F484608

General Info

Members Datasets Scaffolds Average Seq Length
883 338 1766 150

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0007419|Ga0501044_0007419_2278_2724
Length 143
Sequence MHARPEGIDLAARSRARRRALQALYAWQLSGSHMNAVIEQFRHEQDMEVADLEYFEDLLHGVEKHVAELDALLRPYLDREPIERAALRLAAYELKHRPDVPYRVVINEAIEVTKRFGADHGHSYVNGVLDKLAGQLRSTEKRA

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
89 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
129 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
196 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
197 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
198 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
199 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
200 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
201 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
202 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
203 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
204 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
205 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044662 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E Metagenome Unclassified
210 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
211 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
237 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
256 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
276 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
284 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
309 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
310 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
311 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
312 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
313 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
314 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
319 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
320 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
321 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
322 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
323 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
324 2734482264 Dyella sp. AD052 Isolate Unclassified
325 2738543009 Luteibacter sp. OK325 Isolate Unclassified
326 2739367700 Dyella sp. YR388 Isolate Unclassified
327 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
328 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
329 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
330 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
331 2884411467 Dyella sp. AD56 Isolate Rhizosphere
332 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
333 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
334 2919085039 Luteibacter sp. 1214 Isolate Unclassified
335 2919404418 Luteibacter sp. 3190 Isolate Unclassified
336 2928963466 Dyella japonica 1073 Isolate Unclassified
337 2941471342 Luteibacter sp. 621 Isolate Unclassified
338 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.7
Metatranscriptomes 1.93
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.89
Nodule 0
Rhizoplane 3.06
Rhizosphere 72.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0007419 3300049823 Bacteria 12063
2 JGI24736J21556_1039259 3300001904 Bacteria 728
3 JGI24741J21665_1002334 3300001915 Bacteria 4974
4 JGI24741J21665_1002712 3300001915 Bacteria 4500
5 JGI24740J21852_10000701 3300001979 Bacteria 14520
6 JGI24739J22299_10009804 3300001989 Bacteria 3561
7 JGI24737J22298_10026518 3300001990 Bacteria 1829
8 JGI24737J22298_10081336 3300001990 Bacteria 964
9 JGI24735J21928_10004013 3300002067 Bacteria 4980
10 JGI24735J21928_10014324 3300002067 Bacteria 2485
11 JGI24735J21928_10201559 3300002067 Bacteria 577
12 JGI24738J21930_10015494 3300002075 Bacteria 1620
13 JGI25162J39368_1001457 3300002737 Bacteria 12519
14 JGI25162J39368_1002014 3300002737 Bacteria 9022
15 JGI25162J39368_1004214 3300002737 Bacteria 3489
16 JGI25162J39368_1010547 3300002737 Bacteria 1161
17 JGI25154J39366_1007917 3300002738 Bacteria 1412
18 JGI25154J39366_1008133 3300002738 Bacteria 1375
19 JGI25154J39366_1014669 3300002738 Bacteria 821
20 JGI25157J39369_1000224 3300002741 Bacteria 44715
21 JGI25157J39369_1001100 3300002741 Bacteria 12060
22 JGI25157J39369_1002245 3300002741 Bacteria 5204
23 JGI25157J39369_1003667 3300002741 Bacteria 3041
24 JGI25157J39369_1008184 3300002741 Bacteria 1466
25 JGI25157J39369_1021350 3300002741 Bacteria 770
26 JGI25163J39215_1001252 3300002771 Bacteria 4647
27 JGI25164J39214_1000164 3300002772 Bacteria 62780
28 JGI25164J39214_1002054 3300002772 Bacteria 3491
29 JGI25164J39214_1006974 3300002772 Bacteria 1164
30 JGI25165J46597_1000317 3300003214 Bacteria 58133
31 JGI25165J46597_1001472 3300003214 Bacteria 12233
32 JGI25165J46597_1012862 3300003214 Bacteria 1161
33 JGI25165J46597_1030791 3300003214 Bacteria 692
34 JGI25153J46596_10018510 3300003215 Bacteria 2702
35 rootH2_10011924 3300003320 Bacteria 18770
36 Ga0006554J51385_1041028 3300003567 Bacteria 976
37 Ga0006562J51391_1031326 3300003578 Bacteria 7320
38 Ga0006562J51391_1042664 3300003578 Bacteria 8710
39 Ga0006562J51391_1042669 3300003578 Bacteria 3710
40 Ga0055533_1002210 3300003756 Bacteria 4593
41 Ga0055533_1005210 3300003756 Bacteria 2139
42 Ga0055533_1006131 3300003756 Bacteria 1818
43 Ga0055525_1000055 3300003759 Bacteria 215181
44 Ga0055527_1000116 3300003760 Bacteria 57355
45 Ga0055527_1000210 3300003760 Bacteria 37874
46 Ga0055535_1000296 3300003761 Bacteria 51261
47 Ga0055535_1000454 3300003761 Bacteria 37846
48 Ga0055535_1001071 3300003761 Bacteria 16846
49 Ga0055535_1001444 3300003761 Bacteria 12063
50 Ga0055535_1002833 3300003761 Bacteria 5481
51 Ga0055542_1000056 3300003762 Bacteria 167483
52 Ga0055542_1000263 3300003762 Bacteria 58594
53 Ga0055542_1000277 3300003762 Bacteria 57355
54 Ga0055542_1000468 3300003762 Bacteria 37874
55 Ga0055542_1000620 3300003762 Bacteria 30079
56 Ga0055542_1004324 3300003762 Bacteria 3489
57 Ga0055542_1028233 3300003762 Bacteria 741
58 Ga0055529_1000253 3300003763 Bacteria 64782
59 Ga0055529_1000298 3300003763 Bacteria 57355
60 Ga0055529_1000479 3300003763 Bacteria 37884
61 Ga0055529_1001107 3300003763 Bacteria 12033
62 Ga0055529_1003276 3300003763 Bacteria 2735
63 Ga0055543_1007681 3300004625 Bacteria 2464
64 Ga0065165_1000108 3300005262 Bacteria 139605
65 Ga0065165_1005855 3300005262 Bacteria 6689
66 Ga0070658_10001565 3300005327 Bacteria 19405
67 Ga0070658_10118601 3300005327 Bacteria 2197
68 Ga0070658_10523744 3300005327 Bacteria 1025
69 Ga0070658_10550404 3300005327 Bacteria 998
70 Ga0070658_10614628 3300005327 Bacteria 942
71 Ga0070683_100127162 3300005329 Bacteria 2409
72 Ga0070683_100142437 3300005329 Bacteria 2271
73 Ga0070683_100174384 3300005329 Bacteria 2041
74 Ga0070690_100202766 3300005330 Bacteria 1381
75 Ga0070690_100345793 3300005330 Bacteria 1078
76 Ga0070670_100009171 3300005331 Bacteria 8458
77 Ga0070670_100265733 3300005331 Bacteria 1496
78 Ga0070666_10000037 3300005335 Bacteria 116528
79 Ga0070666_10000487 3300005335 Bacteria 23992
80 Ga0070666_10007269 3300005335 Bacteria 6828
81 Ga0070680_100097990 3300005336 Bacteria 2431
82 Ga0070680_100460938 3300005336 Bacteria 1086
83 Ga0070682_100176722 3300005337 Bacteria 1488
84 Ga0068868_100058111 3300005338 Bacteria 3056
85 Ga0070660_100247365 3300005339 Bacteria 1453
86 Ga0070660_100373620 3300005339 Bacteria 1176
87 Ga0070660_100648008 3300005339 Bacteria 884
88 Ga0070691_10032937 3300005341 Bacteria 2436
89 Ga0070691_10533427 3300005341 Bacteria 683
90 Ga0070661_100007367 3300005344 Bacteria 7588
91 Ga0070661_100010149 3300005344 Bacteria 6540
92 Ga0070661_100014442 3300005344 Bacteria 5566
93 Ga0070661_100108677 3300005344 Bacteria 2069
94 Ga0070661_100134943 3300005344 Bacteria 1856
95 Ga0070661_100239179 3300005344 Bacteria 1397
96 Ga0070661_100298248 3300005344 Bacteria 1254
97 Ga0070692_10037193 3300005345 Bacteria 2473
98 Ga0070692_10105382 3300005345 Bacteria 1552
99 Ga0070668_100097591 3300005347 Bacteria 2324
100 Ga0070671_100415382 3300005355 Bacteria 1152
101 Ga0070688_100128609 3300005365 Bacteria 1706
102 Ga0070659_100058492 3300005366 Bacteria 3042
103 Ga0070667_100000072 3300005367 Bacteria 122929
104 Ga0070667_100016061 3300005367 Bacteria 6193
105 Ga0070667_100131582 3300005367 Bacteria 2184
106 Ga0070667_100244360 3300005367 Bacteria 1603
107 Ga0070667_100591501 3300005367 Bacteria 1022
108 Ga0070714_100096930 3300005435 Bacteria 2592
109 Ga0070713_100123179 3300005436 Bacteria 2276
110 Ga0070711_100332269 3300005439 Bacteria 1217
111 Ga0070708_100946346 3300005445 Bacteria 808
112 Ga0070663_100005396 3300005455 Bacteria 7595
113 Ga0070663_100028573 3300005455 Bacteria 3798
114 Ga0070663_100039684 3300005455 Bacteria 3292
115 Ga0070663_100072087 3300005455 Bacteria 2515
116 Ga0070663_100110496 3300005455 Bacteria 2065
117 Ga0070663_100287078 3300005455 Bacteria 1313
118 Ga0070663_100372822 3300005455 Bacteria 1161
119 Ga0070663_100649466 3300005455 Bacteria 892
120 Ga0070663_100789579 3300005455 Bacteria 813
121 Ga0070663_100868267 3300005455 Bacteria 777
122 Ga0070678_100362546 3300005456 Bacteria 1249
123 Ga0070681_10000151 3300005458 Bacteria 52829
124 Ga0070681_10037306 3300005458 Bacteria 4878
125 Ga0070681_10125600 3300005458 Bacteria 2498
126 Ga0070681_10128599 3300005458 Bacteria 2465
127 Ga0068867_100045587 3300005459 Bacteria 3217
128 Ga0068867_101105138 3300005459 Bacteria 724
129 Ga0070685_10014858 3300005466 Bacteria 4129
130 Ga0070699_100485645 3300005518 Bacteria 1121
131 Ga0070679_100000250 3300005530 Bacteria 45069
132 Ga0070679_100055321 3300005530 Bacteria 3951
133 Ga0070684_100089335 3300005535 Bacteria 2738
134 Ga0070684_100131098 3300005535 Bacteria 2261
135 Ga0070684_100288459 3300005535 Bacteria 1504
136 Ga0068853_100006694 3300005539 Bacteria 9179
137 Ga0068853_100016337 3300005539 Bacteria 6107
138 Ga0068853_100016385 3300005539 Bacteria 6099
139 Ga0068853_100035262 3300005539 Bacteria 4248
140 Ga0068853_100053738 3300005539 Bacteria 3469
141 Ga0068853_100241308 3300005539 Bacteria 1656
142 Ga0068853_100265685 3300005539 Bacteria 1579
143 Ga0068853_101179716 3300005539 Bacteria 739
144 Ga0068853_101225682 3300005539 Bacteria 725
145 Ga0070696_100007583 3300005546 Bacteria 7254
146 Ga0070696_100031485 3300005546 Bacteria 3635
147 Ga0070665_100000376 3300005548 Bacteria 66416
148 Ga0070665_100010663 3300005548 Bacteria 9303
149 Ga0068855_100010660 3300005563 Bacteria 11087
150 Ga0068855_100122173 3300005563 Bacteria 2980
151 Ga0068855_100212437 3300005563 Bacteria 2173
152 Ga0070664_100128266 3300005564 Bacteria 2226
153 Ga0068857_100013283 3300005577 Bacteria 7173
154 Ga0068857_100038503 3300005577 Bacteria 4235
155 Ga0068857_100050500 3300005577 Bacteria 3689
156 Ga0068857_100061409 3300005577 Bacteria 3339
157 Ga0068857_100226826 3300005577 Bacteria 1707
158 Ga0068854_100003612 3300005578 Bacteria 9680
159 Ga0068854_100113799 3300005578 Bacteria 2044
160 Ga0068854_100123359 3300005578 Bacteria 1970
161 Ga0068854_100429121 3300005578 Bacteria 1099
162 Ga0068856_100007396 3300005614 Bacteria 10716
163 Ga0068856_100012219 3300005614 Bacteria 8319
164 Ga0068856_100169157 3300005614 Bacteria 2197
165 Ga0068856_100319989 3300005614 Bacteria 1568
166 Ga0068852_100006036 3300005616 Bacteria 8728
167 Ga0068852_100034585 3300005616 Bacteria 4206
168 Ga0068852_100042035 3300005616 Bacteria 3868
169 Ga0068852_100073648 3300005616 Bacteria 3005
170 Ga0068852_100169580 3300005616 Bacteria 2045
171 Ga0068852_100178626 3300005616 Bacteria 1994
172 Ga0068852_100235707 3300005616 Bacteria 1746
173 Ga0068859_100324564 3300005617 Bacteria 1633
174 Ga0068859_101521946 3300005617 Bacteria 738
175 Ga0068864_100004209 3300005618 Bacteria 11834
176 Ga0068851_10000908 3300005834 Bacteria 12753
177 Ga0068851_10010761 3300005834 Bacteria 4275
178 Ga0068851_10019388 3300005834 Bacteria 3286
179 Ga0068851_10196718 3300005834 Bacteria 1123
180 Ga0068863_100006254 3300005841 Bacteria 11695
181 Ga0068863_100556207 3300005841 Bacteria 1133
182 Ga0068863_100981392 3300005841 Bacteria 847
183 Ga0068858_100000817 3300005842 Bacteria 32476
184 Ga0068858_100074088 3300005842 Bacteria 3161
185 Ga0068858_100242140 3300005842 Bacteria 1712
186 Ga0068858_100630593 3300005842 Bacteria 1041
187 Ga0068858_100733808 3300005842 Bacteria 962
188 Ga0068860_100017401 3300005843 Bacteria 7003
189 Ga0068860_100066993 3300005843 Bacteria 3412
190 Ga0068860_100265669 3300005843 Bacteria 1673
191 Ga0068860_100270877 3300005843 Bacteria 1657
192 Ga0068862_100176956 3300005844 Bacteria 1913
193 Ga0068862_100646975 3300005844 Bacteria 1019
194 Ga0075369_10064511 3300006186 Bacteria 1604
195 Ga0097621_100324094 3300006237 Bacteria 1365
196 Ga0097621_100400799 3300006237 Bacteria 1228
197 Ga0097621_100482046 3300006237 Bacteria 1121
198 Ga0068871_100231117 3300006358 Bacteria 1605
199 Ga0068865_100427698 3300006881 Bacteria 1090
200 Ga0097620_100324596 3300006931 Bacteria 1633
201 Ga0097620_101522031 3300006931 Bacteria 738
202 Ga0105240_10002563 3300009093 Bacteria 29133
203 Ga0105240_10009143 3300009093 Bacteria 14064
204 Ga0105240_10009721 3300009093 Bacteria 13581
205 Ga0105240_10011172 3300009093 Bacteria 12533
206 Ga0105240_10023678 3300009093 Bacteria 8112
207 Ga0105240_10055889 3300009093 Bacteria 4941
208 Ga0105240_10152926 3300009093 Bacteria 2746
209 Ga0105240_10256770 3300009093 Bacteria 2018
210 Ga0105240_11226200 3300009093 Bacteria 794
211 Ga0105240_11500257 3300009093 Bacteria 707
212 Ga0105245_10286466 3300009098 Bacteria 1612
213 Ga0105245_10406451 3300009098 Bacteria 1362
214 Ga0105247_10002916 3300009101 Bacteria 11384
215 Ga0105241_10015625 3300009174 Bacteria 5562
216 Ga0105241_10094532 3300009174 Bacteria 2364
217 Ga0105241_10620362 3300009174 Bacteria 979
218 Ga0105241_11415169 3300009174 Bacteria 666
219 Ga0105242_10762084 3300009176 Bacteria 954
220 Ga0105248_10000920 3300009177 Bacteria 32785
221 Ga0105248_10944372 3300009177 Bacteria 974
222 Ga0105237_10000084 3300009545 Bacteria 125742
223 Ga0105237_10000675 3300009545 Bacteria 47159
224 Ga0105237_10008928 3300009545 Bacteria 10796
225 Ga0105237_10009642 3300009545 Bacteria 10335
226 Ga0105237_11987742 3300009545 Bacteria 590
227 Ga0105238_10000131 3300009551 Bacteria 82050
228 Ga0105238_10005144 3300009551 Bacteria 12931
229 Ga0105238_10098301 3300009551 Bacteria 2911
230 Ga0105238_10108501 3300009551 Bacteria 2757
231 Ga0105238_10391495 3300009551 Bacteria 1382
232 Ga0105238_11236530 3300009551 Bacteria 772
233 Ga0105249_10000084 3300009553 Bacteria 134869
234 Ga0105249_10007606 3300009553 Bacteria 9453
235 Ga0105239_10000033 3300010375 Bacteria 223933
236 Ga0105239_10018126 3300010375 Bacteria 7783
237 Ga0105239_10042913 3300010375 Bacteria 4955
238 Ga0105239_10106637 3300010375 Bacteria 3104
239 Ga0105239_10572998 3300010375 Bacteria 1286
240 Ga0105246_10011815 3300011119 Bacteria 5427
241 Ga0105246_10128100 3300011119 Bacteria 1892
242 Ga0105246_11968736 3300011119 Bacteria 563
243 Ga0157314_1000507 3300012500 Bacteria 3702
244 Ga0154012_169161 3300013059 Bacteria 1120
245 Ga0157373_10011463 3300013100 Bacteria 6519
246 Ga0157373_10100595 3300013100 Bacteria 2034
247 Ga0157371_10070400 3300013102 Bacteria 2476
248 Ga0157371_10348755 3300013102 Bacteria 1077
249 Ga0157370_10005440 3300013104 Bacteria 14285
250 Ga0157370_10023809 3300013104 Bacteria 6075
251 Ga0157370_10045998 3300013104 Bacteria 4186
252 Ga0157370_10081025 3300013104 Bacteria 3055
253 Ga0157369_10003012 3300013105 Bacteria 20149
254 Ga0157369_10011973 3300013105 Bacteria 9855
255 Ga0157369_10018985 3300013105 Bacteria 7700
256 Ga0157369_10124679 3300013105 Bacteria 2732
257 Ga0157369_11419744 3300013105 Bacteria 707
258 Ga0157374_11003429 3300013296 Bacteria 854
259 Ga0163162_10000221 3300013306 Bacteria 52249
260 Ga0163162_10069555 3300013306 Bacteria 3572
261 Ga0163162_10489642 3300013306 Bacteria 1361
262 Ga0157372_10000334 3300013307 Bacteria 51813
263 Ga0157372_10044203 3300013307 Bacteria 4935
264 Ga0157372_10066779 3300013307 Bacteria 4041
265 Ga0157372_10081165 3300013307 Bacteria 3670
266 Ga0157372_10173947 3300013307 Bacteria 2492
267 Ga0157372_10213378 3300013307 Bacteria 2237
268 Ga0157372_11449664 3300013307 Bacteria 791
269 Ga0163163_10000112 3300014325 Bacteria 86324
270 Ga0163163_10000585 3300014325 Bacteria 32121
271 Ga0182008_10006516 3300014497 Bacteria 6516
272 Ga0182008_10021422 3300014497 Bacteria 3318
273 Ga0182008_10036778 3300014497 Bacteria 2449
274 Ga0182008_10055909 3300014497 Bacteria 1951
275 Ga0182008_10191861 3300014497 Bacteria 1037
276 Ga0157379_10007853 3300014968 Bacteria 9242
277 Ga0157379_10482832 3300014968 Bacteria 1147
278 Ga0157376_10009210 3300014969 Bacteria 7162
279 Ga0182006_1000031 3300015261 Bacteria 240055
280 Ga0182006_1000496 3300015261 Bacteria 30592
281 Ga0182007_10003787 3300015262 Bacteria 7047
282 Ga0182007_10015105 3300015262 Bacteria 2890
283 Ga0182005_1000049 3300015265 Bacteria 123003
284 Ga0182005_1001001 3300015265 Bacteria 12121
285 Ga0182005_1002650 3300015265 Bacteria 6301
286 Ga0183368_1002 3300015687 Bacteria 1865598
287 Ga0163161_10007409 3300017792 Bacteria 7580
288 Ga0163161_10066212 3300017792 Bacteria 2638
289 Ga0206356_11026662 3300020070 Bacteria 4285
290 Ga0206356_11905763 3300020070 Bacteria 1398
291 Ga0206351_10589011 3300020077 Bacteria 1281
292 Ga0206351_10768644 3300020077 Bacteria 1101
293 Ga0206352_10871908 3300020078 Bacteria 1811
294 Ga0206350_11455286 3300020080 Bacteria 1708
295 Ga0206354_10524459 3300020081 Bacteria 4072
296 Ga0206353_10447795 3300020082 Bacteria 2783
297 Ga0206353_11143090 3300020082 Bacteria 799
298 Ga0154015_1513628 3300020610 Bacteria 2906
299 Ga0224712_10074632 3300022467 Bacteria 1386
300 Ga0224712_10128125 3300022467 Bacteria 1106
301 Ga0209760_100376 3300025207 Bacteria 11760
302 Ga0209784_100204 3300025224 Bacteria 42366
303 Ga0209566_102111 3300025225 Bacteria 4074
304 Ga0209674_100061 3300025226 Bacteria 280844
305 Ga0209674_100077 3300025226 Bacteria 206312
306 Ga0209674_100785 3300025226 Bacteria 10709
307 Ga0209674_104333 3300025226 Bacteria 2331
308 Ga0209672_100004 3300025228 Bacteria 1467504
309 Ga0209672_100022 3300025228 Bacteria 374313
310 Ga0209672_100251 3300025228 Bacteria 39907
311 Ga0209672_101130 3300025228 Bacteria 11110
312 Ga0209672_101444 3300025228 Bacteria 8507
313 Ga0209147_107974 3300025229 Bacteria 1344
314 Ga0209563_100076 3300025230 Bacteria 215269
315 Ga0207427_100111 3300025231 Bacteria 112775
316 Ga0207427_100179 3300025231 Bacteria 67665
317 Ga0207427_100185 3300025231 Bacteria 63916
318 Ga0207427_100510 3300025231 Bacteria 20592
319 Ga0209437_100099 3300025233 Bacteria 229500
320 Ga0209437_100113 3300025233 Bacteria 211240
321 Ga0209437_100320 3300025233 Bacteria 62893
322 Ga0209437_100368 3300025233 Bacteria 48548
323 Ga0209437_100782 3300025233 Bacteria 14969
324 Ga0209258_100003 3300025242 Bacteria 1467504
325 Ga0209258_100004 3300025242 Bacteria 1376422
326 Ga0209258_100119 3300025242 Bacteria 183554
327 Ga0209258_100122 3300025242 Bacteria 180314
328 Ga0209258_100137 3300025242 Bacteria 167913
329 Ga0209258_100376 3300025242 Bacteria 57517
330 Ga0209258_106897 3300025242 Bacteria 1730
331 Ga0209646_1000985 3300025246 Bacteria 8811
332 Ga0209646_1001103 3300025246 Bacteria 7995
333 Ga0209646_1003374 3300025246 Bacteria 3173
334 Ga0209646_1027599 3300025246 Bacteria 781
335 Ga0209026_1000087 3300025250 Bacteria 184044
336 Ga0209026_1000175 3300025250 Bacteria 98059
337 Ga0209026_1000274 3300025250 Bacteria 61312
338 Ga0209026_1000276 3300025250 Bacteria 60964
339 Ga0209026_1008805 3300025250 Bacteria 2059
340 Ga0209677_101477 3300025253 Bacteria 10113
341 Ga0209148_1000005 3300025254 Bacteria 1806504
342 Ga0209148_1000025 3300025254 Bacteria 663262
343 Ga0209148_1000036 3300025254 Bacteria 530505
344 Ga0209148_1000062 3300025254 Bacteria 347704
345 Ga0209148_1000083 3300025254 Bacteria 270142
346 Ga0209148_1000137 3300025254 Bacteria 168097
347 Ga0209148_1001786 3300025254 Bacteria 9177
348 Ga0209759_1000136 3300025256 Bacteria 125393
349 Ga0209759_1000320 3300025256 Bacteria 63830
350 Ga0209759_1001153 3300025256 Bacteria 16782
351 Ga0209759_1001565 3300025256 Bacteria 12489
352 Ga0209759_1048645 3300025256 Bacteria 669
353 Ga0209129_1000769 3300025258 Bacteria 20356
354 Ga0209233_1000040 3300025261 Bacteria 530395
355 Ga0209233_1000075 3300025261 Bacteria 356837
356 Ga0209233_1000128 3300025261 Bacteria 209927
357 Ga0209233_1008709 3300025261 Bacteria 3119
358 Ga0209455_1000004 3300025272 Bacteria 1467504
359 Ga0209455_1000040 3300025272 Bacteria 430197
360 Ga0209455_1000084 3300025272 Bacteria 253164
361 Ga0209455_1000095 3300025272 Bacteria 217487
362 Ga0209455_1000164 3300025272 Bacteria 114011
363 Ga0209455_1001294 3300025272 Bacteria 11681
364 Ga0209455_1007907 3300025272 Bacteria 2947
365 Ga0209758_1000301 3300025297 Bacteria 96998
366 Ga0209758_1020451 3300025297 Bacteria 3131
367 Ga0209758_1047231 3300025297 Bacteria 1543
368 Ga0207426_1016040 3300025302 Bacteria 2702
369 Ga0209051_1007151 3300025303 Bacteria 6152
370 Ga0209257_1000067 3300025304 Bacteria 342468
371 Ga0209257_1039691 3300025304 Bacteria 1412
372 Ga0207656_10007153 3300025321 Bacteria 4056
373 Ga0207656_10008269 3300025321 Bacteria 3820
374 Ga0207656_10119317 3300025321 Bacteria 1226
375 Ga0207710_10003748 3300025900 Bacteria 6728
376 Ga0207680_10000001 3300025903 Bacteria 1091453
377 Ga0207680_10000598 3300025903 Bacteria 17011
378 Ga0207680_10001902 3300025903 Bacteria 9799
379 Ga0207680_10388284 3300025903 Bacteria 985
380 Ga0207647_10000034 3300025904 Bacteria 99280
381 Ga0207647_10000262 3300025904 Bacteria 43207
382 Ga0207647_10002208 3300025904 Bacteria 14832
383 Ga0207647_10002308 3300025904 Bacteria 14534
384 Ga0207647_10012004 3300025904 Bacteria 6046
385 Ga0207647_10119619 3300025904 Bacteria 1553
386 Ga0207705_10000560 3300025909 Bacteria 31207
387 Ga0207705_10006860 3300025909 Bacteria 8417
388 Ga0207705_10037183 3300025909 Bacteria 3483
389 Ga0207705_10112632 3300025909 Bacteria 2012
390 Ga0207705_10678893 3300025909 Bacteria 801
391 Ga0207654_10000719 3300025911 Bacteria 18479
392 Ga0207654_10005416 3300025911 Bacteria 6455
393 Ga0207654_10213287 3300025911 Bacteria 1277
394 Ga0207654_10494947 3300025911 Bacteria 863
395 Ga0207707_10000064 3300025912 Bacteria 107490
396 Ga0207707_10006038 3300025912 Bacteria 10596
397 Ga0207707_10006315 3300025912 Bacteria 10349
398 Ga0207707_10029371 3300025912 Bacteria 4806
399 Ga0207707_10094005 3300025912 Bacteria 2619
400 Ga0207695_10000588 3300025913 Bacteria 73260
401 Ga0207695_10001221 3300025913 Bacteria 44045
402 Ga0207695_10001320 3300025913 Bacteria 42048
403 Ga0207695_10002529 3300025913 Bacteria 26858
404 Ga0207695_10003607 3300025913 Bacteria 21652
405 Ga0207695_10004205 3300025913 Bacteria 19775
406 Ga0207695_10027716 3300025913 Bacteria 6304
407 Ga0207695_10056422 3300025913 Bacteria 4087
408 Ga0207695_10103753 3300025913 Bacteria 2834
409 Ga0207695_10123193 3300025913 Bacteria 2558
410 Ga0207695_10176528 3300025913 Bacteria 2058
411 Ga0207695_10544900 3300025913 Bacteria 1042
412 Ga0207671_10000011 3300025914 Bacteria 530349
413 Ga0207671_10012799 3300025914 Bacteria 6724
414 Ga0207671_10013618 3300025914 Bacteria 6470
415 Ga0207671_10094240 3300025914 Bacteria 2260
416 Ga0207663_10040939 3300025916 Bacteria 2820
417 Ga0207660_10001372 3300025917 Bacteria 16322
418 Ga0207660_10001813 3300025917 Bacteria 14233
419 Ga0207660_10003444 3300025917 Bacteria 10324
420 Ga0207660_10135796 3300025917 Bacteria 1877
421 Ga0207657_10002836 3300025919 Bacteria 18613
422 Ga0207657_10029335 3300025919 Bacteria 5010
423 Ga0207657_10029430 3300025919 Bacteria 5000
424 Ga0207649_10001382 3300025920 Bacteria 14383
425 Ga0207649_10006569 3300025920 Bacteria 6318
426 Ga0207649_10006704 3300025920 Bacteria 6258
427 Ga0207649_10010845 3300025920 Bacteria 5009
428 Ga0207649_10249805 3300025920 Bacteria 1277
429 Ga0207649_10811832 3300025920 Bacteria 730
430 Ga0207652_10000019 3300025921 Bacteria 164416
431 Ga0207652_10000801 3300025921 Bacteria 30036
432 Ga0207652_10008959 3300025921 Bacteria 8065
433 Ga0207652_10148733 3300025921 Bacteria 2096
434 Ga0207652_10333672 3300025921 Bacteria 1369
435 Ga0207681_10897705 3300025923 Bacteria 742
436 Ga0207694_10000654 3300025924 Bacteria 31284
437 Ga0207694_10001428 3300025924 Bacteria 20477
438 Ga0207694_10001879 3300025924 Bacteria 17407
439 Ga0207694_10048048 3300025924 Bacteria 3301
440 Ga0207694_10147134 3300025924 Bacteria 1896
441 Ga0207694_10520874 3300025924 Bacteria 996
442 Ga0207694_10613577 3300025924 Bacteria 915
443 Ga0207650_10006245 3300025925 Bacteria 8118
444 Ga0207650_10230356 3300025925 Bacteria 1494
445 Ga0207687_10218969 3300025927 Bacteria 1498
446 Ga0207700_10023119 3300025928 Bacteria 4279
447 Ga0207644_10735062 3300025931 Bacteria 824
448 Ga0207690_10011845 3300025932 Bacteria 5214
449 Ga0207690_10068857 3300025932 Bacteria 2433
450 Ga0207706_10004869 3300025933 Bacteria 12569
451 Ga0207706_10133414 3300025933 Bacteria 2184
452 Ga0207706_10408337 3300025933 Bacteria 1177
453 Ga0207704_10841111 3300025938 Bacteria 769
454 Ga0207711_10001918 3300025941 Bacteria 18898
455 Ga0207661_10036981 3300025944 Bacteria 3814
456 Ga0207661_10448781 3300025944 Bacteria 1174
457 Ga0207679_10054898 3300025945 Bacteria 2935
458 Ga0207679_11742349 3300025945 Bacteria 570
459 Ga0207667_10000219 3300025949 Bacteria 80218
460 Ga0207667_10000446 3300025949 Bacteria 55443
461 Ga0207667_10000574 3300025949 Bacteria 48011
462 Ga0207667_10002469 3300025949 Bacteria 23071
463 Ga0207667_10007024 3300025949 Bacteria 13600
464 Ga0207667_10121219 3300025949 Bacteria 2694
465 Ga0207667_10204493 3300025949 Bacteria 2025
466 Ga0207712_10000140 3300025961 Bacteria 76381
467 Ga0207712_10000395 3300025961 Bacteria 37905
468 Ga0207668_10019465 3300025972 Bacteria 4293
469 Ga0207640_10000280 3300025981 Bacteria 34294
470 Ga0207640_10000495 3300025981 Bacteria 24008
471 Ga0207640_10001128 3300025981 Bacteria 14684
472 Ga0207640_10037290 3300025981 Bacteria 3057
473 Ga0207640_10322638 3300025981 Bacteria 1230
474 Ga0207658_10000997 3300025986 Bacteria 23236
475 Ga0207658_10093031 3300025986 Bacteria 2343
476 Ga0207658_10213853 3300025986 Bacteria 1617
477 Ga0207658_10302291 3300025986 Bacteria 1379
478 Ga0207677_10088491 3300026023 Bacteria 2245
479 Ga0207703_10000766 3300026035 Bacteria 31634
480 Ga0207703_10263265 3300026035 Bacteria 1559
481 Ga0207703_10337519 3300026035 Bacteria 1384
482 Ga0207703_10415415 3300026035 Bacteria 1251
483 Ga0207639_10000277 3300026041 Bacteria 36931
484 Ga0207639_10002487 3300026041 Bacteria 12350
485 Ga0207639_10007555 3300026041 Bacteria 7414
486 Ga0207639_10049181 3300026041 Bacteria 3195
487 Ga0207639_10441995 3300026041 Bacteria 1179
488 Ga0207639_10642877 3300026041 Bacteria 981
489 Ga0207639_11168568 3300026041 Bacteria 722
490 Ga0207639_11200587 3300026041 Bacteria 712
491 Ga0207678_10002665 3300026067 Bacteria 16207
492 Ga0207678_10016613 3300026067 Bacteria 6466
493 Ga0207678_10018779 3300026067 Bacteria 6073
494 Ga0207678_10026967 3300026067 Bacteria 5010
495 Ga0207678_10027074 3300026067 Bacteria 5000
496 Ga0207678_10040297 3300026067 Bacteria 4052
497 Ga0207678_10106813 3300026067 Bacteria 2388
498 Ga0207678_10345286 3300026067 Bacteria 1283
499 Ga0207702_10000132 3300026078 Bacteria 88794
500 Ga0207702_10000338 3300026078 Bacteria 53744
501 Ga0207702_10013397 3300026078 Bacteria 6820
502 Ga0207702_10054245 3300026078 Bacteria 3396
503 Ga0207702_10439479 3300026078 Bacteria 1264
504 Ga0207702_11206364 3300026078 Bacteria 751
505 Ga0207641_10025217 3300026088 Bacteria 4903
506 Ga0207641_10376307 3300026088 Bacteria 1359
507 Ga0207648_10016027 3300026089 Bacteria 6867
508 Ga0207648_10948227 3300026089 Bacteria 805
509 Ga0207648_11103243 3300026089 Bacteria 744
510 Ga0207676_10038682 3300026095 Bacteria 3643
511 Ga0207674_10001145 3300026116 Bacteria 34394
512 Ga0207674_10002886 3300026116 Bacteria 21357
513 Ga0207674_10039493 3300026116 Bacteria 4891
514 Ga0207674_10046326 3300026116 Bacteria 4465
515 Ga0207674_10047098 3300026116 Bacteria 4423
516 Ga0207674_10375402 3300026116 Bacteria 1374
517 Ga0207683_10394289 3300026121 Bacteria 1273
518 Ga0207698_10000491 3300026142 Bacteria 23071
519 Ga0207698_10006628 3300026142 Bacteria 7246
520 Ga0207698_10021688 3300026142 Bacteria 4449
521 Ga0207698_12006094 3300026142 Bacteria 593
522 Ga0268266_10000008 3300028379 Bacteria 1161875
523 Ga0268266_10000075 3300028379 Bacteria 218045
524 Ga0268265_10461712 3300028380 Bacteria 1188
525 Ga0268265_11863648 3300028380 Bacteria 608
526 Ga0268264_10003031 3300028381 Bacteria 14566
527 Ga0268264_10079343 3300028381 Bacteria 2800
528 Ga0268264_10386309 3300028381 Bacteria 1342
529 Ga0268264_10535999 3300028381 Bacteria 1146
530 Ga0307509_10399468 3300031507 Bacteria 1082
531 Ga0307508_10226554 3300031616 Bacteria 1468
532 Ga0316575_10029237 3300031665 Bacteria 2151
533 Ga0307413_10477018 3300031824 Bacteria 996
534 Ga0307412_10043615 3300031911 Bacteria 2921
535 Ga0307412_11252999 3300031911 Bacteria 666
536 Ga0307416_100132487 3300032002 Bacteria 2247
537 Ga0307416_100286179 3300032002 Bacteria 1629
538 Ga0307414_10094121 3300032004 Bacteria 2235
539 Ga0307414_10423568 3300032004 Bacteria 1161
540 Ga0307411_10051057 3300032005 Bacteria 2697
541 Ga0307411_10259112 3300032005 Bacteria 1372
542 Ga0307411_11110105 3300032005 Bacteria 713
543 Ga0307415_100782597 3300032126 Bacteria 869
544 Ga0307507_10102026 3300033179 Bacteria 2396
545 Ga0307507_10374266 3300033179 Bacteria 824
546 Ga0395899_0000110 3300037312 Bacteria 140811
547 Ga0395899_0001023 3300037312 Bacteria 25559
548 Ga0395899_0034712 3300037312 Bacteria 3788
549 Ga0395900_0000049 3300037418 Bacteria 226847
550 Ga0395900_0000060 3300037418 Bacteria 205509
551 Ga0395900_0102529 3300037418 Bacteria 2939
552 Ga0395900_0471806 3300037418 Bacteria 1208
553 Ga0395898_0000023 3300037466 Bacteria 379477
554 Ga0395898_0000237 3300037466 Bacteria 139991
555 Ga0395898_0018522 3300037466 Bacteria 7096
556 Ga0395898_0097752 3300037466 Bacteria 2819
557 Ga0395901_0117942 3300038443 Bacteria 2789
558 Ga0395901_0206518 3300038443 Bacteria 2057
559 Ga0395901_0371738 3300038443 Bacteria 1472
560 Ga0439436_0000032 3300041404 Bacteria 46437
561 Ga0439465_0000530 3300041413 Bacteria 11438
562 Ga0451789_0811766 3300041443 Bacteria 718
563 Ga0451793_1777967 3300041452 Bacteria 4636
564 Ga0451797_0113713 3300041453 Bacteria 1161
565 Ga0451797_1444144 3300041453 Bacteria 762
566 Ga0451795_0322423 3300041456 Bacteria 925
567 Ga0451795_0773849 3300041456 Bacteria 968
568 Ga0451802_0035022 3300041460 Bacteria 824
569 Ga0451806_671699 3300041462 Bacteria 693
570 Ga0451841_0241459 3300041498 Bacteria 1262
571 Ga0450908_000007 3300042184 Bacteria 55488
572 Ga0439459_0061077 3300042438 Bacteria 852
573 Ga0451577_0176764 3300042876 Bacteria 1924
574 Ga0466969_0038934 3300044656 Bacteria 2390
575 Ga0466969_0088821 3300044656 Bacteria 1467
576 Ga0466972_0038589 3300044658 Bacteria 2332
577 Ga0466976_0347589 3300044662 Bacteria 819
578 Ga0466989_0163097 3300044663 Bacteria 1337
579 Ga0466982_0000018 3300044672 Bacteria 113912
580 Ga0466982_0000096 3300044672 Bacteria 21532
581 Ga0466965_0150407 3300044683 Bacteria 1216
582 Ga0466966_0008293 3300044684 Bacteria 6887
583 Ga0466966_0041964 3300044684 Bacteria 2938
584 Ga0466966_0181364 3300044684 Bacteria 1277
585 Ga0466961_0001486 3300044693 Bacteria 14566
586 Ga0466961_0002537 3300044693 Bacteria 11321
587 Ga0466961_0003674 3300044693 Bacteria 9567
588 Ga0466961_0003935 3300044693 Bacteria 9288
589 Ga0466961_0012833 3300044693 Bacteria 5361
590 Ga0466963_0207098 3300044694 Bacteria 1372
591 Ga0466963_0695281 3300044694 Bacteria 718
592 Ga0466964_0001814 3300044706 Bacteria 7433
593 Ga0466964_0025129 3300044706 Bacteria 2325
594 Ga0453684_0000316 3300044712 Bacteria 204457
595 Ga0466971_0001777 3300044719 Bacteria 9148
596 Ga0466971_0015305 3300044719 Bacteria 3375
597 Ga0466971_0015318 3300044719 Bacteria 3373
598 Ga0466971_0111559 3300044719 Bacteria 1262
599 Ga0466968_0001797 3300044735 Bacteria 7743
600 Ga0466968_0012411 3300044735 Bacteria 3335
601 Ga0466970_0004514 3300044765 Bacteria 6867
602 Ga0466970_0019296 3300044765 Bacteria 3533
603 Ga0466957_0002919 3300044842 Bacteria 9262
604 Ga0466957_0039575 3300044842 Bacteria 2844
605 Ga0466957_0133691 3300044842 Bacteria 1592
606 Ga0466957_0251608 3300044842 Bacteria 1175
607 Ga0466957_0643964 3300044842 Bacteria 745
608 Ga0466960_0023732 3300044901 Bacteria 2757
609 Ga0466959_0005091 3300045049 Bacteria 8940
610 Ga0466959_0320532 3300045049 Bacteria 1059
611 Ga0451576_0000128 3300045051 Bacteria 192071
612 Ga0466958_0016421 3300045836 Bacteria 4263
613 Ga0466958_0025788 3300045836 Bacteria 3469
614 Ga0466958_0032951 3300045836 Bacteria 3085
615 Ga0466958_0293822 3300045836 Bacteria 1042
616 Ga0466967_0318912 3300045976 Bacteria 1498
617 Ga0495617_000607 3300046452 Bacteria 18027
618 Ga0495617_001095 3300046452 Bacteria 12313
619 Ga0495638_0000019 3300046460 Bacteria 384671
620 Ga0495638_0000406 3300046460 Bacteria 52627
621 Ga0495638_0000452 3300046460 Bacteria 49237
622 Ga0495638_0001628 3300046460 Bacteria 19981
623 Ga0495650_0000350 3300046471 Bacteria 81541
624 Ga0495650_0000466 3300046471 Bacteria 62626
625 Ga0495650_0000869 3300046471 Bacteria 35923
626 Ga0495605_0126429 3300046474 Bacteria 1156
627 Ga0495584_0001662 3300046491 Bacteria 13072
628 Ga0495585_0001138 3300046492 Bacteria 21797
629 Ga0495585_0040927 3300046492 Bacteria 2600
630 Ga0495607_0000133 3300046501 Bacteria 78789
631 Ga0495607_0001577 3300046501 Bacteria 19905
632 Ga0495607_0007528 3300046501 Bacteria 7519
633 Ga0495583_0011255 3300046506 Bacteria 5149
634 Ga0495606_0000016 3300046507 Bacteria 284865
635 Ga0495606_0000160 3300046507 Bacteria 118218
636 Ga0495606_0001918 3300046507 Bacteria 25850
637 Ga0495606_0002253 3300046507 Bacteria 22923
638 Ga0495606_0234825 3300046507 Bacteria 1025
639 Ga0495606_0269383 3300046507 Bacteria 936
640 Ga0495610_0004501 3300046512 Bacteria 10271
641 Ga0495610_0029998 3300046512 Bacteria 2855
642 Ga0495616_0000006 3300046513 Bacteria 234766
643 Ga0495616_0047917 3300046513 Bacteria 2149
644 Ga0495620_0000711 3300046515 Bacteria 20541
645 Ga0495620_0097744 3300046515 Bacteria 1172
646 Ga0495631_0000036 3300046518 Bacteria 81635
647 Ga0495631_0000318 3300046518 Bacteria 33436
648 Ga0495632_0000010 3300046519 Bacteria 272360
649 Ga0495632_0012658 3300046519 Bacteria 4852
650 Ga0495632_0054517 3300046519 Bacteria 1960
651 Ga0495637_0007175 3300046520 Bacteria 5547
652 Ga0495643_0177310 3300046522 Bacteria 1038
653 Ga0495648_0000881 3300046524 Bacteria 31575
654 Ga0495609_0149052 3300046538 Bacteria 995
655 Ga0495622_0020164 3300046557 Bacteria 3105
656 Ga0495622_0251985 3300046557 Bacteria 776
657 Ga0495668_0005730 3300046616 Bacteria 8306
658 Ga0495611_0000003 3300046648 Bacteria 395679
659 Ga0495611_0000028 3300046648 Bacteria 116155
660 Ga0495625_0000193 3300046660 Bacteria 97042
661 Ga0495625_0006388 3300046660 Bacteria 10509
662 Ga0495625_0015849 3300046660 Bacteria 5949
663 Ga0495625_0048981 3300046660 Bacteria 3038
664 Ga0495625_0090097 3300046660 Bacteria 2122
665 Ga0495661_0001277 3300046665 Bacteria 21603
666 Ga0495670_0000413 3300046691 Bacteria 20501
667 Ga0495670_0013548 3300046691 Bacteria 4010
668 Ga0495670_0026664 3300046691 Bacteria 2860
669 Ga0495671_0000142 3300046692 Bacteria 63300
670 Ga0495649_0009358 3300046694 Bacteria 5830
671 Ga0495649_0023421 3300046694 Bacteria 3450
672 Ga0495589_0000042 3300046794 Bacteria 138627
673 Ga0495660_0004438 3300046810 Bacteria 8484
674 Ga0495660_0010465 3300046810 Bacteria 5394
675 Ga0495683_0000722 3300047323 Bacteria 24066
676 Ga0495679_000046 3300047446 Bacteria 132566
677 Ga0495673_0000004 3300047469 Bacteria 1354526
678 Ga0495673_0000041 3300047469 Bacteria 296723
679 Ga0495673_0004939 3300047469 Bacteria 8207
680 Ga0495681_0111495 3300047470 Bacteria 1184
681 Ga0495686_0000117 3300047472 Bacteria 166073
682 Ga0495686_0000229 3300047472 Bacteria 103283
683 Ga0495686_0002823 3300047472 Bacteria 15713
684 Ga0495686_0007664 3300047472 Bacteria 8057
685 Ga0495686_0011281 3300047472 Bacteria 6299
686 Ga0495686_0023910 3300047472 Bacteria 4019
687 Ga0496100_0090442 3300048903 Bacteria 2087
688 Ga0496101_0004110 3300048904 Bacteria 9109
689 Ga0496102_0197553 3300048905 Bacteria 1896
690 Ga0496102_0413565 3300048905 Bacteria 1267
691 Ga0496103_0026448 3300048906 Bacteria 3513
692 Ga0496104_0031058 3300048907 Bacteria 4966
693 Ga0496104_0194060 3300048907 Bacteria 1943
694 Ga0496105_0042555 3300048908 Bacteria 3744
695 Ga0496106_0001877 3300048909 Bacteria 15732
696 Ga0496106_0199612 3300048909 Bacteria 1592
697 Ga0496107_0092139 3300048910 Bacteria 2215
698 Ga0496108_0260772 3300048911 Bacteria 1508
699 Ga0496113_0011788 3300048916 Bacteria 5854
700 Ga0496114_0067958 3300048917 Bacteria 2991
701 Ga0496115_0000196 3300048918 Bacteria 56608
702 Ga0496115_0000440 3300048918 Bacteria 33623
703 Ga0496115_0032843 3300048918 Bacteria 4096
704 Ga0496115_0214530 3300048918 Bacteria 1589
705 Ga0496115_0733924 3300048918 Bacteria 774
706 Ga0496116_0042941 3300048919 Bacteria 3084
707 Ga0496116_0077088 3300048919 Bacteria 2085
708 Ga0496116_0086439 3300048919 Bacteria 1924
709 Ga0496116_0190880 3300048919 Bacteria 1084
710 Ga0496117_0023133 3300048920 Bacteria 4963
711 Ga0496117_0029156 3300048920 Bacteria 4259
712 Ga0496117_0030912 3300048920 Bacteria 4099
713 Ga0496117_0103448 3300048920 Bacteria 1795
714 Ga0496117_0309500 3300048920 Bacteria 832
715 Ga0496118_0001472 3300048921 Bacteria 35272
716 Ga0496118_0002903 3300048921 Bacteria 22296
717 Ga0496118_0005217 3300048921 Bacteria 14858
718 Ga0496118_0006396 3300048921 Bacteria 12971
719 Ga0496118_0008697 3300048921 Bacteria 10434
720 Ga0496118_0087591 3300048921 Bacteria 2159
721 Ga0496118_0222566 3300048921 Bacteria 1097
722 Ga0496118_0420987 3300048921 Bacteria 687
723 Ga0496119_0000201 3300048922 Bacteria 84438
724 Ga0496119_0005372 3300048922 Bacteria 12317
725 Ga0496119_0018397 3300048922 Bacteria 5202
726 Ga0496120_0000189 3300048923 Bacteria 105313
727 Ga0496120_0000837 3300048923 Bacteria 43826
728 Ga0496121_0000419 3300048924 Bacteria 84137
729 Ga0496121_0000771 3300048924 Bacteria 58811
730 Ga0496121_0001298 3300048924 Bacteria 42922
731 Ga0496121_0003299 3300048924 Bacteria 23175
732 Ga0496121_0014080 3300048924 Bacteria 8531
733 Ga0496121_0032700 3300048924 Bacteria 4722
734 Ga0496121_0051673 3300048924 Bacteria 3459
735 Ga0496121_0064333 3300048924 Bacteria 2991
736 Ga0496121_0071241 3300048924 Bacteria 2796
737 Ga0496121_0363267 3300048924 Bacteria 960
738 Ga0496121_0401542 3300048924 Bacteria 897
739 Ga0496121_0630530 3300048924 Bacteria 656
740 Ga0496122_0001358 3300048925 Bacteria 39854
741 Ga0496122_0007321 3300048925 Bacteria 12323
742 Ga0496122_0019348 3300048925 Bacteria 6224
743 Ga0496122_0082530 3300048925 Bacteria 2232
744 Ga0496122_0116918 3300048925 Bacteria 1733
745 Ga0496123_0004282 3300048926 Bacteria 15181
746 Ga0496123_0004978 3300048926 Bacteria 13609
747 Ga0496123_0009820 3300048926 Bacteria 8547
748 Ga0496123_0042437 3300048926 Bacteria 3139
749 Ga0496123_0096190 3300048926 Bacteria 1739
750 Ga0496124_0000203 3300048927 Bacteria 117239
751 Ga0496124_0001473 3300048927 Bacteria 34592
752 Ga0496124_0109481 3300048927 Bacteria 2226
753 Ga0496125_0001450 3300048928 Bacteria 34494
754 Ga0496125_0008488 3300048928 Bacteria 10750
755 Ga0496125_0027584 3300048928 Bacteria 5146
756 Ga0496125_0152162 3300048928 Bacteria 1587
757 Ga0496126_0001528 3300048929 Bacteria 35621
758 Ga0496126_0009745 3300048929 Bacteria 10172
759 Ga0496126_0016296 3300048929 Bacteria 7438
760 Ga0496126_0052949 3300048929 Bacteria 3685
761 Ga0496126_0062906 3300048929 Bacteria 3328
762 Ga0496126_0070126 3300048929 Bacteria 3123
763 Ga0496126_0073413 3300048929 Bacteria 3041
764 Ga0496126_0319947 3300048929 Bacteria 1275
765 Ga0496126_0442509 3300048929 Bacteria 1047
766 Ga0495678_000066 3300049459 Bacteria 133706
767 Ga0495678_015033 3300049459 Bacteria 3577
768 Ga0495682_0003108 3300049460 Bacteria 7515
769 Ga0495682_0026021 3300049460 Bacteria 2175
770 Ga0495682_0095429 3300049460 Bacteria 1067
771 Ga0501032_0060536 3300049569 Bacteria 2539
772 Ga0501033_0019511 3300049570 Bacteria 5125
773 Ga0501033_0284121 3300049570 Bacteria 1168
774 Ga0501034_0006620 3300049571 Bacteria 12432
775 Ga0501034_0758834 3300049571 Bacteria 865
776 Ga0501036_0394918 3300049572 Bacteria 1154
777 Ga0501037_0018053 3300049573 Bacteria 5196
778 Ga0501037_0152969 3300049573 Bacteria 1648
779 Ga0501038_0015538 3300049574 Bacteria 6920
780 Ga0501038_0418817 3300049574 Bacteria 1034
781 Ga0501039_0120244 3300049575 Bacteria 2058
782 Ga0501039_0358639 3300049575 Bacteria 1145
783 Ga0501043_0022946 3300049579 Bacteria 4893
784 Ga0501043_0031501 3300049579 Bacteria 4169
785 Ga0501043_0086842 3300049579 Bacteria 2458
786 Ga0501043_0196194 3300049579 Bacteria 1568
787 Ga0501043_0255343 3300049579 Bacteria 1349
788 Ga0501046_0008054 3300049580 Bacteria 9209
789 Ga0501046_0200343 3300049580 Bacteria 1485
790 Ga0501046_0234302 3300049580 Bacteria 1355
791 Ga0501047_0002093 3300049581 Bacteria 19094
792 Ga0501047_0003063 3300049581 Bacteria 15848
793 Ga0501047_0045093 3300049581 Bacteria 4262
794 Ga0501047_0059989 3300049581 Bacteria 3672
795 Ga0501047_0060899 3300049581 Bacteria 3641
796 Ga0501047_0140733 3300049581 Bacteria 2291
797 Ga0501048_0065527 3300049582 Bacteria 2568
798 Ga0501048_0111141 3300049582 Bacteria 1935
799 Ga0501067_0000583 3300049583 Bacteria 19798
800 Ga0501068_0184873 3300049584 Bacteria 1318
801 Ga0501069_0001862 3300049585 Bacteria 10542
802 Ga0501069_0002178 3300049585 Bacteria 9867
803 Ga0501069_0026323 3300049585 Bacteria 3184
804 Ga0501069_0066946 3300049585 Bacteria 2009
805 Ga0501069_0113071 3300049585 Bacteria 1547
806 Ga0501070_0004139 3300049586 Bacteria 12490
807 Ga0501070_0004257 3300049586 Bacteria 12303
808 Ga0501070_0061919 3300049586 Bacteria 3099
809 Ga0501070_0066254 3300049586 Bacteria 2990
810 Ga0501070_0146981 3300049586 Bacteria 1945
811 Ga0501070_0458335 3300049586 Bacteria 1027
812 Ga0501071_0008797 3300049587 Bacteria 6689
813 Ga0501072_0002507 3300049588 Bacteria 13756
814 Ga0501072_0143661 3300049588 Bacteria 1903
815 Ga0501073_0008095 3300049589 Bacteria 7799
816 Ga0501073_0015945 3300049589 Bacteria 5445
817 Ga0501073_0159283 3300049589 Bacteria 1564
818 Ga0501073_0209089 3300049589 Bacteria 1348
819 Ga0501073_0284279 3300049589 Bacteria 1141
820 Ga0501074_0003986 3300049590 Bacteria 10524
821 Ga0501074_0005938 3300049590 Bacteria 8802
822 Ga0501074_0025883 3300049590 Bacteria 4257
823 Ga0501074_0062333 3300049590 Bacteria 2685
824 Ga0501074_0065446 3300049590 Bacteria 2616
825 Ga0501074_1063612 3300049590 Bacteria 568
826 Ga0501079_0026319 3300049741 Bacteria 4461
827 Ga0501079_0173661 3300049741 Bacteria 1680
828 Ga0501079_0618568 3300049741 Bacteria 852
829 Ga0501080_0000256 3300049742 Bacteria 40148
830 Ga0501080_0001893 3300049742 Bacteria 18018
831 Ga0501080_0003974 3300049742 Bacteria 13094
832 Ga0501080_0016829 3300049742 Bacteria 6753
833 Ga0501080_0097338 3300049742 Bacteria 2732
834 Ga0501083_0001929 3300049744 Bacteria 14264
835 Ga0501035_0030885 3300049822 Bacteria 4880
836 Ga0501035_0073546 3300049822 Bacteria 3024
837 Ga0501035_0084441 3300049822 Bacteria 2800
838 Ga0501035_0121763 3300049822 Bacteria 2280
839 Ga0501035_0540457 3300049822 Bacteria 955
840 Ga0501044_0003272 3300049823 Bacteria 18232
841 Ga0501044_0007113 3300049823 Bacteria 12307
842 Ga0501044_0014551 3300049823 Bacteria 8488
843 Ga0501044_0114409 3300049823 Bacteria 2704
844 Ga0501044_0205065 3300049823 Bacteria 1928
845 Ga0501044_0296891 3300049823 Bacteria 1545
846 Ga0501044_1283098 3300049823 Bacteria 599
847 nmdc:mga0sz30_92625_c1 3300050516 Bacteria 1316
848 Ga0500643_000036 3300053087 Bacteria 183253
849 Ga0500643_008323 3300053087 Bacteria 4082
850 Ga0500555_001310 3300053103 Bacteria 7858
851 Ga0500597_000016 3300053120 Bacteria 38903
852 Ga0500652_190098 3300053131 Bacteria 837
853 Ga0500633_0001664 3300053160 Bacteria 4305
854 Ga0500645_000639 3300053730 Bacteria 22272
855 Ga0501084_0291415 3300054114 Bacteria 1379
856 Ga0501082_0201301 3300060353 Bacteria 1732
857 Ga0501082_0287069 3300060353 Bacteria 1432
858 Ga0466962_0000272 3300061719 Bacteria 21817
859 Ga0466962_0011816 3300061719 Bacteria 4203
860 Ga0466962_0037551 3300061719 Bacteria 2319
861 Ga0466962_0222261 3300061719 Bacteria 925
862 Ga0466962_0601888 3300061719 Bacteria 560
863 2525558158 2524614729 Bacteria 3091755
864 2538835162 2537561836 Bacteria 3910579
865 2595447961 2593339238 Bacteria 4182970
866 2630649961 2627854209 Bacteria 3093011
867 2643829356 2643221562 Bacteria 4048635
868 2721026089 2718218334 Bacteria 4765486
869 2735833943 2734482264 Unclassified 5014763
870 2739229746 2738543009 Bacteria 4944499
871 2739729927 2739367700 Bacteria 4747630
872 2819565567 2818991440 Bacteria 4774720
873 2842918672 2842914999 Bacteria 4419378
874 2842922143 2842918807 Bacteria 4289178
875 2884341934 2884338543 Bacteria 4610696
876 2884413030 2884411467 Bacteria 5246714
877 2895397305 2895395659 Bacteria 3983269
878 2904466059 2904463128 Bacteria 4775606
879 2919087322 2919085039 Bacteria 4532964
880 2919406554 2919404418 Bacteria 4232372
881 2928965885 2928963466 Bacteria 5165703
882 2941474340 2941471342 Bacteria 5018624
883 2953997261 2953994433 Bacteria 4303959
884 Ga0501044_0007419
885 JGI24736J21556_1039259
886 JGI24741J21665_1002334
887 JGI24741J21665_1002712
888 JGI24740J21852_10000701
889 JGI24739J22299_10009804
890 JGI24737J22298_10026518
891 JGI24737J22298_10081336
892 JGI24735J21928_10004013
893 JGI24735J21928_10014324
894 JGI24735J21928_10201559
895 JGI24738J21930_10015494
896 JGI25162J39368_1001457
897 JGI25162J39368_1002014
898 JGI25162J39368_1004214
899 JGI25162J39368_1010547
900 JGI25154J39366_1007917
901 JGI25154J39366_1008133
902 JGI25154J39366_1014669
903 JGI25157J39369_1000224
904 JGI25157J39369_1001100
905 JGI25157J39369_1002245
906 JGI25157J39369_1003667
907 JGI25157J39369_1008184
908 JGI25157J39369_1021350
909 JGI25163J39215_1001252
910 JGI25164J39214_1000164
911 JGI25164J39214_1002054
912 JGI25164J39214_1006974
913 JGI25165J46597_1000317
914 JGI25165J46597_1001472
915 JGI25165J46597_1012862
916 JGI25165J46597_1030791
917 JGI25153J46596_10018510
918 rootH2_10011924
919 Ga0006554J51385_1041028
920 Ga0006562J51391_1031326
921 Ga0006562J51391_1042664
922 Ga0006562J51391_1042669
923 Ga0055533_1002210
924 Ga0055533_1005210
925 Ga0055533_1006131
926 Ga0055525_1000055
927 Ga0055527_1000116
928 Ga0055527_1000210
929 Ga0055535_1000296
930 Ga0055535_1000454
931 Ga0055535_1001071
932 Ga0055535_1001444
933 Ga0055535_1002833
934 Ga0055542_1000056
935 Ga0055542_1000263
936 Ga0055542_1000277
937 Ga0055542_1000468
938 Ga0055542_1000620
939 Ga0055542_1004324
940 Ga0055542_1028233
941 Ga0055529_1000253
942 Ga0055529_1000298
943 Ga0055529_1000479
944 Ga0055529_1001107
945 Ga0055529_1003276
946 Ga0055543_1007681
947 Ga0065165_1000108
948 Ga0065165_1005855
949 Ga0070658_10001565
950 Ga0070658_10118601
951 Ga0070658_10523744
952 Ga0070658_10550404
953 Ga0070658_10614628
954 Ga0070683_100127162
955 Ga0070683_100142437
956 Ga0070683_100174384
957 Ga0070690_100202766
958 Ga0070690_100345793
959 Ga0070670_100009171
960 Ga0070670_100265733
961 Ga0070666_10000037
962 Ga0070666_10000487
963 Ga0070666_10007269
964 Ga0070680_100097990
965 Ga0070680_100460938
966 Ga0070682_100176722
967 Ga0068868_100058111
968 Ga0070660_100247365
969 Ga0070660_100373620
970 Ga0070660_100648008
971 Ga0070691_10032937
972 Ga0070691_10533427
973 Ga0070661_100007367
974 Ga0070661_100010149
975 Ga0070661_100014442
976 Ga0070661_100108677
977 Ga0070661_100134943
978 Ga0070661_100239179
979 Ga0070661_100298248
980 Ga0070692_10037193
981 Ga0070692_10105382
982 Ga0070668_100097591
983 Ga0070671_100415382
984 Ga0070688_100128609
985 Ga0070659_100058492
986 Ga0070667_100000072
987 Ga0070667_100016061
988 Ga0070667_100131582
989 Ga0070667_100244360
990 Ga0070667_100591501
991 Ga0070714_100096930
992 Ga0070713_100123179
993 Ga0070711_100332269
994 Ga0070708_100946346
995 Ga0070663_100005396
996 Ga0070663_100028573
997 Ga0070663_100039684
998 Ga0070663_100072087
999 Ga0070663_100110496
1000 Ga0070663_100287078
1001 Ga0070663_100372822
1002 Ga0070663_100649466
1003 Ga0070663_100789579
1004 Ga0070663_100868267
1005 Ga0070678_100362546
1006 Ga0070681_10000151
1007 Ga0070681_10037306
1008 Ga0070681_10125600
1009 Ga0070681_10128599
1010 Ga0068867_100045587
1011 Ga0068867_101105138
1012 Ga0070685_10014858
1013 Ga0070699_100485645
1014 Ga0070679_100000250
1015 Ga0070679_100055321
1016 Ga0070684_100089335
1017 Ga0070684_100131098
1018 Ga0070684_100288459
1019 Ga0068853_100006694
1020 Ga0068853_100016337
1021 Ga0068853_100016385
1022 Ga0068853_100035262
1023 Ga0068853_100053738
1024 Ga0068853_100241308
1025 Ga0068853_100265685
1026 Ga0068853_101179716
1027 Ga0068853_101225682
1028 Ga0070696_100007583
1029 Ga0070696_100031485
1030 Ga0070665_100000376
1031 Ga0070665_100010663
1032 Ga0068855_100010660
1033 Ga0068855_100122173
1034 Ga0068855_100212437
1035 Ga0070664_100128266
1036 Ga0068857_100013283
1037 Ga0068857_100038503
1038 Ga0068857_100050500
1039 Ga0068857_100061409
1040 Ga0068857_100226826
1041 Ga0068854_100003612
1042 Ga0068854_100113799
1043 Ga0068854_100123359
1044 Ga0068854_100429121
1045 Ga0068856_100007396
1046 Ga0068856_100012219
1047 Ga0068856_100169157
1048 Ga0068856_100319989
1049 Ga0068852_100006036
1050 Ga0068852_100034585
1051 Ga0068852_100042035
1052 Ga0068852_100073648
1053 Ga0068852_100169580
1054 Ga0068852_100178626
1055 Ga0068852_100235707
1056 Ga0068859_100324564
1057 Ga0068859_101521946
1058 Ga0068864_100004209
1059 Ga0068851_10000908
1060 Ga0068851_10010761
1061 Ga0068851_10019388
1062 Ga0068851_10196718
1063 Ga0068863_100006254
1064 Ga0068863_100556207
1065 Ga0068863_100981392
1066 Ga0068858_100000817
1067 Ga0068858_100074088
1068 Ga0068858_100242140
1069 Ga0068858_100630593
1070 Ga0068858_100733808
1071 Ga0068860_100017401
1072 Ga0068860_100066993
1073 Ga0068860_100265669
1074 Ga0068860_100270877
1075 Ga0068862_100176956
1076 Ga0068862_100646975
1077 Ga0075369_10064511
1078 Ga0097621_100324094
1079 Ga0097621_100400799
1080 Ga0097621_100482046
1081 Ga0068871_100231117
1082 Ga0068865_100427698
1083 Ga0097620_100324596
1084 Ga0097620_101522031
1085 Ga0105240_10002563
1086 Ga0105240_10009143
1087 Ga0105240_10009721
1088 Ga0105240_10011172
1089 Ga0105240_10023678
1090 Ga0105240_10055889
1091 Ga0105240_10152926
1092 Ga0105240_10256770
1093 Ga0105240_11226200
1094 Ga0105240_11500257
1095 Ga0105245_10286466
1096 Ga0105245_10406451
1097 Ga0105247_10002916
1098 Ga0105241_10015625
1099 Ga0105241_10094532
1100 Ga0105241_10620362
1101 Ga0105241_11415169
1102 Ga0105242_10762084
1103 Ga0105248_10000920
1104 Ga0105248_10944372
1105 Ga0105237_10000084
1106 Ga0105237_10000675
1107 Ga0105237_10008928
1108 Ga0105237_10009642
1109 Ga0105237_11987742
1110 Ga0105238_10000131
1111 Ga0105238_10005144
1112 Ga0105238_10098301
1113 Ga0105238_10108501
1114 Ga0105238_10391495
1115 Ga0105238_11236530
1116 Ga0105249_10000084
1117 Ga0105249_10007606
1118 Ga0105239_10000033
1119 Ga0105239_10018126
1120 Ga0105239_10042913
1121 Ga0105239_10106637
1122 Ga0105239_10572998
1123 Ga0105246_10011815
1124 Ga0105246_10128100
1125 Ga0105246_11968736
1126 Ga0157314_1000507
1127 Ga0154012_169161
1128 Ga0157373_10011463
1129 Ga0157373_10100595
1130 Ga0157371_10070400
1131 Ga0157371_10348755
1132 Ga0157370_10005440
1133 Ga0157370_10023809
1134 Ga0157370_10045998
1135 Ga0157370_10081025
1136 Ga0157369_10003012
1137 Ga0157369_10011973
1138 Ga0157369_10018985
1139 Ga0157369_10124679
1140 Ga0157369_11419744
1141 Ga0157374_11003429
1142 Ga0163162_10000221
1143 Ga0163162_10069555
1144 Ga0163162_10489642
1145 Ga0157372_10000334
1146 Ga0157372_10044203
1147 Ga0157372_10066779
1148 Ga0157372_10081165
1149 Ga0157372_10173947
1150 Ga0157372_10213378
1151 Ga0157372_11449664
1152 Ga0163163_10000112
1153 Ga0163163_10000585
1154 Ga0182008_10006516
1155 Ga0182008_10021422
1156 Ga0182008_10036778
1157 Ga0182008_10055909
1158 Ga0182008_10191861
1159 Ga0157379_10007853
1160 Ga0157379_10482832
1161 Ga0157376_10009210
1162 Ga0182006_1000031
1163 Ga0182006_1000496
1164 Ga0182007_10003787
1165 Ga0182007_10015105
1166 Ga0182005_1000049
1167 Ga0182005_1001001
1168 Ga0182005_1002650
1169 Ga0183368_1002
1170 Ga0163161_10007409
1171 Ga0163161_10066212
1172 Ga0206356_11026662
1173 Ga0206356_11905763
1174 Ga0206351_10589011
1175 Ga0206351_10768644
1176 Ga0206352_10871908
1177 Ga0206350_11455286
1178 Ga0206354_10524459
1179 Ga0206353_10447795
1180 Ga0206353_11143090
1181 Ga0154015_1513628
1182 Ga0224712_10074632
1183 Ga0224712_10128125
1184 Ga0209760_100376
1185 Ga0209784_100204
1186 Ga0209566_102111
1187 Ga0209674_100061
1188 Ga0209674_100077
1189 Ga0209674_100785
1190 Ga0209674_104333
1191 Ga0209672_100004
1192 Ga0209672_100022
1193 Ga0209672_100251
1194 Ga0209672_101130
1195 Ga0209672_101444
1196 Ga0209147_107974
1197 Ga0209563_100076
1198 Ga0207427_100111
1199 Ga0207427_100179
1200 Ga0207427_100185
1201 Ga0207427_100510
1202 Ga0209437_100099
1203 Ga0209437_100113
1204 Ga0209437_100320
1205 Ga0209437_100368
1206 Ga0209437_100782
1207 Ga0209258_100003
1208 Ga0209258_100004
1209 Ga0209258_100119
1210 Ga0209258_100122
1211 Ga0209258_100137
1212 Ga0209258_100376
1213 Ga0209258_106897
1214 Ga0209646_1000985
1215 Ga0209646_1001103
1216 Ga0209646_1003374
1217 Ga0209646_1027599
1218 Ga0209026_1000087
1219 Ga0209026_1000175
1220 Ga0209026_1000274
1221 Ga0209026_1000276
1222 Ga0209026_1008805
1223 Ga0209677_101477
1224 Ga0209148_1000005
1225 Ga0209148_1000025
1226 Ga0209148_1000036
1227 Ga0209148_1000062
1228 Ga0209148_1000083
1229 Ga0209148_1000137
1230 Ga0209148_1001786
1231 Ga0209759_1000136
1232 Ga0209759_1000320
1233 Ga0209759_1001153
1234 Ga0209759_1001565
1235 Ga0209759_1048645
1236 Ga0209129_1000769
1237 Ga0209233_1000040
1238 Ga0209233_1000075
1239 Ga0209233_1000128
1240 Ga0209233_1008709
1241 Ga0209455_1000004
1242 Ga0209455_1000040
1243 Ga0209455_1000084
1244 Ga0209455_1000095
1245 Ga0209455_1000164
1246 Ga0209455_1001294
1247 Ga0209455_1007907
1248 Ga0209758_1000301
1249 Ga0209758_1020451
1250 Ga0209758_1047231
1251 Ga0207426_1016040
1252 Ga0209051_1007151
1253 Ga0209257_1000067
1254 Ga0209257_1039691
1255 Ga0207656_10007153
1256 Ga0207656_10008269
1257 Ga0207656_10119317
1258 Ga0207710_10003748
1259 Ga0207680_10000001
1260 Ga0207680_10000598
1261 Ga0207680_10001902
1262 Ga0207680_10388284
1263 Ga0207647_10000034
1264 Ga0207647_10000262
1265 Ga0207647_10002208
1266 Ga0207647_10002308
1267 Ga0207647_10012004
1268 Ga0207647_10119619
1269 Ga0207705_10000560
1270 Ga0207705_10006860
1271 Ga0207705_10037183
1272 Ga0207705_10112632
1273 Ga0207705_10678893
1274 Ga0207654_10000719
1275 Ga0207654_10005416
1276 Ga0207654_10213287
1277 Ga0207654_10494947
1278 Ga0207707_10000064
1279 Ga0207707_10006038
1280 Ga0207707_10006315
1281 Ga0207707_10029371
1282 Ga0207707_10094005
1283 Ga0207695_10000588
1284 Ga0207695_10001221
1285 Ga0207695_10001320
1286 Ga0207695_10002529
1287 Ga0207695_10003607
1288 Ga0207695_10004205
1289 Ga0207695_10027716
1290 Ga0207695_10056422
1291 Ga0207695_10103753
1292 Ga0207695_10123193
1293 Ga0207695_10176528
1294 Ga0207695_10544900
1295 Ga0207671_10000011
1296 Ga0207671_10012799
1297 Ga0207671_10013618
1298 Ga0207671_10094240
1299 Ga0207663_10040939
1300 Ga0207660_10001372
1301 Ga0207660_10001813
1302 Ga0207660_10003444
1303 Ga0207660_10135796
1304 Ga0207657_10002836
1305 Ga0207657_10029335
1306 Ga0207657_10029430
1307 Ga0207649_10001382
1308 Ga0207649_10006569
1309 Ga0207649_10006704
1310 Ga0207649_10010845
1311 Ga0207649_10249805
1312 Ga0207649_10811832
1313 Ga0207652_10000019
1314 Ga0207652_10000801
1315 Ga0207652_10008959
1316 Ga0207652_10148733
1317 Ga0207652_10333672
1318 Ga0207681_10897705
1319 Ga0207694_10000654
1320 Ga0207694_10001428
1321 Ga0207694_10001879
1322 Ga0207694_10048048
1323 Ga0207694_10147134
1324 Ga0207694_10520874
1325 Ga0207694_10613577
1326 Ga0207650_10006245
1327 Ga0207650_10230356
1328 Ga0207687_10218969
1329 Ga0207700_10023119
1330 Ga0207644_10735062
1331 Ga0207690_10011845
1332 Ga0207690_10068857
1333 Ga0207706_10004869
1334 Ga0207706_10133414
1335 Ga0207706_10408337
1336 Ga0207704_10841111
1337 Ga0207711_10001918
1338 Ga0207661_10036981
1339 Ga0207661_10448781
1340 Ga0207679_10054898
1341 Ga0207679_11742349
1342 Ga0207667_10000219
1343 Ga0207667_10000446
1344 Ga0207667_10000574
1345 Ga0207667_10002469
1346 Ga0207667_10007024
1347 Ga0207667_10121219
1348 Ga0207667_10204493
1349 Ga0207712_10000140
1350 Ga0207712_10000395
1351 Ga0207668_10019465
1352 Ga0207640_10000280
1353 Ga0207640_10000495
1354 Ga0207640_10001128
1355 Ga0207640_10037290
1356 Ga0207640_10322638
1357 Ga0207658_10000997
1358 Ga0207658_10093031
1359 Ga0207658_10213853
1360 Ga0207658_10302291
1361 Ga0207677_10088491
1362 Ga0207703_10000766
1363 Ga0207703_10263265
1364 Ga0207703_10337519
1365 Ga0207703_10415415
1366 Ga0207639_10000277
1367 Ga0207639_10002487
1368 Ga0207639_10007555
1369 Ga0207639_10049181
1370 Ga0207639_10441995
1371 Ga0207639_10642877
1372 Ga0207639_11168568
1373 Ga0207639_11200587
1374 Ga0207678_10002665
1375 Ga0207678_10016613
1376 Ga0207678_10018779
1377 Ga0207678_10026967
1378 Ga0207678_10027074
1379 Ga0207678_10040297
1380 Ga0207678_10106813
1381 Ga0207678_10345286
1382 Ga0207702_10000132
1383 Ga0207702_10000338
1384 Ga0207702_10013397
1385 Ga0207702_10054245
1386 Ga0207702_10439479
1387 Ga0207702_11206364
1388 Ga0207641_10025217
1389 Ga0207641_10376307
1390 Ga0207648_10016027
1391 Ga0207648_10948227
1392 Ga0207648_11103243
1393 Ga0207676_10038682
1394 Ga0207674_10001145
1395 Ga0207674_10002886
1396 Ga0207674_10039493
1397 Ga0207674_10046326
1398 Ga0207674_10047098
1399 Ga0207674_10375402
1400 Ga0207683_10394289
1401 Ga0207698_10000491
1402 Ga0207698_10006628
1403 Ga0207698_10021688
1404 Ga0207698_12006094
1405 Ga0268266_10000008
1406 Ga0268266_10000075
1407 Ga0268265_10461712
1408 Ga0268265_11863648
1409 Ga0268264_10003031
1410 Ga0268264_10079343
1411 Ga0268264_10386309
1412 Ga0268264_10535999
1413 Ga0307509_10399468
1414 Ga0307508_10226554
1415 Ga0316575_10029237
1416 Ga0307413_10477018
1417 Ga0307412_10043615
1418 Ga0307412_11252999
1419 Ga0307416_100132487
1420 Ga0307416_100286179
1421 Ga0307414_10094121
1422 Ga0307414_10423568
1423 Ga0307411_10051057
1424 Ga0307411_10259112
1425 Ga0307411_11110105
1426 Ga0307415_100782597
1427 Ga0307507_10102026
1428 Ga0307507_10374266
1429 Ga0395899_0000110
1430 Ga0395899_0001023
1431 Ga0395899_0034712
1432 Ga0395900_0000049
1433 Ga0395900_0000060
1434 Ga0395900_0102529
1435 Ga0395900_0471806
1436 Ga0395898_0000023
1437 Ga0395898_0000237
1438 Ga0395898_0018522
1439 Ga0395898_0097752
1440 Ga0395901_0117942
1441 Ga0395901_0206518
1442 Ga0395901_0371738
1443 Ga0439436_0000032
1444 Ga0439465_0000530
1445 Ga0451789_0811766
1446 Ga0451793_1777967
1447 Ga0451797_0113713
1448 Ga0451797_1444144
1449 Ga0451795_0322423
1450 Ga0451795_0773849
1451 Ga0451802_0035022
1452 Ga0451806_671699
1453 Ga0451841_0241459
1454 Ga0450908_000007
1455 Ga0439459_0061077
1456 Ga0451577_0176764
1457 Ga0466969_0038934
1458 Ga0466969_0088821
1459 Ga0466972_0038589
1460 Ga0466976_0347589
1461 Ga0466989_0163097
1462 Ga0466982_0000018
1463 Ga0466982_0000096
1464 Ga0466965_0150407
1465 Ga0466966_0008293
1466 Ga0466966_0041964
1467 Ga0466966_0181364
1468 Ga0466961_0001486
1469 Ga0466961_0002537
1470 Ga0466961_0003674
1471 Ga0466961_0003935
1472 Ga0466961_0012833
1473 Ga0466963_0207098
1474 Ga0466963_0695281
1475 Ga0466964_0001814
1476 Ga0466964_0025129
1477 Ga0453684_0000316
1478 Ga0466971_0001777
1479 Ga0466971_0015305
1480 Ga0466971_0015318
1481 Ga0466971_0111559
1482 Ga0466968_0001797
1483 Ga0466968_0012411
1484 Ga0466970_0004514
1485 Ga0466970_0019296
1486 Ga0466957_0002919
1487 Ga0466957_0039575
1488 Ga0466957_0133691
1489 Ga0466957_0251608
1490 Ga0466957_0643964
1491 Ga0466960_0023732
1492 Ga0466959_0005091
1493 Ga0466959_0320532
1494 Ga0451576_0000128
1495 Ga0466958_0016421
1496 Ga0466958_0025788
1497 Ga0466958_0032951
1498 Ga0466958_0293822
1499 Ga0466967_0318912
1500 Ga0495617_000607
1501 Ga0495617_001095
1502 Ga0495638_0000019
1503 Ga0495638_0000406
1504 Ga0495638_0000452
1505 Ga0495638_0001628
1506 Ga0495650_0000350
1507 Ga0495650_0000466
1508 Ga0495650_0000869
1509 Ga0495605_0126429
1510 Ga0495584_0001662
1511 Ga0495585_0001138
1512 Ga0495585_0040927
1513 Ga0495607_0000133
1514 Ga0495607_0001577
1515 Ga0495607_0007528
1516 Ga0495583_0011255
1517 Ga0495606_0000016
1518 Ga0495606_0000160
1519 Ga0495606_0001918
1520 Ga0495606_0002253
1521 Ga0495606_0234825
1522 Ga0495606_0269383
1523 Ga0495610_0004501
1524 Ga0495610_0029998
1525 Ga0495616_0000006
1526 Ga0495616_0047917
1527 Ga0495620_0000711
1528 Ga0495620_0097744
1529 Ga0495631_0000036
1530 Ga0495631_0000318
1531 Ga0495632_0000010
1532 Ga0495632_0012658
1533 Ga0495632_0054517
1534 Ga0495637_0007175
1535 Ga0495643_0177310
1536 Ga0495648_0000881
1537 Ga0495609_0149052
1538 Ga0495622_0020164
1539 Ga0495622_0251985
1540 Ga0495668_0005730
1541 Ga0495611_0000003
1542 Ga0495611_0000028
1543 Ga0495625_0000193
1544 Ga0495625_0006388
1545 Ga0495625_0015849
1546 Ga0495625_0048981
1547 Ga0495625_0090097
1548 Ga0495661_0001277
1549 Ga0495670_0000413
1550 Ga0495670_0013548
1551 Ga0495670_0026664
1552 Ga0495671_0000142
1553 Ga0495649_0009358
1554 Ga0495649_0023421
1555 Ga0495589_0000042
1556 Ga0495660_0004438
1557 Ga0495660_0010465
1558 Ga0495683_0000722
1559 Ga0495679_000046
1560 Ga0495673_0000004
1561 Ga0495673_0000041
1562 Ga0495673_0004939
1563 Ga0495681_0111495
1564 Ga0495686_0000117
1565 Ga0495686_0000229
1566 Ga0495686_0002823
1567 Ga0495686_0007664
1568 Ga0495686_0011281
1569 Ga0495686_0023910
1570 Ga0496100_0090442
1571 Ga0496101_0004110
1572 Ga0496102_0197553
1573 Ga0496102_0413565
1574 Ga0496103_0026448
1575 Ga0496104_0031058
1576 Ga0496104_0194060
1577 Ga0496105_0042555
1578 Ga0496106_0001877
1579 Ga0496106_0199612
1580 Ga0496107_0092139
1581 Ga0496108_0260772
1582 Ga0496113_0011788
1583 Ga0496114_0067958
1584 Ga0496115_0000196
1585 Ga0496115_0000440
1586 Ga0496115_0032843
1587 Ga0496115_0214530
1588 Ga0496115_0733924
1589 Ga0496116_0042941
1590 Ga0496116_0077088
1591 Ga0496116_0086439
1592 Ga0496116_0190880
1593 Ga0496117_0023133
1594 Ga0496117_0029156
1595 Ga0496117_0030912
1596 Ga0496117_0103448
1597 Ga0496117_0309500
1598 Ga0496118_0001472
1599 Ga0496118_0002903
1600 Ga0496118_0005217
1601 Ga0496118_0006396
1602 Ga0496118_0008697
1603 Ga0496118_0087591
1604 Ga0496118_0222566
1605 Ga0496118_0420987
1606 Ga0496119_0000201
1607 Ga0496119_0005372
1608 Ga0496119_0018397
1609 Ga0496120_0000189
1610 Ga0496120_0000837
1611 Ga0496121_0000419
1612 Ga0496121_0000771
1613 Ga0496121_0001298
1614 Ga0496121_0003299
1615 Ga0496121_0014080
1616 Ga0496121_0032700
1617 Ga0496121_0051673
1618 Ga0496121_0064333
1619 Ga0496121_0071241
1620 Ga0496121_0363267
1621 Ga0496121_0401542
1622 Ga0496121_0630530
1623 Ga0496122_0001358
1624 Ga0496122_0007321
1625 Ga0496122_0019348
1626 Ga0496122_0082530
1627 Ga0496122_0116918
1628 Ga0496123_0004282
1629 Ga0496123_0004978
1630 Ga0496123_0009820
1631 Ga0496123_0042437
1632 Ga0496123_0096190
1633 Ga0496124_0000203
1634 Ga0496124_0001473
1635 Ga0496124_0109481
1636 Ga0496125_0001450
1637 Ga0496125_0008488
1638 Ga0496125_0027584
1639 Ga0496125_0152162
1640 Ga0496126_0001528
1641 Ga0496126_0009745
1642 Ga0496126_0016296
1643 Ga0496126_0052949
1644 Ga0496126_0062906
1645 Ga0496126_0070126
1646 Ga0496126_0073413
1647 Ga0496126_0319947
1648 Ga0496126_0442509
1649 Ga0495678_000066
1650 Ga0495678_015033
1651 Ga0495682_0003108
1652 Ga0495682_0026021
1653 Ga0495682_0095429
1654 Ga0501032_0060536
1655 Ga0501033_0019511
1656 Ga0501033_0284121
1657 Ga0501034_0006620
1658 Ga0501034_0758834
1659 Ga0501036_0394918
1660 Ga0501037_0018053
1661 Ga0501037_0152969
1662 Ga0501038_0015538
1663 Ga0501038_0418817
1664 Ga0501039_0120244
1665 Ga0501039_0358639
1666 Ga0501043_0022946
1667 Ga0501043_0031501
1668 Ga0501043_0086842
1669 Ga0501043_0196194
1670 Ga0501043_0255343
1671 Ga0501046_0008054
1672 Ga0501046_0200343
1673 Ga0501046_0234302
1674 Ga0501047_0002093
1675 Ga0501047_0003063
1676 Ga0501047_0045093
1677 Ga0501047_0059989
1678 Ga0501047_0060899
1679 Ga0501047_0140733
1680 Ga0501048_0065527
1681 Ga0501048_0111141
1682 Ga0501067_0000583
1683 Ga0501068_0184873
1684 Ga0501069_0001862
1685 Ga0501069_0002178
1686 Ga0501069_0026323
1687 Ga0501069_0066946
1688 Ga0501069_0113071
1689 Ga0501070_0004139
1690 Ga0501070_0004257
1691 Ga0501070_0061919
1692 Ga0501070_0066254
1693 Ga0501070_0146981
1694 Ga0501070_0458335
1695 Ga0501071_0008797
1696 Ga0501072_0002507
1697 Ga0501072_0143661
1698 Ga0501073_0008095
1699 Ga0501073_0015945
1700 Ga0501073_0159283
1701 Ga0501073_0209089
1702 Ga0501073_0284279
1703 Ga0501074_0003986
1704 Ga0501074_0005938
1705 Ga0501074_0025883
1706 Ga0501074_0062333
1707 Ga0501074_0065446
1708 Ga0501074_1063612
1709 Ga0501079_0026319
1710 Ga0501079_0173661
1711 Ga0501079_0618568
1712 Ga0501080_0000256
1713 Ga0501080_0001893
1714 Ga0501080_0003974
1715 Ga0501080_0016829
1716 Ga0501080_0097338
1717 Ga0501083_0001929
1718 Ga0501035_0030885
1719 Ga0501035_0073546
1720 Ga0501035_0084441
1721 Ga0501035_0121763
1722 Ga0501035_0540457
1723 Ga0501044_0003272
1724 Ga0501044_0007113
1725 Ga0501044_0014551
1726 Ga0501044_0114409
1727 Ga0501044_0205065
1728 Ga0501044_0296891
1729 Ga0501044_1283098
1730 nmdc:mga0sz30_92625_c1
1731 Ga0500643_000036
1732 Ga0500643_008323
1733 Ga0500555_001310
1734 Ga0500597_000016
1735 Ga0500652_190098
1736 Ga0500633_0001664
1737 Ga0500645_000639
1738 Ga0501084_0291415
1739 Ga0501082_0201301
1740 Ga0501082_0287069
1741 Ga0466962_0000272
1742 Ga0466962_0011816
1743 Ga0466962_0037551
1744 Ga0466962_0222261
1745 Ga0466962_0601888
1746 2525558158
1747 2538835162
1748 2595447961
1749 2630649961
1750 2643829356
1751 2721026089
1752 2735833943
1753 2739229746
1754 2739729927
1755 2819565567
1756 2842918672
1757 2842922143
1758 2884341934
1759 2884413030
1760 2895397305
1761 2904466059
1762 2919087322
1763 2919406554
1764 2928965885
1765 2941474340
1766 2953997261

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

14

134

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9666 12 147
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9529 12 147
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.9471 11 147
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.934 11 147
5lm7-assembly2.cif.gz_D crystal structure of the lambda n-nus factor complex 0.9107 15 144
ID Description Score Start End Superfamily
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9643 10 147 1.10.940.10
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9508 10 147 1.10.940.10
5lm7D00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9107 15 144 1.10.940.10
af_Q2FY45_1_129_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9007 16 139 1.10.940.10
af_Q2FZ67_2_133_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9007 18 139 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A836PN20-F1-model_v4 Transcription antitermination factor NusB 0.9922 55 149 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A368HI50-F1-model_v4 Transcription antitermination factor NusB 0.9879 52 145 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A831Z5G0-F1-model_v4 Transcription antitermination factor NusB 0.9854 59 149 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A7X5U9W7-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9833 8 150 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A7J6JU36-F1-model_v4 deleted 0.9829 50 147

Map