300002771 | Bacteria | 4647 |
| 27 | JGI25164J39214_1000164 | 3300002772 | Bacteria | 62780 |
| 28 | JGI25164J39214_1002054 | 3300002772 | Bacteria | 3491 |
| 29 | JGI25164J39214_1006974 | 3300002772 | Bacteria | 1164 |
| 30 | JGI25165J46597_1000317 | 3300003214 | Bacteria | 58133 |
| 31 | JGI25165J46597_1001472 | 3300003214 | Bacteria | 12233 |
| 32 | JGI25165J46597_1012862 | 3300003214 | Bacteria | 1161 |
| 33 | JGI25165J46597_1030791 | 3300003214 | Bacteria | 692 |
| 34 | JGI25153J46596_10018510 | 3300003215 | Bacteria | 2702 |
| 35 | rootH2_10011924 | 3300003320 | Bacteria | 18770 |
| 36 | Ga0006554J51385_1041028 | 3300003567 | Bacteria | 976 |
| 37 | Ga0006562J51391_1031326 | 3300003578 | Bacteria | 7320 |
| 38 | Ga0006562J51391_1042664 | 3300003578 | Bacteria | 8710 |
| 39 | Ga0006562J51391_1042669 | 3300003578 | Bacteria | 3710 |
| 40 | Ga0055533_1002210 | 3300003756 | Bacteria | 4593 |
| 41 | Ga0055533_1005210 | 3300003756 | Bacteria | 2139 |
| 42 | Ga0055533_1006131 | 3300003756 | Bacteria | 1818 |
| 43 | Ga0055525_1000055 | 3300003759 | Bacteria | 215181 |
| 44 | Ga0055527_1000116 | 3300003760 | Bacteria | 57355 |
| 45 | Ga0055527_1000210 | 3300003760 | Bacteria | 37874 |
| 46 | Ga0055535_1000296 | 3300003761 | Bacteria | 51261 |
| 47 | Ga0055535_1000454 | 3300003761 | Bacteria | 37846 |
| 48 | Ga0055535_1001071 | 3300003761 | Bacteria | 16846 |
| 49 | Ga0055535_1001444 | 3300003761 | Bacteria | 12063 |
| 50 | Ga0055535_1002833 | 3300003761 | Bacteria | 5481 |
| 51 | Ga0055542_1000056 | 3300003762 | Bacteria | 167483 |
| 52 | Ga0055542_1000263 | 3300003762 | Bacteria | 58594 |
| 53 | Ga0055542_1000277 | 3300003762 | Bacteria | 57355 |
| 54 | Ga0055542_1000468 | 3300003762 | Bacteria | 37874 |
| 55 | Ga0055542_1000620 | 3300003762 | Bacteria | 30079 |
| 56 | Ga0055542_1004324 | 3300003762 | Bacteria | 3489 |
| 57 | Ga0055542_1028233 | 3300003762 | Bacteria | 741 |
| 58 | Ga0055529_1000253 | 3300003763 | Bacteria | 64782 |
| 59 | Ga0055529_1000298 | 3300003763 | Bacteria | 57355 |
| 60 | Ga0055529_1000479 | 3300003763 | Bacteria | 37884 |
| 61 | Ga0055529_1001107 | 3300003763 | Bacteria | 12033 |
| 62 | Ga0055529_1003276 | 3300003763 | Bacteria | 2735 |
| 63 | Ga0055543_1007681 | 3300004625 | Bacteria | 2464 |
| 64 | Ga0065165_1000108 | 3300005262 | Bacteria | 139605 |
| 65 | Ga0065165_1005855 | 3300005262 | Bacteria | 6689 |
| 66 | Ga0070658_10001565 | 3300005327 | Bacteria | 19405 |
| 67 | Ga0070658_10118601 | 3300005327 | Bacteria | 2197 |
| 68 | Ga0070658_10523744 | 3300005327 | Bacteria | 1025 |
| 69 | Ga0070658_10550404 | 3300005327 | Bacteria | 998 |
| 70 | Ga0070658_10614628 | 3300005327 | Bacteria | 942 |
| 71 | Ga0070683_100127162 | 3300005329 | Bacteria | 2409 |
| 72 | Ga0070683_100142437 | 3300005329 | Bacteria | 2271 |
| 73 | Ga0070683_100174384 | 3300005329 | Bacteria | 2041 |
| 74 | Ga0070690_100202766 | 3300005330 | Bacteria | 1381 |
| 75 | Ga0070690_100345793 | 3300005330 | Bacteria | 1078 |
| 76 | Ga0070670_100009171 | 3300005331 | Bacteria | 8458 |
| 77 | Ga0070670_100265733 | 3300005331 | Bacteria | 1496 |
| 78 | Ga0070666_10000037 | 3300005335 | Bacteria | 116528 |
| 79 | Ga0070666_10000487 | 3300005335 | Bacteria | 23992 |
| 80 | Ga0070666_10007269 | 3300005335 | Bacteria | 6828 |
| 81 | Ga0070680_100097990 | 3300005336 | Bacteria | 2431 |
| 82 | Ga0070680_100460938 | 3300005336 | Bacteria | 1086 |
| 83 | Ga0070682_100176722 | 3300005337 | Bacteria | 1488 |
| 84 | Ga0068868_100058111 | 3300005338 | Bacteria | 3056 |
| 85 | Ga0070660_100247365 | 3300005339 | Bacteria | 1453 |
| 86 | Ga0070660_100373620 | 3300005339 | Bacteria | 1176 |
| 87 | Ga0070660_100648008 | 3300005339 | Bacteria | 884 |
| 88 | Ga0070691_10032937 | 3300005341 | Bacteria | 2436 |
| 89 | Ga0070691_10533427 | 3300005341 | Bacteria | 683 |
| 90 | Ga0070661_100007367 | 3300005344 | Bacteria | 7588 |
| 91 | Ga0070661_100010149 | 3300005344 | Bacteria | 6540 |
| 92 | Ga0070661_100014442 | 3300005344 | Bacteria | 5566 |
| 93 | Ga0070661_100108677 | 3300005344 | Bacteria | 2069 |
| 94 | Ga0070661_100134943 | 3300005344 | Bacteria | 1856 |
| 95 | Ga0070661_100239179 | 3300005344 | Bacteria | 1397 |
| 96 | Ga0070661_100298248 | 3300005344 | Bacteria | 1254 |
| 97 | Ga0070692_10037193 | 3300005345 | Bacteria | 2473 |
| 98 | Ga0070692_10105382 | 3300005345 | Bacteria | 1552 |
| 99 | Ga0070668_100097591 | 3300005347 | Bacteria | 2324 |
| 100 | Ga0070671_100415382 | 3300005355 | Bacteria | 1152 |
| 101 | Ga0070688_100128609 | 3300005365 | Bacteria | 1706 |
| 102 | Ga0070659_100058492 | 3300005366 | Bacteria | 3042 |
| 103 | Ga0070667_100000072 | 3300005367 | Bacteria | 122929 |
| 104 | Ga0070667_100016061 | 3300005367 | Bacteria | 6193 |
| 105 | Ga0070667_100131582 | 3300005367 | Bacteria | 2184 |
| 106 | Ga0070667_100244360 | 3300005367 | Bacteria | 1603 |
| 107 | Ga0070667_100591501 | 3300005367 | Bacteria | 1022 |
| 108 | Ga0070714_100096930 | 3300005435 | Bacteria | 2592 |
| 109 | Ga0070713_100123179 | 3300005436 | Bacteria | 2276 |
| 110 | Ga0070711_100332269 | 3300005439 | Bacteria | 1217 |
| 111 | Ga0070708_100946346 | 3300005445 | Bacteria | 808 |
| 112 | Ga0070663_100005396 | 3300005455 | Bacteria | 7595 |
| 113 | Ga0070663_100028573 | 3300005455 | Bacteria | 3798 |
| 114 | Ga0070663_100039684 | 3300005455 | Bacteria | 3292 |
| 115 | Ga0070663_100072087 | 3300005455 | Bacteria | 2515 |
| 116 | Ga0070663_100110496 | 3300005455 | Bacteria | 2065 |
| 117 | Ga0070663_100287078 | 3300005455 | Bacteria | 1313 |
| 118 | Ga0070663_100372822 | 3300005455 | Bacteria | 1161 |
| 119 | Ga0070663_100649466 | 3300005455 | Bacteria | 892 |
| 120 | Ga0070663_100789579 | 3300005455 | Bacteria | 813 |
| 121 | Ga0070663_100868267 | 3300005455 | Bacteria | 777 |
| 122 | Ga0070678_100362546 | 3300005456 | Bacteria | 1249 |
| 123 | Ga0070681_10000151 | 3300005458 | Bacteria | 52829 |
| 124 | Ga0070681_10037306 | 3300005458 | Bacteria | 4878 |
| 125 | Ga0070681_10125600 | 3300005458 | Bacteria | 2498 |
| 126 | Ga0070681_10128599 | 3300005458 | Bacteria | 2465 |
| 127 | Ga0068867_100045587 | 3300005459 | Bacteria | 3217 |
| 128 | Ga0068867_101105138 | 3300005459 | Bacteria | 724 |
| 129 | Ga0070685_10014858 | 3300005466 | Bacteria | 4129 |
| 130 | Ga0070699_100485645 | 3300005518 | Bacteria | 1121 |
| 131 | Ga0070679_100000250 | 3300005530 | Bacteria | 45069 |
| 132 | Ga0070679_100055321 | 3300005530 | Bacteria | 3951 |
| 133 | Ga0070684_100089335 | 3300005535 | Bacteria | 2738 |
| 134 | Ga0070684_100131098 | 3300005535 | Bacteria | 2261 |
| 135 | Ga0070684_100288459 | 3300005535 | Bacteria | 1504 |
| 136 | Ga0068853_100006694 | 3300005539 | Bacteria | 9179 |
| 137 | Ga0068853_100016337 | 3300005539 | Bacteria | 6107 |
| 138 | Ga0068853_100016385 | 3300005539 | Bacteria | 6099 |
| 139 | Ga0068853_100035262 | 3300005539 | Bacteria | 4248 |
| 140 | Ga0068853_100053738 | 3300005539 | Bacteria | 3469 |
| 141 | Ga0068853_100241308 | 3300005539 | Bacteria | 1656 |
| 142 | Ga0068853_100265685 | 3300005539 | Bacteria | 1579 |
| 143 | Ga0068853_101179716 | 3300005539 | Bacteria | 739 |
| 144 | Ga0068853_101225682 | 3300005539 | Bacteria | 725 |
| 145 | Ga0070696_100007583 | 3300005546 | Bacteria | 7254 |
| 146 | Ga0070696_100031485 | 3300005546 | Bacteria | 3635 |
| 147 | Ga0070665_100000376 | 3300005548 | Bacteria | 66416 |
| 148 | Ga0070665_100010663 | 3300005548 | Bacteria | 9303 |
| 149 | Ga0068855_100010660 | 3300005563 | Bacteria | 11087 |
| 150 | Ga0068855_100122173 | 3300005563 | Bacteria | 2980 |
| 151 | Ga0068855_100212437 | 3300005563 | Bacteria | 2173 |
| 152 | Ga0070664_100128266 | 3300005564 | Bacteria | 2226 |
| 153 | Ga0068857_100013283 | 3300005577 | Bacteria | 7173 |
| 154 | Ga0068857_100038503 | 3300005577 | Bacteria | 4235 |
| 155 | Ga0068857_100050500 | 3300005577 | Bacteria | 3689 |
| 156 | Ga0068857_100061409 | 3300005577 | Bacteria | 3339 |
| 157 | Ga0068857_100226826 | 3300005577 | Bacteria | 1707 |
| 158 | Ga0068854_100003612 | 3300005578 | Bacteria | 9680 |
| 159 | Ga0068854_100113799 | 3300005578 | Bacteria | 2044 |
| 160 | Ga0068854_100123359 | 3300005578 | Bacteria | 1970 |
| 161 | Ga0068854_100429121 | 3300005578 | Bacteria | 1099 |
| 162 | Ga0068856_100007396 | 3300005614 | Bacteria | 10716 |
| 163 | Ga0068856_100012219 | 3300005614 | Bacteria | 8319 |
| 164 | Ga0068856_100169157 | 3300005614 | Bacteria | 2197 |
| 165 | Ga0068856_100319989 | 3300005614 | Bacteria | 1568 |
| 166 | Ga0068852_100006036 | 3300005616 | Bacteria | 8728 |
| 167 | Ga0068852_100034585 | 3300005616 | Bacteria | 4206 |
| 168 | Ga0068852_100042035 | 3300005616 | Bacteria | 3868 |
| 169 | Ga0068852_100073648 | 3300005616 | Bacteria | 3005 |
| 170 | Ga0068852_100169580 | 3300005616 | Bacteria | 2045 |
| 171 | Ga0068852_100178626 | 3300005616 | Bacteria | 1994 |
| 172 | Ga0068852_100235707 | 3300005616 | Bacteria | 1746 |
| 173 | Ga0068859_100324564 | 3300005617 | Bacteria | 1633 |
| 174 | Ga0068859_101521946 | 3300005617 | Bacteria | 738 |
| 175 | Ga0068864_100004209 | 3300005618 | Bacteria | 11834 |
| 176 | Ga0068851_10000908 | 3300005834 | Bacteria | 12753 |
| 177 | Ga0068851_10010761 | 3300005834 | Bacteria | 4275 |
| 178 | Ga0068851_10019388 | 3300005834 | Bacteria | 3286 |
| 179 | Ga0068851_10196718 | 3300005834 | Bacteria | 1123 |
| 180 | Ga0068863_100006254 | 3300005841 | Bacteria | 11695 |
| 181 | Ga0068863_100556207 | 3300005841 | Bacteria | 1133 |
| 182 | Ga0068863_100981392 | 3300005841 | Bacteria | 847 |
| 183 | Ga0068858_100000817 | 3300005842 | Bacteria | 32476 |
| 184 | Ga0068858_100074088 | 3300005842 | Bacteria | 3161 |
| 185 | Ga0068858_100242140 | 3300005842 | Bacteria | 1712 |
| 186 | Ga0068858_100630593 | 3300005842 | Bacteria | 1041 |
| 187 | Ga0068858_100733808 | 3300005842 | Bacteria | 962 |
| 188 | Ga0068860_100017401 | 3300005843 | Bacteria | 7003 |
| 189 | Ga0068860_100066993 | 3300005843 | Bacteria | 3412 |
| 190 | Ga0068860_100265669 | 3300005843 | Bacteria | 1673 |
| 191 | Ga0068860_100270877 | 3300005843 | Bacteria | 1657 |
| 192 | Ga0068862_100176956 | 3300005844 | Bacteria | 1913 |
| 193 | Ga0068862_100646975 | 3300005844 | Bacteria | 1019 |
| 194 | Ga0075369_10064511 | 3300006186 | Bacteria | 1604 |
| 195 | Ga0097621_100324094 | 3300006237 | Bacteria | 1365 |
| 196 | Ga0097621_100400799 | 3300006237 | Bacteria | 1228 |
| 197 | Ga0097621_100482046 | 3300006237 | Bacteria | 1121 |
| 198 | Ga0068871_100231117 | 3300006358 | Bacteria | 1605 |
| 199 | Ga0068865_100427698 | 3300006881 | Bacteria | 1090 |
| 200 | Ga0097620_100324596 | 3300006931 | Bacteria | 1633 |
| 201 | Ga0097620_101522031 | 3300006931 | Bacteria | 738 |
| 202 | Ga0105240_10002563 | 3300009093 | Bacteria | 29133 |
| 203 | Ga0105240_10009143 | 3300009093 | Bacteria | 14064 |
| 204 | Ga0105240_10009721 | 3300009093 | Bacteria | 13581 |
| 205 | Ga0105240_10011172 | 3300009093 | Bacteria | 12533 |
| 206 | Ga0105240_10023678 | 3300009093 | Bacteria | 8112 |
| 207 | Ga0105240_10055889 | 3300009093 | Bacteria | 4941 |
| 208 | Ga0105240_10152926 | 3300009093 | Bacteria | 2746 |
| 209 | Ga0105240_10256770 | 3300009093 | Bacteria | 2018 |
| 210 | Ga0105240_11226200 | 3300009093 | Bacteria | 794 |
| 211 | Ga0105240_11500257 | 3300009093 | Bacteria | 707 |
| 212 | Ga0105245_10286466 | 3300009098 | Bacteria | 1612 |
| 213 | Ga0105245_10406451 | 3300009098 | Bacteria | 1362 |
| 214 | Ga0105247_10002916 | 3300009101 | Bacteria | 11384 |
| 215 | Ga0105241_10015625 | 3300009174 | Bacteria | 5562 |
| 216 | Ga0105241_10094532 | 3300009174 | Bacteria | 2364 |
| 217 | Ga0105241_10620362 | 3300009174 | Bacteria | 979 |
| 218 | Ga0105241_11415169 | 3300009174 | Bacteria | 666 |
| 219 | Ga0105242_10762084 | 3300009176 | Bacteria | 954 |
| 220 | Ga0105248_10000920 | 3300009177 | Bacteria | 32785 |
| 221 | Ga0105248_10944372 | 3300009177 | Bacteria | 974 |
| 222 | Ga0105237_10000084 | 3300009545 | Bacteria | 125742 |
| 223 | Ga0105237_10000675 | 3300009545 | Bacteria | 47159 |
| 224 | Ga0105237_10008928 | 3300009545 | Bacteria | 10796 |
| 225 | Ga0105237_10009642 | 3300009545 | Bacteria | 10335 |
| 226 | Ga0105237_11987742 | 3300009545 | Bacteria | 590 |
| 227 | Ga0105238_10000131 | 3300009551 | Bacteria | 82050 |
| 228 | Ga0105238_10005144 | 3300009551 | Bacteria | 12931 |
| 229 | Ga0105238_10098301 | 3300009551 | Bacteria | 2911 |
| 230 | Ga0105238_10108501 | 3300009551 | Bacteria | 2757 |
| 231 | Ga0105238_10391495 | 3300009551 | Bacteria | 1382 |
| 232 | Ga0105238_11236530 | 3300009551 | Bacteria | 772 |
| 233 | Ga0105249_10000084 | 3300009553 | Bacteria | 134869 |
| 234 | Ga0105249_10007606 | 3300009553 | Bacteria | 9453 |
| 235 | Ga0105239_10000033 | 3300010375 | Bacteria | 223933 |
| 236 | Ga0105239_10018126 | 3300010375 | Bacteria | 7783 |
| 237 | Ga0105239_10042913 | 3300010375 | Bacteria | 4955 |
| 238 | Ga0105239_10106637 | 3300010375 | Bacteria | 3104 |
| 239 | Ga0105239_10572998 | 3300010375 | Bacteria | 1286 |
| 240 | Ga0105246_10011815 | 3300011119 | Bacteria | 5427 |
| 241 | Ga0105246_10128100 | 3300011119 | Bacteria | 1892 |
| 242 | Ga0105246_11968736 | 3300011119 | Bacteria | 563 |
| 243 | Ga0157314_1000507 | 3300012500 | Bacteria | 3702 |
| 244 | Ga0154012_169161 | 3300013059 | Bacteria | 1120 |
| 245 | Ga0157373_10011463 | 3300013100 | Bacteria | 6519 |
| 246 | Ga0157373_10100595 | 3300013100 | Bacteria | 2034 |
| 247 | Ga0157371_10070400 | 3300013102 | Bacteria | 2476 |
| 248 | Ga0157371_10348755 | 3300013102 | Bacteria | 1077 |
| 249 | Ga0157370_10005440 | 3300013104 | Bacteria | 14285 |
| 250 | Ga0157370_10023809 | 3300013104 | Bacteria | 6075 |
| 251 | Ga0157370_10045998 | 3300013104 | Bacteria | 4186 |
| 252 | Ga0157370_10081025 | 3300013104 | Bacteria | 3055 |
| 253 | Ga0157369_10003012 | 3300013105 | Bacteria | 20149 |
| 254 | Ga0157369_10011973 | 3300013105 | Bacteria | 9855 |
| 255 | Ga0157369_10018985 | 3300013105 | Bacteria | 7700 |
| 256 | Ga0157369_10124679 | 3300013105 | Bacteria | 2732 |
| 257 | Ga0157369_11419744 | 3300013105 | Bacteria | 707 |
| 258 | Ga0157374_11003429 | 3300013296 | Bacteria | 854 |
| 259 | Ga0163162_10000221 | 3300013306 | Bacteria | 52249 |
| 260 | Ga0163162_10069555 | 3300013306 | Bacteria | 3572 |
| 261 | Ga0163162_10489642 | 3300013306 | Bacteria | 1361 |
| 262 | Ga0157372_10000334 | 3300013307 | Bacteria | 51813 |
| 263 | Ga0157372_10044203 | 3300013307 | Bacteria | 4935 |
| 264 | Ga0157372_10066779 | 3300013307 | Bacteria | 4041 |
| 265 | Ga0157372_10081165 | 3300013307 | Bacteria | 3670 |
| 266 | Ga0157372_10173947 | 3300013307 | Bacteria | 2492 |
| 267 | Ga0157372_10213378 | 3300013307 | Bacteria | 2237 |
| 268 | Ga0157372_11449664 | 3300013307 | Bacteria | 791 |
| 269 | Ga0163163_10000112 | 3300014325 | Bacteria | 86324 |
| 270 | Ga0163163_10000585 | 3300014325 | Bacteria | 32121 |
| 271 | Ga0182008_10006516 | 3300014497 | Bacteria | 6516 |
| 272 | Ga0182008_10021422 | 3300014497 | Bacteria | 3318 |
| 273 | Ga0182008_10036778 | 3300014497 | Bacteria | 2449 |
| 274 | Ga0182008_10055909 | 3300014497 | Bacteria | 1951 |
| 275 | Ga0182008_10191861 | 3300014497 | Bacteria | 1037 |
| 276 | Ga0157379_10007853 | 3300014968 | Bacteria | 9242 |
| 277 | Ga0157379_10482832 | 3300014968 | Bacteria | 1147 |
| 278 | Ga0157376_10009210 | 3300014969 | Bacteria | 7162 |
| 279 | Ga0182006_1000031 | 3300015261 | Bacteria | 240055 |
| 280 | Ga0182006_1000496 | 3300015261 | Bacteria | 30592 |
| 281 | Ga0182007_10003787 | 3300015262 | Bacteria | 7047 |
| 282 | Ga0182007_10015105 | 3300015262 | Bacteria | 2890 |
| 283 | Ga0182005_1000049 | 3300015265 | Bacteria | 123003 |
| 284 | Ga0182005_1001001 | 3300015265 | Bacteria | 12121 |
| 285 | Ga0182005_1002650 | 3300015265 | Bacteria | 6301 |
| 286 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 287 | Ga0163161_10007409 | 3300017792 | Bacteria | 7580 |
| 288 | Ga0163161_10066212 | 3300017792 | Bacteria | 2638 |
| 289 | Ga0206356_11026662 | 3300020070 | Bacteria | 4285 |
| 290 | Ga0206356_11905763 | 3300020070 | Bacteria | 1398 |
| 291 | Ga0206351_10589011 | 3300020077 | Bacteria | 1281 |
| 292 | Ga0206351_10768644 | 3300020077 | Bacteria | 1101 |
| 293 | Ga0206352_10871908 | 3300020078 | Bacteria | 1811 |
| 294 | Ga0206350_11455286 | 3300020080 | Bacteria | 1708 |
| 295 | Ga0206354_10524459 | 3300020081 | Bacteria | 4072 |
| 296 | Ga0206353_10447795 | 3300020082 | Bacteria | 2783 |
| 297 | Ga0206353_11143090 | 3300020082 | Bacteria | 799 |
| 298 | Ga0154015_1513628 | 3300020610 | Bacteria | 2906 |
| 299 | Ga0224712_10074632 | 3300022467 | Bacteria | 1386 |
| 300 | Ga0224712_10128125 | 3300022467 | Bacteria | 1106 |
| 301 | Ga0209760_100376 | 3300025207 | Bacteria | 11760 |
| 302 | Ga0209784_100204 | 3300025224 | Bacteria | 42366 |
| 303 | Ga0209566_102111 | 3300025225 | Bacteria | 4074 |
| 304 | Ga0209674_100061 | 3300025226 | Bacteria | 280844 |
| 305 | Ga0209674_100077 | 3300025226 | Bacteria | 206312 |
| 306 | Ga0209674_100785 | 3300025226 | Bacteria | 10709 |
| 307 | Ga0209674_104333 | 3300025226 | Bacteria | 2331 |
| 308 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 309 | Ga0209672_100022 | 3300025228 | Bacteria | 374313 |
| 310 | Ga0209672_100251 | 3300025228 | Bacteria | 39907 |
| 311 | Ga0209672_101130 | 3300025228 | Bacteria | 11110 |
| 312 | Ga0209672_101444 | 3300025228 | Bacteria | 8507 |
| 313 | Ga0209147_107974 | 3300025229 | Bacteria | 1344 |
| 314 | Ga0209563_100076 | 3300025230 | Bacteria | 215269 |
| 315 | Ga0207427_100111 | 3300025231 | Bacteria | 112775 |
| 316 | Ga0207427_100179 | 3300025231 | Bacteria | 67665 |
| 317 | Ga0207427_100185 | 3300025231 | Bacteria | 63916 |
| 318 | Ga0207427_100510 | 3300025231 | Bacteria | 20592 |
| 319 | Ga0209437_100099 | 3300025233 | Bacteria | 229500 |
| 320 | Ga0209437_100113 | 3300025233 | Bacteria | 211240 |
| 321 | Ga0209437_100320 | 3300025233 | Bacteria | 62893 |
| 322 | Ga0209437_100368 | 3300025233 | Bacteria | 48548 |
| 323 | Ga0209437_100782 | 3300025233 | Bacteria | 14969 |
| 324 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 325 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 326 | Ga0209258_100119 | 3300025242 | Bacteria | 183554 |
| 327 | Ga0209258_100122 | 3300025242 | Bacteria | 180314 |
| 328 | Ga0209258_100137 | 3300025242 | Bacteria | 167913 |
| 329 | Ga0209258_100376 | 3300025242 | Bacteria | 57517 |
| 330 | Ga0209258_106897 | 3300025242 | Bacteria | 1730 |
| 331 | Ga0209646_1000985 | 3300025246 | Bacteria | 8811 |
| 332 | Ga0209646_1001103 | 3300025246 | Bacteria | 7995 |
| 333 | Ga0209646_1003374 | 3300025246 | Bacteria | 3173 |
| 334 | Ga0209646_1027599 | 3300025246 | Bacteria | 781 |
| 335 | Ga0209026_1000087 | 3300025250 | Bacteria | 184044 |
| 336 | Ga0209026_1000175 | 3300025250 | Bacteria | 98059 |
| 337 | Ga0209026_1000274 | 3300025250 | Bacteria | 61312 |
| 338 | Ga0209026_1000276 | 3300025250 | Bacteria | 60964 |
| 339 | Ga0209026_1008805 | 3300025250 | Bacteria | 2059 |
| 340 | Ga0209677_101477 | 3300025253 | Bacteria | 10113 |
| 341 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 342 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 343 | Ga0209148_1000036 | 3300025254 | Bacteria | 530505 |
| 344 | Ga0209148_1000062 | 3300025254 | Bacteria | 347704 |
| 345 | Ga0209148_1000083 | 3300025254 | Bacteria | 270142 |
| 346 | Ga0209148_1000137 | 3300025254 | Bacteria | 168097 |
| 347 | Ga0209148_1001786 | 3300025254 | Bacteria | 9177 |
| 348 | Ga0209759_1000136 | 3300025256 | Bacteria | 125393 |
| 349 | Ga0209759_1000320 | 3300025256 | Bacteria | 63830 |
| 350 | Ga0209759_1001153 | 3300025256 | Bacteria | 16782 |
| 351 | Ga0209759_1001565 | 3300025256 | Bacteria | 12489 |
| 352 | Ga0209759_1048645 | 3300025256 | Bacteria | 669 |
| 353 | Ga0209129_1000769 | 3300025258 | Bacteria | 20356 |
| 354 | Ga0209233_1000040 | 3300025261 | Bacteria | 530395 |
| 355 | Ga0209233_1000075 | 3300025261 | Bacteria | 356837 |
| 356 | Ga0209233_1000128 | 3300025261 | Bacteria | 209927 |
| 357 | Ga0209233_1008709 | 3300025261 | Bacteria | 3119 |
| 358 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 359 | Ga0209455_1000040 | 3300025272 | Bacteria | 430197 |
| 360 | Ga0209455_1000084 | 3300025272 | Bacteria | 253164 |
| 361 | Ga0209455_1000095 | 3300025272 | Bacteria | 217487 |
| 362 | Ga0209455_1000164 | 3300025272 | Bacteria | 114011 |
| 363 | Ga0209455_1001294 | 3300025272 | Bacteria | 11681 |
| 364 | Ga0209455_1007907 | 3300025272 | Bacteria | 2947 |
| 365 | Ga0209758_1000301 | 3300025297 | Bacteria | 96998 |
| 366 | Ga0209758_1020451 | 3300025297 | Bacteria | 3131 |
| 367 | Ga0209758_1047231 | 3300025297 | Bacteria | 1543 |
| 368 | Ga0207426_1016040 | 3300025302 | Bacteria | 2702 |
| 369 | Ga0209051_1007151 | 3300025303 | Bacteria | 6152 |
| 370 | Ga0209257_1000067 | 3300025304 | Bacteria | 342468 |
| 371 | Ga0209257_1039691 | 3300025304 | Bacteria | 1412 |
| 372 | Ga0207656_10007153 | 3300025321 | Bacteria | 4056 |
| 373 | Ga0207656_10008269 | 3300025321 | Bacteria | 3820 |
| 374 | Ga0207656_10119317 | 3300025321 | Bacteria | 1226 |
| 375 | Ga0207710_10003748 | 3300025900 | Bacteria | 6728 |
| 376 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 377 | Ga0207680_10000598 | 3300025903 | Bacteria | 17011 |
| 378 | Ga0207680_10001902 | 3300025903 | Bacteria | 9799 |
| 379 | Ga0207680_10388284 | 3300025903 | Bacteria | 985 |
| 380 | Ga0207647_10000034 | 3300025904 | Bacteria | 99280 |
| 381 | Ga0207647_10000262 | 3300025904 | Bacteria | 43207 |
| 382 | Ga0207647_10002208 | 3300025904 | Bacteria | 14832 |
| 383 | Ga0207647_10002308 | 3300025904 | Bacteria | 14534 |
| 384 | Ga0207647_10012004 | 3300025904 | Bacteria | 6046 |
| 385 | Ga0207647_10119619 | 3300025904 | Bacteria | 1553 |
| 386 | Ga0207705_10000560 | 3300025909 | Bacteria | 31207 |
| 387 | Ga0207705_10006860 | 3300025909 | Bacteria | 8417 |
| 388 | Ga0207705_10037183 | 3300025909 | Bacteria | 3483 |
| 389 | Ga0207705_10112632 | 3300025909 | Bacteria | 2012 |
| 390 | Ga0207705_10678893 | 3300025909 | Bacteria | 801 |
| 391 | Ga0207654_10000719 | 3300025911 | Bacteria | 18479 |
| 392 | Ga0207654_10005416 | 3300025911 | Bacteria | 6455 |
| 393 | Ga0207654_10213287 | 3300025911 | Bacteria | 1277 |
| 394 | Ga0207654_10494947 | 3300025911 | Bacteria | 863 |
| 395 | Ga0207707_10000064 | 3300025912 | Bacteria | 107490 |
| 396 | Ga0207707_10006038 | 3300025912 | Bacteria | 10596 |
| 397 | Ga0207707_10006315 | 3300025912 | Bacteria | 10349 |
| 398 | Ga0207707_10029371 | 3300025912 | Bacteria | 4806 |
| 399 | Ga0207707_10094005 | 3300025912 | Bacteria | 2619 |
| 400 | Ga0207695_10000588 | 3300025913 | Bacteria | 73260 |
| 401 | Ga0207695_10001221 | 3300025913 | Bacteria | 44045 |
| 402 | Ga0207695_10001320 | 3300025913 | Bacteria | 42048 |
| 403 | Ga0207695_10002529 | 3300025913 | Bacteria | 26858 |
| 404 | Ga0207695_10003607 | 3300025913 | Bacteria | 21652 |
| 405 | Ga0207695_10004205 | 3300025913 | Bacteria | 19775 |
| 406 | Ga0207695_10027716 | 3300025913 | Bacteria | 6304 |
| 407 | Ga0207695_10056422 | 3300025913 | Bacteria | 4087 |
| 408 | Ga0207695_10103753 | 3300025913 | Bacteria | 2834 |
| 409 | Ga0207695_10123193 | 3300025913 | Bacteria | 2558 |
| 410 | Ga0207695_10176528 | 3300025913 | Bacteria | 2058 |
| 411 | Ga0207695_10544900 | 3300025913 | Bacteria | 1042 |
| 412 | Ga0207671_10000011 | 3300025914 | Bacteria | 530349 |
| 413 | Ga0207671_10012799 | 3300025914 | Bacteria | 6724 |
| 414 | Ga0207671_10013618 | 3300025914 | Bacteria | 6470 |
| 415 | Ga0207671_10094240 | 3300025914 | Bacteria | 2260 |
| 416 | Ga0207663_10040939 | 3300025916 | Bacteria | 2820 |
| 417 | Ga0207660_10001372 | 3300025917 | Bacteria | 16322 |
| 418 | Ga0207660_10001813 | 3300025917 | Bacteria | 14233 |
| 419 | Ga0207660_10003444 | 3300025917 | Bacteria | 10324 |
| 420 | Ga0207660_10135796 | 3300025917 | Bacteria | 1877 |
| 421 | Ga0207657_10002836 | 3300025919 | Bacteria | 18613 |
| 422 | Ga0207657_10029335 | 3300025919 | Bacteria | 5010 |
| 423 | Ga0207657_10029430 | 3300025919 | Bacteria | 5000 |
| 424 | Ga0207649_10001382 | 3300025920 | Bacteria | 14383 |
| 425 | Ga0207649_10006569 | 3300025920 | Bacteria | 6318 |
| 426 | Ga0207649_10006704 | 3300025920 | Bacteria | 6258 |
| 427 | Ga0207649_10010845 | 3300025920 | Bacteria | 5009 |
| 428 | Ga0207649_10249805 | 3300025920 | Bacteria | 1277 |
| 429 | Ga0207649_10811832 | 3300025920 | Bacteria | 730 |
| 430 | Ga0207652_10000019 | 3300025921 | Bacteria | 164416 |
| 431 | Ga0207652_10000801 | 3300025921 | Bacteria | 30036 |
| 432 | Ga0207652_10008959 | 3300025921 | Bacteria | 8065 |
| 433 | Ga0207652_10148733 | 3300025921 | Bacteria | 2096 |
| 434 | Ga0207652_10333672 | 3300025921 | Bacteria | 1369 |
| 435 | Ga0207681_10897705 | 3300025923 | Bacteria | 742 |
| 436 | Ga0207694_10000654 | 3300025924 | Bacteria | 31284 |
| 437 | Ga0207694_10001428 | 3300025924 | Bacteria | 20477 |
| 438 | Ga0207694_10001879 | 3300025924 | Bacteria | 17407 |
| 439 | Ga0207694_10048048 | 3300025924 | Bacteria | 3301 |
| 440 | Ga0207694_10147134 | 3300025924 | Bacteria | 1896 |
| 441 | Ga0207694_10520874 | 3300025924 | Bacteria | 996 |
| 442 | Ga0207694_10613577 | 3300025924 | Bacteria | 915 |
| 443 | Ga0207650_10006245 | 3300025925 | Bacteria | 8118 |
| 444 | Ga0207650_10230356 | 3300025925 | Bacteria | 1494 |
| 445 | Ga0207687_10218969 | 3300025927 | Bacteria | 1498 |
| 446 | Ga0207700_10023119 | 3300025928 | Bacteria | 4279 |
| 447 | Ga0207644_10735062 | 3300025931 | Bacteria | 824 |
| 448 | Ga0207690_10011845 | 3300025932 | Bacteria | 5214 |
| 449 | Ga0207690_10068857 | 3300025932 | Bacteria | 2433 |
| 450 | Ga0207706_10004869 | 3300025933 | Bacteria | 12569 |
| 451 | Ga0207706_10133414 | 3300025933 | Bacteria | 2184 |
| 452 | Ga0207706_10408337 | 3300025933 | Bacteria | 1177 |
| 453 | Ga0207704_10841111 | 3300025938 | Bacteria | 769 |
| 454 | Ga0207711_10001918 | 3300025941 | Bacteria | 18898 |
| 455 | Ga0207661_10036981 | 3300025944 | Bacteria | 3814 |
| 456 | Ga0207661_10448781 | 3300025944 | Bacteria | 1174 |
| 457 | Ga0207679_10054898 | 3300025945 | Bacteria | 2935 |
| 458 | Ga0207679_11742349 | 3300025945 | Bacteria | 570 |
| 459 | Ga0207667_10000219 | 3300025949 | Bacteria | 80218 |
| 460 | Ga0207667_10000446 | 3300025949 | Bacteria | 55443 |
| 461 | Ga0207667_10000574 | 3300025949 | Bacteria | 48011 |
| 462 | Ga0207667_10002469 | 3300025949 | Bacteria | 23071 |
| 463 | Ga0207667_10007024 | 3300025949 | Bacteria | 13600 |
| 464 | Ga0207667_10121219 | 3300025949 | Bacteria | 2694 |
| 465 | Ga0207667_10204493 | 3300025949 | Bacteria | 2025 |
| 466 | Ga0207712_10000140 | 3300025961 | Bacteria | 76381 |
| 467 | Ga0207712_10000395 | 3300025961 | Bacteria | 37905 |
| 468 | Ga0207668_10019465 | 3300025972 | Bacteria | 4293 |
| 469 | Ga0207640_10000280 | 3300025981 | Bacteria | 34294 |
| 470 | Ga0207640_10000495 | 3300025981 | Bacteria | 24008 |
| 471 | Ga0207640_10001128 | 3300025981 | Bacteria | 14684 |
| 472 | Ga0207640_10037290 | 3300025981 | Bacteria | 3057 |
| 473 | Ga0207640_10322638 | 3300025981 | Bacteria | 1230 |
| 474 | Ga0207658_10000997 | 3300025986 | Bacteria | 23236 |
| 475 | Ga0207658_10093031 | 3300025986 | Bacteria | 2343 |
| 476 | Ga0207658_10213853 | 3300025986 | Bacteria | 1617 |
| 477 | Ga0207658_10302291 | 3300025986 | Bacteria | 1379 |
| 478 | Ga0207677_10088491 | 3300026023 | Bacteria | 2245 |
| 479 | Ga0207703_10000766 | 3300026035 | Bacteria | 31634 |
| 480 | Ga0207703_10263265 | 3300026035 | Bacteria | 1559 |
| 481 | Ga0207703_10337519 | 3300026035 | Bacteria | 1384 |
| 482 | Ga0207703_10415415 | 3300026035 | Bacteria | 1251 |
| 483 | Ga0207639_10000277 | 3300026041 | Bacteria | 36931 |
| 484 | Ga0207639_10002487 | 3300026041 | Bacteria | 12350 |
| 485 | Ga0207639_10007555 | 3300026041 | Bacteria | 7414 |
| 486 | Ga0207639_10049181 | 3300026041 | Bacteria | 3195 |
| 487 | Ga0207639_10441995 | 3300026041 | Bacteria | 1179 |
| 488 | Ga0207639_10642877 | 3300026041 | Bacteria | 981 |
| 489 | Ga0207639_11168568 | 3300026041 | Bacteria | 722 |
| 490 | Ga0207639_11200587 | 3300026041 | Bacteria | 712 |
| 491 | Ga0207678_10002665 | 3300026067 | Bacteria | 16207 |
| 492 | Ga0207678_10016613 | 3300026067 | Bacteria | 6466 |
| 493 | Ga0207678_10018779 | 3300026067 | Bacteria | 6073 |
| 494 | Ga0207678_10026967 | 3300026067 | Bacteria | 5010 |
| 495 | Ga0207678_10027074 | 3300026067 | Bacteria | 5000 |
| 496 | Ga0207678_10040297 | 3300026067 | Bacteria | 4052 |
| 497 | Ga0207678_10106813 | 3300026067 | Bacteria | 2388 |
| 498 | Ga0207678_10345286 | 3300026067 | Bacteria | 1283 |
| 499 | Ga0207702_10000132 | 3300026078 | Bacteria | 88794 |
| 500 | Ga0207702_10000338 | 3300026078 | Bacteria | 53744 |
| 501 | Ga0207702_10013397 | 3300026078 | Bacteria | 6820 |
| 502 | Ga0207702_10054245 | 3300026078 | Bacteria | 3396 |
| 503 | Ga0207702_10439479 | 3300026078 | Bacteria | 1264 |
| 504 | Ga0207702_11206364 | 3300026078 | Bacteria | 751 |
| 505 | Ga0207641_10025217 | 3300026088 | Bacteria | 4903 |
| 506 | Ga0207641_10376307 | 3300026088 | Bacteria | 1359 |
| 507 | Ga0207648_10016027 | 3300026089 | Bacteria | 6867 |
| 508 | Ga0207648_10948227 | 3300026089 | Bacteria | 805 |
| 509 | Ga0207648_11103243 | 3300026089 | Bacteria | 744 |
| 510 | Ga0207676_10038682 | 3300026095 | Bacteria | 3643 |
| 511 | Ga0207674_10001145 | 3300026116 | Bacteria | 34394 |
| 512 | Ga0207674_10002886 | 3300026116 | Bacteria | 21357 |
| 513 | Ga0207674_10039493 | 3300026116 | Bacteria | 4891 |
| 514 | Ga0207674_10046326 | 3300026116 | Bacteria | 4465 |
| 515 | Ga0207674_10047098 | 3300026116 | Bacteria | 4423 |
| 516 | Ga0207674_10375402 | 3300026116 | Bacteria | 1374 |
| 517 | Ga0207683_10394289 | 3300026121 | Bacteria | 1273 |
| 518 | Ga0207698_10000491 | 3300026142 | Bacteria | 23071 |
| 519 | Ga0207698_10006628 | 3300026142 | Bacteria | 7246 |
| 520 | Ga0207698_10021688 | 3300026142 | Bacteria | 4449 |
| 521 | Ga0207698_12006094 | 3300026142 | Bacteria | 593 |
| 522 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 523 | Ga0268266_10000075 | 3300028379 | Bacteria | 218045 |
| 524 | Ga0268265_10461712 | 3300028380 | Bacteria | 1188 |
| 525 | Ga0268265_11863648 | 3300028380 | Bacteria | 608 |
| 526 | Ga0268264_10003031 | 3300028381 | Bacteria | 14566 |
| 527 | Ga0268264_10079343 | 3300028381 | Bacteria | 2800 |
| 528 | Ga0268264_10386309 | 3300028381 | Bacteria | 1342 |
| 529 | Ga0268264_10535999 | 3300028381 | Bacteria | 1146 |
| 530 | Ga0307509_10399468 | 3300031507 | Bacteria | 1082 |
| 531 | Ga0307508_10226554 | 3300031616 | Bacteria | 1468 |
| 532 | Ga0316575_10029237 | 3300031665 | Bacteria | 2151 |
| 533 | Ga0307413_10477018 | 3300031824 | Bacteria | 996 |
| 534 | Ga0307412_10043615 | 3300031911 | Bacteria | 2921 |
| 535 | Ga0307412_11252999 | 3300031911 | Bacteria | 666 |
| 536 | Ga0307416_100132487 | 3300032002 | Bacteria | 2247 |
| 537 | Ga0307416_100286179 | 3300032002 | Bacteria | 1629 |
| 538 | Ga0307414_10094121 | 3300032004 | Bacteria | 2235 |
| 539 | Ga0307414_10423568 | 3300032004 | Bacteria | 1161 |
| 540 | Ga0307411_10051057 | 3300032005 | Bacteria | 2697 |
| 541 | Ga0307411_10259112 | 3300032005 | Bacteria | 1372 |
| 542 | Ga0307411_11110105 | 3300032005 | Bacteria | 713 |
| 543 | Ga0307415_100782597 | 3300032126 | Bacteria | 869 |
| 544 | Ga0307507_10102026 | 3300033179 | Bacteria | 2396 |
| 545 | Ga0307507_10374266 | 3300033179 | Bacteria | 824 |
| 546 | Ga0395899_0000110 | 3300037312 | Bacteria | 140811 |
| 547 | Ga0395899_0001023 | 3300037312 | Bacteria | 25559 |
| 548 | Ga0395899_0034712 | 3300037312 | Bacteria | 3788 |
| 549 | Ga0395900_0000049 | 3300037418 | Bacteria | 226847 |
| 550 | Ga0395900_0000060 | 3300037418 | Bacteria | 205509 |
| 551 | Ga0395900_0102529 | 3300037418 | Bacteria | 2939 |
| 552 | Ga0395900_0471806 | 3300037418 | Bacteria | 1208 |
| 553 | Ga0395898_0000023 | 3300037466 | Bacteria | 379477 |
| 554 | Ga0395898_0000237 | 3300037466 | Bacteria | 139991 |
| 555 | Ga0395898_0018522 | 3300037466 | Bacteria | 7096 |
| 556 | Ga0395898_0097752 | 3300037466 | Bacteria | 2819 |
| 557 | Ga0395901_0117942 | 3300038443 | Bacteria | 2789 |
| 558 | Ga0395901_0206518 | 3300038443 | Bacteria | 2057 |
| 559 | Ga0395901_0371738 | 3300038443 | Bacteria | 1472 |
| 560 | Ga0439436_0000032 | 3300041404 | Bacteria | 46437 |
| 561 | Ga0439465_0000530 | 3300041413 | Bacteria | 11438 |
| 562 | Ga0451789_0811766 | 3300041443 | Bacteria | 718 |
| 563 | Ga0451793_1777967 | 3300041452 | Bacteria | 4636 |
| 564 | Ga0451797_0113713 | 3300041453 | Bacteria | 1161 |
| 565 | Ga0451797_1444144 | 3300041453 | Bacteria | 762 |
| 566 | Ga0451795_0322423 | 3300041456 | Bacteria | 925 |
| 567 | Ga0451795_0773849 | 3300041456 | Bacteria | 968 |
| 568 | Ga0451802_0035022 | 3300041460 | Bacteria | 824 |
| 569 | Ga0451806_671699 | 3300041462 | Bacteria | 693 |
| 570 | Ga0451841_0241459 | 3300041498 | Bacteria | 1262 |
| 571 | Ga0450908_000007 | 3300042184 | Bacteria | 55488 |
| 572 | Ga0439459_0061077 | 3300042438 | Bacteria | 852 |
| 573 | Ga0451577_0176764 | 3300042876 | Bacteria | 1924 |
| 574 | Ga0466969_0038934 | 3300044656 | Bacteria | 2390 |
| 575 | Ga0466969_0088821 | 3300044656 | Bacteria | 1467 |
| 576 | Ga0466972_0038589 | 3300044658 | Bacteria | 2332 |
| 577 | Ga0466976_0347589 | 3300044662 | Bacteria | 819 |
| 578 | Ga0466989_0163097 | 3300044663 | Bacteria | 1337 |
| 579 | Ga0466982_0000018 | 3300044672 | Bacteria | 113912 |
| 580 | Ga0466982_0000096 | 3300044672 | Bacteria | 21532 |
| 581 | Ga0466965_0150407 | 3300044683 | Bacteria | 1216 |
| 582 | Ga0466966_0008293 | 3300044684 | Bacteria | 6887 |
| 583 | Ga0466966_0041964 | 3300044684 | Bacteria | 2938 |
| 584 | Ga0466966_0181364 | 3300044684 | Bacteria | 1277 |
| 585 | Ga0466961_0001486 | 3300044693 | Bacteria | 14566 |
| 586 | Ga0466961_0002537 | 3300044693 | Bacteria | 11321 |
| 587 | Ga0466961_0003674 | 3300044693 | Bacteria | 9567 |
| 588 | Ga0466961_0003935 | 3300044693 | Bacteria | 9288 |
| 589 | Ga0466961_0012833 | 3300044693 | Bacteria | 5361 |
| 590 | Ga0466963_0207098 | 3300044694 | Bacteria | 1372 |
| 591 | Ga0466963_0695281 | 3300044694 | Bacteria | 718 |
| 592 | Ga0466964_0001814 | 3300044706 | Bacteria | 7433 |
| 593 | Ga0466964_0025129 | 3300044706 | Bacteria | 2325 |
| 594 | Ga0453684_0000316 | 3300044712 | Bacteria | 204457 |
| 595 | Ga0466971_0001777 | 3300044719 | Bacteria | 9148 |
| 596 | Ga0466971_0015305 | 3300044719 | Bacteria | 3375 |
| 597 | Ga0466971_0015318 | 3300044719 | Bacteria | 3373 |
| 598 | Ga0466971_0111559 | 3300044719 | Bacteria | 1262 |
| 599 | Ga0466968_0001797 | 3300044735 | Bacteria | 7743 |
| 600 | Ga0466968_0012411 | 3300044735 | Bacteria | 3335 |
| 601 | Ga0466970_0004514 | 3300044765 | Bacteria | 6867 |
| 602 | Ga0466970_0019296 | 3300044765 | Bacteria | 3533 |
| 603 | Ga0466957_0002919 | 3300044842 | Bacteria | 9262 |
| 604 | Ga0466957_0039575 | 3300044842 | Bacteria | 2844 |
| 605 | Ga0466957_0133691 | 3300044842 | Bacteria | 1592 |
| 606 | Ga0466957_0251608 | 3300044842 | Bacteria | 1175 |
| 607 | Ga0466957_0643964 | 3300044842 | Bacteria | 745 |
| 608 | Ga0466960_0023732 | 3300044901 | Bacteria | 2757 |
| 609 | Ga0466959_0005091 | 3300045049 | Bacteria | 8940 |
| 610 | Ga0466959_0320532 | 3300045049 | Bacteria | 1059 |
| 611 | Ga0451576_0000128 | 3300045051 | Bacteria | 192071 |
| 612 | Ga0466958_0016421 | 3300045836 | Bacteria | 4263 |
| 613 | Ga0466958_0025788 | 3300045836 | Bacteria | 3469 |
| 614 | Ga0466958_0032951 | 3300045836 | Bacteria | 3085 |
| 615 | Ga0466958_0293822 | 3300045836 | Bacteria | 1042 |
| 616 | Ga0466967_0318912 | 3300045976 | Bacteria | 1498 |
| 617 | Ga0495617_000607 | 3300046452 | Bacteria | 18027 |
| 618 | Ga0495617_001095 | 3300046452 | Bacteria | 12313 |
| 619 | Ga0495638_0000019 | 3300046460 | Bacteria | 384671 |
| 620 | Ga0495638_0000406 | 3300046460 | Bacteria | 52627 |
| 621 | Ga0495638_0000452 | 3300046460 | Bacteria | 49237 |
| 622 | Ga0495638_0001628 | 3300046460 | Bacteria | 19981 |
| 623 | Ga0495650_0000350 | 3300046471 | Bacteria | 81541 |
| 624 | Ga0495650_0000466 | 3300046471 | Bacteria | 62626 |
| 625 | Ga0495650_0000869 | 3300046471 | Bacteria | 35923 |
| 626 | Ga0495605_0126429 | 3300046474 | Bacteria | 1156 |
| 627 | Ga0495584_0001662 | 3300046491 | Bacteria | 13072 |
| 628 | Ga0495585_0001138 | 3300046492 | Bacteria | 21797 |
| 629 | Ga0495585_0040927 | 3300046492 | Bacteria | 2600 |
| 630 | Ga0495607_0000133 | 3300046501 | Bacteria | 78789 |
| 631 | Ga0495607_0001577 | 3300046501 | Bacteria | 19905 |
| 632 | Ga0495607_0007528 | 3300046501 | Bacteria | 7519 |
| 633 | Ga0495583_0011255 | 3300046506 | Bacteria | 5149 |
| 634 | Ga0495606_0000016 | 3300046507 | Bacteria | 284865 |
| 635 | Ga0495606_0000160 | 3300046507 | Bacteria | 118218 |
| 636 | Ga0495606_0001918 | 3300046507 | Bacteria | 25850 |
| 637 | Ga0495606_0002253 | 3300046507 | Bacteria | 22923 |
| 638 | Ga0495606_0234825 | 3300046507 | Bacteria | 1025 |
| 639 | Ga0495606_0269383 | 3300046507 | Bacteria | 936 |
| 640 | Ga0495610_0004501 | 3300046512 | Bacteria | 10271 |
| 641 | Ga0495610_0029998 | 3300046512 | Bacteria | 2855 |
| 642 | Ga0495616_0000006 | 3300046513 | Bacteria | 234766 |
| 643 | Ga0495616_0047917 | 3300046513 | Bacteria | 2149 |
| 644 | Ga0495620_0000711 | 3300046515 | Bacteria | 20541 |
| 645 | Ga0495620_0097744 | 3300046515 | Bacteria | 1172 |
| 646 | Ga0495631_0000036 | 3300046518 | Bacteria | 81635 |
| 647 | Ga0495631_0000318 | 3300046518 | Bacteria | 33436 |
| 648 | Ga0495632_0000010 | 3300046519 | Bacteria | 272360 |
| 649 | Ga0495632_0012658 | 3300046519 | Bacteria | 4852 |
| 650 | Ga0495632_0054517 | 3300046519 | Bacteria | 1960 |
| 651 | Ga0495637_0007175 | 3300046520 | Bacteria | 5547 |
| 652 | Ga0495643_0177310 | 3300046522 | Bacteria | 1038 |
| 653 | Ga0495648_0000881 | 3300046524 | Bacteria | 31575 |
| 654 | Ga0495609_0149052 | 3300046538 | Bacteria | 995 |
| 655 | Ga0495622_0020164 | 3300046557 | Bacteria | 3105 |
| 656 | Ga0495622_0251985 | 3300046557 | Bacteria | 776 |
| 657 | Ga0495668_0005730 | 3300046616 | Bacteria | 8306 |
| 658 | Ga0495611_0000003 | 3300046648 | Bacteria | 395679 |
| 659 | Ga0495611_0000028 | 3300046648 | Bacteria | 116155 |
| 660 | Ga0495625_0000193 | 3300046660 | Bacteria | 97042 |
| 661 | Ga0495625_0006388 | 3300046660 | Bacteria | 10509 |
| 662 | Ga0495625_0015849 | 3300046660 | Bacteria | 5949 |
| 663 | Ga0495625_0048981 | 3300046660 | Bacteria | 3038 |
| 664 | Ga0495625_0090097 | 3300046660 | Bacteria | 2122 |
| 665 | Ga0495661_0001277 | 3300046665 | Bacteria | 21603 |
| 666 | Ga0495670_0000413 | 3300046691 | Bacteria | 20501 |
| 667 | Ga0495670_0013548 | 3300046691 | Bacteria | 4010 |
| 668 | Ga0495670_0026664 | 3300046691 | Bacteria | 2860 |
| 669 | Ga0495671_0000142 | 3300046692 | Bacteria | 63300 |
| 670 | Ga0495649_0009358 | 3300046694 | Bacteria | 5830 |
| 671 | Ga0495649_0023421 | 3300046694 | Bacteria | 3450 |
| 672 | Ga0495589_0000042 | 3300046794 | Bacteria | 138627 |
| 673 | Ga0495660_0004438 | 3300046810 | Bacteria | 8484 |
| 674 | Ga0495660_0010465 | 3300046810 | Bacteria | 5394 |
| 675 | Ga0495683_0000722 | 3300047323 | Bacteria | 24066 |
| 676 | Ga0495679_000046 | 3300047446 | Bacteria | 132566 |
| 677 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 678 | Ga0495673_0000041 | 3300047469 | Bacteria | 296723 |
| 679 | Ga0495673_0004939 | 3300047469 | Bacteria | 8207 |
| 680 | Ga0495681_0111495 | 3300047470 | Bacteria | 1184 |
| 681 | Ga0495686_0000117 | 3300047472 | Bacteria | 166073 |
| 682 | Ga0495686_0000229 | 3300047472 | Bacteria | 103283 |
| 683 | Ga0495686_0002823 | 3300047472 | Bacteria | 15713 |
| 684 | Ga0495686_0007664 | 3300047472 | Bacteria | 8057 |
| 685 | Ga0495686_0011281 | 3300047472 | Bacteria | 6299 |
| 686 | Ga0495686_0023910 | 3300047472 | Bacteria | 4019 |
| 687 | Ga0496100_0090442 | 3300048903 | Bacteria | 2087 |
| 688 | Ga0496101_0004110 | 3300048904 | Bacteria | 9109 |
| 689 | Ga0496102_0197553 | 3300048905 | Bacteria | 1896 |
| 690 | Ga0496102_0413565 | 3300048905 | Bacteria | 1267 |
| 691 | Ga0496103_0026448 | 3300048906 | Bacteria | 3513 |
| 692 | Ga0496104_0031058 | 3300048907 | Bacteria | 4966 |
| 693 | Ga0496104_0194060 | 3300048907 | Bacteria | 1943 |
| 694 | Ga0496105_0042555 | 3300048908 | Bacteria | 3744 |
| 695 | Ga0496106_0001877 | 3300048909 | Bacteria | 15732 |
| 696 | Ga0496106_0199612 | 3300048909 | Bacteria | 1592 |
| 697 | Ga0496107_0092139 | 3300048910 | Bacteria | 2215 |
| 698 | Ga0496108_0260772 | 3300048911 | Bacteria | 1508 |
| 699 | Ga0496113_0011788 | 3300048916 | Bacteria | 5854 |
| 700 | Ga0496114_0067958 | 3300048917 | Bacteria | 2991 |
| 701 | Ga0496115_0000196 | 3300048918 | Bacteria | 56608 |
| 702 | Ga0496115_0000440 | 3300048918 | Bacteria | 33623 |
| 703 | Ga0496115_0032843 | 3300048918 | Bacteria | 4096 |
| 704 | Ga0496115_0214530 | 3300048918 | Bacteria | 1589 |
| 705 | Ga0496115_0733924 | 3300048918 | Bacteria | 774 |
| 706 | Ga0496116_0042941 | 3300048919 | Bacteria | 3084 |
| 707 | Ga0496116_0077088 | 3300048919 | Bacteria | 2085 |
| 708 | Ga0496116_0086439 | 3300048919 | Bacteria | 1924 |
| 709 | Ga0496116_0190880 | 3300048919 | Bacteria | 1084 |
| 710 | Ga0496117_0023133 | 3300048920 | Bacteria | 4963 |
| 711 | Ga0496117_0029156 | 3300048920 | Bacteria | 4259 |
| 712 | Ga0496117_0030912 | 3300048920 | Bacteria | 4099 |
| 713 | Ga0496117_0103448 | 3300048920 | Bacteria | 1795 |
| 714 | Ga0496117_0309500 | 3300048920 | Bacteria | 832 |
| 715 | Ga0496118_0001472 | 3300048921 | Bacteria | 35272 |
| 716 | Ga0496118_0002903 | 3300048921 | Bacteria | 22296 |
| 717 | Ga0496118_0005217 | 3300048921 | Bacteria | 14858 |
| 718 | Ga0496118_0006396 | 3300048921 | Bacteria | 12971 |
| 719 | Ga0496118_0008697 | 3300048921 | Bacteria | 10434 |
| 720 | Ga0496118_0087591 | 3300048921 | Bacteria | 2159 |
| 721 | Ga0496118_0222566 | 3300048921 | Bacteria | 1097 |
| 722 | Ga0496118_0420987 | 3300048921 | Bacteria | 687 |
| 723 | Ga0496119_0000201 | 3300048922 | Bacteria | 84438 |
| 724 | Ga0496119_0005372 | 3300048922 | Bacteria | 12317 |
| 725 | Ga0496119_0018397 | 3300048922 | Bacteria | 5202 |
| 726 | Ga0496120_0000189 | 3300048923 | Bacteria | 105313 |
| 727 | Ga0496120_0000837 | 3300048923 | Bacteria | 43826 |
| 728 | Ga0496121_0000419 | 3300048924 | Bacteria | 84137 |
| 729 | Ga0496121_0000771 | 3300048924 | Bacteria | 58811 |
| 730 | Ga0496121_0001298 | 3300048924 | Bacteria | 42922 |
| 731 | Ga0496121_0003299 | 3300048924 | Bacteria | 23175 |
| 732 | Ga0496121_0014080 | 3300048924 | Bacteria | 8531 |
| 733 | Ga0496121_0032700 | 3300048924 | Bacteria | 4722 |
| 734 | Ga0496121_0051673 | 3300048924 | Bacteria | 3459 |
| 735 | Ga0496121_0064333 | 3300048924 | Bacteria | 2991 |
| 736 | Ga0496121_0071241 | 3300048924 | Bacteria | 2796 |
| 737 | Ga0496121_0363267 | 3300048924 | Bacteria | 960 |
| 738 | Ga0496121_0401542 | 3300048924 | Bacteria | 897 |
| 739 | Ga0496121_0630530 | 3300048924 | Bacteria | 656 |
| 740 | Ga0496122_0001358 | 3300048925 | Bacteria | 39854 |
| 741 | Ga0496122_0007321 | 3300048925 | Bacteria | 12323 |
| 742 | Ga0496122_0019348 | 3300048925 | Bacteria | 6224 |
| 743 | Ga0496122_0082530 | 3300048925 | Bacteria | 2232 |
| 744 | Ga0496122_0116918 | 3300048925 | Bacteria | 1733 |
| 745 | Ga0496123_0004282 | 3300048926 | Bacteria | 15181 |
| 746 | Ga0496123_0004978 | 3300048926 | Bacteria | 13609 |
| 747 | Ga0496123_0009820 | 3300048926 | Bacteria | 8547 |
| 748 | Ga0496123_0042437 | 3300048926 | Bacteria | 3139 |
| 749 | Ga0496123_0096190 | 3300048926 | Bacteria | 1739 |
| 750 | Ga0496124_0000203 | 3300048927 | Bacteria | 117239 |
| 751 | Ga0496124_0001473 | 3300048927 | Bacteria | 34592 |
| 752 | Ga0496124_0109481 | 3300048927 | Bacteria | 2226 |
| 753 | Ga0496125_0001450 | 3300048928 | Bacteria | 34494 |
| 754 | Ga0496125_0008488 | 3300048928 | Bacteria | 10750 |
| 755 | Ga0496125_0027584 | 3300048928 | Bacteria | 5146 |
| 756 | Ga0496125_0152162 | 3300048928 | Bacteria | 1587 |
| 757 | Ga0496126_0001528 | 3300048929 | Bacteria | 35621 |
| 758 | Ga0496126_0009745 | 3300048929 | Bacteria | 10172 |
| 759 | Ga0496126_0016296 | 3300048929 | Bacteria | 7438 |
| 760 | Ga0496126_0052949 | 3300048929 | Bacteria | 3685 |
| 761 | Ga0496126_0062906 | 3300048929 | Bacteria | 3328 |
| 762 | Ga0496126_0070126 | 3300048929 | Bacteria | 3123 |
| 763 | Ga0496126_0073413 | 3300048929 | Bacteria | 3041 |
| 764 | Ga0496126_0319947 | 3300048929 | Bacteria | 1275 |
| 765 | Ga0496126_0442509 | 3300048929 | Bacteria | 1047 |
| 766 | Ga0495678_000066 | 3300049459 | Bacteria | 133706 |
| 767 | Ga0495678_015033 | 3300049459 | Bacteria | 3577 |
| 768 | Ga0495682_0003108 | 3300049460 | Bacteria | 7515 |
| 769 | Ga0495682_0026021 | 3300049460 | Bacteria | 2175 |
| 770 | Ga0495682_0095429 | 3300049460 | Bacteria | 1067 |
| 771 | Ga0501032_0060536 | 3300049569 | Bacteria | 2539 |
| 772 | Ga0501033_0019511 | 3300049570 | Bacteria | 5125 |
| 773 | Ga0501033_0284121 | 3300049570 | Bacteria | 1168 |
| 774 | Ga0501034_0006620 | 3300049571 | Bacteria | 12432 |
| 775 | Ga0501034_0758834 | 3300049571 | Bacteria | 865 |
| 776 | Ga0501036_0394918 | 3300049572 | Bacteria | 1154 |
| 777 | Ga0501037_0018053 | 3300049573 | Bacteria | 5196 |
| 778 | Ga0501037_0152969 | 3300049573 | Bacteria | 1648 |
| 779 | Ga0501038_0015538 | 3300049574 | Bacteria | 6920 |
| 780 | Ga0501038_0418817 | 3300049574 | Bacteria | 1034 |
| 781 | Ga0501039_0120244 | 3300049575 | Bacteria | 2058 |
| 782 | Ga0501039_0358639 | 3300049575 | Bacteria | 1145 |
| 783 | Ga0501043_0022946 | 3300049579 | Bacteria | 4893 |
| 784 | Ga0501043_0031501 | 3300049579 | Bacteria | 4169 |
| 785 | Ga0501043_0086842 | 3300049579 | Bacteria | 2458 |
| 786 | Ga0501043_0196194 | 3300049579 | Bacteria | 1568 |
| 787 | Ga0501043_0255343 | 3300049579 | Bacteria | 1349 |
| 788 | Ga0501046_0008054 | 3300049580 | Bacteria | 9209 |
| 789 | Ga0501046_0200343 | 3300049580 | Bacteria | 1485 |
| 790 | Ga0501046_0234302 | 3300049580 | Bacteria | 1355 |
| 791 | Ga0501047_0002093 | 3300049581 | Bacteria | 19094 |
| 792 | Ga0501047_0003063 | 3300049581 | Bacteria | 15848 |
| 793 | Ga0501047_0045093 | 3300049581 | Bacteria | 4262 |
| 794 | Ga0501047_0059989 | 3300049581 | Bacteria | 3672 |
| 795 | Ga0501047_0060899 | 3300049581 | Bacteria | 3641 |
| 796 | Ga0501047_0140733 | 3300049581 | Bacteria | 2291 |
| 797 | Ga0501048_0065527 | 3300049582 | Bacteria | 2568 |
| 798 | Ga0501048_0111141 | 3300049582 | Bacteria | 1935 |
| 799 | Ga0501067_0000583 | 3300049583 | Bacteria | 19798 |
| 800 | Ga0501068_0184873 | 3300049584 | Bacteria | 1318 |
| 801 | Ga0501069_0001862 | 3300049585 | Bacteria | 10542 |
| 802 | Ga0501069_0002178 | 3300049585 | Bacteria | 9867 |
| 803 | Ga0501069_0026323 | 3300049585 | Bacteria | 3184 |
| 804 | Ga0501069_0066946 | 3300049585 | Bacteria | 2009 |
| 805 | Ga0501069_0113071 | 3300049585 | Bacteria | 1547 |
| 806 | Ga0501070_0004139 | 3300049586 | Bacteria | 12490 |
| 807 | Ga0501070_0004257 | 3300049586 | Bacteria | 12303 |
| 808 | Ga0501070_0061919 | 3300049586 | Bacteria | 3099 |
| 809 | Ga0501070_0066254 | 3300049586 | Bacteria | 2990 |
| 810 | Ga0501070_0146981 | 3300049586 | Bacteria | 1945 |
| 811 | Ga0501070_0458335 | 3300049586 | Bacteria | 1027 |
| 812 | Ga0501071_0008797 | 3300049587 | Bacteria | 6689 |
| 813 | Ga0501072_0002507 | 3300049588 | Bacteria | 13756 |
| 814 | Ga0501072_0143661 | 3300049588 | Bacteria | 1903 |
| 815 | Ga0501073_0008095 | 3300049589 | Bacteria | 7799 |
| 816 | Ga0501073_0015945 | 3300049589 | Bacteria | 5445 |
| 817 | Ga0501073_0159283 | 3300049589 | Bacteria | 1564 |
| 818 | Ga0501073_0209089 | 3300049589 | Bacteria | 1348 |
| 819 | Ga0501073_0284279 | 3300049589 | Bacteria | 1141 |
| 820 | Ga0501074_0003986 | 3300049590 | Bacteria | 10524 |
| 821 | Ga0501074_0005938 | 3300049590 | Bacteria | 8802 |
| 822 | Ga0501074_0025883 | 3300049590 | Bacteria | 4257 |
| 823 | Ga0501074_0062333 | 3300049590 | Bacteria | 2685 |
| 824 | Ga0501074_0065446 | 3300049590 | Bacteria | 2616 |
| 825 | Ga0501074_1063612 | 3300049590 | Bacteria | 568 |
| 826 | Ga0501079_0026319 | 3300049741 | Bacteria | 4461 |
| 827 | Ga0501079_0173661 | 3300049741 | Bacteria | 1680 |
| 828 | Ga0501079_0618568 | 3300049741 | Bacteria | 852 |
| 829 | Ga0501080_0000256 | 3300049742 | Bacteria | 40148 |
| 830 | Ga0501080_0001893 | 3300049742 | Bacteria | 18018 |
| 831 | Ga0501080_0003974 | 3300049742 | Bacteria | 13094 |
| 832 | Ga0501080_0016829 | 3300049742 | Bacteria | 6753 |
| 833 | Ga0501080_0097338 | 3300049742 | Bacteria | 2732 |
| 834 | Ga0501083_0001929 | 3300049744 | Bacteria | 14264 |
| 835 | Ga0501035_0030885 | 3300049822 | Bacteria | 4880 |
| 836 | Ga0501035_0073546 | 3300049822 | Bacteria | 3024 |
| 837 | Ga0501035_0084441 | 3300049822 | Bacteria | 2800 |
| 838 | Ga0501035_0121763 | 3300049822 | Bacteria | 2280 |
| 839 | Ga0501035_0540457 | 3300049822 | Bacteria | 955 |
| 840 | Ga0501044_0003272 | 3300049823 | Bacteria | 18232 |
| 841 | Ga0501044_0007113 | 3300049823 | Bacteria | 12307 |
| 842 | Ga0501044_0014551 | 3300049823 | Bacteria | 8488 |
| 843 | Ga0501044_0114409 | 3300049823 | Bacteria | 2704 |
| 844 | Ga0501044_0205065 | 3300049823 | Bacteria | 1928 |
| 845 | Ga0501044_0296891 | 3300049823 | Bacteria | 1545 |
| 846 | Ga0501044_1283098 | 3300049823 | Bacteria | 599 |
| 847 | nmdc:mga0sz30_92625_c1 | 3300050516 | Bacteria | 1316 |
| 848 | Ga0500643_000036 | 3300053087 | Bacteria | 183253 |
| 849 | Ga0500643_008323 | 3300053087 | Bacteria | 4082 |
| 850 | Ga0500555_001310 | 3300053103 | Bacteria | 7858 |
| 851 | Ga0500597_000016 | 3300053120 | Bacteria | 38903 |
| 852 | Ga0500652_190098 | 3300053131 | Bacteria | 837 |
| 853 | Ga0500633_0001664 | 3300053160 | Bacteria | 4305 |
| 854 | Ga0500645_000639 | 3300053730 | Bacteria | 22272 |
| 855 | Ga0501084_0291415 | 3300054114 | Bacteria | 1379 |
| 856 | Ga0501082_0201301 | 3300060353 | Bacteria | 1732 |
| 857 | Ga0501082_0287069 | 3300060353 | Bacteria | 1432 |
| 858 | Ga0466962_0000272 | 3300061719 | Bacteria | 21817 |
| 859 | Ga0466962_0011816 | 3300061719 | Bacteria | 4203 |
| 860 | Ga0466962_0037551 | 3300061719 | Bacteria | 2319 |
| 861 | Ga0466962_0222261 | 3300061719 | Bacteria | 925 |
| 862 | Ga0466962_0601888 | 3300061719 | Bacteria | 560 |
| 863 | 2525558158 | 2524614729 | Bacteria | 3091755 |
| 864 | 2538835162 | 2537561836 | Bacteria | 3910579 |
| 865 | 2595447961 | 2593339238 | Bacteria | 4182970 |
| 866 | 2630649961 | 2627854209 | Bacteria | 3093011 |
| 867 | 2643829356 | 2643221562 | Bacteria | 4048635 |
| 868 | 2721026089 | 2718218334 | Bacteria | 4765486 |
| 869 | 2735833943 | 2734482264 | Unclassified | 5014763 |
| 870 | 2739229746 | 2738543009 | Bacteria | 4944499 |
| 871 | 2739729927 | 2739367700 | Bacteria | 4747630 |
| 872 | 2819565567 | 2818991440 | Bacteria | 4774720 |
| 873 | 2842918672 | 2842914999 | Bacteria | 4419378 |
| 874 | 2842922143 | 2842918807 | Bacteria | 4289178 |
| 875 | 2884341934 | 2884338543 | Bacteria | 4610696 |
| 876 | 2884413030 | 2884411467 | Bacteria | 5246714 |
| 877 | 2895397305 | 2895395659 | Bacteria | 3983269 |
| 878 | 2904466059 | 2904463128 | Bacteria | 4775606 |
| 879 | 2919087322 | 2919085039 | Bacteria | 4532964 |
| 880 | 2919406554 | 2919404418 | Bacteria | 4232372 |
| 881 | 2928965885 | 2928963466 | Bacteria | 5165703 |
| 882 | 2941474340 | 2941471342 | Bacteria | 5018624 |
| 883 | 2953997261 | 2953994433 | Bacteria | 4303959 |
| 884 | Ga0501044_0007419 | |||
| 885 | JGI24736J21556_1039259 | |||
| 886 | JGI24741J21665_1002334 | |||
| 887 | JGI24741J21665_1002712 | |||
| 888 | JGI24740J21852_10000701 | |||
| 889 | JGI24739J22299_10009804 | |||
| 890 | JGI24737J22298_10026518 | |||
| 891 | JGI24737J22298_10081336 | |||
| 892 | JGI24735J21928_10004013 | |||
| 893 | JGI24735J21928_10014324 | |||
| 894 | JGI24735J21928_10201559 | |||
| 895 | JGI24738J21930_10015494 | |||
| 896 | JGI25162J39368_1001457 | |||
| 897 | JGI25162J39368_1002014 | |||
| 898 | JGI25162J39368_1004214 | |||
| 899 | JGI25162J39368_1010547 | |||
| 900 | JGI25154J39366_1007917 | |||
| 901 | JGI25154J39366_1008133 | |||
| 902 | JGI25154J39366_1014669 | |||
| 903 | JGI25157J39369_1000224 | |||
| 904 | JGI25157J39369_1001100 | |||
| 905 | JGI25157J39369_1002245 | |||
| 906 | JGI25157J39369_1003667 | |||
| 907 | JGI25157J39369_1008184 | |||
| 908 | JGI25157J39369_1021350 | |||
| 909 | JGI25163J39215_1001252 | |||
| 910 | JGI25164J39214_1000164 | |||
| 911 | JGI25164J39214_1002054 | |||
| 912 | JGI25164J39214_1006974 | |||
| 913 | JGI25165J46597_1000317 | |||
| 914 | JGI25165J46597_1001472 | |||
| 915 | JGI25165J46597_1012862 | |||
| 916 | JGI25165J46597_1030791 | |||
| 917 | JGI25153J46596_10018510 | |||
| 918 | rootH2_10011924 | |||
| 919 | Ga0006554J51385_1041028 | |||
| 920 | Ga0006562J51391_1031326 | |||
| 921 | Ga0006562J51391_1042664 | |||
| 922 | Ga0006562J51391_1042669 | |||
| 923 | Ga0055533_1002210 | |||
| 924 | Ga0055533_1005210 | |||
| 925 | Ga0055533_1006131 | |||
| 926 | Ga0055525_1000055 | |||
| 927 | Ga0055527_1000116 | |||
| 928 | Ga0055527_1000210 | |||
| 929 | Ga0055535_1000296 | |||
| 930 | Ga0055535_1000454 | |||
| 931 | Ga0055535_1001071 | |||
| 932 | Ga0055535_1001444 | |||
| 933 | Ga0055535_1002833 | |||
| 934 | Ga0055542_1000056 | |||
| 935 | Ga0055542_1000263 | |||
| 936 | Ga0055542_1000277 | |||
| 937 | Ga0055542_1000468 | |||
| 938 | Ga0055542_1000620 | |||
| 939 | Ga0055542_1004324 | |||
| 940 | Ga0055542_1028233 | |||
| 941 | Ga0055529_1000253 | |||
| 942 | Ga0055529_1000298 | |||
| 943 | Ga0055529_1000479 | |||
| 944 | Ga0055529_1001107 | |||
| 945 | Ga0055529_1003276 | |||
| 946 | Ga0055543_1007681 | |||
| 947 | Ga0065165_1000108 | |||
| 948 | Ga0065165_1005855 | |||
| 949 | Ga0070658_10001565 | |||
| 950 | Ga0070658_10118601 | |||
| 951 | Ga0070658_10523744 | |||
| 952 | Ga0070658_10550404 | |||
| 953 | Ga0070658_10614628 | |||
| 954 | Ga0070683_100127162 | |||
| 955 | Ga0070683_100142437 | |||
| 956 | Ga0070683_100174384 | |||
| 957 | Ga0070690_100202766 | |||
| 958 | Ga0070690_100345793 | |||
| 959 | Ga0070670_100009171 | |||
| 960 | Ga0070670_100265733 | |||
| 961 | Ga0070666_10000037 | |||
| 962 | Ga0070666_10000487 | |||
| 963 | Ga0070666_10007269 | |||
| 964 | Ga0070680_100097990 | |||
| 965 | Ga0070680_100460938 | |||
| 966 | Ga0070682_100176722 | |||
| 967 | Ga0068868_100058111 | |||
| 968 | Ga0070660_100247365 | |||
| 969 | Ga0070660_100373620 | |||
| 970 | Ga0070660_100648008 | |||
| 971 | Ga0070691_10032937 | |||
| 972 | Ga0070691_10533427 | |||
| 973 | Ga0070661_100007367 | |||
| 974 | Ga0070661_100010149 | |||
| 975 | Ga0070661_100014442 | |||
| 976 | Ga0070661_100108677 | |||
| 977 | Ga0070661_100134943 | |||
| 978 | Ga0070661_100239179 | |||
| 979 | Ga0070661_100298248 | |||
| 980 | Ga0070692_10037193 | |||
| 981 | Ga0070692_10105382 | |||
| 982 | Ga0070668_100097591 | |||
| 983 | Ga0070671_100415382 | |||
| 984 | Ga0070688_100128609 | |||
| 985 | Ga0070659_100058492 | |||
| 986 | Ga0070667_100000072 | |||
| 987 | Ga0070667_100016061 | |||
| 988 | Ga0070667_100131582 | |||
| 989 | Ga0070667_100244360 | |||
| 990 | Ga0070667_100591501 | |||
| 991 | Ga0070714_100096930 | |||
| 992 | Ga0070713_100123179 | |||
| 993 | Ga0070711_100332269 | |||
| 994 | Ga0070708_100946346 | |||
| 995 | Ga0070663_100005396 | |||
| 996 | Ga0070663_100028573 | |||
| 997 | Ga0070663_100039684 | |||
| 998 | Ga0070663_100072087 | |||
| 999 | Ga0070663_100110496 | |||
| 1000 | Ga0070663_100287078 | |||
| 1001 | Ga0070663_100372822 | |||
| 1002 | Ga0070663_100649466 | |||
| 1003 | Ga0070663_100789579 | |||
| 1004 | Ga0070663_100868267 | |||
| 1005 | Ga0070678_100362546 | |||
| 1006 | Ga0070681_10000151 | |||
| 1007 | Ga0070681_10037306 | |||
| 1008 | Ga0070681_10125600 | |||
| 1009 | Ga0070681_10128599 | |||
| 1010 | Ga0068867_100045587 | |||
| 1011 | Ga0068867_101105138 | |||
| 1012 | Ga0070685_10014858 | |||
| 1013 | Ga0070699_100485645 | |||
| 1014 | Ga0070679_100000250 | |||
| 1015 | Ga0070679_100055321 | |||
| 1016 | Ga0070684_100089335 | |||
| 1017 | Ga0070684_100131098 | |||
| 1018 | Ga0070684_100288459 | |||
| 1019 | Ga0068853_100006694 | |||
| 1020 | Ga0068853_100016337 | |||
| 1021 | Ga0068853_100016385 | |||
| 1022 | Ga0068853_100035262 | |||
| 1023 | Ga0068853_100053738 | |||
| 1024 | Ga0068853_100241308 | |||
| 1025 | Ga0068853_100265685 | |||
| 1026 | Ga0068853_101179716 | |||
| 1027 | Ga0068853_101225682 | |||
| 1028 | Ga0070696_100007583 | |||
| 1029 | Ga0070696_100031485 | |||
| 1030 | Ga0070665_100000376 | |||
| 1031 | Ga0070665_100010663 | |||
| 1032 | Ga0068855_100010660 | |||
| 1033 | Ga0068855_100122173 | |||
| 1034 | Ga0068855_100212437 | |||
| 1035 | Ga0070664_100128266 | |||
| 1036 | Ga0068857_100013283 | |||
| 1037 | Ga0068857_100038503 | |||
| 1038 | Ga0068857_100050500 | |||
| 1039 | Ga0068857_100061409 | |||
| 1040 | Ga0068857_100226826 | |||
| 1041 | Ga0068854_100003612 | |||
| 1042 | Ga0068854_100113799 | |||
| 1043 | Ga0068854_100123359 | |||
| 1044 | Ga0068854_100429121 | |||
| 1045 | Ga0068856_100007396 | |||
| 1046 | Ga0068856_100012219 | |||
| 1047 | Ga0068856_100169157 | |||
| 1048 | Ga0068856_100319989 | |||
| 1049 | Ga0068852_100006036 | |||
| 1050 | Ga0068852_100034585 | |||
| 1051 | Ga0068852_100042035 | |||
| 1052 | Ga0068852_100073648 | |||
| 1053 | Ga0068852_100169580 | |||
| 1054 | Ga0068852_100178626 | |||
| 1055 | Ga0068852_100235707 | |||
| 1056 | Ga0068859_100324564 | |||
| 1057 | Ga0068859_101521946 | |||
| 1058 | Ga0068864_100004209 | |||
| 1059 | Ga0068851_10000908 | |||
| 1060 | Ga0068851_10010761 | |||
| 1061 | Ga0068851_10019388 | |||
| 1062 | Ga0068851_10196718 | |||
| 1063 | Ga0068863_100006254 | |||
| 1064 | Ga0068863_100556207 | |||
| 1065 | Ga0068863_100981392 | |||
| 1066 | Ga0068858_100000817 | |||
| 1067 | Ga0068858_100074088 | |||
| 1068 | Ga0068858_100242140 | |||
| 1069 | Ga0068858_100630593 | |||
| 1070 | Ga0068858_100733808 | |||
| 1071 | Ga0068860_100017401 | |||
| 1072 | Ga0068860_100066993 | |||
| 1073 | Ga0068860_100265669 | |||
| 1074 | Ga0068860_100270877 | |||
| 1075 | Ga0068862_100176956 | |||
| 1076 | Ga0068862_100646975 | |||
| 1077 | Ga0075369_10064511 | |||
| 1078 | Ga0097621_100324094 | |||
| 1079 | Ga0097621_100400799 | |||
| 1080 | Ga0097621_100482046 | |||
| 1081 | Ga0068871_100231117 | |||
| 1082 | Ga0068865_100427698 | |||
| 1083 | Ga0097620_100324596 | |||
| 1084 | Ga0097620_101522031 | |||
| 1085 | Ga0105240_10002563 | |||
| 1086 | Ga0105240_10009143 | |||
| 1087 | Ga0105240_10009721 | |||
| 1088 | Ga0105240_10011172 | |||
| 1089 | Ga0105240_10023678 | |||
| 1090 | Ga0105240_10055889 | |||
| 1091 | Ga0105240_10152926 | |||
| 1092 | Ga0105240_10256770 | |||
| 1093 | Ga0105240_11226200 | |||
| 1094 | Ga0105240_11500257 | |||
| 1095 | Ga0105245_10286466 | |||
| 1096 | Ga0105245_10406451 | |||
| 1097 | Ga0105247_10002916 | |||
| 1098 | Ga0105241_10015625 | |||
| 1099 | Ga0105241_10094532 | |||
| 1100 | Ga0105241_10620362 | |||
| 1101 | Ga0105241_11415169 | |||
| 1102 | Ga0105242_10762084 | |||
| 1103 | Ga0105248_10000920 | |||
| 1104 | Ga0105248_10944372 | |||
| 1105 | Ga0105237_10000084 | |||
| 1106 | Ga0105237_10000675 | |||
| 1107 | Ga0105237_10008928 | |||
| 1108 | Ga0105237_10009642 | |||
| 1109 | Ga0105237_11987742 | |||
| 1110 | Ga0105238_10000131 | |||
| 1111 | Ga0105238_10005144 | |||
| 1112 | Ga0105238_10098301 | |||
| 1113 | Ga0105238_10108501 | |||
| 1114 | Ga0105238_10391495 | |||
| 1115 | Ga0105238_11236530 | |||
| 1116 | Ga0105249_10000084 | |||
| 1117 | Ga0105249_10007606 | |||
| 1118 | Ga0105239_10000033 | |||
| 1119 | Ga0105239_10018126 | |||
| 1120 | Ga0105239_10042913 | |||
| 1121 | Ga0105239_10106637 | |||
| 1122 | Ga0105239_10572998 | |||
| 1123 | Ga0105246_10011815 | |||
| 1124 | Ga0105246_10128100 | |||
| 1125 | Ga0105246_11968736 | |||
| 1126 | Ga0157314_1000507 | |||
| 1127 | Ga0154012_169161 | |||
| 1128 | Ga0157373_10011463 | |||
| 1129 | Ga0157373_10100595 | |||
| 1130 | Ga0157371_10070400 | |||
| 1131 | Ga0157371_10348755 | |||
| 1132 | Ga0157370_10005440 | |||
| 1133 | Ga0157370_10023809 | |||
| 1134 | Ga0157370_10045998 | |||
| 1135 | Ga0157370_10081025 | |||
| 1136 | Ga0157369_10003012 | |||
| 1137 | Ga0157369_10011973 | |||
| 1138 | Ga0157369_10018985 | |||
| 1139 | Ga0157369_10124679 | |||
| 1140 | Ga0157369_11419744 | |||
| 1141 | Ga0157374_11003429 | |||
| 1142 | Ga0163162_10000221 | |||
| 1143 | Ga0163162_10069555 | |||
| 1144 | Ga0163162_10489642 | |||
| 1145 | Ga0157372_10000334 | |||
| 1146 | Ga0157372_10044203 | |||
| 1147 | Ga0157372_10066779 | |||
| 1148 | Ga0157372_10081165 | |||
| 1149 | Ga0157372_10173947 | |||
| 1150 | Ga0157372_10213378 | |||
| 1151 | Ga0157372_11449664 | |||
| 1152 | Ga0163163_10000112 | |||
| 1153 | Ga0163163_10000585 | |||
| 1154 | Ga0182008_10006516 | |||
| 1155 | Ga0182008_10021422 | |||
| 1156 | Ga0182008_10036778 | |||
| 1157 | Ga0182008_10055909 | |||
| 1158 | Ga0182008_10191861 | |||
| 1159 | Ga0157379_10007853 | |||
| 1160 | Ga0157379_10482832 | |||
| 1161 | Ga0157376_10009210 | |||
| 1162 | Ga0182006_1000031 | |||
| 1163 | Ga0182006_1000496 | |||
| 1164 | Ga0182007_10003787 | |||
| 1165 | Ga0182007_10015105 | |||
| 1166 | Ga0182005_1000049 | |||
| 1167 | Ga0182005_1001001 | |||
| 1168 | Ga0182005_1002650 | |||
| 1169 | Ga0183368_1002 | |||
| 1170 | Ga0163161_10007409 | |||
| 1171 | Ga0163161_10066212 | |||
| 1172 | Ga0206356_11026662 | |||
| 1173 | Ga0206356_11905763 | |||
| 1174 | Ga0206351_10589011 | |||
| 1175 | Ga0206351_10768644 | |||
| 1176 | Ga0206352_10871908 | |||
| 1177 | Ga0206350_11455286 | |||
| 1178 | Ga0206354_10524459 | |||
| 1179 | Ga0206353_10447795 | |||
| 1180 | Ga0206353_11143090 | |||
| 1181 | Ga0154015_1513628 | |||
| 1182 | Ga0224712_10074632 | |||
| 1183 | Ga0224712_10128125 | |||
| 1184 | Ga0209760_100376 | |||
| 1185 | Ga0209784_100204 | |||
| 1186 | Ga0209566_102111 | |||
| 1187 | Ga0209674_100061 | |||
| 1188 | Ga0209674_100077 | |||
| 1189 | Ga0209674_100785 | |||
| 1190 | Ga0209674_104333 | |||
| 1191 | Ga0209672_100004 | |||
| 1192 | Ga0209672_100022 | |||
| 1193 | Ga0209672_100251 | |||
| 1194 | Ga0209672_101130 | |||
| 1195 | Ga0209672_101444 | |||
| 1196 | Ga0209147_107974 | |||
| 1197 | Ga0209563_100076 | |||
| 1198 | Ga0207427_100111 | |||
| 1199 | Ga0207427_100179 | |||
| 1200 | Ga0207427_100185 | |||
| 1201 | Ga0207427_100510 | |||
| 1202 | Ga0209437_100099 | |||
| 1203 | Ga0209437_100113 | |||
| 1204 | Ga0209437_100320 | |||
| 1205 | Ga0209437_100368 | |||
| 1206 | Ga0209437_100782 | |||
| 1207 | Ga0209258_100003 | |||
| 1208 | Ga0209258_100004 | |||
| 1209 | Ga0209258_100119 | |||
| 1210 | Ga0209258_100122 | |||
| 1211 | Ga0209258_100137 | |||
| 1212 | Ga0209258_100376 | |||
| 1213 | Ga0209258_106897 | |||
| 1214 | Ga0209646_1000985 | |||
| 1215 | Ga0209646_1001103 | |||
| 1216 | Ga0209646_1003374 | |||
| 1217 | Ga0209646_1027599 | |||
| 1218 | Ga0209026_1000087 | |||
| 1219 | Ga0209026_1000175 | |||
| 1220 | Ga0209026_1000274 | |||
| 1221 | Ga0209026_1000276 | |||
| 1222 | Ga0209026_1008805 | |||
| 1223 | Ga0209677_101477 | |||
| 1224 | Ga0209148_1000005 | |||
| 1225 | Ga0209148_1000025 | |||
| 1226 | Ga0209148_1000036 | |||
| 1227 | Ga0209148_1000062 | |||
| 1228 | Ga0209148_1000083 | |||
| 1229 | Ga0209148_1000137 | |||
| 1230 | Ga0209148_1001786 | |||
| 1231 | Ga0209759_1000136 | |||
| 1232 | Ga0209759_1000320 | |||
| 1233 | Ga0209759_1001153 | |||
| 1234 | Ga0209759_1001565 | |||
| 1235 | Ga0209759_1048645 | |||
| 1236 | Ga0209129_1000769 | |||
| 1237 | Ga0209233_1000040 | |||
| 1238 | Ga0209233_1000075 | |||
| 1239 | Ga0209233_1000128 | |||
| 1240 | Ga0209233_1008709 | |||
| 1241 | Ga0209455_1000004 | |||
| 1242 | Ga0209455_1000040 | |||
| 1243 | Ga0209455_1000084 | |||
| 1244 | Ga0209455_1000095 | |||
| 1245 | Ga0209455_1000164 | |||
| 1246 | Ga0209455_1001294 | |||
| 1247 | Ga0209455_1007907 | |||
| 1248 | Ga0209758_1000301 | |||
| 1249 | Ga0209758_1020451 | |||
| 1250 | Ga0209758_1047231 | |||
| 1251 | Ga0207426_1016040 | |||
| 1252 | Ga0209051_1007151 | |||
| 1253 | Ga0209257_1000067 | |||
| 1254 | Ga0209257_1039691 | |||
| 1255 | Ga0207656_10007153 | |||
| 1256 | Ga0207656_10008269 | |||
| 1257 | Ga0207656_10119317 | |||
| 1258 | Ga0207710_10003748 | |||
| 1259 | Ga0207680_10000001 | |||
| 1260 | Ga0207680_10000598 | |||
| 1261 | Ga0207680_10001902 | |||
| 1262 | Ga0207680_10388284 | |||
| 1263 | Ga0207647_10000034 | |||
| 1264 | Ga0207647_10000262 | |||
| 1265 | Ga0207647_10002208 | |||
| 1266 | Ga0207647_10002308 | |||
| 1267 | Ga0207647_10012004 | |||
| 1268 | Ga0207647_10119619 | |||
| 1269 | Ga0207705_10000560 | |||
| 1270 | Ga0207705_10006860 | |||
| 1271 | Ga0207705_10037183 | |||
| 1272 | Ga0207705_10112632 | |||
| 1273 | Ga0207705_10678893 | |||
| 1274 | Ga0207654_10000719 | |||
| 1275 | Ga0207654_10005416 | |||
| 1276 | Ga0207654_10213287 | |||
| 1277 | Ga0207654_10494947 | |||
| 1278 | Ga0207707_10000064 | |||
| 1279 | Ga0207707_10006038 | |||
| 1280 | Ga0207707_10006315 | |||
| 1281 | Ga0207707_10029371 | |||
| 1282 | Ga0207707_10094005 | |||
| 1283 | Ga0207695_10000588 | |||
| 1284 | Ga0207695_10001221 | |||
| 1285 | Ga0207695_10001320 | |||
| 1286 | Ga0207695_10002529 | |||
| 1287 | Ga0207695_10003607 | |||
| 1288 | Ga0207695_10004205 | |||
| 1289 | Ga0207695_10027716 | |||
| 1290 | Ga0207695_10056422 | |||
| 1291 | Ga0207695_10103753 | |||
| 1292 | Ga0207695_10123193 | |||
| 1293 | Ga0207695_10176528 | |||
| 1294 | Ga0207695_10544900 | |||
| 1295 | Ga0207671_10000011 | |||
| 1296 | Ga0207671_10012799 | |||
| 1297 | Ga0207671_10013618 | |||
| 1298 | Ga0207671_10094240 | |||
| 1299 | Ga0207663_10040939 | |||
| 1300 | Ga0207660_10001372 | |||
| 1301 | Ga0207660_10001813 | |||
| 1302 | Ga0207660_10003444 | |||
| 1303 | Ga0207660_10135796 | |||
| 1304 | Ga0207657_10002836 | |||
| 1305 | Ga0207657_10029335 | |||
| 1306 | Ga0207657_10029430 | |||
| 1307 | Ga0207649_10001382 | |||
| 1308 | Ga0207649_10006569 | |||
| 1309 | Ga0207649_10006704 | |||
| 1310 | Ga0207649_10010845 | |||
| 1311 | Ga0207649_10249805 | |||
| 1312 | Ga0207649_10811832 | |||
| 1313 | Ga0207652_10000019 | |||
| 1314 | Ga0207652_10000801 | |||
| 1315 | Ga0207652_10008959 | |||
| 1316 | Ga0207652_10148733 | |||
| 1317 | Ga0207652_10333672 | |||
| 1318 | Ga0207681_10897705 | |||
| 1319 | Ga0207694_10000654 | |||
| 1320 | Ga0207694_10001428 | |||
| 1321 | Ga0207694_10001879 | |||
| 1322 | Ga0207694_10048048 | |||
| 1323 | Ga0207694_10147134 | |||
| 1324 | Ga0207694_10520874 | |||
| 1325 | Ga0207694_10613577 | |||
| 1326 | Ga0207650_10006245 | |||
| 1327 | Ga0207650_10230356 | |||
| 1328 | Ga0207687_10218969 | |||
| 1329 | Ga0207700_10023119 | |||
| 1330 | Ga0207644_10735062 | |||
| 1331 | Ga0207690_10011845 | |||
| 1332 | Ga0207690_10068857 | |||
| 1333 | Ga0207706_10004869 | |||
| 1334 | Ga0207706_10133414 | |||
| 1335 | Ga0207706_10408337 | |||
| 1336 | Ga0207704_10841111 | |||
| 1337 | Ga0207711_10001918 | |||
| 1338 | Ga0207661_10036981 | |||
| 1339 | Ga0207661_10448781 | |||
| 1340 | Ga0207679_10054898 | |||
| 1341 | Ga0207679_11742349 | |||
| 1342 | Ga0207667_10000219 | |||
| 1343 | Ga0207667_10000446 | |||
| 1344 | Ga0207667_10000574 | |||
| 1345 | Ga0207667_10002469 | |||
| 1346 | Ga0207667_10007024 | |||
| 1347 | Ga0207667_10121219 | |||
| 1348 | Ga0207667_10204493 | |||
| 1349 | Ga0207712_10000140 | |||
| 1350 | Ga0207712_10000395 | |||
| 1351 | Ga0207668_10019465 | |||
| 1352 | Ga0207640_10000280 | |||
| 1353 | Ga0207640_10000495 | |||
| 1354 | Ga0207640_10001128 | |||
| 1355 | Ga0207640_10037290 | |||
| 1356 | Ga0207640_10322638 | |||
| 1357 | Ga0207658_10000997 | |||
| 1358 | Ga0207658_10093031 | |||
| 1359 | Ga0207658_10213853 | |||
| 1360 | Ga0207658_10302291 | |||
| 1361 | Ga0207677_10088491 | |||
| 1362 | Ga0207703_10000766 | |||
| 1363 | Ga0207703_10263265 | |||
| 1364 | Ga0207703_10337519 | |||
| 1365 | Ga0207703_10415415 | |||
| 1366 | Ga0207639_10000277 | |||
| 1367 | Ga0207639_10002487 | |||
| 1368 | Ga0207639_10007555 | |||
| 1369 | Ga0207639_10049181 | |||
| 1370 | Ga0207639_10441995 | |||
| 1371 | Ga0207639_10642877 | |||
| 1372 | Ga0207639_11168568 | |||
| 1373 | Ga0207639_11200587 | |||
| 1374 | Ga0207678_10002665 | |||
| 1375 | Ga0207678_10016613 | |||
| 1376 | Ga0207678_10018779 | |||
| 1377 | Ga0207678_10026967 | |||
| 1378 | Ga0207678_10027074 | |||
| 1379 | Ga0207678_10040297 | |||
| 1380 | Ga0207678_10106813 | |||
| 1381 | Ga0207678_10345286 | |||
| 1382 | Ga0207702_10000132 | |||
| 1383 | Ga0207702_10000338 | |||
| 1384 | Ga0207702_10013397 | |||
| 1385 | Ga0207702_10054245 | |||
| 1386 | Ga0207702_10439479 | |||
| 1387 | Ga0207702_11206364 | |||
| 1388 | Ga0207641_10025217 | |||
| 1389 | Ga0207641_10376307 | |||
| 1390 | Ga0207648_10016027 | |||
| 1391 | Ga0207648_10948227 | |||
| 1392 | Ga0207648_11103243 | |||
| 1393 | Ga0207676_10038682 | |||
| 1394 | Ga0207674_10001145 | |||
| 1395 | Ga0207674_10002886 | |||
| 1396 | Ga0207674_10039493 | |||
| 1397 | Ga0207674_10046326 | |||
| 1398 | Ga0207674_10047098 | |||
| 1399 | Ga0207674_10375402 | |||
| 1400 | Ga0207683_10394289 | |||
| 1401 | Ga0207698_10000491 | |||
| 1402 | Ga0207698_10006628 | |||
| 1403 | Ga0207698_10021688 | |||
| 1404 | Ga0207698_12006094 | |||
| 1405 | Ga0268266_10000008 | |||
| 1406 | Ga0268266_10000075 | |||
| 1407 | Ga0268265_10461712 | |||
| 1408 | Ga0268265_11863648 | |||
| 1409 | Ga0268264_10003031 | |||
| 1410 | Ga0268264_10079343 | |||
| 1411 | Ga0268264_10386309 | |||
| 1412 | Ga0268264_10535999 | |||
| 1413 | Ga0307509_10399468 | |||
| 1414 | Ga0307508_10226554 | |||
| 1415 | Ga0316575_10029237 | |||
| 1416 | Ga0307413_10477018 | |||
| 1417 | Ga0307412_10043615 | |||
| 1418 | Ga0307412_11252999 | |||
| 1419 | Ga0307416_100132487 | |||
| 1420 | Ga0307416_100286179 | |||
| 1421 | Ga0307414_10094121 | |||
| 1422 | Ga0307414_10423568 | |||
| 1423 | Ga0307411_10051057 | |||
| 1424 | Ga0307411_10259112 | |||
| 1425 | Ga0307411_11110105 | |||
| 1426 | Ga0307415_100782597 | |||
| 1427 | Ga0307507_10102026 | |||
| 1428 | Ga0307507_10374266 | |||
| 1429 | Ga0395899_0000110 | |||
| 1430 | Ga0395899_0001023 | |||
| 1431 | Ga0395899_0034712 | |||
| 1432 | Ga0395900_0000049 | |||
| 1433 | Ga0395900_0000060 | |||
| 1434 | Ga0395900_0102529 | |||
| 1435 | Ga0395900_0471806 | |||
| 1436 | Ga0395898_0000023 | |||
| 1437 | Ga0395898_0000237 | |||
| 1438 | Ga0395898_0018522 | |||
| 1439 | Ga0395898_0097752 | |||
| 1440 | Ga0395901_0117942 | |||
| 1441 | Ga0395901_0206518 | |||
| 1442 | Ga0395901_0371738 | |||
| 1443 | Ga0439436_0000032 | |||
| 1444 | Ga0439465_0000530 | |||
| 1445 | Ga0451789_0811766 | |||
| 1446 | Ga0451793_1777967 | |||
| 1447 | Ga0451797_0113713 | |||
| 1448 | Ga0451797_1444144 | |||
| 1449 | Ga0451795_0322423 | |||
| 1450 | Ga0451795_0773849 | |||
| 1451 | Ga0451802_0035022 | |||
| 1452 | Ga0451806_671699 | |||
| 1453 | Ga0451841_0241459 | |||
| 1454 | Ga0450908_000007 | |||
| 1455 | Ga0439459_0061077 | |||
| 1456 | Ga0451577_0176764 | |||
| 1457 | Ga0466969_0038934 | |||
| 1458 | Ga0466969_0088821 | |||
| 1459 | Ga0466972_0038589 | |||
| 1460 | Ga0466976_0347589 | |||
| 1461 | Ga0466989_0163097 | |||
| 1462 | Ga0466982_0000018 | |||
| 1463 | Ga0466982_0000096 | |||
| 1464 | Ga0466965_0150407 | |||
| 1465 | Ga0466966_0008293 | |||
| 1466 | Ga0466966_0041964 | |||
| 1467 | Ga0466966_0181364 | |||
| 1468 | Ga0466961_0001486 | |||
| 1469 | Ga0466961_0002537 | |||
| 1470 | Ga0466961_0003674 | |||
| 1471 | Ga0466961_0003935 | |||
| 1472 | Ga0466961_0012833 | |||
| 1473 | Ga0466963_0207098 | |||
| 1474 | Ga0466963_0695281 | |||
| 1475 | Ga0466964_0001814 | |||
| 1476 | Ga0466964_0025129 | |||
| 1477 | Ga0453684_0000316 | |||
| 1478 | Ga0466971_0001777 | |||
| 1479 | Ga0466971_0015305 | |||
| 1480 | Ga0466971_0015318 | |||
| 1481 | Ga0466971_0111559 | |||
| 1482 | Ga0466968_0001797 | |||
| 1483 | Ga0466968_0012411 | |||
| 1484 | Ga0466970_0004514 | |||
| 1485 | Ga0466970_0019296 | |||
| 1486 | Ga0466957_0002919 | |||
| 1487 | Ga0466957_0039575 | |||
| 1488 | Ga0466957_0133691 | |||
| 1489 | Ga0466957_0251608 | |||
| 1490 | Ga0466957_0643964 | |||
| 1491 | Ga0466960_0023732 | |||
| 1492 | Ga0466959_0005091 | |||
| 1493 | Ga0466959_0320532 | |||
| 1494 | Ga0451576_0000128 | |||
| 1495 | Ga0466958_0016421 | |||
| 1496 | Ga0466958_0025788 | |||
| 1497 | Ga0466958_0032951 | |||
| 1498 | Ga0466958_0293822 | |||
| 1499 | Ga0466967_0318912 | |||
| 1500 | Ga0495617_000607 | |||
| 1501 | Ga0495617_001095 | |||
| 1502 | Ga0495638_0000019 | |||
| 1503 | Ga0495638_0000406 | |||
| 1504 | Ga0495638_0000452 | |||
| 1505 | Ga0495638_0001628 | |||
| 1506 | Ga0495650_0000350 | |||
| 1507 | Ga0495650_0000466 | |||
| 1508 | Ga0495650_0000869 | |||
| 1509 | Ga0495605_0126429 | |||
| 1510 | Ga0495584_0001662 | |||
| 1511 | Ga0495585_0001138 | |||
| 1512 | Ga0495585_0040927 | |||
| 1513 | Ga0495607_0000133 | |||
| 1514 | Ga0495607_0001577 | |||
| 1515 | Ga0495607_0007528 | |||
| 1516 | Ga0495583_0011255 | |||
| 1517 | Ga0495606_0000016 | |||
| 1518 | Ga0495606_0000160 | |||
| 1519 | Ga0495606_0001918 | |||
| 1520 | Ga0495606_0002253 | |||
| 1521 | Ga0495606_0234825 | |||
| 1522 | Ga0495606_0269383 | |||
| 1523 | Ga0495610_0004501 | |||
| 1524 | Ga0495610_0029998 | |||
| 1525 | Ga0495616_0000006 | |||
| 1526 | Ga0495616_0047917 | |||
| 1527 | Ga0495620_0000711 | |||
| 1528 | Ga0495620_0097744 | |||
| 1529 | Ga0495631_0000036 | |||
| 1530 | Ga0495631_0000318 | |||
| 1531 | Ga0495632_0000010 | |||
| 1532 | Ga0495632_0012658 | |||
| 1533 | Ga0495632_0054517 | |||
| 1534 | Ga0495637_0007175 | |||
| 1535 | Ga0495643_0177310 | |||
| 1536 | Ga0495648_0000881 | |||
| 1537 | Ga0495609_0149052 | |||
| 1538 | Ga0495622_0020164 | |||
| 1539 | Ga0495622_0251985 | |||
| 1540 | Ga0495668_0005730 | |||
| 1541 | Ga0495611_0000003 | |||
| 1542 | Ga0495611_0000028 | |||
| 1543 | Ga0495625_0000193 | |||
| 1544 | Ga0495625_0006388 | |||
| 1545 | Ga0495625_0015849 | |||
| 1546 | Ga0495625_0048981 | |||
| 1547 | Ga0495625_0090097 | |||
| 1548 | Ga0495661_0001277 | |||
| 1549 | Ga0495670_0000413 | |||
| 1550 | Ga0495670_0013548 | |||
| 1551 | Ga0495670_0026664 | |||
| 1552 | Ga0495671_0000142 | |||
| 1553 | Ga0495649_0009358 | |||
| 1554 | Ga0495649_0023421 | |||
| 1555 | Ga0495589_0000042 | |||
| 1556 | Ga0495660_0004438 | |||
| 1557 | Ga0495660_0010465 | |||
| 1558 | Ga0495683_0000722 | |||
| 1559 | Ga0495679_000046 | |||
| 1560 | Ga0495673_0000004 | |||
| 1561 | Ga0495673_0000041 | |||
| 1562 | Ga0495673_0004939 | |||
| 1563 | Ga0495681_0111495 | |||
| 1564 | Ga0495686_0000117 | |||
| 1565 | Ga0495686_0000229 | |||
| 1566 | Ga0495686_0002823 | |||
| 1567 | Ga0495686_0007664 | |||
| 1568 | Ga0495686_0011281 | |||
| 1569 | Ga0495686_0023910 | |||
| 1570 | Ga0496100_0090442 | |||
| 1571 | Ga0496101_0004110 | |||
| 1572 | Ga0496102_0197553 | |||
| 1573 | Ga0496102_0413565 | |||
| 1574 | Ga0496103_0026448 | |||
| 1575 | Ga0496104_0031058 | |||
| 1576 | Ga0496104_0194060 | |||
| 1577 | Ga0496105_0042555 | |||
| 1578 | Ga0496106_0001877 | |||
| 1579 | Ga0496106_0199612 | |||
| 1580 | Ga0496107_0092139 | |||
| 1581 | Ga0496108_0260772 | |||
| 1582 | Ga0496113_0011788 | |||
| 1583 | Ga0496114_0067958 | |||
| 1584 | Ga0496115_0000196 | |||
| 1585 | Ga0496115_0000440 | |||
| 1586 | Ga0496115_0032843 | |||
| 1587 | Ga0496115_0214530 | |||
| 1588 | Ga0496115_0733924 | |||
| 1589 | Ga0496116_0042941 | |||
| 1590 | Ga0496116_0077088 | |||
| 1591 | Ga0496116_0086439 | |||
| 1592 | Ga0496116_0190880 | |||
| 1593 | Ga0496117_0023133 | |||
| 1594 | Ga0496117_0029156 | |||
| 1595 | Ga0496117_0030912 | |||
| 1596 | Ga0496117_0103448 | |||
| 1597 | Ga0496117_0309500 | |||
| 1598 | Ga0496118_0001472 | |||
| 1599 | Ga0496118_0002903 | |||
| 1600 | Ga0496118_0005217 | |||
| 1601 | Ga0496118_0006396 | |||
| 1602 | Ga0496118_0008697 | |||
| 1603 | Ga0496118_0087591 | |||
| 1604 | Ga0496118_0222566 | |||
| 1605 | Ga0496118_0420987 | |||
| 1606 | Ga0496119_0000201 | |||
| 1607 | Ga0496119_0005372 | |||
| 1608 | Ga0496119_0018397 | |||
| 1609 | Ga0496120_0000189 | |||
| 1610 | Ga0496120_0000837 | |||
| 1611 | Ga0496121_0000419 | |||
| 1612 | Ga0496121_0000771 | |||
| 1613 | Ga0496121_0001298 | |||
| 1614 | Ga0496121_0003299 | |||
| 1615 | Ga0496121_0014080 | |||
| 1616 | Ga0496121_0032700 | |||
| 1617 | Ga0496121_0051673 | |||
| 1618 | Ga0496121_0064333 | |||
| 1619 | Ga0496121_0071241 | |||
| 1620 | Ga0496121_0363267 | |||
| 1621 | Ga0496121_0401542 | |||
| 1622 | Ga0496121_0630530 | |||
| 1623 | Ga0496122_0001358 | |||
| 1624 | Ga0496122_0007321 | |||
| 1625 | Ga0496122_0019348 | |||
| 1626 | Ga0496122_0082530 | |||
| 1627 | Ga0496122_0116918 | |||
| 1628 | Ga0496123_0004282 | |||
| 1629 | Ga0496123_0004978 | |||
| 1630 | Ga0496123_0009820 | |||
| 1631 | Ga0496123_0042437 | |||
| 1632 | Ga0496123_0096190 | |||
| 1633 | Ga0496124_0000203 | |||
| 1634 | Ga0496124_0001473 | |||
| 1635 | Ga0496124_0109481 | |||
| 1636 | Ga0496125_0001450 | |||
| 1637 | Ga0496125_0008488 | |||
| 1638 | Ga0496125_0027584 | |||
| 1639 | Ga0496125_0152162 | |||
| 1640 | Ga0496126_0001528 | |||
| 1641 | Ga0496126_0009745 | |||
| 1642 | Ga0496126_0016296 | |||
| 1643 | Ga0496126_0052949 | |||
| 1644 | Ga0496126_0062906 | |||
| 1645 | Ga0496126_0070126 | |||
| 1646 | Ga0496126_0073413 | |||
| 1647 | Ga0496126_0319947 | |||
| 1648 | Ga0496126_0442509 | |||
| 1649 | Ga0495678_000066 | |||
| 1650 | Ga0495678_015033 | |||
| 1651 | Ga0495682_0003108 | |||
| 1652 | Ga0495682_0026021 | |||
| 1653 | Ga0495682_0095429 | |||
| 1654 | Ga0501032_0060536 | |||
| 1655 | Ga0501033_0019511 | |||
| 1656 | Ga0501033_0284121 | |||
| 1657 | Ga0501034_0006620 | |||
| 1658 | Ga0501034_0758834 | |||
| 1659 | Ga0501036_0394918 | |||
| 1660 | Ga0501037_0018053 | |||
| 1661 | Ga0501037_0152969 | |||
| 1662 | Ga0501038_0015538 | |||
| 1663 | Ga0501038_0418817 | |||
| 1664 | Ga0501039_0120244 | |||
| 1665 | Ga0501039_0358639 | |||
| 1666 | Ga0501043_0022946 | |||
| 1667 | Ga0501043_0031501 | |||
| 1668 | Ga0501043_0086842 | |||
| 1669 | Ga0501043_0196194 | |||
| 1670 | Ga0501043_0255343 | |||
| 1671 | Ga0501046_0008054 | |||
| 1672 | Ga0501046_0200343 | |||
| 1673 | Ga0501046_0234302 | |||
| 1674 | Ga0501047_0002093 | |||
| 1675 | Ga0501047_0003063 | |||
| 1676 | Ga0501047_0045093 | |||
| 1677 | Ga0501047_0059989 | |||
| 1678 | Ga0501047_0060899 | |||
| 1679 | Ga0501047_0140733 | |||
| 1680 | Ga0501048_0065527 | |||
| 1681 | Ga0501048_0111141 | |||
| 1682 | Ga0501067_0000583 | |||
| 1683 | Ga0501068_0184873 | |||
| 1684 | Ga0501069_0001862 | |||
| 1685 | Ga0501069_0002178 | |||
| 1686 | Ga0501069_0026323 | |||
| 1687 | Ga0501069_0066946 | |||
| 1688 | Ga0501069_0113071 | |||
| 1689 | Ga0501070_0004139 | |||
| 1690 | Ga0501070_0004257 | |||
| 1691 | Ga0501070_0061919 | |||
| 1692 | Ga0501070_0066254 | |||
| 1693 | Ga0501070_0146981 | |||
| 1694 | Ga0501070_0458335 | |||
| 1695 | Ga0501071_0008797 | |||
| 1696 | Ga0501072_0002507 | |||
| 1697 | Ga0501072_0143661 | |||
| 1698 | Ga0501073_0008095 | |||
| 1699 | Ga0501073_0015945 | |||
| 1700 | Ga0501073_0159283 | |||
| 1701 | Ga0501073_0209089 | |||
| 1702 | Ga0501073_0284279 | |||
| 1703 | Ga0501074_0003986 | |||
| 1704 | Ga0501074_0005938 | |||
| 1705 | Ga0501074_0025883 | |||
| 1706 | Ga0501074_0062333 | |||
| 1707 | Ga0501074_0065446 | |||
| 1708 | Ga0501074_1063612 | |||
| 1709 | Ga0501079_0026319 | |||
| 1710 | Ga0501079_0173661 | |||
| 1711 | Ga0501079_0618568 | |||
| 1712 | Ga0501080_0000256 | |||
| 1713 | Ga0501080_0001893 | |||
| 1714 | Ga0501080_0003974 | |||
| 1715 | Ga0501080_0016829 | |||
| 1716 | Ga0501080_0097338 | |||
| 1717 | Ga0501083_0001929 | |||
| 1718 | Ga0501035_0030885 | |||
| 1719 | Ga0501035_0073546 | |||
| 1720 | Ga0501035_0084441 | |||
| 1721 | Ga0501035_0121763 | |||
| 1722 | Ga0501035_0540457 | |||
| 1723 | Ga0501044_0003272 | |||
| 1724 | Ga0501044_0007113 | |||
| 1725 | Ga0501044_0014551 | |||
| 1726 | Ga0501044_0114409 | |||
| 1727 | Ga0501044_0205065 | |||
| 1728 | Ga0501044_0296891 | |||
| 1729 | Ga0501044_1283098 | |||
| 1730 | nmdc:mga0sz30_92625_c1 | |||
| 1731 | Ga0500643_000036 | |||
| 1732 | Ga0500643_008323 | |||
| 1733 | Ga0500555_001310 | |||
| 1734 | Ga0500597_000016 | |||
| 1735 | Ga0500652_190098 | |||
| 1736 | Ga0500633_0001664 | |||
| 1737 | Ga0500645_000639 | |||
| 1738 | Ga0501084_0291415 | |||
| 1739 | Ga0501082_0201301 | |||
| 1740 | Ga0501082_0287069 | |||
| 1741 | Ga0466962_0000272 | |||
| 1742 | Ga0466962_0011816 | |||
| 1743 | Ga0466962_0037551 | |||
| 1744 | Ga0466962_0222261 | |||
| 1745 | Ga0466962_0601888 | |||
| 1746 | 2525558158 | |||
| 1747 | 2538835162 | |||
| 1748 | 2595447961 | |||
| 1749 | 2630649961 | |||
| 1750 | 2643829356 | |||
| 1751 | 2721026089 | |||
| 1752 | 2735833943 | |||
| 1753 | 2739229746 | |||
| 1754 | 2739729927 | |||
| 1755 | 2819565567 | |||
| 1756 | 2842918672 | |||
| 1757 | 2842922143 | |||
| 1758 | 2884341934 | |||
| 1759 | 2884413030 | |||
| 1760 | 2895397305 | |||
| 1761 | 2904466059 | |||
| 1762 | 2919087322 | |||
| 1763 | 2919406554 | |||
| 1764 | 2928965885 | |||
| 1765 | 2941474340 | |||
| 1766 | 2953997261 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3imq-assembly1.cif.gz_A | crystal structure of the nusb101-s10(delta loop) complex | 0.9666 | 12 | 147 |
| 3imq-assembly1.cif.gz_A | crystal structure of the nusb101-s10(delta loop) complex | 0.9529 | 12 | 147 |
| 3d3c-assembly3.cif.gz_C | structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. | 0.9471 | 11 | 147 |
| 3d3c-assembly3.cif.gz_C | structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. | 0.934 | 11 | 147 |
| 5lm7-assembly2.cif.gz_D | crystal structure of the lambda n-nus factor complex | 0.9107 | 15 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A780_1_139_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9643 | 10 | 147 | 1.10.940.10 |
| af_P0A780_1_139_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9508 | 10 | 147 | 1.10.940.10 |
| 5lm7D00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9107 | 15 | 144 | 1.10.940.10 |
| af_Q2FY45_1_129_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9007 | 16 | 139 | 1.10.940.10 |
| af_Q2FZ67_2_133_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9007 | 18 | 139 | 1.10.940.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836PN20-F1-model_v4 | Transcription antitermination factor NusB | 0.9922 | 55 | 149 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A368HI50-F1-model_v4 | Transcription antitermination factor NusB | 0.9879 | 52 | 145 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A831Z5G0-F1-model_v4 | Transcription antitermination factor NusB | 0.9854 | 59 | 149 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A7X5U9W7-F1-model_v4 | Transcription antitermination protein NusB (Antitermination factor NusB) | 0.9833 | 8 | 150 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A7J6JU36-F1-model_v4 | deleted | 0.9829 | 50 | 147 |
|