F484635

General Info

Members Datasets Scaffolds Average Seq Length
884 527 1768 454

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_007901|Ga0439438_007901_1478_2902
Length 474
Sequence MRRAPLMLAALSLKNLRRVRMTSNNPQTREWQTLSNDHHLAPFSDFKQLKEKGPRIITNAKGVYLWDSEGNKILDGMAGLWCVAIGYGRDELADAASKQMRELPYYNLFFQTAHPPVLELAKAISDIAPQGMNHVFFTGSGSEGNDTMLRMVRHYWAIKGQPKKKVIISRKNGYHGSTVAGASLGGMTYMHEQGDLPIPGIVHIAQPYWFAEGGEMTPEEFGVWAANQLEEKILEVGVDNVGAFIAEPIQGAGGVIIPPATYWPRIKEILAKYDILFVADEVICGFGRTGEWFGSDFYDLKPDMMTIAKGLTSGYIPMGGLIVRDEVVEVLNEGGDFNHGFTYSGHPVAAAVALENIRILREEKIIERVHAETAPYLQKRLRELSDHPLVGEVRGVGLLGAIELVQDKATRKRYEGKGAGMICRTFCFENGLIMRAVGDTMIIAPPLVITPAEIDELVTKARKCLDLTLSALQG

Samples

Sample ID Description Type Environment
1 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
68 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
131 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
132 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
138 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
139 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
140 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
156 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
157 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
158 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
159 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
160 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
161 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
162 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
163 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
164 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
169 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
170 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
185 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
235 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
236 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
257 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
271 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
277 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
278 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
279 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
280 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
281 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 2511231004 Pseudomonas sp. GM102 Isolate Nodule
285 2511231006 Pseudomonas sp. GM17 Isolate Nodule
286 2511231007 Pseudomonas sp. GM18 Isolate Nodule
287 2511231008 Pseudomonas sp. GM21 Isolate Nodule
288 2511231010 Pseudomonas sp. GM25 Isolate Nodule
289 2511231011 Pseudomonas sp. GM30 Isolate Nodule
290 2511231012 Pseudomonas sp. GM33 Isolate Nodule
291 2511231014 Pseudomonas sp. GM48 Isolate Nodule
292 2511231015 Pseudomonas sp. GM49 Isolate Nodule
293 2511231016 Pseudomonas sp. GM50 Isolate Nodule
294 2511231017 Pseudomonas sp. GM55 Isolate Nodule
295 2511231018 Pseudomonas sp. GM60 Isolate Nodule
296 2511231019 Pseudomonas sp. GM67 Isolate Nodule
297 2511231020 Pseudomonas sp. GM74 Isolate Nodule
298 2511231021 Pseudomonas sp. GM78 Isolate Nodule
299 2511231022 Pseudomonas sp. GM79 Isolate Nodule
300 2511231023 Pseudomonas sp. GM80 Isolate Nodule
301 2511231024 Pseudomonas sp. GM84 Isolate Nodule
302 2511231031 Pseudomonas sp. GM16 Isolate Nodule
303 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
304 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
305 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
306 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
307 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
308 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
309 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
310 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
311 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
312 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
313 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
314 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
315 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
316 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
317 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
318 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
319 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
320 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
321 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
322 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
323 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
324 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
325 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
326 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
327 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
328 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
329 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
330 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
331 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
332 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
333 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
334 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
335 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
336 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
337 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
338 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
339 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
340 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
341 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
342 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
343 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
344 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
345 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
346 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
347 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
348 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
349 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
350 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
351 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
352 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
353 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
354 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
355 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
356 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
357 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
358 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
359 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
360 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
361 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
362 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
363 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
364 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
365 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
366 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
367 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
368 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
369 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
370 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
371 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
372 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
373 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
374 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
375 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
376 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
377 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
378 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
379 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
380 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
381 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
382 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
383 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
384 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
385 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
386 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
387 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
388 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
389 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
390 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
391 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
392 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
393 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
394 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
395 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
396 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
397 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
398 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
399 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
400 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
401 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
402 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
403 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
404 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
405 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
406 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
407 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
408 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
409 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
410 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
411 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
412 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
413 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
414 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
415 2765235841 Pseudomonas putida AA7 Isolate Unclassified
416 2773857670 Pseudomonas sp. 478 Isolate Unclassified
417 2773857673 Pseudomonas sp. 443 Isolate Unclassified
418 2784132063 Pseudomonas sp. 424 Isolate Unclassified
419 2784132072 Pseudomonas sp. 460 Isolate Unclassified
420 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
421 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
422 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
423 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
424 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
425 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
426 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
427 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
428 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
429 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
430 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
431 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
432 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
433 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
434 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
435 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
436 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
437 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
438 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
439 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
440 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
441 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
442 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
443 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
444 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
445 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
446 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
447 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
448 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
449 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
450 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
451 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
452 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
453 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
454 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
455 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
456 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
457 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
458 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
459 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
460 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
461 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
462 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
463 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
464 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
465 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
466 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
467 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
468 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
469 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
470 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
471 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
472 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
473 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
474 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
475 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
476 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
477 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
478 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
479 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
480 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
481 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
482 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
483 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
484 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
485 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
486 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
487 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
488 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
489 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
490 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
491 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
492 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
493 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
494 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
495 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
496 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
497 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
498 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
499 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
500 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
501 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
502 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
503 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
504 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
505 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
506 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
507 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
508 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
509 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
510 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
511 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
512 8052494512 Pseudomonas putida LD6 Isolate Unclassified
513 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
514 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
515 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
516 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
517 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
518 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
519 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
520 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
521 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
522 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
523 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
524 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
525 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
526 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
527 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.27
Metatranscriptomes 0
Isolates 28.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.2
Nodule 3.73
Rhizoplane 8.48
Rhizosphere 60.63
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439438_007901 3300041405 Bacteria 3587
2 MRS2a_Contig_136 2124908027 Bacteria 16261
3 SwRhRL2b_contig_180730 2162886007 Bacteria 3385
4 JGI24741J21665_1004873 3300001915 Bacteria 2898
5 JGI25156J39149_1000278 3300002705 Bacteria 34709
6 JGI25156J39149_1000973 3300002705 Bacteria 13642
7 JGI25156J39149_1009634 3300002705 Bacteria 2332
8 JGI25162J39368_1000505 3300002737 Bacteria 29260
9 JGI25162J39368_1000520 3300002737 Bacteria 28748
10 JGI25154J39366_1000221 3300002738 Bacteria 38916
11 JGI25157J39369_1000049 3300002741 Bacteria 115611
12 JGI25163J39215_1002359 3300002771 Bacteria 2003
13 JGI25164J39214_1000342 3300002772 Bacteria 29260
14 JGI25164J39214_1000350 3300002772 Bacteria 28748
15 JGI25165J46597_1000629 3300003214 Bacteria 29260
16 JGI25165J46597_1000645 3300003214 Bacteria 28748
17 rootH1_10025580 3300003323 Bacteria 2734
18 Ga0055538_1000007 3300003751 Bacteria 399715
19 Ga0055538_1000032 3300003751 Bacteria 199718
20 Ga0055539_1000043 3300003752 Bacteria 199718
21 Ga0055539_1000583 3300003752 Bacteria 10242
22 Ga0055539_1001782 3300003752 Bacteria 3705
23 Ga0055533_1000010 3300003756 Bacteria 491196
24 Ga0055533_1000052 3300003756 Bacteria 199718
25 Ga0055532_1000047 3300003758 Bacteria 179201
26 Ga0055525_1000062 3300003759 Bacteria 199718
27 Ga0055525_1000775 3300003759 Bacteria 10334
28 Ga0055535_1000607 3300003761 Bacteria 29519
29 Ga0055535_1000906 3300003761 Bacteria 20145
30 Ga0055535_1004623 3300003761 Bacteria 3274
31 Ga0055529_1000731 3300003763 Bacteria 21383
32 Ga0055536_1001013 3300003781 Bacteria 17859
33 Ga0055536_1004708 3300003781 Bacteria 6871
34 Ga0055536_1004755 3300003781 Bacteria 6817
35 Ga0055530_10000150 3300003791 Bacteria 63051
36 Ga0055530_10001395 3300003791 Bacteria 17859
37 Ga0055530_10004701 3300003791 Bacteria 6915
38 Ga0055530_10009077 3300003791 Bacteria 3872
39 Ga0055540_1000175 3300003792 Bacteria 63051
40 Ga0055540_1002862 3300003792 Bacteria 8769
41 Ga0055540_1003956 3300003792 Bacteria 6915
42 Ga0055540_1007251 3300003792 Bacteria 4230
43 Ga0055531_10008572 3300003794 Bacteria 5367
44 Ga0055541_1000030 3300003841 Bacteria 199616
45 Ga0058692_1001311 3300003856 Bacteria 9374
46 Ga0065165_1000774 3300005262 Bacteria 43046
47 Ga0065714_10003458 3300005288 Bacteria 7061
48 Ga0065714_10008011 3300005288 Bacteria 4309
49 Ga0065714_10019612 3300005288 Bacteria 1684
50 Ga0065704_10071473 3300005289 Bacteria 11003
51 Ga0065712_10000927 3300005290 Bacteria 7406
52 Ga0065712_10069335 3300005290 Bacteria 7506
53 Ga0065712_10072290 3300005290 Bacteria 4824
54 Ga0065715_10002954 3300005293 Bacteria 7366
55 Ga0070658_10136714 3300005327 Bacteria 2045
56 Ga0070670_100001953 3300005331 Bacteria 16902
57 Ga0070670_100210681 3300005331 Bacteria 1690
58 Ga0068869_100053998 3300005334 Bacteria 2923
59 Ga0070660_100097909 3300005339 Bacteria 2321
60 Ga0070661_100001640 3300005344 Bacteria 15489
61 Ga0070669_100002598 3300005353 Bacteria 13053
62 Ga0070669_100011283 3300005353 Bacteria 6344
63 Ga0070663_100034782 3300005455 Bacteria 3491
64 Ga0070662_100008312 3300005457 Bacteria 6763
65 Ga0070662_100078941 3300005457 Bacteria 2446
66 Ga0068853_100000187 3300005539 Bacteria 43749
67 Ga0070665_100078213 3300005548 Bacteria 3314
68 Ga0068855_100052495 3300005563 Bacteria 4799
69 Ga0070664_100001886 3300005564 Bacteria 16837
70 Ga0068857_100024975 3300005577 Bacteria 5263
71 Ga0068861_100040263 3300005719 Bacteria 3493
72 Ga0068851_10000007 3300005834 Bacteria 244101
73 Ga0075364_10154732 3300006051 Bacteria 1546
74 Ga0075432_10007217 3300006058 Bacteria 3782
75 Ga0075432_10009884 3300006058 Bacteria 3243
76 Ga0075432_10015661 3300006058 Bacteria 2587
77 Ga0075366_10001453 3300006195 Bacteria 11797
78 Ga0075366_10006476 3300006195 Bacteria 6421
79 Ga0075366_10006521 3300006195 Bacteria 6399
80 Ga0075370_10016883 3300006353 Bacteria 3936
81 Ga0075434_100203650 3300006871 Unclassified 1999
82 Ga0099823_1000043 3300006944 Bacteria 60786
83 Ga0099823_1000050 3300006944 Bacteria 57425
84 Ga0099823_1022982 3300006944 Bacteria 5739
85 Ga0099823_1063234 3300006944 Bacteria 1855
86 Ga0079104_1001103 3300006946 Bacteria 19997
87 Ga0079104_1003465 3300006946 Bacteria 7309
88 Ga0099826_10004877 3300006948 Bacteria 9495
89 Ga0105251_10000024 3300009011 Bacteria 133058
90 Ga0105251_10002156 3300009011 Bacteria 15794
91 Ga0105251_10004294 3300009011 Bacteria 9779
92 Ga0105251_10015050 3300009011 Bacteria 4243
93 Ga0105251_10018016 3300009011 Bacteria 3768
94 Ga0105251_10018659 3300009011 Bacteria 3681
95 Ga0105251_10054573 3300009011 Bacteria 1897
96 Ga0105244_10000265 3300009036 Bacteria 52791
97 Ga0105244_10000542 3300009036 Bacteria 33662
98 Ga0105244_10007755 3300009036 Bacteria 6793
99 Ga0105244_10014617 3300009036 Bacteria 4535
100 Ga0105244_10018100 3300009036 Bacteria 3963
101 Ga0105244_10025226 3300009036 Bacteria 3234
102 Ga0105244_10028356 3300009036 Bacteria 3005
103 Ga0105244_10080040 3300009036 Bacteria 1618
104 Ga0105250_10001113 3300009092 Bacteria 15161
105 Ga0105250_10012888 3300009092 Bacteria 3441
106 Ga0105240_10072481 3300009093 Bacteria 4257
107 Ga0111539_10344589 3300009094 Bacteria 1734
108 Ga0105243_10001572 3300009148 Bacteria 19964
109 Ga0105243_10001599 3300009148 Bacteria 19744
110 Ga0105243_10011620 3300009148 Bacteria 6660
111 Ga0105243_10052138 3300009148 Bacteria 3239
112 Ga0105243_10125045 3300009148 Bacteria 2174
113 Ga0105242_10001499 3300009176 Bacteria 18352
114 Ga0105242_10194169 3300009176 Bacteria 1799
115 Ga0105248_10007834 3300009177 Bacteria 11730
116 Ga0105237_10010598 3300009545 Bacteria 9791
117 Ga0105237_10111123 3300009545 Bacteria 2732
118 Ga0105238_10170899 3300009551 Bacteria 2150
119 Ga0105249_10007064 3300009553 Bacteria 9797
120 Ga0105239_10025926 3300010375 Bacteria 6455
121 Ga0105246_10002803 3300011119 Bacteria 10549
122 Ga0105246_10007983 3300011119 Bacteria 6497
123 Ga0105246_10011130 3300011119 Bacteria 5575
124 Ga0157337_1000729 3300012483 Bacteria 1562
125 Ga0157345_1000705 3300012498 Bacteria 2699
126 Ga0157373_10013919 3300013100 Bacteria 5900
127 Ga0157373_10033727 3300013100 Bacteria 3680
128 Ga0157373_10047177 3300013100 Bacteria 3073
129 Ga0157371_10001604 3300013102 Bacteria 23194
130 Ga0157371_10013168 3300013102 Bacteria 6296
131 Ga0157371_10013733 3300013102 Bacteria 6141
132 Ga0157371_10038069 3300013102 Bacteria 3442
133 Ga0157371_10043778 3300013102 Bacteria 3188
134 Ga0157370_10003242 3300013104 Bacteria 19198
135 Ga0157370_10003759 3300013104 Bacteria 17721
136 Ga0157370_10063716 3300013104 Bacteria 3491
137 Ga0157370_10069376 3300013104 Bacteria 3330
138 Ga0157370_10084960 3300013104 Bacteria 2973
139 Ga0157370_10135753 3300013104 Bacteria 2293
140 Ga0157369_10030463 3300013105 Bacteria 5950
141 Ga0157369_10043726 3300013105 Bacteria 4881
142 Ga0157369_10055802 3300013105 Bacteria 4263
143 Ga0157369_10122753 3300013105 Bacteria 2755
144 Ga0157369_10166556 3300013105 Bacteria 2324
145 Ga0157369_10301600 3300013105 Bacteria 1666
146 Ga0163162_10030569 3300013306 Bacteria 5337
147 Ga0157372_10015782 3300013307 Bacteria 8102
148 Ga0157375_10152615 3300013308 Bacteria 2446
149 Ga0157375_10256711 3300013308 Bacteria 1909
150 Ga0182008_10006484 3300014497 Bacteria 6535
151 Ga0182008_10007506 3300014497 Bacteria 6016
152 Ga0157379_10070294 3300014968 Bacteria 3132
153 Ga0182006_1003062 3300015261 Bacteria 8773
154 Ga0182006_1012007 3300015261 Bacteria 3794
155 Ga0182006_1030231 3300015261 Bacteria 2190
156 Ga0182006_1052089 3300015261 Bacteria 1573
157 Ga0182007_10002733 3300015262 Bacteria 8624
158 Ga0182005_1002836 3300015265 Bacteria 6038
159 Ga0182005_1003780 3300015265 Bacteria 5033
160 Ga0182005_1008200 3300015265 Bacteria 3090
161 Ga0163161_10089329 3300017792 Bacteria 2279
162 Ga0163161_10093556 3300017792 Bacteria 2227
163 Ga0213872_10000066 3300021361 Bacteria 93052
164 Ga0213872_10000187 3300021361 Bacteria 55101
165 Ga0213872_10062256 3300021361 Bacteria 1686
166 Ga0209760_100027 3300025207 Bacteria 153290
167 Ga0209760_100197 3300025207 Bacteria 29065
168 Ga0209784_100007 3300025224 Bacteria 747715
169 Ga0209566_100009 3300025225 Bacteria 554018
170 Ga0209674_100003 3300025226 Bacteria 2196646
171 Ga0209674_100021 3300025226 Bacteria 629811
172 Ga0209147_100009 3300025229 Bacteria 747409
173 Ga0209563_100018 3300025230 Bacteria 747850
174 Ga0209563_100049 3300025230 Bacteria 358472
175 Ga0209563_101931 3300025230 Bacteria 5007
176 Ga0207427_100005 3300025231 Bacteria 797999
177 Ga0207427_100006 3300025231 Bacteria 785415
178 Ga0207427_100280 3300025231 Bacteria 37213
179 Ga0209437_100013 3300025233 Bacteria 785457
180 Ga0209437_100018 3300025233 Bacteria 694400
181 Ga0209437_101479 3300025233 Bacteria 5645
182 Ga0209258_100163 3300025242 Bacteria 149677
183 Ga0209258_100169 3300025242 Bacteria 145227
184 Ga0209646_1000138 3300025246 Bacteria 114892
185 Ga0209646_1000184 3300025246 Bacteria 78423
186 Ga0209026_1000021 3300025250 Bacteria 375165
187 Ga0209677_100012 3300025253 Bacteria 554018
188 Ga0209677_100145 3300025253 Bacteria 65577
189 Ga0209677_100209 3300025253 Bacteria 45370
190 Ga0209677_107310 3300025253 Bacteria 2376
191 Ga0209759_1000025 3300025256 Bacteria 317082
192 Ga0209759_1001401 3300025256 Bacteria 13807
193 Ga0209759_1002119 3300025256 Bacteria 9190
194 Ga0209759_1010090 3300025256 Bacteria 2794
195 Ga0209759_1011333 3300025256 Bacteria 2542
196 Ga0209233_1000021 3300025261 Bacteria 798078
197 Ga0209233_1000022 3300025261 Bacteria 785415
198 Ga0209455_1000059 3300025272 Bacteria 339995
199 Ga0209673_1005874 3300025273 Bacteria 6071
200 Ga0209675_1002099 3300025291 Bacteria 10560
201 Ga0209676_1000015 3300025292 Bacteria 784458
202 Ga0209676_1000030 3300025292 Bacteria 506421
203 Ga0209676_1000041 3300025292 Bacteria 424583
204 Ga0209676_1000617 3300025292 Bacteria 51959
205 Ga0209676_1001192 3300025292 Bacteria 27932
206 Ga0209676_1005922 3300025292 Bacteria 6193
207 Ga0209676_1007365 3300025292 Bacteria 5181
208 Ga0209050_1000024 3300025298 Bacteria 533389
209 Ga0209050_1000030 3300025298 Bacteria 463381
210 Ga0209050_1000374 3300025298 Bacteria 85298
211 Ga0209050_1000518 3300025298 Bacteria 64332
212 Ga0209050_1000647 3300025298 Bacteria 54000
213 Ga0209051_1000012 3300025303 Bacteria 595474
214 Ga0209051_1000023 3300025303 Bacteria 437371
215 Ga0209051_1000881 3300025303 Bacteria 30220
216 Ga0209051_1003155 3300025303 Bacteria 11068
217 Ga0209051_1005236 3300025303 Bacteria 7659
218 Ga0209257_1000069 3300025304 Bacteria 339826
219 Ga0209257_1004945 3300025304 Bacteria 9776
220 Ga0207656_10000006 3300025321 Bacteria 395044
221 Ga0207696_1000031 3300025711 Bacteria 384169
222 Ga0207696_1000050 3300025711 Bacteria 276983
223 Ga0207696_1000105 3300025711 Bacteria 163421
224 Ga0207696_1000156 3300025711 Bacteria 112840
225 Ga0207696_1000541 3300025711 Bacteria 30663
226 Ga0207696_1008940 3300025711 Bacteria 3772
227 Ga0207696_1009541 3300025711 Bacteria 3614
228 Ga0207696_1013612 3300025711 Bacteria 2824
229 Ga0207655_1000014 3300025728 Bacteria 607124
230 Ga0207655_1000202 3300025728 Bacteria 103907
231 Ga0207655_1000216 3300025728 Bacteria 99551
232 Ga0207655_1000295 3300025728 Bacteria 75367
233 Ga0207655_1000388 3300025728 Bacteria 61513
234 Ga0207655_1001189 3300025728 Bacteria 25183
235 Ga0207655_1002393 3300025728 Bacteria 15296
236 Ga0207655_1002424 3300025728 Bacteria 15154
237 Ga0207655_1005954 3300025728 Bacteria 8168
238 Ga0207655_1007793 3300025728 Bacteria 6900
239 Ga0207655_1009633 3300025728 Bacteria 5976
240 Ga0207655_1012780 3300025728 Bacteria 4869
241 Ga0207655_1013044 3300025728 Bacteria 4798
242 Ga0207655_1020188 3300025728 Bacteria 3437
243 Ga0207655_1027790 3300025728 Bacteria 2684
244 Ga0207713_1000010 3300025735 Bacteria 528374
245 Ga0207713_1000077 3300025735 Bacteria 176517
246 Ga0207713_1001506 3300025735 Bacteria 18410
247 Ga0207713_1003359 3300025735 Bacteria 10976
248 Ga0207713_1003953 3300025735 Bacteria 9846
249 Ga0207713_1004110 3300025735 Bacteria 9590
250 Ga0207713_1004772 3300025735 Bacteria 8713
251 Ga0207713_1007874 3300025735 Bacteria 6211
252 Ga0207713_1009206 3300025735 Bacteria 5593
253 Ga0207713_1019128 3300025735 Bacteria 3363
254 Ga0207713_1028390 3300025735 Bacteria 2525
255 Ga0207705_10020837 3300025909 Bacteria 4680
256 Ga0207671_10000131 3300025914 Bacteria 116866
257 Ga0207657_10029841 3300025919 Bacteria 4957
258 Ga0207649_10000012 3300025920 Bacteria 265674
259 Ga0207681_10000099 3300025923 Bacteria 73220
260 Ga0207681_10008578 3300025923 Bacteria 6242
261 Ga0207650_10000157 3300025925 Bacteria 81959
262 Ga0207650_10000185 3300025925 Bacteria 72385
263 Ga0207650_10071195 3300025925 Bacteria 2615
264 Ga0207690_10070448 3300025932 Bacteria 2409
265 Ga0207706_10001069 3300025933 Bacteria 27808
266 Ga0207706_10009625 3300025933 Bacteria 8870
267 Ga0207686_10000319 3300025934 Bacteria 34615
268 Ga0207709_10000071 3300025935 Bacteria 181156
269 Ga0207709_10000337 3300025935 Bacteria 49221
270 Ga0207709_10045241 3300025935 Bacteria 2664
271 Ga0207709_10081986 3300025935 Bacteria 2081
272 Ga0207711_10056958 3300025941 Bacteria 3359
273 Ga0207689_10014227 3300025942 Bacteria 6771
274 Ga0207679_10000015 3300025945 Bacteria 265674
275 Ga0207667_10009539 3300025949 Bacteria 11420
276 Ga0207712_10004516 3300025961 Bacteria 8788
277 Ga0207640_10072216 3300025981 Bacteria 2327
278 Ga0207677_10180154 3300026023 Bacteria 1661
279 Ga0207639_10000775 3300026041 Bacteria 21763
280 Ga0207678_10015659 3300026067 Bacteria 6665
281 Ga0207702_10000800 3300026078 Bacteria 33369
282 Ga0207674_10043460 3300026116 Bacteria 4633
283 Ga0207675_100052490 3300026118 Bacteria 3804
284 Ga0209281_1000016 3300027111 Bacteria 588107
285 Ga0209281_1000019 3300027111 Bacteria 576164
286 Ga0209281_1001944 3300027111 Bacteria 9656
287 Ga0209389_1000017 3300027296 Bacteria 180543
288 Ga0209389_1000053 3300027296 Bacteria 108874
289 Ga0209389_1072180 3300027296 Bacteria 1862
290 Ga0209371_1000032 3300027312 Bacteria 392355
291 Ga0207428_10027106 3300027907 Bacteria 4772
292 Ga0207428_10111895 3300027907 Bacteria 2101
293 Ga0265336_10000006 3300028666 Bacteria 348453
294 Ga0307515_10023444 3300028794 Bacteria 10813
295 Ga0265324_10002529 3300029957 Bacteria 9267
296 Ga0268256_1000050 3300030500 Bacteria 300675
297 Ga0307511_10083198 3300030521 Bacteria 2231
298 Ga0314311_1099326 3300030733 Bacteria 5378
299 Ga0316178_1008333 3300030735 Bacteria 44288
300 Ga0307408_100000002 3300031548 Bacteria 827227
301 Ga0307408_100000077 3300031548 Bacteria 110022
302 Ga0307408_100022947 3300031548 Bacteria 4246
303 Ga0307408_100047222 3300031548 Bacteria 3082
304 Ga0307514_10001133 3300031649 Bacteria 36650
305 Ga0307516_10000878 3300031730 Bacteria 41335
306 Ga0307405_10024462 3300031731 Bacteria 3450
307 Ga0307409_100129357 3300031995 Bacteria 2154
308 Ga0307416_100206385 3300032002 Bacteria 1869
309 Ga0307414_10016650 3300032004 Bacteria 4475
310 Ga0307414_10026324 3300032004 Bacteria 3743
311 Ga0307411_10066333 3300032005 Bacteria 2424
312 Ga0307510_10122871 3300033180 Bacteria 2294
313 Ga0373937_0023779 3300036401 Bacteria 5524
314 Ga0373937_0119750 3300036401 Bacteria 2453
315 Ga0395905_0051786 3300037471 Bacteria 3845
316 Ga0395901_0014533 3300038443 Bacteria 8005
317 Ga0237819_01098 3300038705 Bacteria 7931
318 Ga0436361_0313405 3300039447 Bacteria 87904
319 Ga0436361_0525200 3300039447 Bacteria 11317
320 Ga0436361_0857598 3300039447 Bacteria 5129
321 Ga0436361_1024184 3300039447 Bacteria 85708
322 Ga0439438_004878 3300041405 Bacteria 5035
323 Ga0439438_006624 3300041405 Bacteria 4058
324 Ga0439447_003423 3300041407 Bacteria 5642
325 Ga0439447_003817 3300041407 Bacteria 5289
326 Ga0439447_008152 3300041407 Bacteria 3264
327 Ga0439466_0000466 3300041411 Bacteria 15422
328 Ga0439466_0002245 3300041411 Bacteria 7567
329 Ga0439466_0003958 3300041411 Bacteria 5714
330 Ga0439466_0017860 3300041411 Bacteria 2550
331 Ga0439432_001621 3300042006 Bacteria 8420
332 Ga0439432_005789 3300042006 Bacteria 4440
333 Ga0439432_011624 3300042006 Bacteria 3032
334 Ga0439432_019622 3300042006 Bacteria 2251
335 Ga0439452_003753 3300042010 Bacteria 5231
336 Ga0439452_004104 3300042010 Bacteria 4951
337 Ga0439452_004757 3300042010 Bacteria 4487
338 Ga0439452_005513 3300042010 Bacteria 4065
339 Ga0439456_003040 3300042013 Bacteria 3389
340 Ga0439456_010509 3300042013 Bacteria 1913
341 Ga0439463_002333 3300042016 Bacteria 4842
342 Ga0439463_002471 3300042016 Bacteria 4693
343 Ga0450911_000027 3300042115 Bacteria 82476
344 Ga0450911_000100 3300042115 Bacteria 34941
345 Ga0450911_002622 3300042115 Bacteria 3457
346 Ga0450890_000509 3300042127 Bacteria 5716
347 Ga0450905_004727 3300042142 Bacteria 1813
348 Ga0450907_001254 3300042146 Bacteria 5697
349 Ga0450907_003651 3300042146 Bacteria 2719
350 Ga0439446_0001826 3300042156 Bacteria 4980
351 Ga0439446_0017545 3300042156 Bacteria 2001
352 Ga0439434_0003416 3300042435 Bacteria 4641
353 Ga0439459_0012881 3300042438 Bacteria 1496
354 Ga0439464_0002231 3300042439 Bacteria 4739
355 Ga0439460_0000875 3300042461 Bacteria 6881
356 Ga0450916_000042 3300042530 Bacteria 6810
357 Ga0451577_0164037 3300042876 Bacteria 2002
358 Ga0466969_0009333 3300044656 Bacteria 5199
359 Ga0466965_0000692 3300044683 Bacteria 12482
360 Ga0466966_0005876 3300044684 Bacteria 8094
361 Ga0466961_0015298 3300044693 Bacteria 4927
362 Ga0466963_0057201 3300044694 Bacteria 2597
363 Ga0466964_0001646 3300044706 Bacteria 7720
364 Ga0453684_0012190 3300044712 Bacteria 14255
365 Ga0453684_0012554 3300044712 Bacteria 13945
366 Ga0466971_0006553 3300044719 Bacteria 5059
367 Ga0466957_0002678 3300044842 Bacteria 9618
368 Ga0466959_0003818 3300045049 Bacteria 9988
369 Ga0466958_0031576 3300045836 Bacteria 3148
370 Ga0466967_0058693 3300045976 Bacteria 3402
371 Ga0495617_003398 3300046452 Bacteria 5999
372 Ga0495617_019767 3300046452 Bacteria 2277
373 Ga0495627_000102 3300046453 Bacteria 104889
374 Ga0495627_004313 3300046453 Bacteria 5977
375 Ga0495627_012419 3300046453 Bacteria 3022
376 Ga0495590_0016101 3300046457 Bacteria 2704
377 Ga0495591_000105 3300046458 Bacteria 97199
378 Ga0495591_003166 3300046458 Bacteria 8682
379 Ga0495591_004534 3300046458 Bacteria 6746
380 Ga0495591_004959 3300046458 Bacteria 6303
381 Ga0495591_006424 3300046458 Bacteria 5196
382 Ga0495591_014983 3300046458 Bacteria 2757
383 Ga0495591_015401 3300046458 Bacteria 2703
384 Ga0495591_018892 3300046458 Bacteria 2324
385 Ga0495651_0146508 3300046462 Bacteria 1706
386 Ga0495653_0022923 3300046463 Bacteria 5049
387 Ga0495653_0040147 3300046463 Bacteria 3659
388 Ga0495653_0048713 3300046463 Bacteria 3269
389 Ga0495650_0000578 3300046471 Bacteria 51315
390 Ga0495650_0015211 3300046471 Bacteria 3956
391 Ga0495650_0030023 3300046471 Bacteria 2469
392 Ga0495650_0037793 3300046471 Bacteria 2097
393 Ga0495605_0000590 3300046474 Bacteria 28966
394 Ga0495605_0000625 3300046474 Bacteria 27283
395 Ga0495605_0001226 3300046474 Bacteria 17066
396 Ga0495605_0001398 3300046474 Bacteria 15876
397 Ga0495605_0010112 3300046474 Bacteria 5284
398 Ga0495605_0027479 3300046474 Bacteria 2947
399 Ga0495605_0067345 3300046474 Bacteria 1699
400 Ga0495639_0003111 3300046475 Bacteria 7214
401 Ga0495584_0009566 3300046491 Bacteria 4993
402 Ga0495584_0012700 3300046491 Bacteria 4298
403 Ga0495584_0093849 3300046491 Bacteria 1514
404 Ga0495585_0007063 3300046492 Bacteria 6904
405 Ga0495585_0010687 3300046492 Bacteria 5452
406 Ga0495585_0028569 3300046492 Bacteria 3180
407 Ga0495585_0047158 3300046492 Bacteria 2400
408 Ga0495596_0004395 3300046500 Bacteria 6880
409 Ga0495607_0001133 3300046501 Bacteria 24182
410 Ga0495607_0001267 3300046501 Bacteria 22574
411 Ga0495607_0004588 3300046501 Bacteria 10120
412 Ga0495607_0005049 3300046501 Bacteria 9572
413 Ga0495607_0013525 3300046501 Bacteria 5346
414 Ga0495607_0030626 3300046501 Bacteria 3302
415 Ga0495607_0039997 3300046501 Bacteria 2795
416 Ga0495607_0050428 3300046501 Bacteria 2422
417 Ga0495583_0000015 3300046506 Bacteria 316392
418 Ga0495583_0000927 3300046506 Bacteria 34448
419 Ga0495583_0004981 3300046506 Bacteria 9213
420 Ga0495583_0013180 3300046506 Bacteria 4627
421 Ga0495583_0016105 3300046506 Bacteria 4036
422 Ga0495583_0023578 3300046506 Bacteria 3110
423 Ga0495583_0062515 3300046506 Bacteria 1658
424 Ga0495606_0000083 3300046507 Bacteria 159263
425 Ga0495606_0003050 3300046507 Bacteria 18259
426 Ga0495606_0008185 3300046507 Bacteria 9147
427 Ga0495606_0015235 3300046507 Bacteria 5936
428 Ga0495606_0018166 3300046507 Bacteria 5285
429 Ga0495610_0009929 3300046512 Bacteria 5954
430 Ga0495610_0011079 3300046512 Bacteria 5538
431 Ga0495616_0014738 3300046513 Bacteria 4365
432 Ga0495620_0000171 3300046515 Bacteria 51260
433 Ga0495620_0000229 3300046515 Bacteria 41859
434 Ga0495620_0005486 3300046515 Bacteria 7069
435 Ga0495620_0014267 3300046515 Bacteria 4042
436 Ga0495631_0004242 3300046518 Bacteria 7670
437 Ga0495631_0017782 3300046518 Bacteria 3356
438 Ga0495632_0007443 3300046519 Bacteria 6876
439 Ga0495632_0008782 3300046519 Bacteria 6156
440 Ga0495632_0037321 3300046519 Bacteria 2466
441 Ga0495632_0088007 3300046519 Bacteria 1475
442 Ga0495637_0000271 3300046520 Bacteria 40891
443 Ga0495637_0002084 3300046520 Bacteria 11247
444 Ga0495637_0005947 3300046520 Bacteria 6169
445 Ga0495637_0015531 3300046520 Bacteria 3571
446 Ga0495637_0019714 3300046520 Bacteria 3114
447 Ga0495637_0027237 3300046520 Bacteria 2559
448 Ga0495643_0000345 3300046522 Bacteria 63090
449 Ga0495643_0000627 3300046522 Bacteria 41961
450 Ga0495643_0002030 3300046522 Bacteria 16840
451 Ga0495643_0007948 3300046522 Bacteria 6763
452 Ga0495643_0011277 3300046522 Bacteria 5453
453 Ga0495643_0012620 3300046522 Bacteria 5089
454 Ga0495643_0017811 3300046522 Bacteria 4143
455 Ga0495643_0039455 3300046522 Bacteria 2582
456 Ga0495644_0005075 3300046523 Bacteria 5152
457 Ga0495648_0013922 3300046524 Bacteria 5922
458 Ga0495648_0022554 3300046524 Bacteria 4331
459 Ga0495648_0023818 3300046524 Bacteria 4182
460 Ga0495648_0030158 3300046524 Bacteria 3590
461 Ga0495648_0059154 3300046524 Bacteria 2287
462 Ga0495642_0000631 3300046528 Bacteria 17653
463 Ga0495642_0024565 3300046528 Bacteria 2384
464 Ga0495654_0005941 3300046530 Bacteria 7014
465 Ga0495654_0006795 3300046530 Bacteria 6459
466 Ga0495654_0015100 3300046530 Bacteria 4104
467 Ga0495654_0021575 3300046530 Bacteria 3349
468 Ga0495586_0120780 3300046535 Bacteria 1464
469 Ga0495587_0015762 3300046536 Bacteria 4712
470 Ga0495609_0000023 3300046538 Bacteria 269702
471 Ga0495609_0000458 3300046538 Bacteria 33250
472 Ga0495609_0000759 3300046538 Bacteria 24242
473 Ga0495609_0003174 3300046538 Bacteria 9560
474 Ga0495597_0000221 3300046542 Bacteria 52360
475 Ga0495597_0005155 3300046542 Bacteria 6962
476 Ga0495622_0002873 3300046557 Bacteria 8224
477 Ga0495633_0000115 3300046558 Bacteria 108676
478 Ga0495656_0003150 3300046615 Bacteria 5551
479 Ga0495668_0009606 3300046616 Bacteria 5919
480 Ga0495668_0018591 3300046616 Bacteria 4015
481 Ga0495668_0058209 3300046616 Bacteria 2133
482 Ga0495668_0107117 3300046616 Bacteria 1528
483 Ga0495634_0019357 3300046642 Bacteria 4838
484 Ga0495611_0000749 3300046648 Bacteria 18315
485 Ga0495611_0003126 3300046648 Bacteria 7342
486 Ga0495611_0046839 3300046648 Bacteria 1939
487 Ga0495625_0000187 3300046660 Bacteria 97797
488 Ga0495635_0020678 3300046663 Bacteria 4584
489 Ga0495661_0000061 3300046665 Bacteria 130811
490 Ga0495661_0000865 3300046665 Bacteria 28200
491 Ga0495661_0002054 3300046665 Bacteria 15804
492 Ga0495661_0002403 3300046665 Bacteria 14449
493 Ga0495661_0019070 3300046665 Bacteria 4499
494 Ga0495661_0079958 3300046665 Bacteria 1888
495 Ga0495623_0022811 3300046679 Bacteria 4041
496 Ga0495670_0004412 3300046691 Bacteria 6902
497 Ga0495671_0005463 3300046692 Bacteria 7438
498 Ga0495671_0009031 3300046692 Bacteria 5594
499 Ga0495671_0011710 3300046692 Bacteria 4809
500 Ga0495671_0024764 3300046692 Bacteria 3122
501 Ga0495649_0000464 3300046694 Bacteria 34868
502 Ga0495649_0004778 3300046694 Bacteria 8776
503 Ga0495649_0008513 3300046694 Bacteria 6166
504 Ga0495649_0009795 3300046694 Bacteria 5673
505 Ga0495649_0023432 3300046694 Bacteria 3449
506 Ga0495589_0008703 3300046794 Bacteria 5286
507 Ga0495589_0010021 3300046794 Bacteria 4923
508 Ga0495589_0012850 3300046794 Bacteria 4328
509 Ga0495589_0052557 3300046794 Bacteria 2012
510 Ga0495600_0003343 3300046809 Bacteria 9426
511 Ga0495660_0000831 3300046810 Bacteria 22952
512 Ga0495660_0026271 3300046810 Bacteria 3301
513 Ga0495660_0045243 3300046810 Bacteria 2417
514 Ga0495636_0010451 3300047318 Bacteria 3666
515 Ga0495672_0012072 3300047320 Bacteria 6048
516 Ga0495672_0036083 3300047320 Bacteria 3038
517 Ga0495672_0036806 3300047320 Bacteria 3002
518 Ga0495672_0090366 3300047320 Bacteria 1683
519 Ga0495676_0000011 3300047321 Bacteria 242612
520 Ga0495676_0040008 3300047321 Bacteria 3874
521 Ga0495680_0014977 3300047322 Bacteria 6697
522 Ga0495680_0094802 3300047322 Bacteria 2232
523 Ga0495683_0000106 3300047323 Bacteria 86579
524 Ga0495683_0000207 3300047323 Bacteria 55998
525 Ga0495683_0007048 3300047323 Bacteria 6100
526 Ga0495683_0008997 3300047323 Bacteria 5328
527 Ga0495683_0012111 3300047323 Bacteria 4533
528 Ga0495687_007653 3300047443 Bacteria 6321
529 Ga0495679_000274 3300047446 Bacteria 43056
530 Ga0495679_000704 3300047446 Bacteria 21744
531 Ga0495673_0001682 3300047469 Bacteria 16994
532 Ga0495673_0005616 3300047469 Bacteria 7542
533 Ga0495673_0007829 3300047469 Bacteria 6080
534 Ga0495673_0010604 3300047469 Bacteria 5001
535 Ga0495673_0014010 3300047469 Bacteria 4185
536 Ga0495681_0012867 3300047470 Bacteria 4892
537 Ga0495681_0018926 3300047470 Bacteria 3777
538 Ga0495686_0003059 3300047472 Bacteria 14830
539 Ga0495686_0075073 3300047472 Bacteria 2073
540 Ga0495593_0014851 3300047673 Bacteria 4423
541 Ga0495626_0000068 3300048091 Bacteria 139126
542 Ga0495626_0005680 3300048091 Bacteria 7222
543 Ga0495626_0007093 3300048091 Bacteria 6278
544 Ga0495626_0008893 3300048091 Bacteria 5455
545 Ga0496102_0026312 3300048905 Bacteria 5188
546 Ga0496110_0019824 3300048913 Bacteria 5668
547 Ga0496114_0005705 3300048917 Bacteria 9760
548 Ga0496114_0103367 3300048917 Bacteria 2435
549 Ga0496116_0008830 3300048919 Bacteria 8682
550 Ga0496116_0018636 3300048919 Bacteria 5341
551 Ga0496116_0021869 3300048919 Bacteria 4811
552 Ga0496117_0000961 3300048920 Bacteria 44128
553 Ga0496117_0018385 3300048920 Bacteria 5789
554 Ga0496117_0038087 3300048920 Bacteria 3572
555 Ga0496117_0039315 3300048920 Bacteria 3493
556 Ga0496117_0060179 3300048920 Bacteria 2619
557 Ga0496118_0014197 3300048921 Bacteria 7469
558 Ga0496118_0016655 3300048921 Bacteria 6735
559 Ga0496118_0023180 3300048921 Bacteria 5400
560 Ga0496118_0068461 3300048921 Bacteria 2578
561 Ga0496119_0004034 3300048922 Bacteria 14828
562 Ga0496120_0003119 3300048923 Bacteria 15545
563 Ga0496121_0011294 3300048924 Bacteria 9945
564 Ga0496121_0013055 3300048924 Bacteria 8970
565 Ga0496121_0020706 3300048924 Bacteria 6490
566 Ga0496121_0021850 3300048924 Bacteria 6248
567 Ga0496122_0001707 3300048925 Bacteria 34056
568 Ga0496122_0002086 3300048925 Bacteria 29621
569 Ga0496122_0004723 3300048925 Bacteria 16722
570 Ga0496122_0006443 3300048925 Bacteria 13471
571 Ga0496122_0019987 3300048925 Bacteria 6087
572 Ga0496122_0074921 3300048925 Bacteria 2391
573 Ga0496123_0000178 3300048926 Bacteria 128587
574 Ga0496123_0000445 3300048926 Bacteria 74126
575 Ga0496123_0000607 3300048926 Bacteria 60365
576 Ga0496123_0037585 3300048926 Bacteria 3417
577 Ga0496123_0042041 3300048926 Bacteria 3160
578 Ga0496123_0057209 3300048926 Bacteria 2540
579 Ga0496124_0000073 3300048927 Bacteria 219306
580 Ga0496124_0004545 3300048927 Bacteria 16148
581 Ga0496124_0019279 3300048927 Bacteria 6356
582 Ga0496124_0022258 3300048927 Bacteria 5817
583 Ga0496124_0033513 3300048927 Bacteria 4518
584 Ga0496125_0011967 3300048928 Bacteria 8639
585 Ga0496125_0012388 3300048928 Bacteria 8469
586 Ga0496125_0103660 3300048928 Bacteria 2086
587 Ga0496125_0123922 3300048928 Bacteria 1836
588 Ga0496126_0039798 3300048929 Bacteria 4359
589 Ga0496126_0097773 3300048929 Bacteria 2572
590 Ga0496126_0178237 3300048929 Bacteria 1807
591 Ga0495678_000017 3300049459 Bacteria 282592
592 Ga0495678_000404 3300049459 Bacteria 43644
593 Ga0495678_006385 3300049459 Bacteria 6285
594 Ga0495678_015394 3300049459 Bacteria 3518
595 Ga0495678_015771 3300049459 Bacteria 3469
596 Ga0495682_0000054 3300049460 Bacteria 104787
597 Ga0495682_0000124 3300049460 Bacteria 67600
598 Ga0495682_0007005 3300049460 Bacteria 4518
599 Ga0501033_0073415 3300049570 Bacteria 2512
600 Ga0501034_0000143 3300049571 Bacteria 133317
601 Ga0501034_0000200 3300049571 Bacteria 113556
602 Ga0501039_0028547 3300049575 Bacteria 4295
603 Ga0501040_0027158 3300049576 Bacteria 3852
604 Ga0501072_0044165 3300049588 Bacteria 3504
605 Ga0501075_0010316 3300049591 Bacteria 6564
606 Ga0501076_0000757 3300049592 Bacteria 20885
607 Ga0501222_005362 3300049662 Bacteria 1732
608 Ga0501079_0001187 3300049741 Bacteria 18244
609 Ga0501080_0080217 3300049742 Bacteria 3033
610 Ga0501081_0000552 3300049743 Bacteria 21253
611 Ga0501083_0075748 3300049744 Bacteria 2234
612 Ga0501241_008201 3300049758 Bacteria 1910
613 Ga0501226_000001 3300049853 Bacteria 432595
614 nmdc:mga0k408_1301_c1 3300050493 Bacteria 13499
615 nmdc:mga0k408_41573_c1 3300050493 Bacteria 2647
616 nmdc:mga07m45_3438_c1 3300050496 Bacteria 3093
617 nmdc:mga07m45_4618_c1 3300050496 Bacteria 6752
618 nmdc:mga05p37_41370_c1 3300050507 Bacteria 5658
619 Ga0500635_0000017 3300053080 Bacteria 113720
620 Ga0500635_0013483 3300053080 Bacteria 2375
621 Ga0500578_0000683 3300053086 Bacteria 40592
622 Ga0500652_000930 3300053131 Bacteria 9670
623 Ga0500659_0003436 3300053135 Bacteria 9256
624 Ga0500559_0010928 3300053136 Bacteria 3889
625 Ga0500622_0000001 3300053156 Bacteria 657715
626 Ga0500622_0000028 3300053156 Bacteria 218994
627 Ga0500636_0045507 3300053177 Bacteria 2588
628 Ga0466962_0001425 3300061719 Bacteria 11134
629 Ga0530510_0009039 3300061734 Bacteria 6983
630 Ga0530510_0010256 3300061734 Bacteria 6564
631 2511254009 2511231004 Bacteria 6669789
632 2511266851 2511231006 Bacteria 6794709
633 2511272443 2511231007 Bacteria 6306603
634 2511275102 2511231008 Bacteria 6624100
635 2511289394 2511231010 Bacteria 6373152
636 2511297762 2511231011 Bacteria 6149768
637 2511302826 2511231012 Bacteria 6738011
638 2511314420 2511231014 Bacteria 6462302
639 2511317222 2511231015 Bacteria 6598026
640 2511328020 2511231016 Bacteria 6704427
641 2511329659 2511231017 Bacteria 6503007
642 2511336844 2511231018 Bacteria 6436256
643 2511344807 2511231019 Bacteria 6520662
644 2511349570 2511231020 Bacteria 6115223
645 2511359298 2511231021 Bacteria 7302637
646 2511360908 2511231022 Bacteria 6719296
647 2511370984 2511231023 Bacteria 6808468
648 2511375692 2511231024 Bacteria 5835885
649 2511413476 2511231031 Bacteria 6558529
650 2511827624 2511231156 Bacteria 6845832
651 2512329503 2512047018 Bacteria 6663241
652 2555245930 2554235231 Bacteria 5215788
653 2555672825 2554235341 Bacteria 6867980
654 2583795735 2582580891 Bacteria 6800976
655 2587729511 2585428057 Bacteria 6737412
656 2587733974 2585428058 Bacteria 6853932
657 2588294591 2588253510 Bacteria 6901809
658 2597860869 2597489887 Bacteria 6666321
659 2597866619 2597489888 Bacteria 6179543
660 2597872475 2597489889 Bacteria 6297495
661 2599331154 2599185155 Bacteria 5827168
662 2599355971 2599185160 Bacteria 6844013
663 2599362627 2599185161 Bacteria 6960462
664 2599369067 2599185162 Bacteria 6957254
665 2599375736 2599185163 Bacteria 6995158
666 2599381077 2599185164 Bacteria 6841688
667 2599387407 2599185165 Bacteria 6843250
668 2599394594 2599185166 Bacteria 6959206
669 2599400550 2599185167 Bacteria 6353609
670 2599406359 2599185168 Bacteria 6997636
671 2599449874 2599185179 Bacteria 6611171
672 2599462805 2599185181 Bacteria 6844519
673 2599467772 2599185182 Bacteria 6883168
674 2599485895 2599185185 Bacteria 6652270
675 2599491822 2599185186 Bacteria 6831633
676 2599500250 2599185188 Bacteria 6164180
677 2599505741 2599185189 Bacteria 5862825
678 2599511948 2599185190 Bacteria 6285678
679 2599516932 2599185191 Bacteria 6297582
680 2599614419 2599185212 Bacteria 6765997
681 2599768162 2599185248 Bacteria 6696816
682 2599804677 2599185257 Bacteria 6492581
683 2599879026 2599185288 Bacteria 6666191
684 2599885597 2599185289 Bacteria 6778765
685 2599892690 2599185290 Bacteria 6289611
686 2599897311 2599185291 Bacteria 6775623
687 2599930720 2599185300 Bacteria 6062622
688 2599942359 2599185302 Bacteria 5954930
689 2599951440 2599185303 Bacteria 6512725
690 2599954228 2599185304 Bacteria 5951361
691 2599961901 2599185305 Bacteria 6748700
692 2599965927 2599185306 Bacteria 6637356
693 2599972217 2599185307 Bacteria 6194719
694 2599980890 2599185308 Bacteria 6621546
695 2599982929 2599185309 Bacteria 5969593
696 2599988321 2599185310 Bacteria 6014457
697 2599993980 2599185311 Bacteria 6354990
698 2599999115 2599185312 Bacteria 5912071
699 2600004325 2599185313 Bacteria 6658188
700 2600014766 2599185314 Bacteria 6621749
701 2600020386 2599185315 Bacteria 6771107
702 2600026350 2599185316 Bacteria 6320029
703 2600032100 2599185317 Bacteria 6435722
704 2600035963 2599185318 Bacteria 6961590
705 2600042327 2599185319 Bacteria 6637840
706 2600046646 2599185320 Bacteria 5963263
707 2600054936 2599185321 Bacteria 6764560
708 2600061037 2599185322 Bacteria 6763055
709 2600066379 2599185323 Bacteria 6688755
710 2600074377 2599185324 Bacteria 6590677
711 2600076549 2599185325 Bacteria 6324919
712 2600215431 2599185356 Bacteria 6843884
713 2600359003 2600254930 Bacteria 6431253
714 2600363559 2600254931 Bacteria 6734225
715 2600444088 2600254954 Bacteria 5100516
716 2600445720 2600254954 Bacteria 5100516
717 2601627300 2600255283 Bacteria 6061572
718 2601693456 2600255296 Bacteria 5784754
719 2601775597 2600255313 Bacteria 6842543
720 2601798571 2600255318 Bacteria 6383414
721 2602008427 2600255389 Bacteria 5275336
722 2602012564 2600255389 Bacteria 5275336
723 2606077465 2603880185 Bacteria 6379190
724 2606129289 2603880199 Bacteria 6377649
725 2621296857 2619619299 Bacteria 6649820
726 2624483401 2623620443 Bacteria 6427864
727 2624494921 2623620446 Bacteria 6500345
728 2643842952 2643221565 Bacteria 6216018
729 2643872253 2643221571 Bacteria 6228673
730 2643955645 2643221589 Bacteria 6250934
731 2643969636 2643221592 Bacteria 6608788
732 2644020439 2643221602 Bacteria 6249926
733 2644143936 2643221625 Bacteria 6512927
734 2644184494 2643221633 Bacteria 6733554
735 2644276357 2643221648 Bacteria 6521465
736 2644283239 2643221650 Bacteria 7029547
737 2644304782 2643221654 Bacteria 5273570
738 2644620156 2643221713 Bacteria 6554480
739 2652544923 2651869719 Bacteria 6047974
740 2671089539 2667528170 Bacteria 6786960
741 2671099267 2667528171 Bacteria 6900659
742 2671128595 2667528176 Bacteria 6724917
743 2671771684 2671180172 Bacteria 6495783
744 2677897119 2675903420 Bacteria 6247433
745 2678266137 2675903515 Bacteria 6580491
746 2715749842 2713897148 Bacteria 5883533
747 2715754858 2713897149 Bacteria 6506249
748 2718636602 2718217725 Bacteria 5758958
749 2723251355 2721755607 Bacteria 5841722
750 2738671677 2738541265 Bacteria 6594665
751 2738691946 2738541271 Bacteria 5657310
752 2738750071 2738541282 Bacteria 6593925
753 2738807242 2738541294 Bacteria 6925949
754 2738859111 2738541303 Bacteria 6591772
755 2738894602 2738541309 Bacteria 6926455
756 2739199047 2738543004 Bacteria 6381073
757 2739258988 2738543015 Bacteria 6750701
758 2739263304 2738543016 Bacteria 5657564
759 2739285133 2738543020 Bacteria 5718238
760 2739289617 2738543020 Bacteria 5718238
761 2739290447 2738543021 Bacteria 5718241
762 2739294929 2738543021 Bacteria 5718241
763 2739312517 2738543025 Bacteria 6600348
764 2743740411 2740892503 Bacteria 6855563
765 2745007369 2744054620 Bacteria 6551379
766 2765581401 2765235841 Bacteria 6137024
767 2774118389 2773857670 Bacteria 6407454
768 2774135579 2773857673 Bacteria 6513460
769 2784261830 2784132063 Bacteria 6262788
770 2784313563 2784132072 Bacteria 6596533
771 2794593850 2791355520 Bacteria 5948615
772 2808855706 2808606361 Bacteria 6136259
773 2808905735 2808606373 Bacteria 4423627
774 2808926499 2808606376 Bacteria 6248667
775 2808928454 2808606377 Bacteria 6646337
776 2808935457 2808606378 Bacteria 6177535
777 2808942154 2808606379 Bacteria 5022697
778 2808942793 2808606379 Bacteria 5022697
779 2808948660 2808606380 Bacteria 6248705
780 2808950363 2808606381 Bacteria 6646461
781 2808959855 2808606382 Bacteria 6841132
782 2808964065 2808606383 Bacteria 6138645
783 2808976138 2808606385 Bacteria 6711065
784 2808993238 2808606388 Bacteria 6706662
785 2808999099 2808606389 Bacteria 6138126
786 2809217174 2808606445 Bacteria 6057339
787 2817494030 2816332298 Bacteria 6852809
788 2819655119 2818991456 Bacteria 6123676
789 2819704389 2818991464 Bacteria 6907494
790 2823424048 2823421272 Bacteria 5372474
791 2823425716 2823421272 Bacteria 5372474
792 2825655106 2825651385 Bacteria 6715909
793 2826581927 2826581358 Bacteria 5963467
794 2834030939 2834028612 Bacteria 6354979
795 2842806224 2842805378 Bacteria 5385175
796 2842807777 2842805378 Bacteria 5385175
797 2842816818 2842815866 Bacteria 5947510
798 2842831296 2842826826 Bacteria 5974129
799 2842833449 2842832357 Bacteria 5959113
800 2842837888 2842837860 Bacteria 6066181
801 2842845679 2842843487 Bacteria 6004777
802 2842853967 2842849001 Bacteria 5924277
803 2842855610 2842854478 Bacteria 6143501
804 2844667076 2844665904 Bacteria 6817974
805 2852616340 2852612431 Bacteria 6885235
806 2852659666 2852657418 Bacteria 6472974
807 2852671308 2852667396 Bacteria 6885555
808 2860341702 2860339153 Bacteria 6846989
809 2860873017 2860867994 Bacteria 5645326
810 2878035343 2878029506 Bacteria 6418441
811 2880235984 2880230671 Bacteria 6140320
812 2904518968 2904518522 Bacteria 6068986
813 2904551339 2904550169 Bacteria 6221258
814 2908452570 2908446538 Bacteria 6829095
815 2912968885 2912963787 Bacteria 5646108
816 2913042518 2913036834 Bacteria 6704877
817 2917076721 2917070673 Bacteria 6868303
818 2919065528 2919063839 Bacteria 6302690
819 2919155905 2919155634 Bacteria 4860545
820 2919389200 2919385768 Bacteria 5897293
821 2919457536 2919456309 Bacteria 6586567
822 2919485645 2919481497 Bacteria 6907839
823 2919488177 2919487758 Bacteria 5929766
824 2919502463 2919501602 Bacteria 5286340
825 2919503701 2919501602 Bacteria 5286340
826 2919700587 2919697872 Bacteria 6553725
827 2923159504 2923153595 Bacteria 6870622
828 2923526223 2923525760 Bacteria 4472324
829 2923588988 2923586266 Bacteria 6565975
830 2926064136 2926063275 Bacteria 5285848
831 2926065727 2926063275 Bacteria 5285848
832 2929149909 2929144301 Bacteria 6622272
833 2929195139 2929189879 Bacteria 5930554
834 2931372651 2931369376 Bacteria 6847892
835 2931396399 2931390751 Bacteria 6273349
836 2931398067 2931396565 Bacteria 7251677
837 2935358312 2935353572 Unclassified 6955622
838 2939640816 2939636861 Bacteria 6297853
839 2939654226 2939651529 Bacteria 5895393
840 2945930920 2945928738 Bacteria 6053221
841 2945966844 2945961074 Bacteria 7342064
842 2946013297 2946006987 Bacteria 6705746
843 2946027892 2946027586 Bacteria 6049274
844 2947234412 2947233263 Bacteria 6439278
845 2969310163 2969304461 Bacteria 6601805
846 2974294089 2974289157 Bacteria 6080362
847 2984286612 2984286254 Bacteria 6702062
848 2988731450 2988728565 Bacteria 6124362
849 2990199686 2990196909 Bacteria 4054280
850 2998145386 2998139840 Bacteria 6073514
851 3007255270 3007252601 Bacteria 4559114
852 3007315928 3007315729 Bacteria 5076637
853 3007399409 3007395558 Bacteria 6755444
854 3007419828 3007419365 Bacteria 7026924
855 3007517167 3007511990 Bacteria 6481491
856 3007618520 3007614139 Bacteria 6053559
857 3007622511 3007619802 Bacteria 6411688
858 3007721744 3007718800 Bacteria 5971527
859 3007803577 3007803356 Bacteria 5931491
860 3007859181 3007855910 Bacteria 5637581
861 3007865113 3007861166 Bacteria 6045338
862 3007866790 3007866637 Bacteria 5899198
863 637323262 637000220 Bacteria 7074893
864 8015693603 8015687852 Bacteria 6613826
865 8019769781 8019769354 Bacteria 6924660
866 8019777694 8019775933 Bacteria 6858656
867 8029995515 8029995093 Bacteria 5990776
868 8052494845 8052494512 Bacteria 5765634
869 8052496366 8052494512 Bacteria 5765634
870 8054287908 8054285046 Bacteria 6919322
871 8054349593 8054347763 Bacteria 5901107
872 8054508921 8054503363 Bacteria 6101651
873 8055776849 8055770955 Bacteria 6827675
874 8055823890 8055817908 Bacteria 6609162
875 8056131593 8056125926 Bacteria 6228218
876 8056137297 8056131705 Bacteria 6107031
877 8056148759 8056143049 Bacteria 6307666
878 8056151505 8056148874 Bacteria 6479865
879 8056160840 8056155041 Bacteria 6486948
880 8056163621 8056161164 Bacteria 6106669
881 8056171318 8056166840 Bacteria 5820959
882 8056177420 8056172158 Bacteria 6133900
883 8056181988 8056177738 Bacteria 6748268
884 8056570454 8056569372 Bacteria 5997322
885 Ga0439438_007901
886 MRS2a_Contig_136
887 SwRhRL2b_contig_180730
888 JGI24741J21665_1004873
889 JGI25156J39149_1000278
890 JGI25156J39149_1000973
891 JGI25156J39149_1009634
892 JGI25162J39368_1000505
893 JGI25162J39368_1000520
894 JGI25154J39366_1000221
895 JGI25157J39369_1000049
896 JGI25163J39215_1002359
897 JGI25164J39214_1000342
898 JGI25164J39214_1000350
899 JGI25165J46597_1000629
900 JGI25165J46597_1000645
901 rootH1_10025580
902 Ga0055538_1000007
903 Ga0055538_1000032
904 Ga0055539_1000043
905 Ga0055539_1000583
906 Ga0055539_1001782
907 Ga0055533_1000010
908 Ga0055533_1000052
909 Ga0055532_1000047
910 Ga0055525_1000062
911 Ga0055525_1000775
912 Ga0055535_1000607
913 Ga0055535_1000906
914 Ga0055535_1004623
915 Ga0055529_1000731
916 Ga0055536_1001013
917 Ga0055536_1004708
918 Ga0055536_1004755
919 Ga0055530_10000150
920 Ga0055530_10001395
921 Ga0055530_10004701
922 Ga0055530_10009077
923 Ga0055540_1000175
924 Ga0055540_1002862
925 Ga0055540_1003956
926 Ga0055540_1007251
927 Ga0055531_10008572
928 Ga0055541_1000030
929 Ga0058692_1001311
930 Ga0065165_1000774
931 Ga0065714_10003458
932 Ga0065714_10008011
933 Ga0065714_10019612
934 Ga0065704_10071473
935 Ga0065712_10000927
936 Ga0065712_10069335
937 Ga0065712_10072290
938 Ga0065715_10002954
939 Ga0070658_10136714
940 Ga0070670_100001953
941 Ga0070670_100210681
942 Ga0068869_100053998
943 Ga0070660_100097909
944 Ga0070661_100001640
945 Ga0070669_100002598
946 Ga0070669_100011283
947 Ga0070663_100034782
948 Ga0070662_100008312
949 Ga0070662_100078941
950 Ga0068853_100000187
951 Ga0070665_100078213
952 Ga0068855_100052495
953 Ga0070664_100001886
954 Ga0068857_100024975
955 Ga0068861_100040263
956 Ga0068851_10000007
957 Ga0075364_10154732
958 Ga0075432_10007217
959 Ga0075432_10009884
960 Ga0075432_10015661
961 Ga0075366_10001453
962 Ga0075366_10006476
963 Ga0075366_10006521
964 Ga0075370_10016883
965 Ga0075434_100203650
966 Ga0099823_1000043
967 Ga0099823_1000050
968 Ga0099823_1022982
969 Ga0099823_1063234
970 Ga0079104_1001103
971 Ga0079104_1003465
972 Ga0099826_10004877
973 Ga0105251_10000024
974 Ga0105251_10002156
975 Ga0105251_10004294
976 Ga0105251_10015050
977 Ga0105251_10018016
978 Ga0105251_10018659
979 Ga0105251_10054573
980 Ga0105244_10000265
981 Ga0105244_10000542
982 Ga0105244_10007755
983 Ga0105244_10014617
984 Ga0105244_10018100
985 Ga0105244_10025226
986 Ga0105244_10028356
987 Ga0105244_10080040
988 Ga0105250_10001113
989 Ga0105250_10012888
990 Ga0105240_10072481
991 Ga0111539_10344589
992 Ga0105243_10001572
993 Ga0105243_10001599
994 Ga0105243_10011620
995 Ga0105243_10052138
996 Ga0105243_10125045
997 Ga0105242_10001499
998 Ga0105242_10194169
999 Ga0105248_10007834
1000 Ga0105237_10010598
1001 Ga0105237_10111123
1002 Ga0105238_10170899
1003 Ga0105249_10007064
1004 Ga0105239_10025926
1005 Ga0105246_10002803
1006 Ga0105246_10007983
1007 Ga0105246_10011130
1008 Ga0157337_1000729
1009 Ga0157345_1000705
1010 Ga0157373_10013919
1011 Ga0157373_10033727
1012 Ga0157373_10047177
1013 Ga0157371_10001604
1014 Ga0157371_10013168
1015 Ga0157371_10013733
1016 Ga0157371_10038069
1017 Ga0157371_10043778
1018 Ga0157370_10003242
1019 Ga0157370_10003759
1020 Ga0157370_10063716
1021 Ga0157370_10069376
1022 Ga0157370_10084960
1023 Ga0157370_10135753
1024 Ga0157369_10030463
1025 Ga0157369_10043726
1026 Ga0157369_10055802
1027 Ga0157369_10122753
1028 Ga0157369_10166556
1029 Ga0157369_10301600
1030 Ga0163162_10030569
1031 Ga0157372_10015782
1032 Ga0157375_10152615
1033 Ga0157375_10256711
1034 Ga0182008_10006484
1035 Ga0182008_10007506
1036 Ga0157379_10070294
1037 Ga0182006_1003062
1038 Ga0182006_1012007
1039 Ga0182006_1030231
1040 Ga0182006_1052089
1041 Ga0182007_10002733
1042 Ga0182005_1002836
1043 Ga0182005_1003780
1044 Ga0182005_1008200
1045 Ga0163161_10089329
1046 Ga0163161_10093556
1047 Ga0213872_10000066
1048 Ga0213872_10000187
1049 Ga0213872_10062256
1050 Ga0209760_100027
1051 Ga0209760_100197
1052 Ga0209784_100007
1053 Ga0209566_100009
1054 Ga0209674_100003
1055 Ga0209674_100021
1056 Ga0209147_100009
1057 Ga0209563_100018
1058 Ga0209563_100049
1059 Ga0209563_101931
1060 Ga0207427_100005
1061 Ga0207427_100006
1062 Ga0207427_100280
1063 Ga0209437_100013
1064 Ga0209437_100018
1065 Ga0209437_101479
1066 Ga0209258_100163
1067 Ga0209258_100169
1068 Ga0209646_1000138
1069 Ga0209646_1000184
1070 Ga0209026_1000021
1071 Ga0209677_100012
1072 Ga0209677_100145
1073 Ga0209677_100209
1074 Ga0209677_107310
1075 Ga0209759_1000025
1076 Ga0209759_1001401
1077 Ga0209759_1002119
1078 Ga0209759_1010090
1079 Ga0209759_1011333
1080 Ga0209233_1000021
1081 Ga0209233_1000022
1082 Ga0209455_1000059
1083 Ga0209673_1005874
1084 Ga0209675_1002099
1085 Ga0209676_1000015
1086 Ga0209676_1000030
1087 Ga0209676_1000041
1088 Ga0209676_1000617
1089 Ga0209676_1001192
1090 Ga0209676_1005922
1091 Ga0209676_1007365
1092 Ga0209050_1000024
1093 Ga0209050_1000030
1094 Ga0209050_1000374
1095 Ga0209050_1000518
1096 Ga0209050_1000647
1097 Ga0209051_1000012
1098 Ga0209051_1000023
1099 Ga0209051_1000881
1100 Ga0209051_1003155
1101 Ga0209051_1005236
1102 Ga0209257_1000069
1103 Ga0209257_1004945
1104 Ga0207656_10000006
1105 Ga0207696_1000031
1106 Ga0207696_1000050
1107 Ga0207696_1000105
1108 Ga0207696_1000156
1109 Ga0207696_1000541
1110 Ga0207696_1008940
1111 Ga0207696_1009541
1112 Ga0207696_1013612
1113 Ga0207655_1000014
1114 Ga0207655_1000202
1115 Ga0207655_1000216
1116 Ga0207655_1000295
1117 Ga0207655_1000388
1118 Ga0207655_1001189
1119 Ga0207655_1002393
1120 Ga0207655_1002424
1121 Ga0207655_1005954
1122 Ga0207655_1007793
1123 Ga0207655_1009633
1124 Ga0207655_1012780
1125 Ga0207655_1013044
1126 Ga0207655_1020188
1127 Ga0207655_1027790
1128 Ga0207713_1000010
1129 Ga0207713_1000077
1130 Ga0207713_1001506
1131 Ga0207713_1003359
1132 Ga0207713_1003953
1133 Ga0207713_1004110
1134 Ga0207713_1004772
1135 Ga0207713_1007874
1136 Ga0207713_1009206
1137 Ga0207713_1019128
1138 Ga0207713_1028390
1139 Ga0207705_10020837
1140 Ga0207671_10000131
1141 Ga0207657_10029841
1142 Ga0207649_10000012
1143 Ga0207681_10000099
1144 Ga0207681_10008578
1145 Ga0207650_10000157
1146 Ga0207650_10000185
1147 Ga0207650_10071195
1148 Ga0207690_10070448
1149 Ga0207706_10001069
1150 Ga0207706_10009625
1151 Ga0207686_10000319
1152 Ga0207709_10000071
1153 Ga0207709_10000337
1154 Ga0207709_10045241
1155 Ga0207709_10081986
1156 Ga0207711_10056958
1157 Ga0207689_10014227
1158 Ga0207679_10000015
1159 Ga0207667_10009539
1160 Ga0207712_10004516
1161 Ga0207640_10072216
1162 Ga0207677_10180154
1163 Ga0207639_10000775
1164 Ga0207678_10015659
1165 Ga0207702_10000800
1166 Ga0207674_10043460
1167 Ga0207675_100052490
1168 Ga0209281_1000016
1169 Ga0209281_1000019
1170 Ga0209281_1001944
1171 Ga0209389_1000017
1172 Ga0209389_1000053
1173 Ga0209389_1072180
1174 Ga0209371_1000032
1175 Ga0207428_10027106
1176 Ga0207428_10111895
1177 Ga0265336_10000006
1178 Ga0307515_10023444
1179 Ga0265324_10002529
1180 Ga0268256_1000050
1181 Ga0307511_10083198
1182 Ga0314311_1099326
1183 Ga0316178_1008333
1184 Ga0307408_100000002
1185 Ga0307408_100000077
1186 Ga0307408_100022947
1187 Ga0307408_100047222
1188 Ga0307514_10001133
1189 Ga0307516_10000878
1190 Ga0307405_10024462
1191 Ga0307409_100129357
1192 Ga0307416_100206385
1193 Ga0307414_10016650
1194 Ga0307414_10026324
1195 Ga0307411_10066333
1196 Ga0307510_10122871
1197 Ga0373937_0023779
1198 Ga0373937_0119750
1199 Ga0395905_0051786
1200 Ga0395901_0014533
1201 Ga0237819_01098
1202 Ga0436361_0313405
1203 Ga0436361_0525200
1204 Ga0436361_0857598
1205 Ga0436361_1024184
1206 Ga0439438_004878
1207 Ga0439438_006624
1208 Ga0439447_003423
1209 Ga0439447_003817
1210 Ga0439447_008152
1211 Ga0439466_0000466
1212 Ga0439466_0002245
1213 Ga0439466_0003958
1214 Ga0439466_0017860
1215 Ga0439432_001621
1216 Ga0439432_005789
1217 Ga0439432_011624
1218 Ga0439432_019622
1219 Ga0439452_003753
1220 Ga0439452_004104
1221 Ga0439452_004757
1222 Ga0439452_005513
1223 Ga0439456_003040
1224 Ga0439456_010509
1225 Ga0439463_002333
1226 Ga0439463_002471
1227 Ga0450911_000027
1228 Ga0450911_000100
1229 Ga0450911_002622
1230 Ga0450890_000509
1231 Ga0450905_004727
1232 Ga0450907_001254
1233 Ga0450907_003651
1234 Ga0439446_0001826
1235 Ga0439446_0017545
1236 Ga0439434_0003416
1237 Ga0439459_0012881
1238 Ga0439464_0002231
1239 Ga0439460_0000875
1240 Ga0450916_000042
1241 Ga0451577_0164037
1242 Ga0466969_0009333
1243 Ga0466965_0000692
1244 Ga0466966_0005876
1245 Ga0466961_0015298
1246 Ga0466963_0057201
1247 Ga0466964_0001646
1248 Ga0453684_0012190
1249 Ga0453684_0012554
1250 Ga0466971_0006553
1251 Ga0466957_0002678
1252 Ga0466959_0003818
1253 Ga0466958_0031576
1254 Ga0466967_0058693
1255 Ga0495617_003398
1256 Ga0495617_019767
1257 Ga0495627_000102
1258 Ga0495627_004313
1259 Ga0495627_012419
1260 Ga0495590_0016101
1261 Ga0495591_000105
1262 Ga0495591_003166
1263 Ga0495591_004534
1264 Ga0495591_004959
1265 Ga0495591_006424
1266 Ga0495591_014983
1267 Ga0495591_015401
1268 Ga0495591_018892
1269 Ga0495651_0146508
1270 Ga0495653_0022923
1271 Ga0495653_0040147
1272 Ga0495653_0048713
1273 Ga0495650_0000578
1274 Ga0495650_0015211
1275 Ga0495650_0030023
1276 Ga0495650_0037793
1277 Ga0495605_0000590
1278 Ga0495605_0000625
1279 Ga0495605_0001226
1280 Ga0495605_0001398
1281 Ga0495605_0010112
1282 Ga0495605_0027479
1283 Ga0495605_0067345
1284 Ga0495639_0003111
1285 Ga0495584_0009566
1286 Ga0495584_0012700
1287 Ga0495584_0093849
1288 Ga0495585_0007063
1289 Ga0495585_0010687
1290 Ga0495585_0028569
1291 Ga0495585_0047158
1292 Ga0495596_0004395
1293 Ga0495607_0001133
1294 Ga0495607_0001267
1295 Ga0495607_0004588
1296 Ga0495607_0005049
1297 Ga0495607_0013525
1298 Ga0495607_0030626
1299 Ga0495607_0039997
1300 Ga0495607_0050428
1301 Ga0495583_0000015
1302 Ga0495583_0000927
1303 Ga0495583_0004981
1304 Ga0495583_0013180
1305 Ga0495583_0016105
1306 Ga0495583_0023578
1307 Ga0495583_0062515
1308 Ga0495606_0000083
1309 Ga0495606_0003050
1310 Ga0495606_0008185
1311 Ga0495606_0015235
1312 Ga0495606_0018166
1313 Ga0495610_0009929
1314 Ga0495610_0011079
1315 Ga0495616_0014738
1316 Ga0495620_0000171
1317 Ga0495620_0000229
1318 Ga0495620_0005486
1319 Ga0495620_0014267
1320 Ga0495631_0004242
1321 Ga0495631_0017782
1322 Ga0495632_0007443
1323 Ga0495632_0008782
1324 Ga0495632_0037321
1325 Ga0495632_0088007
1326 Ga0495637_0000271
1327 Ga0495637_0002084
1328 Ga0495637_0005947
1329 Ga0495637_0015531
1330 Ga0495637_0019714
1331 Ga0495637_0027237
1332 Ga0495643_0000345
1333 Ga0495643_0000627
1334 Ga0495643_0002030
1335 Ga0495643_0007948
1336 Ga0495643_0011277
1337 Ga0495643_0012620
1338 Ga0495643_0017811
1339 Ga0495643_0039455
1340 Ga0495644_0005075
1341 Ga0495648_0013922
1342 Ga0495648_0022554
1343 Ga0495648_0023818
1344 Ga0495648_0030158
1345 Ga0495648_0059154
1346 Ga0495642_0000631
1347 Ga0495642_0024565
1348 Ga0495654_0005941
1349 Ga0495654_0006795
1350 Ga0495654_0015100
1351 Ga0495654_0021575
1352 Ga0495586_0120780
1353 Ga0495587_0015762
1354 Ga0495609_0000023
1355 Ga0495609_0000458
1356 Ga0495609_0000759
1357 Ga0495609_0003174
1358 Ga0495597_0000221
1359 Ga0495597_0005155
1360 Ga0495622_0002873
1361 Ga0495633_0000115
1362 Ga0495656_0003150
1363 Ga0495668_0009606
1364 Ga0495668_0018591
1365 Ga0495668_0058209
1366 Ga0495668_0107117
1367 Ga0495634_0019357
1368 Ga0495611_0000749
1369 Ga0495611_0003126
1370 Ga0495611_0046839
1371 Ga0495625_0000187
1372 Ga0495635_0020678
1373 Ga0495661_0000061
1374 Ga0495661_0000865
1375 Ga0495661_0002054
1376 Ga0495661_0002403
1377 Ga0495661_0019070
1378 Ga0495661_0079958
1379 Ga0495623_0022811
1380 Ga0495670_0004412
1381 Ga0495671_0005463
1382 Ga0495671_0009031
1383 Ga0495671_0011710
1384 Ga0495671_0024764
1385 Ga0495649_0000464
1386 Ga0495649_0004778
1387 Ga0495649_0008513
1388 Ga0495649_0009795
1389 Ga0495649_0023432
1390 Ga0495589_0008703
1391 Ga0495589_0010021
1392 Ga0495589_0012850
1393 Ga0495589_0052557
1394 Ga0495600_0003343
1395 Ga0495660_0000831
1396 Ga0495660_0026271
1397 Ga0495660_0045243
1398 Ga0495636_0010451
1399 Ga0495672_0012072
1400 Ga0495672_0036083
1401 Ga0495672_0036806
1402 Ga0495672_0090366
1403 Ga0495676_0000011
1404 Ga0495676_0040008
1405 Ga0495680_0014977
1406 Ga0495680_0094802
1407 Ga0495683_0000106
1408 Ga0495683_0000207
1409 Ga0495683_0007048
1410 Ga0495683_0008997
1411 Ga0495683_0012111
1412 Ga0495687_007653
1413 Ga0495679_000274
1414 Ga0495679_000704
1415 Ga0495673_0001682
1416 Ga0495673_0005616
1417 Ga0495673_0007829
1418 Ga0495673_0010604
1419 Ga0495673_0014010
1420 Ga0495681_0012867
1421 Ga0495681_0018926
1422 Ga0495686_0003059
1423 Ga0495686_0075073
1424 Ga0495593_0014851
1425 Ga0495626_0000068
1426 Ga0495626_0005680
1427 Ga0495626_0007093
1428 Ga0495626_0008893
1429 Ga0496102_0026312
1430 Ga0496110_0019824
1431 Ga0496114_0005705
1432 Ga0496114_0103367
1433 Ga0496116_0008830
1434 Ga0496116_0018636
1435 Ga0496116_0021869
1436 Ga0496117_0000961
1437 Ga0496117_0018385
1438 Ga0496117_0038087
1439 Ga0496117_0039315
1440 Ga0496117_0060179
1441 Ga0496118_0014197
1442 Ga0496118_0016655
1443 Ga0496118_0023180
1444 Ga0496118_0068461
1445 Ga0496119_0004034
1446 Ga0496120_0003119
1447 Ga0496121_0011294
1448 Ga0496121_0013055
1449 Ga0496121_0020706
1450 Ga0496121_0021850
1451 Ga0496122_0001707
1452 Ga0496122_0002086
1453 Ga0496122_0004723
1454 Ga0496122_0006443
1455 Ga0496122_0019987
1456 Ga0496122_0074921
1457 Ga0496123_0000178
1458 Ga0496123_0000445
1459 Ga0496123_0000607
1460 Ga0496123_0037585
1461 Ga0496123_0042041
1462 Ga0496123_0057209
1463 Ga0496124_0000073
1464 Ga0496124_0004545
1465 Ga0496124_0019279
1466 Ga0496124_0022258
1467 Ga0496124_0033513
1468 Ga0496125_0011967
1469 Ga0496125_0012388
1470 Ga0496125_0103660
1471 Ga0496125_0123922
1472 Ga0496126_0039798
1473 Ga0496126_0097773
1474 Ga0496126_0178237
1475 Ga0495678_000017
1476 Ga0495678_000404
1477 Ga0495678_006385
1478 Ga0495678_015394
1479 Ga0495678_015771
1480 Ga0495682_0000054
1481 Ga0495682_0000124
1482 Ga0495682_0007005
1483 Ga0501033_0073415
1484 Ga0501034_0000143
1485 Ga0501034_0000200
1486 Ga0501039_0028547
1487 Ga0501040_0027158
1488 Ga0501072_0044165
1489 Ga0501075_0010316
1490 Ga0501076_0000757
1491 Ga0501222_005362
1492 Ga0501079_0001187
1493 Ga0501080_0080217
1494 Ga0501081_0000552
1495 Ga0501083_0075748
1496 Ga0501241_008201
1497 Ga0501226_000001
1498 nmdc:mga0k408_1301_c1
1499 nmdc:mga0k408_41573_c1
1500 nmdc:mga07m45_3438_c1
1501 nmdc:mga07m45_4618_c1
1502 nmdc:mga05p37_41370_c1
1503 Ga0500635_0000017
1504 Ga0500635_0013483
1505 Ga0500578_0000683
1506 Ga0500652_000930
1507 Ga0500659_0003436
1508 Ga0500559_0010928
1509 Ga0500622_0000001
1510 Ga0500622_0000028
1511 Ga0500636_0045507
1512 Ga0466962_0001425
1513 Ga0530510_0009039
1514 Ga0530510_0010256
1515 2511254009
1516 2511266851
1517 2511272443
1518 2511275102
1519 2511289394
1520 2511297762
1521 2511302826
1522 2511314420
1523 2511317222
1524 2511328020
1525 2511329659
1526 2511336844
1527 2511344807
1528 2511349570
1529 2511359298
1530 2511360908
1531 2511370984
1532 2511375692
1533 2511413476
1534 2511827624
1535 2512329503
1536 2555245930
1537 2555672825
1538 2583795735
1539 2587729511
1540 2587733974
1541 2588294591
1542 2597860869
1543 2597866619
1544 2597872475
1545 2599331154
1546 2599355971
1547 2599362627
1548 2599369067
1549 2599375736
1550 2599381077
1551 2599387407
1552 2599394594
1553 2599400550
1554 2599406359
1555 2599449874
1556 2599462805
1557 2599467772
1558 2599485895
1559 2599491822
1560 2599500250
1561 2599505741
1562 2599511948
1563 2599516932
1564 2599614419
1565 2599768162
1566 2599804677
1567 2599879026
1568 2599885597
1569 2599892690
1570 2599897311
1571 2599930720
1572 2599942359
1573 2599951440
1574 2599954228
1575 2599961901
1576 2599965927
1577 2599972217
1578 2599980890
1579 2599982929
1580 2599988321
1581 2599993980
1582 2599999115
1583 2600004325
1584 2600014766
1585 2600020386
1586 2600026350
1587 2600032100
1588 2600035963
1589 2600042327
1590 2600046646
1591 2600054936
1592 2600061037
1593 2600066379
1594 2600074377
1595 2600076549
1596 2600215431
1597 2600359003
1598 2600363559
1599 2600444088
1600 2600445720
1601 2601627300
1602 2601693456
1603 2601775597
1604 2601798571
1605 2602008427
1606 2602012564
1607 2606077465
1608 2606129289
1609 2621296857
1610 2624483401
1611 2624494921
1612 2643842952
1613 2643872253
1614 2643955645
1615 2643969636
1616 2644020439
1617 2644143936
1618 2644184494
1619 2644276357
1620 2644283239
1621 2644304782
1622 2644620156
1623 2652544923
1624 2671089539
1625 2671099267
1626 2671128595
1627 2671771684
1628 2677897119
1629 2678266137
1630 2715749842
1631 2715754858
1632 2718636602
1633 2723251355
1634 2738671677
1635 2738691946
1636 2738750071
1637 2738807242
1638 2738859111
1639 2738894602
1640 2739199047
1641 2739258988
1642 2739263304
1643 2739285133
1644 2739289617
1645 2739290447
1646 2739294929
1647 2739312517
1648 2743740411
1649 2745007369
1650 2765581401
1651 2774118389
1652 2774135579
1653 2784261830
1654 2784313563
1655 2794593850
1656 2808855706
1657 2808905735
1658 2808926499
1659 2808928454
1660 2808935457
1661 2808942154
1662 2808942793
1663 2808948660
1664 2808950363
1665 2808959855
1666 2808964065
1667 2808976138
1668 2808993238
1669 2808999099
1670 2809217174
1671 2817494030
1672 2819655119
1673 2819704389
1674 2823424048
1675 2823425716
1676 2825655106
1677 2826581927
1678 2834030939
1679 2842806224
1680 2842807777
1681 2842816818
1682 2842831296
1683 2842833449
1684 2842837888
1685 2842845679
1686 2842853967
1687 2842855610
1688 2844667076
1689 2852616340
1690 2852659666
1691 2852671308
1692 2860341702
1693 2860873017
1694 2878035343
1695 2880235984
1696 2904518968
1697 2904551339
1698 2908452570
1699 2912968885
1700 2913042518
1701 2917076721
1702 2919065528
1703 2919155905
1704 2919389200
1705 2919457536
1706 2919485645
1707 2919488177
1708 2919502463
1709 2919503701
1710 2919700587
1711 2923159504
1712 2923526223
1713 2923588988
1714 2926064136
1715 2926065727
1716 2929149909
1717 2929195139
1718 2931372651
1719 2931396399
1720 2931398067
1721 2935358312
1722 2939640816
1723 2939654226
1724 2945930920
1725 2945966844
1726 2946013297
1727 2946027892
1728 2947234412
1729 2969310163
1730 2974294089
1731 2984286612
1732 2988731450
1733 2990199686
1734 2998145386
1735 3007255270
1736 3007315928
1737 3007399409
1738 3007419828
1739 3007517167
1740 3007618520
1741 3007622511
1742 3007721744
1743 3007803577
1744 3007859181
1745 3007865113
1746 3007866790
1747 637323262
1748 8015693603
1749 8019769781
1750 8019777694
1751 8029995515
1752 8052494845
1753 8052496366
1754 8054287908
1755 8054349593
1756 8054508921
1757 8055776849
1758 8055823890
1759 8056131593
1760 8056137297
1761 8056148759
1762 8056151505
1763 8056160840
1764 8056163621
1765 8056171318
1766 8056177420
1767 8056181988
1768 8056570454

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

47

465

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gwi-assembly1.cif.gz_A the crystal structure of halomonas elongata amino-transferase 0.9855 7 431
7q9x-assembly1.cif.gz_AAA crystal structure of chromobacterium violaceum aminotransferase in complex with plp-pyruvate adduct 0.9823 9 432
4a72-assembly2.cif.gz_C crystal structure of the omega transaminase from chromobacterium violaceum in a mixture of apo and plp-bound states 0.9799 9 432
6snu-assembly1.cif.gz_B crystal structure of the w60c mutant of the (s)-selective transaminase from chromobacterium violaceum 0.9793 5 432
7ypm-assembly2.cif.gz_D crystal structure of transaminase cc1012 complexed with plp and l-alanine 0.9704 5 432
ID Description Score Start End Superfamily
5ti8B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9967 323 430 3.90.1150.10
3hmuB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9747 64 321 3.40.640.10
af_Q59ZF3_365_473_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9632 333 422 3.90.1150.10
5kquA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9612 64 319 3.40.640.10
af_Q58696_369_458_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9599 339 425 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A3C1AN13-F1-model_v4 deleted 0.9988 350 430
AF-A0A355R1U6-F1-model_v4 Aspartate aminotransferase family protein 0.9935 178 431 GO:0005829
GO:0008483
GO:0030170
AF-A0A1G3EAD8-F1-model_v4 Aminotransferase 0.9873 1 393 GO:0005829
GO:0008483
GO:0030170
AF-A0A355R1U6-F1-model_v4 Aspartate aminotransferase family protein 0.9858 178 431 GO:0005829
GO:0008483
GO:0030170
AF-A0A354FKU3-F1-model_v4 Aspartate aminotransferase family protein 0.9842 43 432 GO:0005829
GO:0008483
GO:0030170

Map