F484635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 884 | 527 | 1768 | 454 |
Family's Representative Sequence
| Representative Sequence | 3300041405|Ga0439438_007901|Ga0439438_007901_1478_2902 |
| Length | 474 |
| Sequence | MRRAPLMLAALSLKNLRRVRMTSNNPQTREWQTLSNDHHLAPFSDFKQLKEKGPRIITNAKGVYLWDSEGNKILDGMAGLWCVAIGYGRDELADAASKQMRELPYYNLFFQTAHPPVLELAKAISDIAPQGMNHVFFTGSGSEGNDTMLRMVRHYWAIKGQPKKKVIISRKNGYHGSTVAGASLGGMTYMHEQGDLPIPGIVHIAQPYWFAEGGEMTPEEFGVWAANQLEEKILEVGVDNVGAFIAEPIQGAGGVIIPPATYWPRIKEILAKYDILFVADEVICGFGRTGEWFGSDFYDLKPDMMTIAKGLTSGYIPMGGLIVRDEVVEVLNEGGDFNHGFTYSGHPVAAAVALENIRILREEKIIERVHAETAPYLQKRLRELSDHPLVGEVRGVGLLGAIELVQDKATRKRYEGKGAGMICRTFCFENGLIMRAVGDTMIIAPPLVITPAEIDELVTKARKCLDLTLSALQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 52 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 53 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 54 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 68 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 83 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 94 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 131 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 132 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 136 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 139 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 140 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 141 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 142 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 143 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 148 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 149 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 154 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 155 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 156 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 157 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 158 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 159 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 160 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 161 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 162 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 163 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 164 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 165 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 166 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 167 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 168 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 169 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 170 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 171 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 172 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 173 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 174 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 175 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 176 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 177 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 178 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 179 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 183 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 184 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 246 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 247 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 248 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 249 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 250 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 251 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 252 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 253 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 266 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 272 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 273 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 276 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 277 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 278 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 279 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 280 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 281 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 282 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 284 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 285 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 286 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 287 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 288 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 289 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 290 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 291 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 292 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 293 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 294 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 295 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 296 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 297 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 298 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 299 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 300 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 301 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 302 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 303 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 304 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 305 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 306 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 307 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 308 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 309 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 310 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 311 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 312 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 313 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 314 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 315 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 316 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 317 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 318 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 319 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 320 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 321 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 322 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 323 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 324 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 325 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 326 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 327 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 328 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 329 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 330 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 331 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 332 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 333 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 334 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 335 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 336 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 337 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 338 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 339 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 340 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 341 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 342 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 343 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 344 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 345 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 346 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 347 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 348 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 349 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 350 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 351 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 352 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 353 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 354 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 355 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 356 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 357 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 358 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 359 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 360 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 361 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 362 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 363 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 364 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 365 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 366 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 367 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 368 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 369 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 370 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 371 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 372 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 373 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 374 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 375 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 376 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 377 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 378 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 379 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 380 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 381 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 382 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 383 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 384 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 385 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 386 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 387 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 388 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 389 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 390 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 391 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 392 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 393 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 394 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 395 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 396 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 397 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 398 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 399 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 400 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 401 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 402 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 403 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 404 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 405 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 406 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 407 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 408 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 409 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 410 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 411 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 412 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 413 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 414 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 415 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 416 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 417 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 418 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 419 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 420 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 421 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 422 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 423 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 424 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 425 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 426 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 427 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 428 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 429 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 430 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 431 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 432 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 433 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 434 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 435 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 436 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 437 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 438 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 439 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 440 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 441 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 442 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 443 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 444 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 445 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 446 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 447 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 448 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 449 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 450 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 451 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 452 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 453 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 454 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 455 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 456 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 457 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 458 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 459 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 460 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 461 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 462 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 463 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 464 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 465 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 466 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 467 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 468 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 469 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 470 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 471 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 472 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 473 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 474 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 475 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 476 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 477 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 478 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 479 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 480 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 481 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 482 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 483 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 484 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 485 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 486 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 487 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 488 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 489 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 490 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 491 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 492 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 493 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 494 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 495 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 496 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 497 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 498 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 499 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 500 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 501 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 502 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 503 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 504 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 505 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 506 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 507 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 508 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 509 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 510 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 511 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 512 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 513 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 514 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 515 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 516 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 517 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 518 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 519 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 520 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 521 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 522 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 523 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 524 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 525 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 526 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 527 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.27 |
| Metatranscriptomes | 0 |
| Isolates | 28.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.2 |
| Nodule | 3.73 |
| Rhizoplane | 8.48 |
| Rhizosphere | 60.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439438_007901 | 3300041405 | Bacteria | 3587 |
| 2 | MRS2a_Contig_136 | 2124908027 | Bacteria | 16261 |
| 3 | SwRhRL2b_contig_180730 | 2162886007 | Bacteria | 3385 |
| 4 | JGI24741J21665_1004873 | 3300001915 | Bacteria | 2898 |
| 5 | JGI25156J39149_1000278 | 3300002705 | Bacteria | 34709 |
| 6 | JGI25156J39149_1000973 | 3300002705 | Bacteria | 13642 |
| 7 | JGI25156J39149_1009634 | 3300002705 | Bacteria | 2332 |
| 8 | JGI25162J39368_1000505 | 3300002737 | Bacteria | 29260 |
| 9 | JGI25162J39368_1000520 | 3300002737 | Bacteria | 28748 |
| 10 | JGI25154J39366_1000221 | 3300002738 | Bacteria | 38916 |
| 11 | JGI25157J39369_1000049 | 3300002741 | Bacteria | 115611 |
| 12 | JGI25163J39215_1002359 | 3300002771 | Bacteria | 2003 |
| 13 | JGI25164J39214_1000342 | 3300002772 | Bacteria | 29260 |
| 14 | JGI25164J39214_1000350 | 3300002772 | Bacteria | 28748 |
| 15 | JGI25165J46597_1000629 | 3300003214 | Bacteria | 29260 |
| 16 | JGI25165J46597_1000645 | 3300003214 | Bacteria | 28748 |
| 17 | rootH1_10025580 | 3300003323 | Bacteria | 2734 |
| 18 | Ga0055538_1000007 | 3300003751 | Bacteria | 399715 |
| 19 | Ga0055538_1000032 | 3300003751 | Bacteria | 199718 |
| 20 | Ga0055539_1000043 | 3300003752 | Bacteria | 199718 |
| 21 | Ga0055539_1000583 | 3300003752 | Bacteria | 10242 |
| 22 | Ga0055539_1001782 | 3300003752 | Bacteria | 3705 |
| 23 | Ga0055533_1000010 | 3300003756 | Bacteria | 491196 |
| 24 | Ga0055533_1000052 | 3300003756 | Bacteria | 199718 |
| 25 | Ga0055532_1000047 | 3300003758 | Bacteria | 179201 |
| 26 | Ga0055525_1000062 | 3300003759 | Bacteria | 199718 |
| 27 | Ga0055525_1000775 | 3300003759 | Bacteria | 10334 |
| 28 | Ga0055535_1000607 | 3300003761 | Bacteria | 29519 |
| 29 | Ga0055535_1000906 | 3300003761 | Bacteria | 20145 |
| 30 | Ga0055535_1004623 | 3300003761 | Bacteria | 3274 |
| 31 | Ga0055529_1000731 | 3300003763 | Bacteria | 21383 |
| 32 | Ga0055536_1001013 | 3300003781 | Bacteria | 17859 |
| 33 | Ga0055536_1004708 | 3300003781 | Bacteria | 6871 |
| 34 | Ga0055536_1004755 | 3300003781 | Bacteria | 6817 |
| 35 | Ga0055530_10000150 | 3300003791 | Bacteria | 63051 |
| 36 | Ga0055530_10001395 | 3300003791 | Bacteria | 17859 |
| 37 | Ga0055530_10004701 | 3300003791 | Bacteria | 6915 |
| 38 | Ga0055530_10009077 | 3300003791 | Bacteria | 3872 |
| 39 | Ga0055540_1000175 | 3300003792 | Bacteria | 63051 |
| 40 | Ga0055540_1002862 | 3300003792 | Bacteria | 8769 |
| 41 | Ga0055540_1003956 | 3300003792 | Bacteria | 6915 |
| 42 | Ga0055540_1007251 | 3300003792 | Bacteria | 4230 |
| 43 | Ga0055531_10008572 | 3300003794 | Bacteria | 5367 |
| 44 | Ga0055541_1000030 | 3300003841 | Bacteria | 199616 |
| 45 | Ga0058692_1001311 | 3300003856 | Bacteria | 9374 |
| 46 | Ga0065165_1000774 | 3300005262 | Bacteria | 43046 |
| 47 | Ga0065714_10003458 | 3300005288 | Bacteria | 7061 |
| 48 | Ga0065714_10008011 | 3300005288 | Bacteria | 4309 |
| 49 | Ga0065714_10019612 | 3300005288 | Bacteria | 1684 |
| 50 | Ga0065704_10071473 | 3300005289 | Bacteria | 11003 |
| 51 | Ga0065712_10000927 | 3300005290 | Bacteria | 7406 |
| 52 | Ga0065712_10069335 | 3300005290 | Bacteria | 7506 |
| 53 | Ga0065712_10072290 | 3300005290 | Bacteria | 4824 |
| 54 | Ga0065715_10002954 | 3300005293 | Bacteria | 7366 |
| 55 | Ga0070658_10136714 | 3300005327 | Bacteria | 2045 |
| 56 | Ga0070670_100001953 | 3300005331 | Bacteria | 16902 |
| 57 | Ga0070670_100210681 | 3300005331 | Bacteria | 1690 |
| 58 | Ga0068869_100053998 | 3300005334 | Bacteria | 2923 |
| 59 | Ga0070660_100097909 | 3300005339 | Bacteria | 2321 |
| 60 | Ga0070661_100001640 | 3300005344 | Bacteria | 15489 |
| 61 | Ga0070669_100002598 | 3300005353 | Bacteria | 13053 |
| 62 | Ga0070669_100011283 | 3300005353 | Bacteria | 6344 |
| 63 | Ga0070663_100034782 | 3300005455 | Bacteria | 3491 |
| 64 | Ga0070662_100008312 | 3300005457 | Bacteria | 6763 |
| 65 | Ga0070662_100078941 | 3300005457 | Bacteria | 2446 |
| 66 | Ga0068853_100000187 | 3300005539 | Bacteria | 43749 |
| 67 | Ga0070665_100078213 | 3300005548 | Bacteria | 3314 |
| 68 | Ga0068855_100052495 | 3300005563 | Bacteria | 4799 |
| 69 | Ga0070664_100001886 | 3300005564 | Bacteria | 16837 |
| 70 | Ga0068857_100024975 | 3300005577 | Bacteria | 5263 |
| 71 | Ga0068861_100040263 | 3300005719 | Bacteria | 3493 |
| 72 | Ga0068851_10000007 | 3300005834 | Bacteria | 244101 |
| 73 | Ga0075364_10154732 | 3300006051 | Bacteria | 1546 |
| 74 | Ga0075432_10007217 | 3300006058 | Bacteria | 3782 |
| 75 | Ga0075432_10009884 | 3300006058 | Bacteria | 3243 |
| 76 | Ga0075432_10015661 | 3300006058 | Bacteria | 2587 |
| 77 | Ga0075366_10001453 | 3300006195 | Bacteria | 11797 |
| 78 | Ga0075366_10006476 | 3300006195 | Bacteria | 6421 |
| 79 | Ga0075366_10006521 | 3300006195 | Bacteria | 6399 |
| 80 | Ga0075370_10016883 | 3300006353 | Bacteria | 3936 |
| 81 | Ga0075434_100203650 | 3300006871 | Unclassified | 1999 |
| 82 | Ga0099823_1000043 | 3300006944 | Bacteria | 60786 |
| 83 | Ga0099823_1000050 | 3300006944 | Bacteria | 57425 |
| 84 | Ga0099823_1022982 | 3300006944 | Bacteria | 5739 |
| 85 | Ga0099823_1063234 | 3300006944 | Bacteria | 1855 |
| 86 | Ga0079104_1001103 | 3300006946 | Bacteria | 19997 |
| 87 | Ga0079104_1003465 | 3300006946 | Bacteria | 7309 |
| 88 | Ga0099826_10004877 | 3300006948 | Bacteria | 9495 |
| 89 | Ga0105251_10000024 | 3300009011 | Bacteria | 133058 |
| 90 | Ga0105251_10002156 | 3300009011 | Bacteria | 15794 |
| 91 | Ga0105251_10004294 | 3300009011 | Bacteria | 9779 |
| 92 | Ga0105251_10015050 | 3300009011 | Bacteria | 4243 |
| 93 | Ga0105251_10018016 | 3300009011 | Bacteria | 3768 |
| 94 | Ga0105251_10018659 | 3300009011 | Bacteria | 3681 |
| 95 | Ga0105251_10054573 | 3300009011 | Bacteria | 1897 |
| 96 | Ga0105244_10000265 | 3300009036 | Bacteria | 52791 |
| 97 | Ga0105244_10000542 | 3300009036 | Bacteria | 33662 |
| 98 | Ga0105244_10007755 | 3300009036 | Bacteria | 6793 |
| 99 | Ga0105244_10014617 | 3300009036 | Bacteria | 4535 |
| 100 | Ga0105244_10018100 | 3300009036 | Bacteria | 3963 |
| 101 | Ga0105244_10025226 | 3300009036 | Bacteria | 3234 |
| 102 | Ga0105244_10028356 | 3300009036 | Bacteria | 3005 |
| 103 | Ga0105244_10080040 | 3300009036 | Bacteria | 1618 |
| 104 | Ga0105250_10001113 | 3300009092 | Bacteria | 15161 |
| 105 | Ga0105250_10012888 | 3300009092 | Bacteria | 3441 |
| 106 | Ga0105240_10072481 | 3300009093 | Bacteria | 4257 |
| 107 | Ga0111539_10344589 | 3300009094 | Bacteria | 1734 |
| 108 | Ga0105243_10001572 | 3300009148 | Bacteria | 19964 |
| 109 | Ga0105243_10001599 | 3300009148 | Bacteria | 19744 |
| 110 | Ga0105243_10011620 | 3300009148 | Bacteria | 6660 |
| 111 | Ga0105243_10052138 | 3300009148 | Bacteria | 3239 |
| 112 | Ga0105243_10125045 | 3300009148 | Bacteria | 2174 |
| 113 | Ga0105242_10001499 | 3300009176 | Bacteria | 18352 |
| 114 | Ga0105242_10194169 | 3300009176 | Bacteria | 1799 |
| 115 | Ga0105248_10007834 | 3300009177 | Bacteria | 11730 |
| 116 | Ga0105237_10010598 | 3300009545 | Bacteria | 9791 |
| 117 | Ga0105237_10111123 | 3300009545 | Bacteria | 2732 |
| 118 | Ga0105238_10170899 | 3300009551 | Bacteria | 2150 |
| 119 | Ga0105249_10007064 | 3300009553 | Bacteria | 9797 |
| 120 | Ga0105239_10025926 | 3300010375 | Bacteria | 6455 |
| 121 | Ga0105246_10002803 | 3300011119 | Bacteria | 10549 |
| 122 | Ga0105246_10007983 | 3300011119 | Bacteria | 6497 |
| 123 | Ga0105246_10011130 | 3300011119 | Bacteria | 5575 |
| 124 | Ga0157337_1000729 | 3300012483 | Bacteria | 1562 |
| 125 | Ga0157345_1000705 | 3300012498 | Bacteria | 2699 |
| 126 | Ga0157373_10013919 | 3300013100 | Bacteria | 5900 |
| 127 | Ga0157373_10033727 | 3300013100 | Bacteria | 3680 |
| 128 | Ga0157373_10047177 | 3300013100 | Bacteria | 3073 |
| 129 | Ga0157371_10001604 | 3300013102 | Bacteria | 23194 |
| 130 | Ga0157371_10013168 | 3300013102 | Bacteria | 6296 |
| 131 | Ga0157371_10013733 | 3300013102 | Bacteria | 6141 |
| 132 | Ga0157371_10038069 | 3300013102 | Bacteria | 3442 |
| 133 | Ga0157371_10043778 | 3300013102 | Bacteria | 3188 |
| 134 | Ga0157370_10003242 | 3300013104 | Bacteria | 19198 |
| 135 | Ga0157370_10003759 | 3300013104 | Bacteria | 17721 |
| 136 | Ga0157370_10063716 | 3300013104 | Bacteria | 3491 |
| 137 | Ga0157370_10069376 | 3300013104 | Bacteria | 3330 |
| 138 | Ga0157370_10084960 | 3300013104 | Bacteria | 2973 |
| 139 | Ga0157370_10135753 | 3300013104 | Bacteria | 2293 |
| 140 | Ga0157369_10030463 | 3300013105 | Bacteria | 5950 |
| 141 | Ga0157369_10043726 | 3300013105 | Bacteria | 4881 |
| 142 | Ga0157369_10055802 | 3300013105 | Bacteria | 4263 |
| 143 | Ga0157369_10122753 | 3300013105 | Bacteria | 2755 |
| 144 | Ga0157369_10166556 | 3300013105 | Bacteria | 2324 |
| 145 | Ga0157369_10301600 | 3300013105 | Bacteria | 1666 |
| 146 | Ga0163162_10030569 | 3300013306 | Bacteria | 5337 |
| 147 | Ga0157372_10015782 | 3300013307 | Bacteria | 8102 |
| 148 | Ga0157375_10152615 | 3300013308 | Bacteria | 2446 |
| 149 | Ga0157375_10256711 | 3300013308 | Bacteria | 1909 |
| 150 | Ga0182008_10006484 | 3300014497 | Bacteria | 6535 |
| 151 | Ga0182008_10007506 | 3300014497 | Bacteria | 6016 |
| 152 | Ga0157379_10070294 | 3300014968 | Bacteria | 3132 |
| 153 | Ga0182006_1003062 | 3300015261 | Bacteria | 8773 |
| 154 | Ga0182006_1012007 | 3300015261 | Bacteria | 3794 |
| 155 | Ga0182006_1030231 | 3300015261 | Bacteria | 2190 |
| 156 | Ga0182006_1052089 | 3300015261 | Bacteria | 1573 |
| 157 | Ga0182007_10002733 | 3300015262 | Bacteria | 8624 |
| 158 | Ga0182005_1002836 | 3300015265 | Bacteria | 6038 |
| 159 | Ga0182005_1003780 | 3300015265 | Bacteria | 5033 |
| 160 | Ga0182005_1008200 | 3300015265 | Bacteria | 3090 |
| 161 | Ga0163161_10089329 | 3300017792 | Bacteria | 2279 |
| 162 | Ga0163161_10093556 | 3300017792 | Bacteria | 2227 |
| 163 | Ga0213872_10000066 | 3300021361 | Bacteria | 93052 |
| 164 | Ga0213872_10000187 | 3300021361 | Bacteria | 55101 |
| 165 | Ga0213872_10062256 | 3300021361 | Bacteria | 1686 |
| 166 | Ga0209760_100027 | 3300025207 | Bacteria | 153290 |
| 167 | Ga0209760_100197 | 3300025207 | Bacteria | 29065 |
| 168 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 169 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 170 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 171 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 172 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 173 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 174 | Ga0209563_100049 | 3300025230 | Bacteria | 358472 |
| 175 | Ga0209563_101931 | 3300025230 | Bacteria | 5007 |
| 176 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 177 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 178 | Ga0207427_100280 | 3300025231 | Bacteria | 37213 |
| 179 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 180 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 181 | Ga0209437_101479 | 3300025233 | Bacteria | 5645 |
| 182 | Ga0209258_100163 | 3300025242 | Bacteria | 149677 |
| 183 | Ga0209258_100169 | 3300025242 | Bacteria | 145227 |
| 184 | Ga0209646_1000138 | 3300025246 | Bacteria | 114892 |
| 185 | Ga0209646_1000184 | 3300025246 | Bacteria | 78423 |
| 186 | Ga0209026_1000021 | 3300025250 | Bacteria | 375165 |
| 187 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 188 | Ga0209677_100145 | 3300025253 | Bacteria | 65577 |
| 189 | Ga0209677_100209 | 3300025253 | Bacteria | 45370 |
| 190 | Ga0209677_107310 | 3300025253 | Bacteria | 2376 |
| 191 | Ga0209759_1000025 | 3300025256 | Bacteria | 317082 |
| 192 | Ga0209759_1001401 | 3300025256 | Bacteria | 13807 |
| 193 | Ga0209759_1002119 | 3300025256 | Bacteria | 9190 |
| 194 | Ga0209759_1010090 | 3300025256 | Bacteria | 2794 |
| 195 | Ga0209759_1011333 | 3300025256 | Bacteria | 2542 |
| 196 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 197 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 198 | Ga0209455_1000059 | 3300025272 | Bacteria | 339995 |
| 199 | Ga0209673_1005874 | 3300025273 | Bacteria | 6071 |
| 200 | Ga0209675_1002099 | 3300025291 | Bacteria | 10560 |
| 201 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 202 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 203 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 204 | Ga0209676_1000617 | 3300025292 | Bacteria | 51959 |
| 205 | Ga0209676_1001192 | 3300025292 | Bacteria | 27932 |
| 206 | Ga0209676_1005922 | 3300025292 | Bacteria | 6193 |
| 207 | Ga0209676_1007365 | 3300025292 | Bacteria | 5181 |
| 208 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 209 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 210 | Ga0209050_1000374 | 3300025298 | Bacteria | 85298 |
| 211 | Ga0209050_1000518 | 3300025298 | Bacteria | 64332 |
| 212 | Ga0209050_1000647 | 3300025298 | Bacteria | 54000 |
| 213 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 214 | Ga0209051_1000023 | 3300025303 | Bacteria | 437371 |
| 215 | Ga0209051_1000881 | 3300025303 | Bacteria | 30220 |
| 216 | Ga0209051_1003155 | 3300025303 | Bacteria | 11068 |
| 217 | Ga0209051_1005236 | 3300025303 | Bacteria | 7659 |
| 218 | Ga0209257_1000069 | 3300025304 | Bacteria | 339826 |
| 219 | Ga0209257_1004945 | 3300025304 | Bacteria | 9776 |
| 220 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 221 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 222 | Ga0207696_1000050 | 3300025711 | Bacteria | 276983 |
| 223 | Ga0207696_1000105 | 3300025711 | Bacteria | 163421 |
| 224 | Ga0207696_1000156 | 3300025711 | Bacteria | 112840 |
| 225 | Ga0207696_1000541 | 3300025711 | Bacteria | 30663 |
| 226 | Ga0207696_1008940 | 3300025711 | Bacteria | 3772 |
| 227 | Ga0207696_1009541 | 3300025711 | Bacteria | 3614 |
| 228 | Ga0207696_1013612 | 3300025711 | Bacteria | 2824 |
| 229 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 230 | Ga0207655_1000202 | 3300025728 | Bacteria | 103907 |
| 231 | Ga0207655_1000216 | 3300025728 | Bacteria | 99551 |
| 232 | Ga0207655_1000295 | 3300025728 | Bacteria | 75367 |
| 233 | Ga0207655_1000388 | 3300025728 | Bacteria | 61513 |
| 234 | Ga0207655_1001189 | 3300025728 | Bacteria | 25183 |
| 235 | Ga0207655_1002393 | 3300025728 | Bacteria | 15296 |
| 236 | Ga0207655_1002424 | 3300025728 | Bacteria | 15154 |
| 237 | Ga0207655_1005954 | 3300025728 | Bacteria | 8168 |
| 238 | Ga0207655_1007793 | 3300025728 | Bacteria | 6900 |
| 239 | Ga0207655_1009633 | 3300025728 | Bacteria | 5976 |
| 240 | Ga0207655_1012780 | 3300025728 | Bacteria | 4869 |
| 241 | Ga0207655_1013044 | 3300025728 | Bacteria | 4798 |
| 242 | Ga0207655_1020188 | 3300025728 | Bacteria | 3437 |
| 243 | Ga0207655_1027790 | 3300025728 | Bacteria | 2684 |
| 244 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 245 | Ga0207713_1000077 | 3300025735 | Bacteria | 176517 |
| 246 | Ga0207713_1001506 | 3300025735 | Bacteria | 18410 |
| 247 | Ga0207713_1003359 | 3300025735 | Bacteria | 10976 |
| 248 | Ga0207713_1003953 | 3300025735 | Bacteria | 9846 |
| 249 | Ga0207713_1004110 | 3300025735 | Bacteria | 9590 |
| 250 | Ga0207713_1004772 | 3300025735 | Bacteria | 8713 |
| 251 | Ga0207713_1007874 | 3300025735 | Bacteria | 6211 |
| 252 | Ga0207713_1009206 | 3300025735 | Bacteria | 5593 |
| 253 | Ga0207713_1019128 | 3300025735 | Bacteria | 3363 |
| 254 | Ga0207713_1028390 | 3300025735 | Bacteria | 2525 |
| 255 | Ga0207705_10020837 | 3300025909 | Bacteria | 4680 |
| 256 | Ga0207671_10000131 | 3300025914 | Bacteria | 116866 |
| 257 | Ga0207657_10029841 | 3300025919 | Bacteria | 4957 |
| 258 | Ga0207649_10000012 | 3300025920 | Bacteria | 265674 |
| 259 | Ga0207681_10000099 | 3300025923 | Bacteria | 73220 |
| 260 | Ga0207681_10008578 | 3300025923 | Bacteria | 6242 |
| 261 | Ga0207650_10000157 | 3300025925 | Bacteria | 81959 |
| 262 | Ga0207650_10000185 | 3300025925 | Bacteria | 72385 |
| 263 | Ga0207650_10071195 | 3300025925 | Bacteria | 2615 |
| 264 | Ga0207690_10070448 | 3300025932 | Bacteria | 2409 |
| 265 | Ga0207706_10001069 | 3300025933 | Bacteria | 27808 |
| 266 | Ga0207706_10009625 | 3300025933 | Bacteria | 8870 |
| 267 | Ga0207686_10000319 | 3300025934 | Bacteria | 34615 |
| 268 | Ga0207709_10000071 | 3300025935 | Bacteria | 181156 |
| 269 | Ga0207709_10000337 | 3300025935 | Bacteria | 49221 |
| 270 | Ga0207709_10045241 | 3300025935 | Bacteria | 2664 |
| 271 | Ga0207709_10081986 | 3300025935 | Bacteria | 2081 |
| 272 | Ga0207711_10056958 | 3300025941 | Bacteria | 3359 |
| 273 | Ga0207689_10014227 | 3300025942 | Bacteria | 6771 |
| 274 | Ga0207679_10000015 | 3300025945 | Bacteria | 265674 |
| 275 | Ga0207667_10009539 | 3300025949 | Bacteria | 11420 |
| 276 | Ga0207712_10004516 | 3300025961 | Bacteria | 8788 |
| 277 | Ga0207640_10072216 | 3300025981 | Bacteria | 2327 |
| 278 | Ga0207677_10180154 | 3300026023 | Bacteria | 1661 |
| 279 | Ga0207639_10000775 | 3300026041 | Bacteria | 21763 |
| 280 | Ga0207678_10015659 | 3300026067 | Bacteria | 6665 |
| 281 | Ga0207702_10000800 | 3300026078 | Bacteria | 33369 |
| 282 | Ga0207674_10043460 | 3300026116 | Bacteria | 4633 |
| 283 | Ga0207675_100052490 | 3300026118 | Bacteria | 3804 |
| 284 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 285 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 286 | Ga0209281_1001944 | 3300027111 | Bacteria | 9656 |
| 287 | Ga0209389_1000017 | 3300027296 | Bacteria | 180543 |
| 288 | Ga0209389_1000053 | 3300027296 | Bacteria | 108874 |
| 289 | Ga0209389_1072180 | 3300027296 | Bacteria | 1862 |
| 290 | Ga0209371_1000032 | 3300027312 | Bacteria | 392355 |
| 291 | Ga0207428_10027106 | 3300027907 | Bacteria | 4772 |
| 292 | Ga0207428_10111895 | 3300027907 | Bacteria | 2101 |
| 293 | Ga0265336_10000006 | 3300028666 | Bacteria | 348453 |
| 294 | Ga0307515_10023444 | 3300028794 | Bacteria | 10813 |
| 295 | Ga0265324_10002529 | 3300029957 | Bacteria | 9267 |
| 296 | Ga0268256_1000050 | 3300030500 | Bacteria | 300675 |
| 297 | Ga0307511_10083198 | 3300030521 | Bacteria | 2231 |
| 298 | Ga0314311_1099326 | 3300030733 | Bacteria | 5378 |
| 299 | Ga0316178_1008333 | 3300030735 | Bacteria | 44288 |
| 300 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 301 | Ga0307408_100000077 | 3300031548 | Bacteria | 110022 |
| 302 | Ga0307408_100022947 | 3300031548 | Bacteria | 4246 |
| 303 | Ga0307408_100047222 | 3300031548 | Bacteria | 3082 |
| 304 | Ga0307514_10001133 | 3300031649 | Bacteria | 36650 |
| 305 | Ga0307516_10000878 | 3300031730 | Bacteria | 41335 |
| 306 | Ga0307405_10024462 | 3300031731 | Bacteria | 3450 |
| 307 | Ga0307409_100129357 | 3300031995 | Bacteria | 2154 |
| 308 | Ga0307416_100206385 | 3300032002 | Bacteria | 1869 |
| 309 | Ga0307414_10016650 | 3300032004 | Bacteria | 4475 |
| 310 | Ga0307414_10026324 | 3300032004 | Bacteria | 3743 |
| 311 | Ga0307411_10066333 | 3300032005 | Bacteria | 2424 |
| 312 | Ga0307510_10122871 | 3300033180 | Bacteria | 2294 |
| 313 | Ga0373937_0023779 | 3300036401 | Bacteria | 5524 |
| 314 | Ga0373937_0119750 | 3300036401 | Bacteria | 2453 |
| 315 | Ga0395905_0051786 | 3300037471 | Bacteria | 3845 |
| 316 | Ga0395901_0014533 | 3300038443 | Bacteria | 8005 |
| 317 | Ga0237819_01098 | 3300038705 | Bacteria | 7931 |
| 318 | Ga0436361_0313405 | 3300039447 | Bacteria | 87904 |
| 319 | Ga0436361_0525200 | 3300039447 | Bacteria | 11317 |
| 320 | Ga0436361_0857598 | 3300039447 | Bacteria | 5129 |
| 321 | Ga0436361_1024184 | 3300039447 | Bacteria | 85708 |
| 322 | Ga0439438_004878 | 3300041405 | Bacteria | 5035 |
| 323 | Ga0439438_006624 | 3300041405 | Bacteria | 4058 |
| 324 | Ga0439447_003423 | 3300041407 | Bacteria | 5642 |
| 325 | Ga0439447_003817 | 3300041407 | Bacteria | 5289 |
| 326 | Ga0439447_008152 | 3300041407 | Bacteria | 3264 |
| 327 | Ga0439466_0000466 | 3300041411 | Bacteria | 15422 |
| 328 | Ga0439466_0002245 | 3300041411 | Bacteria | 7567 |
| 329 | Ga0439466_0003958 | 3300041411 | Bacteria | 5714 |
| 330 | Ga0439466_0017860 | 3300041411 | Bacteria | 2550 |
| 331 | Ga0439432_001621 | 3300042006 | Bacteria | 8420 |
| 332 | Ga0439432_005789 | 3300042006 | Bacteria | 4440 |
| 333 | Ga0439432_011624 | 3300042006 | Bacteria | 3032 |
| 334 | Ga0439432_019622 | 3300042006 | Bacteria | 2251 |
| 335 | Ga0439452_003753 | 3300042010 | Bacteria | 5231 |
| 336 | Ga0439452_004104 | 3300042010 | Bacteria | 4951 |
| 337 | Ga0439452_004757 | 3300042010 | Bacteria | 4487 |
| 338 | Ga0439452_005513 | 3300042010 | Bacteria | 4065 |
| 339 | Ga0439456_003040 | 3300042013 | Bacteria | 3389 |
| 340 | Ga0439456_010509 | 3300042013 | Bacteria | 1913 |
| 341 | Ga0439463_002333 | 3300042016 | Bacteria | 4842 |
| 342 | Ga0439463_002471 | 3300042016 | Bacteria | 4693 |
| 343 | Ga0450911_000027 | 3300042115 | Bacteria | 82476 |
| 344 | Ga0450911_000100 | 3300042115 | Bacteria | 34941 |
| 345 | Ga0450911_002622 | 3300042115 | Bacteria | 3457 |
| 346 | Ga0450890_000509 | 3300042127 | Bacteria | 5716 |
| 347 | Ga0450905_004727 | 3300042142 | Bacteria | 1813 |
| 348 | Ga0450907_001254 | 3300042146 | Bacteria | 5697 |
| 349 | Ga0450907_003651 | 3300042146 | Bacteria | 2719 |
| 350 | Ga0439446_0001826 | 3300042156 | Bacteria | 4980 |
| 351 | Ga0439446_0017545 | 3300042156 | Bacteria | 2001 |
| 352 | Ga0439434_0003416 | 3300042435 | Bacteria | 4641 |
| 353 | Ga0439459_0012881 | 3300042438 | Bacteria | 1496 |
| 354 | Ga0439464_0002231 | 3300042439 | Bacteria | 4739 |
| 355 | Ga0439460_0000875 | 3300042461 | Bacteria | 6881 |
| 356 | Ga0450916_000042 | 3300042530 | Bacteria | 6810 |
| 357 | Ga0451577_0164037 | 3300042876 | Bacteria | 2002 |
| 358 | Ga0466969_0009333 | 3300044656 | Bacteria | 5199 |
| 359 | Ga0466965_0000692 | 3300044683 | Bacteria | 12482 |
| 360 | Ga0466966_0005876 | 3300044684 | Bacteria | 8094 |
| 361 | Ga0466961_0015298 | 3300044693 | Bacteria | 4927 |
| 362 | Ga0466963_0057201 | 3300044694 | Bacteria | 2597 |
| 363 | Ga0466964_0001646 | 3300044706 | Bacteria | 7720 |
| 364 | Ga0453684_0012190 | 3300044712 | Bacteria | 14255 |
| 365 | Ga0453684_0012554 | 3300044712 | Bacteria | 13945 |
| 366 | Ga0466971_0006553 | 3300044719 | Bacteria | 5059 |
| 367 | Ga0466957_0002678 | 3300044842 | Bacteria | 9618 |
| 368 | Ga0466959_0003818 | 3300045049 | Bacteria | 9988 |
| 369 | Ga0466958_0031576 | 3300045836 | Bacteria | 3148 |
| 370 | Ga0466967_0058693 | 3300045976 | Bacteria | 3402 |
| 371 | Ga0495617_003398 | 3300046452 | Bacteria | 5999 |
| 372 | Ga0495617_019767 | 3300046452 | Bacteria | 2277 |
| 373 | Ga0495627_000102 | 3300046453 | Bacteria | 104889 |
| 374 | Ga0495627_004313 | 3300046453 | Bacteria | 5977 |
| 375 | Ga0495627_012419 | 3300046453 | Bacteria | 3022 |
| 376 | Ga0495590_0016101 | 3300046457 | Bacteria | 2704 |
| 377 | Ga0495591_000105 | 3300046458 | Bacteria | 97199 |
| 378 | Ga0495591_003166 | 3300046458 | Bacteria | 8682 |
| 379 | Ga0495591_004534 | 3300046458 | Bacteria | 6746 |
| 380 | Ga0495591_004959 | 3300046458 | Bacteria | 6303 |
| 381 | Ga0495591_006424 | 3300046458 | Bacteria | 5196 |
| 382 | Ga0495591_014983 | 3300046458 | Bacteria | 2757 |
| 383 | Ga0495591_015401 | 3300046458 | Bacteria | 2703 |
| 384 | Ga0495591_018892 | 3300046458 | Bacteria | 2324 |
| 385 | Ga0495651_0146508 | 3300046462 | Bacteria | 1706 |
| 386 | Ga0495653_0022923 | 3300046463 | Bacteria | 5049 |
| 387 | Ga0495653_0040147 | 3300046463 | Bacteria | 3659 |
| 388 | Ga0495653_0048713 | 3300046463 | Bacteria | 3269 |
| 389 | Ga0495650_0000578 | 3300046471 | Bacteria | 51315 |
| 390 | Ga0495650_0015211 | 3300046471 | Bacteria | 3956 |
| 391 | Ga0495650_0030023 | 3300046471 | Bacteria | 2469 |
| 392 | Ga0495650_0037793 | 3300046471 | Bacteria | 2097 |
| 393 | Ga0495605_0000590 | 3300046474 | Bacteria | 28966 |
| 394 | Ga0495605_0000625 | 3300046474 | Bacteria | 27283 |
| 395 | Ga0495605_0001226 | 3300046474 | Bacteria | 17066 |
| 396 | Ga0495605_0001398 | 3300046474 | Bacteria | 15876 |
| 397 | Ga0495605_0010112 | 3300046474 | Bacteria | 5284 |
| 398 | Ga0495605_0027479 | 3300046474 | Bacteria | 2947 |
| 399 | Ga0495605_0067345 | 3300046474 | Bacteria | 1699 |
| 400 | Ga0495639_0003111 | 3300046475 | Bacteria | 7214 |
| 401 | Ga0495584_0009566 | 3300046491 | Bacteria | 4993 |
| 402 | Ga0495584_0012700 | 3300046491 | Bacteria | 4298 |
| 403 | Ga0495584_0093849 | 3300046491 | Bacteria | 1514 |
| 404 | Ga0495585_0007063 | 3300046492 | Bacteria | 6904 |
| 405 | Ga0495585_0010687 | 3300046492 | Bacteria | 5452 |
| 406 | Ga0495585_0028569 | 3300046492 | Bacteria | 3180 |
| 407 | Ga0495585_0047158 | 3300046492 | Bacteria | 2400 |
| 408 | Ga0495596_0004395 | 3300046500 | Bacteria | 6880 |
| 409 | Ga0495607_0001133 | 3300046501 | Bacteria | 24182 |
| 410 | Ga0495607_0001267 | 3300046501 | Bacteria | 22574 |
| 411 | Ga0495607_0004588 | 3300046501 | Bacteria | 10120 |
| 412 | Ga0495607_0005049 | 3300046501 | Bacteria | 9572 |
| 413 | Ga0495607_0013525 | 3300046501 | Bacteria | 5346 |
| 414 | Ga0495607_0030626 | 3300046501 | Bacteria | 3302 |
| 415 | Ga0495607_0039997 | 3300046501 | Bacteria | 2795 |
| 416 | Ga0495607_0050428 | 3300046501 | Bacteria | 2422 |
| 417 | Ga0495583_0000015 | 3300046506 | Bacteria | 316392 |
| 418 | Ga0495583_0000927 | 3300046506 | Bacteria | 34448 |
| 419 | Ga0495583_0004981 | 3300046506 | Bacteria | 9213 |
| 420 | Ga0495583_0013180 | 3300046506 | Bacteria | 4627 |
| 421 | Ga0495583_0016105 | 3300046506 | Bacteria | 4036 |
| 422 | Ga0495583_0023578 | 3300046506 | Bacteria | 3110 |
| 423 | Ga0495583_0062515 | 3300046506 | Bacteria | 1658 |
| 424 | Ga0495606_0000083 | 3300046507 | Bacteria | 159263 |
| 425 | Ga0495606_0003050 | 3300046507 | Bacteria | 18259 |
| 426 | Ga0495606_0008185 | 3300046507 | Bacteria | 9147 |
| 427 | Ga0495606_0015235 | 3300046507 | Bacteria | 5936 |
| 428 | Ga0495606_0018166 | 3300046507 | Bacteria | 5285 |
| 429 | Ga0495610_0009929 | 3300046512 | Bacteria | 5954 |
| 430 | Ga0495610_0011079 | 3300046512 | Bacteria | 5538 |
| 431 | Ga0495616_0014738 | 3300046513 | Bacteria | 4365 |
| 432 | Ga0495620_0000171 | 3300046515 | Bacteria | 51260 |
| 433 | Ga0495620_0000229 | 3300046515 | Bacteria | 41859 |
| 434 | Ga0495620_0005486 | 3300046515 | Bacteria | 7069 |
| 435 | Ga0495620_0014267 | 3300046515 | Bacteria | 4042 |
| 436 | Ga0495631_0004242 | 3300046518 | Bacteria | 7670 |
| 437 | Ga0495631_0017782 | 3300046518 | Bacteria | 3356 |
| 438 | Ga0495632_0007443 | 3300046519 | Bacteria | 6876 |
| 439 | Ga0495632_0008782 | 3300046519 | Bacteria | 6156 |
| 440 | Ga0495632_0037321 | 3300046519 | Bacteria | 2466 |
| 441 | Ga0495632_0088007 | 3300046519 | Bacteria | 1475 |
| 442 | Ga0495637_0000271 | 3300046520 | Bacteria | 40891 |
| 443 | Ga0495637_0002084 | 3300046520 | Bacteria | 11247 |
| 444 | Ga0495637_0005947 | 3300046520 | Bacteria | 6169 |
| 445 | Ga0495637_0015531 | 3300046520 | Bacteria | 3571 |
| 446 | Ga0495637_0019714 | 3300046520 | Bacteria | 3114 |
| 447 | Ga0495637_0027237 | 3300046520 | Bacteria | 2559 |
| 448 | Ga0495643_0000345 | 3300046522 | Bacteria | 63090 |
| 449 | Ga0495643_0000627 | 3300046522 | Bacteria | 41961 |
| 450 | Ga0495643_0002030 | 3300046522 | Bacteria | 16840 |
| 451 | Ga0495643_0007948 | 3300046522 | Bacteria | 6763 |
| 452 | Ga0495643_0011277 | 3300046522 | Bacteria | 5453 |
| 453 | Ga0495643_0012620 | 3300046522 | Bacteria | 5089 |
| 454 | Ga0495643_0017811 | 3300046522 | Bacteria | 4143 |
| 455 | Ga0495643_0039455 | 3300046522 | Bacteria | 2582 |
| 456 | Ga0495644_0005075 | 3300046523 | Bacteria | 5152 |
| 457 | Ga0495648_0013922 | 3300046524 | Bacteria | 5922 |
| 458 | Ga0495648_0022554 | 3300046524 | Bacteria | 4331 |
| 459 | Ga0495648_0023818 | 3300046524 | Bacteria | 4182 |
| 460 | Ga0495648_0030158 | 3300046524 | Bacteria | 3590 |
| 461 | Ga0495648_0059154 | 3300046524 | Bacteria | 2287 |
| 462 | Ga0495642_0000631 | 3300046528 | Bacteria | 17653 |
| 463 | Ga0495642_0024565 | 3300046528 | Bacteria | 2384 |
| 464 | Ga0495654_0005941 | 3300046530 | Bacteria | 7014 |
| 465 | Ga0495654_0006795 | 3300046530 | Bacteria | 6459 |
| 466 | Ga0495654_0015100 | 3300046530 | Bacteria | 4104 |
| 467 | Ga0495654_0021575 | 3300046530 | Bacteria | 3349 |
| 468 | Ga0495586_0120780 | 3300046535 | Bacteria | 1464 |
| 469 | Ga0495587_0015762 | 3300046536 | Bacteria | 4712 |
| 470 | Ga0495609_0000023 | 3300046538 | Bacteria | 269702 |
| 471 | Ga0495609_0000458 | 3300046538 | Bacteria | 33250 |
| 472 | Ga0495609_0000759 | 3300046538 | Bacteria | 24242 |
| 473 | Ga0495609_0003174 | 3300046538 | Bacteria | 9560 |
| 474 | Ga0495597_0000221 | 3300046542 | Bacteria | 52360 |
| 475 | Ga0495597_0005155 | 3300046542 | Bacteria | 6962 |
| 476 | Ga0495622_0002873 | 3300046557 | Bacteria | 8224 |
| 477 | Ga0495633_0000115 | 3300046558 | Bacteria | 108676 |
| 478 | Ga0495656_0003150 | 3300046615 | Bacteria | 5551 |
| 479 | Ga0495668_0009606 | 3300046616 | Bacteria | 5919 |
| 480 | Ga0495668_0018591 | 3300046616 | Bacteria | 4015 |
| 481 | Ga0495668_0058209 | 3300046616 | Bacteria | 2133 |
| 482 | Ga0495668_0107117 | 3300046616 | Bacteria | 1528 |
| 483 | Ga0495634_0019357 | 3300046642 | Bacteria | 4838 |
| 484 | Ga0495611_0000749 | 3300046648 | Bacteria | 18315 |
| 485 | Ga0495611_0003126 | 3300046648 | Bacteria | 7342 |
| 486 | Ga0495611_0046839 | 3300046648 | Bacteria | 1939 |
| 487 | Ga0495625_0000187 | 3300046660 | Bacteria | 97797 |
| 488 | Ga0495635_0020678 | 3300046663 | Bacteria | 4584 |
| 489 | Ga0495661_0000061 | 3300046665 | Bacteria | 130811 |
| 490 | Ga0495661_0000865 | 3300046665 | Bacteria | 28200 |
| 491 | Ga0495661_0002054 | 3300046665 | Bacteria | 15804 |
| 492 | Ga0495661_0002403 | 3300046665 | Bacteria | 14449 |
| 493 | Ga0495661_0019070 | 3300046665 | Bacteria | 4499 |
| 494 | Ga0495661_0079958 | 3300046665 | Bacteria | 1888 |
| 495 | Ga0495623_0022811 | 3300046679 | Bacteria | 4041 |
| 496 | Ga0495670_0004412 | 3300046691 | Bacteria | 6902 |
| 497 | Ga0495671_0005463 | 3300046692 | Bacteria | 7438 |
| 498 | Ga0495671_0009031 | 3300046692 | Bacteria | 5594 |
| 499 | Ga0495671_0011710 | 3300046692 | Bacteria | 4809 |
| 500 | Ga0495671_0024764 | 3300046692 | Bacteria | 3122 |
| 501 | Ga0495649_0000464 | 3300046694 | Bacteria | 34868 |
| 502 | Ga0495649_0004778 | 3300046694 | Bacteria | 8776 |
| 503 | Ga0495649_0008513 | 3300046694 | Bacteria | 6166 |
| 504 | Ga0495649_0009795 | 3300046694 | Bacteria | 5673 |
| 505 | Ga0495649_0023432 | 3300046694 | Bacteria | 3449 |
| 506 | Ga0495589_0008703 | 3300046794 | Bacteria | 5286 |
| 507 | Ga0495589_0010021 | 3300046794 | Bacteria | 4923 |
| 508 | Ga0495589_0012850 | 3300046794 | Bacteria | 4328 |
| 509 | Ga0495589_0052557 | 3300046794 | Bacteria | 2012 |
| 510 | Ga0495600_0003343 | 3300046809 | Bacteria | 9426 |
| 511 | Ga0495660_0000831 | 3300046810 | Bacteria | 22952 |
| 512 | Ga0495660_0026271 | 3300046810 | Bacteria | 3301 |
| 513 | Ga0495660_0045243 | 3300046810 | Bacteria | 2417 |
| 514 | Ga0495636_0010451 | 3300047318 | Bacteria | 3666 |
| 515 | Ga0495672_0012072 | 3300047320 | Bacteria | 6048 |
| 516 | Ga0495672_0036083 | 3300047320 | Bacteria | 3038 |
| 517 | Ga0495672_0036806 | 3300047320 | Bacteria | 3002 |
| 518 | Ga0495672_0090366 | 3300047320 | Bacteria | 1683 |
| 519 | Ga0495676_0000011 | 3300047321 | Bacteria | 242612 |
| 520 | Ga0495676_0040008 | 3300047321 | Bacteria | 3874 |
| 521 | Ga0495680_0014977 | 3300047322 | Bacteria | 6697 |
| 522 | Ga0495680_0094802 | 3300047322 | Bacteria | 2232 |
| 523 | Ga0495683_0000106 | 3300047323 | Bacteria | 86579 |
| 524 | Ga0495683_0000207 | 3300047323 | Bacteria | 55998 |
| 525 | Ga0495683_0007048 | 3300047323 | Bacteria | 6100 |
| 526 | Ga0495683_0008997 | 3300047323 | Bacteria | 5328 |
| 527 | Ga0495683_0012111 | 3300047323 | Bacteria | 4533 |
| 528 | Ga0495687_007653 | 3300047443 | Bacteria | 6321 |
| 529 | Ga0495679_000274 | 3300047446 | Bacteria | 43056 |
| 530 | Ga0495679_000704 | 3300047446 | Bacteria | 21744 |
| 531 | Ga0495673_0001682 | 3300047469 | Bacteria | 16994 |
| 532 | Ga0495673_0005616 | 3300047469 | Bacteria | 7542 |
| 533 | Ga0495673_0007829 | 3300047469 | Bacteria | 6080 |
| 534 | Ga0495673_0010604 | 3300047469 | Bacteria | 5001 |
| 535 | Ga0495673_0014010 | 3300047469 | Bacteria | 4185 |
| 536 | Ga0495681_0012867 | 3300047470 | Bacteria | 4892 |
| 537 | Ga0495681_0018926 | 3300047470 | Bacteria | 3777 |
| 538 | Ga0495686_0003059 | 3300047472 | Bacteria | 14830 |
| 539 | Ga0495686_0075073 | 3300047472 | Bacteria | 2073 |
| 540 | Ga0495593_0014851 | 3300047673 | Bacteria | 4423 |
| 541 | Ga0495626_0000068 | 3300048091 | Bacteria | 139126 |
| 542 | Ga0495626_0005680 | 3300048091 | Bacteria | 7222 |
| 543 | Ga0495626_0007093 | 3300048091 | Bacteria | 6278 |
| 544 | Ga0495626_0008893 | 3300048091 | Bacteria | 5455 |
| 545 | Ga0496102_0026312 | 3300048905 | Bacteria | 5188 |
| 546 | Ga0496110_0019824 | 3300048913 | Bacteria | 5668 |
| 547 | Ga0496114_0005705 | 3300048917 | Bacteria | 9760 |
| 548 | Ga0496114_0103367 | 3300048917 | Bacteria | 2435 |
| 549 | Ga0496116_0008830 | 3300048919 | Bacteria | 8682 |
| 550 | Ga0496116_0018636 | 3300048919 | Bacteria | 5341 |
| 551 | Ga0496116_0021869 | 3300048919 | Bacteria | 4811 |
| 552 | Ga0496117_0000961 | 3300048920 | Bacteria | 44128 |
| 553 | Ga0496117_0018385 | 3300048920 | Bacteria | 5789 |
| 554 | Ga0496117_0038087 | 3300048920 | Bacteria | 3572 |
| 555 | Ga0496117_0039315 | 3300048920 | Bacteria | 3493 |
| 556 | Ga0496117_0060179 | 3300048920 | Bacteria | 2619 |
| 557 | Ga0496118_0014197 | 3300048921 | Bacteria | 7469 |
| 558 | Ga0496118_0016655 | 3300048921 | Bacteria | 6735 |
| 559 | Ga0496118_0023180 | 3300048921 | Bacteria | 5400 |
| 560 | Ga0496118_0068461 | 3300048921 | Bacteria | 2578 |
| 561 | Ga0496119_0004034 | 3300048922 | Bacteria | 14828 |
| 562 | Ga0496120_0003119 | 3300048923 | Bacteria | 15545 |
| 563 | Ga0496121_0011294 | 3300048924 | Bacteria | 9945 |
| 564 | Ga0496121_0013055 | 3300048924 | Bacteria | 8970 |
| 565 | Ga0496121_0020706 | 3300048924 | Bacteria | 6490 |
| 566 | Ga0496121_0021850 | 3300048924 | Bacteria | 6248 |
| 567 | Ga0496122_0001707 | 3300048925 | Bacteria | 34056 |
| 568 | Ga0496122_0002086 | 3300048925 | Bacteria | 29621 |
| 569 | Ga0496122_0004723 | 3300048925 | Bacteria | 16722 |
| 570 | Ga0496122_0006443 | 3300048925 | Bacteria | 13471 |
| 571 | Ga0496122_0019987 | 3300048925 | Bacteria | 6087 |
| 572 | Ga0496122_0074921 | 3300048925 | Bacteria | 2391 |
| 573 | Ga0496123_0000178 | 3300048926 | Bacteria | 128587 |
| 574 | Ga0496123_0000445 | 3300048926 | Bacteria | 74126 |
| 575 | Ga0496123_0000607 | 3300048926 | Bacteria | 60365 |
| 576 | Ga0496123_0037585 | 3300048926 | Bacteria | 3417 |
| 577 | Ga0496123_0042041 | 3300048926 | Bacteria | 3160 |
| 578 | Ga0496123_0057209 | 3300048926 | Bacteria | 2540 |
| 579 | Ga0496124_0000073 | 3300048927 | Bacteria | 219306 |
| 580 | Ga0496124_0004545 | 3300048927 | Bacteria | 16148 |
| 581 | Ga0496124_0019279 | 3300048927 | Bacteria | 6356 |
| 582 | Ga0496124_0022258 | 3300048927 | Bacteria | 5817 |
| 583 | Ga0496124_0033513 | 3300048927 | Bacteria | 4518 |
| 584 | Ga0496125_0011967 | 3300048928 | Bacteria | 8639 |
| 585 | Ga0496125_0012388 | 3300048928 | Bacteria | 8469 |
| 586 | Ga0496125_0103660 | 3300048928 | Bacteria | 2086 |
| 587 | Ga0496125_0123922 | 3300048928 | Bacteria | 1836 |
| 588 | Ga0496126_0039798 | 3300048929 | Bacteria | 4359 |
| 589 | Ga0496126_0097773 | 3300048929 | Bacteria | 2572 |
| 590 | Ga0496126_0178237 | 3300048929 | Bacteria | 1807 |
| 591 | Ga0495678_000017 | 3300049459 | Bacteria | 282592 |
| 592 | Ga0495678_000404 | 3300049459 | Bacteria | 43644 |
| 593 | Ga0495678_006385 | 3300049459 | Bacteria | 6285 |
| 594 | Ga0495678_015394 | 3300049459 | Bacteria | 3518 |
| 595 | Ga0495678_015771 | 3300049459 | Bacteria | 3469 |
| 596 | Ga0495682_0000054 | 3300049460 | Bacteria | 104787 |
| 597 | Ga0495682_0000124 | 3300049460 | Bacteria | 67600 |
| 598 | Ga0495682_0007005 | 3300049460 | Bacteria | 4518 |
| 599 | Ga0501033_0073415 | 3300049570 | Bacteria | 2512 |
| 600 | Ga0501034_0000143 | 3300049571 | Bacteria | 133317 |
| 601 | Ga0501034_0000200 | 3300049571 | Bacteria | 113556 |
| 602 | Ga0501039_0028547 | 3300049575 | Bacteria | 4295 |
| 603 | Ga0501040_0027158 | 3300049576 | Bacteria | 3852 |
| 604 | Ga0501072_0044165 | 3300049588 | Bacteria | 3504 |
| 605 | Ga0501075_0010316 | 3300049591 | Bacteria | 6564 |
| 606 | Ga0501076_0000757 | 3300049592 | Bacteria | 20885 |
| 607 | Ga0501222_005362 | 3300049662 | Bacteria | 1732 |
| 608 | Ga0501079_0001187 | 3300049741 | Bacteria | 18244 |
| 609 | Ga0501080_0080217 | 3300049742 | Bacteria | 3033 |
| 610 | Ga0501081_0000552 | 3300049743 | Bacteria | 21253 |
| 611 | Ga0501083_0075748 | 3300049744 | Bacteria | 2234 |
| 612 | Ga0501241_008201 | 3300049758 | Bacteria | 1910 |
| 613 | Ga0501226_000001 | 3300049853 | Bacteria | 432595 |
| 614 | nmdc:mga0k408_1301_c1 | 3300050493 | Bacteria | 13499 |
| 615 | nmdc:mga0k408_41573_c1 | 3300050493 | Bacteria | 2647 |
| 616 | nmdc:mga07m45_3438_c1 | 3300050496 | Bacteria | 3093 |
| 617 | nmdc:mga07m45_4618_c1 | 3300050496 | Bacteria | 6752 |
| 618 | nmdc:mga05p37_41370_c1 | 3300050507 | Bacteria | 5658 |
| 619 | Ga0500635_0000017 | 3300053080 | Bacteria | 113720 |
| 620 | Ga0500635_0013483 | 3300053080 | Bacteria | 2375 |
| 621 | Ga0500578_0000683 | 3300053086 | Bacteria | 40592 |
| 622 | Ga0500652_000930 | 3300053131 | Bacteria | 9670 |
| 623 | Ga0500659_0003436 | 3300053135 | Bacteria | 9256 |
| 624 | Ga0500559_0010928 | 3300053136 | Bacteria | 3889 |
| 625 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 626 | Ga0500622_0000028 | 3300053156 | Bacteria | 218994 |
| 627 | Ga0500636_0045507 | 3300053177 | Bacteria | 2588 |
| 628 | Ga0466962_0001425 | 3300061719 | Bacteria | 11134 |
| 629 | Ga0530510_0009039 | 3300061734 | Bacteria | 6983 |
| 630 | Ga0530510_0010256 | 3300061734 | Bacteria | 6564 |
| 631 | 2511254009 | 2511231004 | Bacteria | 6669789 |
| 632 | 2511266851 | 2511231006 | Bacteria | 6794709 |
| 633 | 2511272443 | 2511231007 | Bacteria | 6306603 |
| 634 | 2511275102 | 2511231008 | Bacteria | 6624100 |
| 635 | 2511289394 | 2511231010 | Bacteria | 6373152 |
| 636 | 2511297762 | 2511231011 | Bacteria | 6149768 |
| 637 | 2511302826 | 2511231012 | Bacteria | 6738011 |
| 638 | 2511314420 | 2511231014 | Bacteria | 6462302 |
| 639 | 2511317222 | 2511231015 | Bacteria | 6598026 |
| 640 | 2511328020 | 2511231016 | Bacteria | 6704427 |
| 641 | 2511329659 | 2511231017 | Bacteria | 6503007 |
| 642 | 2511336844 | 2511231018 | Bacteria | 6436256 |
| 643 | 2511344807 | 2511231019 | Bacteria | 6520662 |
| 644 | 2511349570 | 2511231020 | Bacteria | 6115223 |
| 645 | 2511359298 | 2511231021 | Bacteria | 7302637 |
| 646 | 2511360908 | 2511231022 | Bacteria | 6719296 |
| 647 | 2511370984 | 2511231023 | Bacteria | 6808468 |
| 648 | 2511375692 | 2511231024 | Bacteria | 5835885 |
| 649 | 2511413476 | 2511231031 | Bacteria | 6558529 |
| 650 | 2511827624 | 2511231156 | Bacteria | 6845832 |
| 651 | 2512329503 | 2512047018 | Bacteria | 6663241 |
| 652 | 2555245930 | 2554235231 | Bacteria | 5215788 |
| 653 | 2555672825 | 2554235341 | Bacteria | 6867980 |
| 654 | 2583795735 | 2582580891 | Bacteria | 6800976 |
| 655 | 2587729511 | 2585428057 | Bacteria | 6737412 |
| 656 | 2587733974 | 2585428058 | Bacteria | 6853932 |
| 657 | 2588294591 | 2588253510 | Bacteria | 6901809 |
| 658 | 2597860869 | 2597489887 | Bacteria | 6666321 |
| 659 | 2597866619 | 2597489888 | Bacteria | 6179543 |
| 660 | 2597872475 | 2597489889 | Bacteria | 6297495 |
| 661 | 2599331154 | 2599185155 | Bacteria | 5827168 |
| 662 | 2599355971 | 2599185160 | Bacteria | 6844013 |
| 663 | 2599362627 | 2599185161 | Bacteria | 6960462 |
| 664 | 2599369067 | 2599185162 | Bacteria | 6957254 |
| 665 | 2599375736 | 2599185163 | Bacteria | 6995158 |
| 666 | 2599381077 | 2599185164 | Bacteria | 6841688 |
| 667 | 2599387407 | 2599185165 | Bacteria | 6843250 |
| 668 | 2599394594 | 2599185166 | Bacteria | 6959206 |
| 669 | 2599400550 | 2599185167 | Bacteria | 6353609 |
| 670 | 2599406359 | 2599185168 | Bacteria | 6997636 |
| 671 | 2599449874 | 2599185179 | Bacteria | 6611171 |
| 672 | 2599462805 | 2599185181 | Bacteria | 6844519 |
| 673 | 2599467772 | 2599185182 | Bacteria | 6883168 |
| 674 | 2599485895 | 2599185185 | Bacteria | 6652270 |
| 675 | 2599491822 | 2599185186 | Bacteria | 6831633 |
| 676 | 2599500250 | 2599185188 | Bacteria | 6164180 |
| 677 | 2599505741 | 2599185189 | Bacteria | 5862825 |
| 678 | 2599511948 | 2599185190 | Bacteria | 6285678 |
| 679 | 2599516932 | 2599185191 | Bacteria | 6297582 |
| 680 | 2599614419 | 2599185212 | Bacteria | 6765997 |
| 681 | 2599768162 | 2599185248 | Bacteria | 6696816 |
| 682 | 2599804677 | 2599185257 | Bacteria | 6492581 |
| 683 | 2599879026 | 2599185288 | Bacteria | 6666191 |
| 684 | 2599885597 | 2599185289 | Bacteria | 6778765 |
| 685 | 2599892690 | 2599185290 | Bacteria | 6289611 |
| 686 | 2599897311 | 2599185291 | Bacteria | 6775623 |
| 687 | 2599930720 | 2599185300 | Bacteria | 6062622 |
| 688 | 2599942359 | 2599185302 | Bacteria | 5954930 |
| 689 | 2599951440 | 2599185303 | Bacteria | 6512725 |
| 690 | 2599954228 | 2599185304 | Bacteria | 5951361 |
| 691 | 2599961901 | 2599185305 | Bacteria | 6748700 |
| 692 | 2599965927 | 2599185306 | Bacteria | 6637356 |
| 693 | 2599972217 | 2599185307 | Bacteria | 6194719 |
| 694 | 2599980890 | 2599185308 | Bacteria | 6621546 |
| 695 | 2599982929 | 2599185309 | Bacteria | 5969593 |
| 696 | 2599988321 | 2599185310 | Bacteria | 6014457 |
| 697 | 2599993980 | 2599185311 | Bacteria | 6354990 |
| 698 | 2599999115 | 2599185312 | Bacteria | 5912071 |
| 699 | 2600004325 | 2599185313 | Bacteria | 6658188 |
| 700 | 2600014766 | 2599185314 | Bacteria | 6621749 |
| 701 | 2600020386 | 2599185315 | Bacteria | 6771107 |
| 702 | 2600026350 | 2599185316 | Bacteria | 6320029 |
| 703 | 2600032100 | 2599185317 | Bacteria | 6435722 |
| 704 | 2600035963 | 2599185318 | Bacteria | 6961590 |
| 705 | 2600042327 | 2599185319 | Bacteria | 6637840 |
| 706 | 2600046646 | 2599185320 | Bacteria | 5963263 |
| 707 | 2600054936 | 2599185321 | Bacteria | 6764560 |
| 708 | 2600061037 | 2599185322 | Bacteria | 6763055 |
| 709 | 2600066379 | 2599185323 | Bacteria | 6688755 |
| 710 | 2600074377 | 2599185324 | Bacteria | 6590677 |
| 711 | 2600076549 | 2599185325 | Bacteria | 6324919 |
| 712 | 2600215431 | 2599185356 | Bacteria | 6843884 |
| 713 | 2600359003 | 2600254930 | Bacteria | 6431253 |
| 714 | 2600363559 | 2600254931 | Bacteria | 6734225 |
| 715 | 2600444088 | 2600254954 | Bacteria | 5100516 |
| 716 | 2600445720 | 2600254954 | Bacteria | 5100516 |
| 717 | 2601627300 | 2600255283 | Bacteria | 6061572 |
| 718 | 2601693456 | 2600255296 | Bacteria | 5784754 |
| 719 | 2601775597 | 2600255313 | Bacteria | 6842543 |
| 720 | 2601798571 | 2600255318 | Bacteria | 6383414 |
| 721 | 2602008427 | 2600255389 | Bacteria | 5275336 |
| 722 | 2602012564 | 2600255389 | Bacteria | 5275336 |
| 723 | 2606077465 | 2603880185 | Bacteria | 6379190 |
| 724 | 2606129289 | 2603880199 | Bacteria | 6377649 |
| 725 | 2621296857 | 2619619299 | Bacteria | 6649820 |
| 726 | 2624483401 | 2623620443 | Bacteria | 6427864 |
| 727 | 2624494921 | 2623620446 | Bacteria | 6500345 |
| 728 | 2643842952 | 2643221565 | Bacteria | 6216018 |
| 729 | 2643872253 | 2643221571 | Bacteria | 6228673 |
| 730 | 2643955645 | 2643221589 | Bacteria | 6250934 |
| 731 | 2643969636 | 2643221592 | Bacteria | 6608788 |
| 732 | 2644020439 | 2643221602 | Bacteria | 6249926 |
| 733 | 2644143936 | 2643221625 | Bacteria | 6512927 |
| 734 | 2644184494 | 2643221633 | Bacteria | 6733554 |
| 735 | 2644276357 | 2643221648 | Bacteria | 6521465 |
| 736 | 2644283239 | 2643221650 | Bacteria | 7029547 |
| 737 | 2644304782 | 2643221654 | Bacteria | 5273570 |
| 738 | 2644620156 | 2643221713 | Bacteria | 6554480 |
| 739 | 2652544923 | 2651869719 | Bacteria | 6047974 |
| 740 | 2671089539 | 2667528170 | Bacteria | 6786960 |
| 741 | 2671099267 | 2667528171 | Bacteria | 6900659 |
| 742 | 2671128595 | 2667528176 | Bacteria | 6724917 |
| 743 | 2671771684 | 2671180172 | Bacteria | 6495783 |
| 744 | 2677897119 | 2675903420 | Bacteria | 6247433 |
| 745 | 2678266137 | 2675903515 | Bacteria | 6580491 |
| 746 | 2715749842 | 2713897148 | Bacteria | 5883533 |
| 747 | 2715754858 | 2713897149 | Bacteria | 6506249 |
| 748 | 2718636602 | 2718217725 | Bacteria | 5758958 |
| 749 | 2723251355 | 2721755607 | Bacteria | 5841722 |
| 750 | 2738671677 | 2738541265 | Bacteria | 6594665 |
| 751 | 2738691946 | 2738541271 | Bacteria | 5657310 |
| 752 | 2738750071 | 2738541282 | Bacteria | 6593925 |
| 753 | 2738807242 | 2738541294 | Bacteria | 6925949 |
| 754 | 2738859111 | 2738541303 | Bacteria | 6591772 |
| 755 | 2738894602 | 2738541309 | Bacteria | 6926455 |
| 756 | 2739199047 | 2738543004 | Bacteria | 6381073 |
| 757 | 2739258988 | 2738543015 | Bacteria | 6750701 |
| 758 | 2739263304 | 2738543016 | Bacteria | 5657564 |
| 759 | 2739285133 | 2738543020 | Bacteria | 5718238 |
| 760 | 2739289617 | 2738543020 | Bacteria | 5718238 |
| 761 | 2739290447 | 2738543021 | Bacteria | 5718241 |
| 762 | 2739294929 | 2738543021 | Bacteria | 5718241 |
| 763 | 2739312517 | 2738543025 | Bacteria | 6600348 |
| 764 | 2743740411 | 2740892503 | Bacteria | 6855563 |
| 765 | 2745007369 | 2744054620 | Bacteria | 6551379 |
| 766 | 2765581401 | 2765235841 | Bacteria | 6137024 |
| 767 | 2774118389 | 2773857670 | Bacteria | 6407454 |
| 768 | 2774135579 | 2773857673 | Bacteria | 6513460 |
| 769 | 2784261830 | 2784132063 | Bacteria | 6262788 |
| 770 | 2784313563 | 2784132072 | Bacteria | 6596533 |
| 771 | 2794593850 | 2791355520 | Bacteria | 5948615 |
| 772 | 2808855706 | 2808606361 | Bacteria | 6136259 |
| 773 | 2808905735 | 2808606373 | Bacteria | 4423627 |
| 774 | 2808926499 | 2808606376 | Bacteria | 6248667 |
| 775 | 2808928454 | 2808606377 | Bacteria | 6646337 |
| 776 | 2808935457 | 2808606378 | Bacteria | 6177535 |
| 777 | 2808942154 | 2808606379 | Bacteria | 5022697 |
| 778 | 2808942793 | 2808606379 | Bacteria | 5022697 |
| 779 | 2808948660 | 2808606380 | Bacteria | 6248705 |
| 780 | 2808950363 | 2808606381 | Bacteria | 6646461 |
| 781 | 2808959855 | 2808606382 | Bacteria | 6841132 |
| 782 | 2808964065 | 2808606383 | Bacteria | 6138645 |
| 783 | 2808976138 | 2808606385 | Bacteria | 6711065 |
| 784 | 2808993238 | 2808606388 | Bacteria | 6706662 |
| 785 | 2808999099 | 2808606389 | Bacteria | 6138126 |
| 786 | 2809217174 | 2808606445 | Bacteria | 6057339 |
| 787 | 2817494030 | 2816332298 | Bacteria | 6852809 |
| 788 | 2819655119 | 2818991456 | Bacteria | 6123676 |
| 789 | 2819704389 | 2818991464 | Bacteria | 6907494 |
| 790 | 2823424048 | 2823421272 | Bacteria | 5372474 |
| 791 | 2823425716 | 2823421272 | Bacteria | 5372474 |
| 792 | 2825655106 | 2825651385 | Bacteria | 6715909 |
| 793 | 2826581927 | 2826581358 | Bacteria | 5963467 |
| 794 | 2834030939 | 2834028612 | Bacteria | 6354979 |
| 795 | 2842806224 | 2842805378 | Bacteria | 5385175 |
| 796 | 2842807777 | 2842805378 | Bacteria | 5385175 |
| 797 | 2842816818 | 2842815866 | Bacteria | 5947510 |
| 798 | 2842831296 | 2842826826 | Bacteria | 5974129 |
| 799 | 2842833449 | 2842832357 | Bacteria | 5959113 |
| 800 | 2842837888 | 2842837860 | Bacteria | 6066181 |
| 801 | 2842845679 | 2842843487 | Bacteria | 6004777 |
| 802 | 2842853967 | 2842849001 | Bacteria | 5924277 |
| 803 | 2842855610 | 2842854478 | Bacteria | 6143501 |
| 804 | 2844667076 | 2844665904 | Bacteria | 6817974 |
| 805 | 2852616340 | 2852612431 | Bacteria | 6885235 |
| 806 | 2852659666 | 2852657418 | Bacteria | 6472974 |
| 807 | 2852671308 | 2852667396 | Bacteria | 6885555 |
| 808 | 2860341702 | 2860339153 | Bacteria | 6846989 |
| 809 | 2860873017 | 2860867994 | Bacteria | 5645326 |
| 810 | 2878035343 | 2878029506 | Bacteria | 6418441 |
| 811 | 2880235984 | 2880230671 | Bacteria | 6140320 |
| 812 | 2904518968 | 2904518522 | Bacteria | 6068986 |
| 813 | 2904551339 | 2904550169 | Bacteria | 6221258 |
| 814 | 2908452570 | 2908446538 | Bacteria | 6829095 |
| 815 | 2912968885 | 2912963787 | Bacteria | 5646108 |
| 816 | 2913042518 | 2913036834 | Bacteria | 6704877 |
| 817 | 2917076721 | 2917070673 | Bacteria | 6868303 |
| 818 | 2919065528 | 2919063839 | Bacteria | 6302690 |
| 819 | 2919155905 | 2919155634 | Bacteria | 4860545 |
| 820 | 2919389200 | 2919385768 | Bacteria | 5897293 |
| 821 | 2919457536 | 2919456309 | Bacteria | 6586567 |
| 822 | 2919485645 | 2919481497 | Bacteria | 6907839 |
| 823 | 2919488177 | 2919487758 | Bacteria | 5929766 |
| 824 | 2919502463 | 2919501602 | Bacteria | 5286340 |
| 825 | 2919503701 | 2919501602 | Bacteria | 5286340 |
| 826 | 2919700587 | 2919697872 | Bacteria | 6553725 |
| 827 | 2923159504 | 2923153595 | Bacteria | 6870622 |
| 828 | 2923526223 | 2923525760 | Bacteria | 4472324 |
| 829 | 2923588988 | 2923586266 | Bacteria | 6565975 |
| 830 | 2926064136 | 2926063275 | Bacteria | 5285848 |
| 831 | 2926065727 | 2926063275 | Bacteria | 5285848 |
| 832 | 2929149909 | 2929144301 | Bacteria | 6622272 |
| 833 | 2929195139 | 2929189879 | Bacteria | 5930554 |
| 834 | 2931372651 | 2931369376 | Bacteria | 6847892 |
| 835 | 2931396399 | 2931390751 | Bacteria | 6273349 |
| 836 | 2931398067 | 2931396565 | Bacteria | 7251677 |
| 837 | 2935358312 | 2935353572 | Unclassified | 6955622 |
| 838 | 2939640816 | 2939636861 | Bacteria | 6297853 |
| 839 | 2939654226 | 2939651529 | Bacteria | 5895393 |
| 840 | 2945930920 | 2945928738 | Bacteria | 6053221 |
| 841 | 2945966844 | 2945961074 | Bacteria | 7342064 |
| 842 | 2946013297 | 2946006987 | Bacteria | 6705746 |
| 843 | 2946027892 | 2946027586 | Bacteria | 6049274 |
| 844 | 2947234412 | 2947233263 | Bacteria | 6439278 |
| 845 | 2969310163 | 2969304461 | Bacteria | 6601805 |
| 846 | 2974294089 | 2974289157 | Bacteria | 6080362 |
| 847 | 2984286612 | 2984286254 | Bacteria | 6702062 |
| 848 | 2988731450 | 2988728565 | Bacteria | 6124362 |
| 849 | 2990199686 | 2990196909 | Bacteria | 4054280 |
| 850 | 2998145386 | 2998139840 | Bacteria | 6073514 |
| 851 | 3007255270 | 3007252601 | Bacteria | 4559114 |
| 852 | 3007315928 | 3007315729 | Bacteria | 5076637 |
| 853 | 3007399409 | 3007395558 | Bacteria | 6755444 |
| 854 | 3007419828 | 3007419365 | Bacteria | 7026924 |
| 855 | 3007517167 | 3007511990 | Bacteria | 6481491 |
| 856 | 3007618520 | 3007614139 | Bacteria | 6053559 |
| 857 | 3007622511 | 3007619802 | Bacteria | 6411688 |
| 858 | 3007721744 | 3007718800 | Bacteria | 5971527 |
| 859 | 3007803577 | 3007803356 | Bacteria | 5931491 |
| 860 | 3007859181 | 3007855910 | Bacteria | 5637581 |
| 861 | 3007865113 | 3007861166 | Bacteria | 6045338 |
| 862 | 3007866790 | 3007866637 | Bacteria | 5899198 |
| 863 | 637323262 | 637000220 | Bacteria | 7074893 |
| 864 | 8015693603 | 8015687852 | Bacteria | 6613826 |
| 865 | 8019769781 | 8019769354 | Bacteria | 6924660 |
| 866 | 8019777694 | 8019775933 | Bacteria | 6858656 |
| 867 | 8029995515 | 8029995093 | Bacteria | 5990776 |
| 868 | 8052494845 | 8052494512 | Bacteria | 5765634 |
| 869 | 8052496366 | 8052494512 | Bacteria | 5765634 |
| 870 | 8054287908 | 8054285046 | Bacteria | 6919322 |
| 871 | 8054349593 | 8054347763 | Bacteria | 5901107 |
| 872 | 8054508921 | 8054503363 | Bacteria | 6101651 |
| 873 | 8055776849 | 8055770955 | Bacteria | 6827675 |
| 874 | 8055823890 | 8055817908 | Bacteria | 6609162 |
| 875 | 8056131593 | 8056125926 | Bacteria | 6228218 |
| 876 | 8056137297 | 8056131705 | Bacteria | 6107031 |
| 877 | 8056148759 | 8056143049 | Bacteria | 6307666 |
| 878 | 8056151505 | 8056148874 | Bacteria | 6479865 |
| 879 | 8056160840 | 8056155041 | Bacteria | 6486948 |
| 880 | 8056163621 | 8056161164 | Bacteria | 6106669 |
| 881 | 8056171318 | 8056166840 | Bacteria | 5820959 |
| 882 | 8056177420 | 8056172158 | Bacteria | 6133900 |
| 883 | 8056181988 | 8056177738 | Bacteria | 6748268 |
| 884 | 8056570454 | 8056569372 | Bacteria | 5997322 |
| 885 | Ga0439438_007901 | |||
| 886 | MRS2a_Contig_136 | |||
| 887 | SwRhRL2b_contig_180730 | |||
| 888 | JGI24741J21665_1004873 | |||
| 889 | JGI25156J39149_1000278 | |||
| 890 | JGI25156J39149_1000973 | |||
| 891 | JGI25156J39149_1009634 | |||
| 892 | JGI25162J39368_1000505 | |||
| 893 | JGI25162J39368_1000520 | |||
| 894 | JGI25154J39366_1000221 | |||
| 895 | JGI25157J39369_1000049 | |||
| 896 | JGI25163J39215_1002359 | |||
| 897 | JGI25164J39214_1000342 | |||
| 898 | JGI25164J39214_1000350 | |||
| 899 | JGI25165J46597_1000629 | |||
| 900 | JGI25165J46597_1000645 | |||
| 901 | rootH1_10025580 | |||
| 902 | Ga0055538_1000007 | |||
| 903 | Ga0055538_1000032 | |||
| 904 | Ga0055539_1000043 | |||
| 905 | Ga0055539_1000583 | |||
| 906 | Ga0055539_1001782 | |||
| 907 | Ga0055533_1000010 | |||
| 908 | Ga0055533_1000052 | |||
| 909 | Ga0055532_1000047 | |||
| 910 | Ga0055525_1000062 | |||
| 911 | Ga0055525_1000775 | |||
| 912 | Ga0055535_1000607 | |||
| 913 | Ga0055535_1000906 | |||
| 914 | Ga0055535_1004623 | |||
| 915 | Ga0055529_1000731 | |||
| 916 | Ga0055536_1001013 | |||
| 917 | Ga0055536_1004708 | |||
| 918 | Ga0055536_1004755 | |||
| 919 | Ga0055530_10000150 | |||
| 920 | Ga0055530_10001395 | |||
| 921 | Ga0055530_10004701 | |||
| 922 | Ga0055530_10009077 | |||
| 923 | Ga0055540_1000175 | |||
| 924 | Ga0055540_1002862 | |||
| 925 | Ga0055540_1003956 | |||
| 926 | Ga0055540_1007251 | |||
| 927 | Ga0055531_10008572 | |||
| 928 | Ga0055541_1000030 | |||
| 929 | Ga0058692_1001311 | |||
| 930 | Ga0065165_1000774 | |||
| 931 | Ga0065714_10003458 | |||
| 932 | Ga0065714_10008011 | |||
| 933 | Ga0065714_10019612 | |||
| 934 | Ga0065704_10071473 | |||
| 935 | Ga0065712_10000927 | |||
| 936 | Ga0065712_10069335 | |||
| 937 | Ga0065712_10072290 | |||
| 938 | Ga0065715_10002954 | |||
| 939 | Ga0070658_10136714 | |||
| 940 | Ga0070670_100001953 | |||
| 941 | Ga0070670_100210681 | |||
| 942 | Ga0068869_100053998 | |||
| 943 | Ga0070660_100097909 | |||
| 944 | Ga0070661_100001640 | |||
| 945 | Ga0070669_100002598 | |||
| 946 | Ga0070669_100011283 | |||
| 947 | Ga0070663_100034782 | |||
| 948 | Ga0070662_100008312 | |||
| 949 | Ga0070662_100078941 | |||
| 950 | Ga0068853_100000187 | |||
| 951 | Ga0070665_100078213 | |||
| 952 | Ga0068855_100052495 | |||
| 953 | Ga0070664_100001886 | |||
| 954 | Ga0068857_100024975 | |||
| 955 | Ga0068861_100040263 | |||
| 956 | Ga0068851_10000007 | |||
| 957 | Ga0075364_10154732 | |||
| 958 | Ga0075432_10007217 | |||
| 959 | Ga0075432_10009884 | |||
| 960 | Ga0075432_10015661 | |||
| 961 | Ga0075366_10001453 | |||
| 962 | Ga0075366_10006476 | |||
| 963 | Ga0075366_10006521 | |||
| 964 | Ga0075370_10016883 | |||
| 965 | Ga0075434_100203650 | |||
| 966 | Ga0099823_1000043 | |||
| 967 | Ga0099823_1000050 | |||
| 968 | Ga0099823_1022982 | |||
| 969 | Ga0099823_1063234 | |||
| 970 | Ga0079104_1001103 | |||
| 971 | Ga0079104_1003465 | |||
| 972 | Ga0099826_10004877 | |||
| 973 | Ga0105251_10000024 | |||
| 974 | Ga0105251_10002156 | |||
| 975 | Ga0105251_10004294 | |||
| 976 | Ga0105251_10015050 | |||
| 977 | Ga0105251_10018016 | |||
| 978 | Ga0105251_10018659 | |||
| 979 | Ga0105251_10054573 | |||
| 980 | Ga0105244_10000265 | |||
| 981 | Ga0105244_10000542 | |||
| 982 | Ga0105244_10007755 | |||
| 983 | Ga0105244_10014617 | |||
| 984 | Ga0105244_10018100 | |||
| 985 | Ga0105244_10025226 | |||
| 986 | Ga0105244_10028356 | |||
| 987 | Ga0105244_10080040 | |||
| 988 | Ga0105250_10001113 | |||
| 989 | Ga0105250_10012888 | |||
| 990 | Ga0105240_10072481 | |||
| 991 | Ga0111539_10344589 | |||
| 992 | Ga0105243_10001572 | |||
| 993 | Ga0105243_10001599 | |||
| 994 | Ga0105243_10011620 | |||
| 995 | Ga0105243_10052138 | |||
| 996 | Ga0105243_10125045 | |||
| 997 | Ga0105242_10001499 | |||
| 998 | Ga0105242_10194169 | |||
| 999 | Ga0105248_10007834 | |||
| 1000 | Ga0105237_10010598 | |||
| 1001 | Ga0105237_10111123 | |||
| 1002 | Ga0105238_10170899 | |||
| 1003 | Ga0105249_10007064 | |||
| 1004 | Ga0105239_10025926 | |||
| 1005 | Ga0105246_10002803 | |||
| 1006 | Ga0105246_10007983 | |||
| 1007 | Ga0105246_10011130 | |||
| 1008 | Ga0157337_1000729 | |||
| 1009 | Ga0157345_1000705 | |||
| 1010 | Ga0157373_10013919 | |||
| 1011 | Ga0157373_10033727 | |||
| 1012 | Ga0157373_10047177 | |||
| 1013 | Ga0157371_10001604 | |||
| 1014 | Ga0157371_10013168 | |||
| 1015 | Ga0157371_10013733 | |||
| 1016 | Ga0157371_10038069 | |||
| 1017 | Ga0157371_10043778 | |||
| 1018 | Ga0157370_10003242 | |||
| 1019 | Ga0157370_10003759 | |||
| 1020 | Ga0157370_10063716 | |||
| 1021 | Ga0157370_10069376 | |||
| 1022 | Ga0157370_10084960 | |||
| 1023 | Ga0157370_10135753 | |||
| 1024 | Ga0157369_10030463 | |||
| 1025 | Ga0157369_10043726 | |||
| 1026 | Ga0157369_10055802 | |||
| 1027 | Ga0157369_10122753 | |||
| 1028 | Ga0157369_10166556 | |||
| 1029 | Ga0157369_10301600 | |||
| 1030 | Ga0163162_10030569 | |||
| 1031 | Ga0157372_10015782 | |||
| 1032 | Ga0157375_10152615 | |||
| 1033 | Ga0157375_10256711 | |||
| 1034 | Ga0182008_10006484 | |||
| 1035 | Ga0182008_10007506 | |||
| 1036 | Ga0157379_10070294 | |||
| 1037 | Ga0182006_1003062 | |||
| 1038 | Ga0182006_1012007 | |||
| 1039 | Ga0182006_1030231 | |||
| 1040 | Ga0182006_1052089 | |||
| 1041 | Ga0182007_10002733 | |||
| 1042 | Ga0182005_1002836 | |||
| 1043 | Ga0182005_1003780 | |||
| 1044 | Ga0182005_1008200 | |||
| 1045 | Ga0163161_10089329 | |||
| 1046 | Ga0163161_10093556 | |||
| 1047 | Ga0213872_10000066 | |||
| 1048 | Ga0213872_10000187 | |||
| 1049 | Ga0213872_10062256 | |||
| 1050 | Ga0209760_100027 | |||
| 1051 | Ga0209760_100197 | |||
| 1052 | Ga0209784_100007 | |||
| 1053 | Ga0209566_100009 | |||
| 1054 | Ga0209674_100003 | |||
| 1055 | Ga0209674_100021 | |||
| 1056 | Ga0209147_100009 | |||
| 1057 | Ga0209563_100018 | |||
| 1058 | Ga0209563_100049 | |||
| 1059 | Ga0209563_101931 | |||
| 1060 | Ga0207427_100005 | |||
| 1061 | Ga0207427_100006 | |||
| 1062 | Ga0207427_100280 | |||
| 1063 | Ga0209437_100013 | |||
| 1064 | Ga0209437_100018 | |||
| 1065 | Ga0209437_101479 | |||
| 1066 | Ga0209258_100163 | |||
| 1067 | Ga0209258_100169 | |||
| 1068 | Ga0209646_1000138 | |||
| 1069 | Ga0209646_1000184 | |||
| 1070 | Ga0209026_1000021 | |||
| 1071 | Ga0209677_100012 | |||
| 1072 | Ga0209677_100145 | |||
| 1073 | Ga0209677_100209 | |||
| 1074 | Ga0209677_107310 | |||
| 1075 | Ga0209759_1000025 | |||
| 1076 | Ga0209759_1001401 | |||
| 1077 | Ga0209759_1002119 | |||
| 1078 | Ga0209759_1010090 | |||
| 1079 | Ga0209759_1011333 | |||
| 1080 | Ga0209233_1000021 | |||
| 1081 | Ga0209233_1000022 | |||
| 1082 | Ga0209455_1000059 | |||
| 1083 | Ga0209673_1005874 | |||
| 1084 | Ga0209675_1002099 | |||
| 1085 | Ga0209676_1000015 | |||
| 1086 | Ga0209676_1000030 | |||
| 1087 | Ga0209676_1000041 | |||
| 1088 | Ga0209676_1000617 | |||
| 1089 | Ga0209676_1001192 | |||
| 1090 | Ga0209676_1005922 | |||
| 1091 | Ga0209676_1007365 | |||
| 1092 | Ga0209050_1000024 | |||
| 1093 | Ga0209050_1000030 | |||
| 1094 | Ga0209050_1000374 | |||
| 1095 | Ga0209050_1000518 | |||
| 1096 | Ga0209050_1000647 | |||
| 1097 | Ga0209051_1000012 | |||
| 1098 | Ga0209051_1000023 | |||
| 1099 | Ga0209051_1000881 | |||
| 1100 | Ga0209051_1003155 | |||
| 1101 | Ga0209051_1005236 | |||
| 1102 | Ga0209257_1000069 | |||
| 1103 | Ga0209257_1004945 | |||
| 1104 | Ga0207656_10000006 | |||
| 1105 | Ga0207696_1000031 | |||
| 1106 | Ga0207696_1000050 | |||
| 1107 | Ga0207696_1000105 | |||
| 1108 | Ga0207696_1000156 | |||
| 1109 | Ga0207696_1000541 | |||
| 1110 | Ga0207696_1008940 | |||
| 1111 | Ga0207696_1009541 | |||
| 1112 | Ga0207696_1013612 | |||
| 1113 | Ga0207655_1000014 | |||
| 1114 | Ga0207655_1000202 | |||
| 1115 | Ga0207655_1000216 | |||
| 1116 | Ga0207655_1000295 | |||
| 1117 | Ga0207655_1000388 | |||
| 1118 | Ga0207655_1001189 | |||
| 1119 | Ga0207655_1002393 | |||
| 1120 | Ga0207655_1002424 | |||
| 1121 | Ga0207655_1005954 | |||
| 1122 | Ga0207655_1007793 | |||
| 1123 | Ga0207655_1009633 | |||
| 1124 | Ga0207655_1012780 | |||
| 1125 | Ga0207655_1013044 | |||
| 1126 | Ga0207655_1020188 | |||
| 1127 | Ga0207655_1027790 | |||
| 1128 | Ga0207713_1000010 | |||
| 1129 | Ga0207713_1000077 | |||
| 1130 | Ga0207713_1001506 | |||
| 1131 | Ga0207713_1003359 | |||
| 1132 | Ga0207713_1003953 | |||
| 1133 | Ga0207713_1004110 | |||
| 1134 | Ga0207713_1004772 | |||
| 1135 | Ga0207713_1007874 | |||
| 1136 | Ga0207713_1009206 | |||
| 1137 | Ga0207713_1019128 | |||
| 1138 | Ga0207713_1028390 | |||
| 1139 | Ga0207705_10020837 | |||
| 1140 | Ga0207671_10000131 | |||
| 1141 | Ga0207657_10029841 | |||
| 1142 | Ga0207649_10000012 | |||
| 1143 | Ga0207681_10000099 | |||
| 1144 | Ga0207681_10008578 | |||
| 1145 | Ga0207650_10000157 | |||
| 1146 | Ga0207650_10000185 | |||
| 1147 | Ga0207650_10071195 | |||
| 1148 | Ga0207690_10070448 | |||
| 1149 | Ga0207706_10001069 | |||
| 1150 | Ga0207706_10009625 | |||
| 1151 | Ga0207686_10000319 | |||
| 1152 | Ga0207709_10000071 | |||
| 1153 | Ga0207709_10000337 | |||
| 1154 | Ga0207709_10045241 | |||
| 1155 | Ga0207709_10081986 | |||
| 1156 | Ga0207711_10056958 | |||
| 1157 | Ga0207689_10014227 | |||
| 1158 | Ga0207679_10000015 | |||
| 1159 | Ga0207667_10009539 | |||
| 1160 | Ga0207712_10004516 | |||
| 1161 | Ga0207640_10072216 | |||
| 1162 | Ga0207677_10180154 | |||
| 1163 | Ga0207639_10000775 | |||
| 1164 | Ga0207678_10015659 | |||
| 1165 | Ga0207702_10000800 | |||
| 1166 | Ga0207674_10043460 | |||
| 1167 | Ga0207675_100052490 | |||
| 1168 | Ga0209281_1000016 | |||
| 1169 | Ga0209281_1000019 | |||
| 1170 | Ga0209281_1001944 | |||
| 1171 | Ga0209389_1000017 | |||
| 1172 | Ga0209389_1000053 | |||
| 1173 | Ga0209389_1072180 | |||
| 1174 | Ga0209371_1000032 | |||
| 1175 | Ga0207428_10027106 | |||
| 1176 | Ga0207428_10111895 | |||
| 1177 | Ga0265336_10000006 | |||
| 1178 | Ga0307515_10023444 | |||
| 1179 | Ga0265324_10002529 | |||
| 1180 | Ga0268256_1000050 | |||
| 1181 | Ga0307511_10083198 | |||
| 1182 | Ga0314311_1099326 | |||
| 1183 | Ga0316178_1008333 | |||
| 1184 | Ga0307408_100000002 | |||
| 1185 | Ga0307408_100000077 | |||
| 1186 | Ga0307408_100022947 | |||
| 1187 | Ga0307408_100047222 | |||
| 1188 | Ga0307514_10001133 | |||
| 1189 | Ga0307516_10000878 | |||
| 1190 | Ga0307405_10024462 | |||
| 1191 | Ga0307409_100129357 | |||
| 1192 | Ga0307416_100206385 | |||
| 1193 | Ga0307414_10016650 | |||
| 1194 | Ga0307414_10026324 | |||
| 1195 | Ga0307411_10066333 | |||
| 1196 | Ga0307510_10122871 | |||
| 1197 | Ga0373937_0023779 | |||
| 1198 | Ga0373937_0119750 | |||
| 1199 | Ga0395905_0051786 | |||
| 1200 | Ga0395901_0014533 | |||
| 1201 | Ga0237819_01098 | |||
| 1202 | Ga0436361_0313405 | |||
| 1203 | Ga0436361_0525200 | |||
| 1204 | Ga0436361_0857598 | |||
| 1205 | Ga0436361_1024184 | |||
| 1206 | Ga0439438_004878 | |||
| 1207 | Ga0439438_006624 | |||
| 1208 | Ga0439447_003423 | |||
| 1209 | Ga0439447_003817 | |||
| 1210 | Ga0439447_008152 | |||
| 1211 | Ga0439466_0000466 | |||
| 1212 | Ga0439466_0002245 | |||
| 1213 | Ga0439466_0003958 | |||
| 1214 | Ga0439466_0017860 | |||
| 1215 | Ga0439432_001621 | |||
| 1216 | Ga0439432_005789 | |||
| 1217 | Ga0439432_011624 | |||
| 1218 | Ga0439432_019622 | |||
| 1219 | Ga0439452_003753 | |||
| 1220 | Ga0439452_004104 | |||
| 1221 | Ga0439452_004757 | |||
| 1222 | Ga0439452_005513 | |||
| 1223 | Ga0439456_003040 | |||
| 1224 | Ga0439456_010509 | |||
| 1225 | Ga0439463_002333 | |||
| 1226 | Ga0439463_002471 | |||
| 1227 | Ga0450911_000027 | |||
| 1228 | Ga0450911_000100 | |||
| 1229 | Ga0450911_002622 | |||
| 1230 | Ga0450890_000509 | |||
| 1231 | Ga0450905_004727 | |||
| 1232 | Ga0450907_001254 | |||
| 1233 | Ga0450907_003651 | |||
| 1234 | Ga0439446_0001826 | |||
| 1235 | Ga0439446_0017545 | |||
| 1236 | Ga0439434_0003416 | |||
| 1237 | Ga0439459_0012881 | |||
| 1238 | Ga0439464_0002231 | |||
| 1239 | Ga0439460_0000875 | |||
| 1240 | Ga0450916_000042 | |||
| 1241 | Ga0451577_0164037 | |||
| 1242 | Ga0466969_0009333 | |||
| 1243 | Ga0466965_0000692 | |||
| 1244 | Ga0466966_0005876 | |||
| 1245 | Ga0466961_0015298 | |||
| 1246 | Ga0466963_0057201 | |||
| 1247 | Ga0466964_0001646 | |||
| 1248 | Ga0453684_0012190 | |||
| 1249 | Ga0453684_0012554 | |||
| 1250 | Ga0466971_0006553 | |||
| 1251 | Ga0466957_0002678 | |||
| 1252 | Ga0466959_0003818 | |||
| 1253 | Ga0466958_0031576 | |||
| 1254 | Ga0466967_0058693 | |||
| 1255 | Ga0495617_003398 | |||
| 1256 | Ga0495617_019767 | |||
| 1257 | Ga0495627_000102 | |||
| 1258 | Ga0495627_004313 | |||
| 1259 | Ga0495627_012419 | |||
| 1260 | Ga0495590_0016101 | |||
| 1261 | Ga0495591_000105 | |||
| 1262 | Ga0495591_003166 | |||
| 1263 | Ga0495591_004534 | |||
| 1264 | Ga0495591_004959 | |||
| 1265 | Ga0495591_006424 | |||
| 1266 | Ga0495591_014983 | |||
| 1267 | Ga0495591_015401 | |||
| 1268 | Ga0495591_018892 | |||
| 1269 | Ga0495651_0146508 | |||
| 1270 | Ga0495653_0022923 | |||
| 1271 | Ga0495653_0040147 | |||
| 1272 | Ga0495653_0048713 | |||
| 1273 | Ga0495650_0000578 | |||
| 1274 | Ga0495650_0015211 | |||
| 1275 | Ga0495650_0030023 | |||
| 1276 | Ga0495650_0037793 | |||
| 1277 | Ga0495605_0000590 | |||
| 1278 | Ga0495605_0000625 | |||
| 1279 | Ga0495605_0001226 | |||
| 1280 | Ga0495605_0001398 | |||
| 1281 | Ga0495605_0010112 | |||
| 1282 | Ga0495605_0027479 | |||
| 1283 | Ga0495605_0067345 | |||
| 1284 | Ga0495639_0003111 | |||
| 1285 | Ga0495584_0009566 | |||
| 1286 | Ga0495584_0012700 | |||
| 1287 | Ga0495584_0093849 | |||
| 1288 | Ga0495585_0007063 | |||
| 1289 | Ga0495585_0010687 | |||
| 1290 | Ga0495585_0028569 | |||
| 1291 | Ga0495585_0047158 | |||
| 1292 | Ga0495596_0004395 | |||
| 1293 | Ga0495607_0001133 | |||
| 1294 | Ga0495607_0001267 | |||
| 1295 | Ga0495607_0004588 | |||
| 1296 | Ga0495607_0005049 | |||
| 1297 | Ga0495607_0013525 | |||
| 1298 | Ga0495607_0030626 | |||
| 1299 | Ga0495607_0039997 | |||
| 1300 | Ga0495607_0050428 | |||
| 1301 | Ga0495583_0000015 | |||
| 1302 | Ga0495583_0000927 | |||
| 1303 | Ga0495583_0004981 | |||
| 1304 | Ga0495583_0013180 | |||
| 1305 | Ga0495583_0016105 | |||
| 1306 | Ga0495583_0023578 | |||
| 1307 | Ga0495583_0062515 | |||
| 1308 | Ga0495606_0000083 | |||
| 1309 | Ga0495606_0003050 | |||
| 1310 | Ga0495606_0008185 | |||
| 1311 | Ga0495606_0015235 | |||
| 1312 | Ga0495606_0018166 | |||
| 1313 | Ga0495610_0009929 | |||
| 1314 | Ga0495610_0011079 | |||
| 1315 | Ga0495616_0014738 | |||
| 1316 | Ga0495620_0000171 | |||
| 1317 | Ga0495620_0000229 | |||
| 1318 | Ga0495620_0005486 | |||
| 1319 | Ga0495620_0014267 | |||
| 1320 | Ga0495631_0004242 | |||
| 1321 | Ga0495631_0017782 | |||
| 1322 | Ga0495632_0007443 | |||
| 1323 | Ga0495632_0008782 | |||
| 1324 | Ga0495632_0037321 | |||
| 1325 | Ga0495632_0088007 | |||
| 1326 | Ga0495637_0000271 | |||
| 1327 | Ga0495637_0002084 | |||
| 1328 | Ga0495637_0005947 | |||
| 1329 | Ga0495637_0015531 | |||
| 1330 | Ga0495637_0019714 | |||
| 1331 | Ga0495637_0027237 | |||
| 1332 | Ga0495643_0000345 | |||
| 1333 | Ga0495643_0000627 | |||
| 1334 | Ga0495643_0002030 | |||
| 1335 | Ga0495643_0007948 | |||
| 1336 | Ga0495643_0011277 | |||
| 1337 | Ga0495643_0012620 | |||
| 1338 | Ga0495643_0017811 | |||
| 1339 | Ga0495643_0039455 | |||
| 1340 | Ga0495644_0005075 | |||
| 1341 | Ga0495648_0013922 | |||
| 1342 | Ga0495648_0022554 | |||
| 1343 | Ga0495648_0023818 | |||
| 1344 | Ga0495648_0030158 | |||
| 1345 | Ga0495648_0059154 | |||
| 1346 | Ga0495642_0000631 | |||
| 1347 | Ga0495642_0024565 | |||
| 1348 | Ga0495654_0005941 | |||
| 1349 | Ga0495654_0006795 | |||
| 1350 | Ga0495654_0015100 | |||
| 1351 | Ga0495654_0021575 | |||
| 1352 | Ga0495586_0120780 | |||
| 1353 | Ga0495587_0015762 | |||
| 1354 | Ga0495609_0000023 | |||
| 1355 | Ga0495609_0000458 | |||
| 1356 | Ga0495609_0000759 | |||
| 1357 | Ga0495609_0003174 | |||
| 1358 | Ga0495597_0000221 | |||
| 1359 | Ga0495597_0005155 | |||
| 1360 | Ga0495622_0002873 | |||
| 1361 | Ga0495633_0000115 | |||
| 1362 | Ga0495656_0003150 | |||
| 1363 | Ga0495668_0009606 | |||
| 1364 | Ga0495668_0018591 | |||
| 1365 | Ga0495668_0058209 | |||
| 1366 | Ga0495668_0107117 | |||
| 1367 | Ga0495634_0019357 | |||
| 1368 | Ga0495611_0000749 | |||
| 1369 | Ga0495611_0003126 | |||
| 1370 | Ga0495611_0046839 | |||
| 1371 | Ga0495625_0000187 | |||
| 1372 | Ga0495635_0020678 | |||
| 1373 | Ga0495661_0000061 | |||
| 1374 | Ga0495661_0000865 | |||
| 1375 | Ga0495661_0002054 | |||
| 1376 | Ga0495661_0002403 | |||
| 1377 | Ga0495661_0019070 | |||
| 1378 | Ga0495661_0079958 | |||
| 1379 | Ga0495623_0022811 | |||
| 1380 | Ga0495670_0004412 | |||
| 1381 | Ga0495671_0005463 | |||
| 1382 | Ga0495671_0009031 | |||
| 1383 | Ga0495671_0011710 | |||
| 1384 | Ga0495671_0024764 | |||
| 1385 | Ga0495649_0000464 | |||
| 1386 | Ga0495649_0004778 | |||
| 1387 | Ga0495649_0008513 | |||
| 1388 | Ga0495649_0009795 | |||
| 1389 | Ga0495649_0023432 | |||
| 1390 | Ga0495589_0008703 | |||
| 1391 | Ga0495589_0010021 | |||
| 1392 | Ga0495589_0012850 | |||
| 1393 | Ga0495589_0052557 | |||
| 1394 | Ga0495600_0003343 | |||
| 1395 | Ga0495660_0000831 | |||
| 1396 | Ga0495660_0026271 | |||
| 1397 | Ga0495660_0045243 | |||
| 1398 | Ga0495636_0010451 | |||
| 1399 | Ga0495672_0012072 | |||
| 1400 | Ga0495672_0036083 | |||
| 1401 | Ga0495672_0036806 | |||
| 1402 | Ga0495672_0090366 | |||
| 1403 | Ga0495676_0000011 | |||
| 1404 | Ga0495676_0040008 | |||
| 1405 | Ga0495680_0014977 | |||
| 1406 | Ga0495680_0094802 | |||
| 1407 | Ga0495683_0000106 | |||
| 1408 | Ga0495683_0000207 | |||
| 1409 | Ga0495683_0007048 | |||
| 1410 | Ga0495683_0008997 | |||
| 1411 | Ga0495683_0012111 | |||
| 1412 | Ga0495687_007653 | |||
| 1413 | Ga0495679_000274 | |||
| 1414 | Ga0495679_000704 | |||
| 1415 | Ga0495673_0001682 | |||
| 1416 | Ga0495673_0005616 | |||
| 1417 | Ga0495673_0007829 | |||
| 1418 | Ga0495673_0010604 | |||
| 1419 | Ga0495673_0014010 | |||
| 1420 | Ga0495681_0012867 | |||
| 1421 | Ga0495681_0018926 | |||
| 1422 | Ga0495686_0003059 | |||
| 1423 | Ga0495686_0075073 | |||
| 1424 | Ga0495593_0014851 | |||
| 1425 | Ga0495626_0000068 | |||
| 1426 | Ga0495626_0005680 | |||
| 1427 | Ga0495626_0007093 | |||
| 1428 | Ga0495626_0008893 | |||
| 1429 | Ga0496102_0026312 | |||
| 1430 | Ga0496110_0019824 | |||
| 1431 | Ga0496114_0005705 | |||
| 1432 | Ga0496114_0103367 | |||
| 1433 | Ga0496116_0008830 | |||
| 1434 | Ga0496116_0018636 | |||
| 1435 | Ga0496116_0021869 | |||
| 1436 | Ga0496117_0000961 | |||
| 1437 | Ga0496117_0018385 | |||
| 1438 | Ga0496117_0038087 | |||
| 1439 | Ga0496117_0039315 | |||
| 1440 | Ga0496117_0060179 | |||
| 1441 | Ga0496118_0014197 | |||
| 1442 | Ga0496118_0016655 | |||
| 1443 | Ga0496118_0023180 | |||
| 1444 | Ga0496118_0068461 | |||
| 1445 | Ga0496119_0004034 | |||
| 1446 | Ga0496120_0003119 | |||
| 1447 | Ga0496121_0011294 | |||
| 1448 | Ga0496121_0013055 | |||
| 1449 | Ga0496121_0020706 | |||
| 1450 | Ga0496121_0021850 | |||
| 1451 | Ga0496122_0001707 | |||
| 1452 | Ga0496122_0002086 | |||
| 1453 | Ga0496122_0004723 | |||
| 1454 | Ga0496122_0006443 | |||
| 1455 | Ga0496122_0019987 | |||
| 1456 | Ga0496122_0074921 | |||
| 1457 | Ga0496123_0000178 | |||
| 1458 | Ga0496123_0000445 | |||
| 1459 | Ga0496123_0000607 | |||
| 1460 | Ga0496123_0037585 | |||
| 1461 | Ga0496123_0042041 | |||
| 1462 | Ga0496123_0057209 | |||
| 1463 | Ga0496124_0000073 | |||
| 1464 | Ga0496124_0004545 | |||
| 1465 | Ga0496124_0019279 | |||
| 1466 | Ga0496124_0022258 | |||
| 1467 | Ga0496124_0033513 | |||
| 1468 | Ga0496125_0011967 | |||
| 1469 | Ga0496125_0012388 | |||
| 1470 | Ga0496125_0103660 | |||
| 1471 | Ga0496125_0123922 | |||
| 1472 | Ga0496126_0039798 | |||
| 1473 | Ga0496126_0097773 | |||
| 1474 | Ga0496126_0178237 | |||
| 1475 | Ga0495678_000017 | |||
| 1476 | Ga0495678_000404 | |||
| 1477 | Ga0495678_006385 | |||
| 1478 | Ga0495678_015394 | |||
| 1479 | Ga0495678_015771 | |||
| 1480 | Ga0495682_0000054 | |||
| 1481 | Ga0495682_0000124 | |||
| 1482 | Ga0495682_0007005 | |||
| 1483 | Ga0501033_0073415 | |||
| 1484 | Ga0501034_0000143 | |||
| 1485 | Ga0501034_0000200 | |||
| 1486 | Ga0501039_0028547 | |||
| 1487 | Ga0501040_0027158 | |||
| 1488 | Ga0501072_0044165 | |||
| 1489 | Ga0501075_0010316 | |||
| 1490 | Ga0501076_0000757 | |||
| 1491 | Ga0501222_005362 | |||
| 1492 | Ga0501079_0001187 | |||
| 1493 | Ga0501080_0080217 | |||
| 1494 | Ga0501081_0000552 | |||
| 1495 | Ga0501083_0075748 | |||
| 1496 | Ga0501241_008201 | |||
| 1497 | Ga0501226_000001 | |||
| 1498 | nmdc:mga0k408_1301_c1 | |||
| 1499 | nmdc:mga0k408_41573_c1 | |||
| 1500 | nmdc:mga07m45_3438_c1 | |||
| 1501 | nmdc:mga07m45_4618_c1 | |||
| 1502 | nmdc:mga05p37_41370_c1 | |||
| 1503 | Ga0500635_0000017 | |||
| 1504 | Ga0500635_0013483 | |||
| 1505 | Ga0500578_0000683 | |||
| 1506 | Ga0500652_000930 | |||
| 1507 | Ga0500659_0003436 | |||
| 1508 | Ga0500559_0010928 | |||
| 1509 | Ga0500622_0000001 | |||
| 1510 | Ga0500622_0000028 | |||
| 1511 | Ga0500636_0045507 | |||
| 1512 | Ga0466962_0001425 | |||
| 1513 | Ga0530510_0009039 | |||
| 1514 | Ga0530510_0010256 | |||
| 1515 | 2511254009 | |||
| 1516 | 2511266851 | |||
| 1517 | 2511272443 | |||
| 1518 | 2511275102 | |||
| 1519 | 2511289394 | |||
| 1520 | 2511297762 | |||
| 1521 | 2511302826 | |||
| 1522 | 2511314420 | |||
| 1523 | 2511317222 | |||
| 1524 | 2511328020 | |||
| 1525 | 2511329659 | |||
| 1526 | 2511336844 | |||
| 1527 | 2511344807 | |||
| 1528 | 2511349570 | |||
| 1529 | 2511359298 | |||
| 1530 | 2511360908 | |||
| 1531 | 2511370984 | |||
| 1532 | 2511375692 | |||
| 1533 | 2511413476 | |||
| 1534 | 2511827624 | |||
| 1535 | 2512329503 | |||
| 1536 | 2555245930 | |||
| 1537 | 2555672825 | |||
| 1538 | 2583795735 | |||
| 1539 | 2587729511 | |||
| 1540 | 2587733974 | |||
| 1541 | 2588294591 | |||
| 1542 | 2597860869 | |||
| 1543 | 2597866619 | |||
| 1544 | 2597872475 | |||
| 1545 | 2599331154 | |||
| 1546 | 2599355971 | |||
| 1547 | 2599362627 | |||
| 1548 | 2599369067 | |||
| 1549 | 2599375736 | |||
| 1550 | 2599381077 | |||
| 1551 | 2599387407 | |||
| 1552 | 2599394594 | |||
| 1553 | 2599400550 | |||
| 1554 | 2599406359 | |||
| 1555 | 2599449874 | |||
| 1556 | 2599462805 | |||
| 1557 | 2599467772 | |||
| 1558 | 2599485895 | |||
| 1559 | 2599491822 | |||
| 1560 | 2599500250 | |||
| 1561 | 2599505741 | |||
| 1562 | 2599511948 | |||
| 1563 | 2599516932 | |||
| 1564 | 2599614419 | |||
| 1565 | 2599768162 | |||
| 1566 | 2599804677 | |||
| 1567 | 2599879026 | |||
| 1568 | 2599885597 | |||
| 1569 | 2599892690 | |||
| 1570 | 2599897311 | |||
| 1571 | 2599930720 | |||
| 1572 | 2599942359 | |||
| 1573 | 2599951440 | |||
| 1574 | 2599954228 | |||
| 1575 | 2599961901 | |||
| 1576 | 2599965927 | |||
| 1577 | 2599972217 | |||
| 1578 | 2599980890 | |||
| 1579 | 2599982929 | |||
| 1580 | 2599988321 | |||
| 1581 | 2599993980 | |||
| 1582 | 2599999115 | |||
| 1583 | 2600004325 | |||
| 1584 | 2600014766 | |||
| 1585 | 2600020386 | |||
| 1586 | 2600026350 | |||
| 1587 | 2600032100 | |||
| 1588 | 2600035963 | |||
| 1589 | 2600042327 | |||
| 1590 | 2600046646 | |||
| 1591 | 2600054936 | |||
| 1592 | 2600061037 | |||
| 1593 | 2600066379 | |||
| 1594 | 2600074377 | |||
| 1595 | 2600076549 | |||
| 1596 | 2600215431 | |||
| 1597 | 2600359003 | |||
| 1598 | 2600363559 | |||
| 1599 | 2600444088 | |||
| 1600 | 2600445720 | |||
| 1601 | 2601627300 | |||
| 1602 | 2601693456 | |||
| 1603 | 2601775597 | |||
| 1604 | 2601798571 | |||
| 1605 | 2602008427 | |||
| 1606 | 2602012564 | |||
| 1607 | 2606077465 | |||
| 1608 | 2606129289 | |||
| 1609 | 2621296857 | |||
| 1610 | 2624483401 | |||
| 1611 | 2624494921 | |||
| 1612 | 2643842952 | |||
| 1613 | 2643872253 | |||
| 1614 | 2643955645 | |||
| 1615 | 2643969636 | |||
| 1616 | 2644020439 | |||
| 1617 | 2644143936 | |||
| 1618 | 2644184494 | |||
| 1619 | 2644276357 | |||
| 1620 | 2644283239 | |||
| 1621 | 2644304782 | |||
| 1622 | 2644620156 | |||
| 1623 | 2652544923 | |||
| 1624 | 2671089539 | |||
| 1625 | 2671099267 | |||
| 1626 | 2671128595 | |||
| 1627 | 2671771684 | |||
| 1628 | 2677897119 | |||
| 1629 | 2678266137 | |||
| 1630 | 2715749842 | |||
| 1631 | 2715754858 | |||
| 1632 | 2718636602 | |||
| 1633 | 2723251355 | |||
| 1634 | 2738671677 | |||
| 1635 | 2738691946 | |||
| 1636 | 2738750071 | |||
| 1637 | 2738807242 | |||
| 1638 | 2738859111 | |||
| 1639 | 2738894602 | |||
| 1640 | 2739199047 | |||
| 1641 | 2739258988 | |||
| 1642 | 2739263304 | |||
| 1643 | 2739285133 | |||
| 1644 | 2739289617 | |||
| 1645 | 2739290447 | |||
| 1646 | 2739294929 | |||
| 1647 | 2739312517 | |||
| 1648 | 2743740411 | |||
| 1649 | 2745007369 | |||
| 1650 | 2765581401 | |||
| 1651 | 2774118389 | |||
| 1652 | 2774135579 | |||
| 1653 | 2784261830 | |||
| 1654 | 2784313563 | |||
| 1655 | 2794593850 | |||
| 1656 | 2808855706 | |||
| 1657 | 2808905735 | |||
| 1658 | 2808926499 | |||
| 1659 | 2808928454 | |||
| 1660 | 2808935457 | |||
| 1661 | 2808942154 | |||
| 1662 | 2808942793 | |||
| 1663 | 2808948660 | |||
| 1664 | 2808950363 | |||
| 1665 | 2808959855 | |||
| 1666 | 2808964065 | |||
| 1667 | 2808976138 | |||
| 1668 | 2808993238 | |||
| 1669 | 2808999099 | |||
| 1670 | 2809217174 | |||
| 1671 | 2817494030 | |||
| 1672 | 2819655119 | |||
| 1673 | 2819704389 | |||
| 1674 | 2823424048 | |||
| 1675 | 2823425716 | |||
| 1676 | 2825655106 | |||
| 1677 | 2826581927 | |||
| 1678 | 2834030939 | |||
| 1679 | 2842806224 | |||
| 1680 | 2842807777 | |||
| 1681 | 2842816818 | |||
| 1682 | 2842831296 | |||
| 1683 | 2842833449 | |||
| 1684 | 2842837888 | |||
| 1685 | 2842845679 | |||
| 1686 | 2842853967 | |||
| 1687 | 2842855610 | |||
| 1688 | 2844667076 | |||
| 1689 | 2852616340 | |||
| 1690 | 2852659666 | |||
| 1691 | 2852671308 | |||
| 1692 | 2860341702 | |||
| 1693 | 2860873017 | |||
| 1694 | 2878035343 | |||
| 1695 | 2880235984 | |||
| 1696 | 2904518968 | |||
| 1697 | 2904551339 | |||
| 1698 | 2908452570 | |||
| 1699 | 2912968885 | |||
| 1700 | 2913042518 | |||
| 1701 | 2917076721 | |||
| 1702 | 2919065528 | |||
| 1703 | 2919155905 | |||
| 1704 | 2919389200 | |||
| 1705 | 2919457536 | |||
| 1706 | 2919485645 | |||
| 1707 | 2919488177 | |||
| 1708 | 2919502463 | |||
| 1709 | 2919503701 | |||
| 1710 | 2919700587 | |||
| 1711 | 2923159504 | |||
| 1712 | 2923526223 | |||
| 1713 | 2923588988 | |||
| 1714 | 2926064136 | |||
| 1715 | 2926065727 | |||
| 1716 | 2929149909 | |||
| 1717 | 2929195139 | |||
| 1718 | 2931372651 | |||
| 1719 | 2931396399 | |||
| 1720 | 2931398067 | |||
| 1721 | 2935358312 | |||
| 1722 | 2939640816 | |||
| 1723 | 2939654226 | |||
| 1724 | 2945930920 | |||
| 1725 | 2945966844 | |||
| 1726 | 2946013297 | |||
| 1727 | 2946027892 | |||
| 1728 | 2947234412 | |||
| 1729 | 2969310163 | |||
| 1730 | 2974294089 | |||
| 1731 | 2984286612 | |||
| 1732 | 2988731450 | |||
| 1733 | 2990199686 | |||
| 1734 | 2998145386 | |||
| 1735 | 3007255270 | |||
| 1736 | 3007315928 | |||
| 1737 | 3007399409 | |||
| 1738 | 3007419828 | |||
| 1739 | 3007517167 | |||
| 1740 | 3007618520 | |||
| 1741 | 3007622511 | |||
| 1742 | 3007721744 | |||
| 1743 | 3007803577 | |||
| 1744 | 3007859181 | |||
| 1745 | 3007865113 | |||
| 1746 | 3007866790 | |||
| 1747 | 637323262 | |||
| 1748 | 8015693603 | |||
| 1749 | 8019769781 | |||
| 1750 | 8019777694 | |||
| 1751 | 8029995515 | |||
| 1752 | 8052494845 | |||
| 1753 | 8052496366 | |||
| 1754 | 8054287908 | |||
| 1755 | 8054349593 | |||
| 1756 | 8054508921 | |||
| 1757 | 8055776849 | |||
| 1758 | 8055823890 | |||
| 1759 | 8056131593 | |||
| 1760 | 8056137297 | |||
| 1761 | 8056148759 | |||
| 1762 | 8056151505 | |||
| 1763 | 8056160840 | |||
| 1764 | 8056163621 | |||
| 1765 | 8056171318 | |||
| 1766 | 8056177420 | |||
| 1767 | 8056181988 | |||
| 1768 | 8056570454 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gwi-assembly1.cif.gz_A | the crystal structure of halomonas elongata amino-transferase | 0.9855 | 7 | 431 |
| 7q9x-assembly1.cif.gz_AAA | crystal structure of chromobacterium violaceum aminotransferase in complex with plp-pyruvate adduct | 0.9823 | 9 | 432 |
| 4a72-assembly2.cif.gz_C | crystal structure of the omega transaminase from chromobacterium violaceum in a mixture of apo and plp-bound states | 0.9799 | 9 | 432 |
| 6snu-assembly1.cif.gz_B | crystal structure of the w60c mutant of the (s)-selective transaminase from chromobacterium violaceum | 0.9793 | 5 | 432 |
| 7ypm-assembly2.cif.gz_D | crystal structure of transaminase cc1012 complexed with plp and l-alanine | 0.9704 | 5 | 432 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ti8B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9967 | 323 | 430 | 3.90.1150.10 |
| 3hmuB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9747 | 64 | 321 | 3.40.640.10 |
| af_Q59ZF3_365_473_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9632 | 333 | 422 | 3.90.1150.10 |
| 5kquA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9612 | 64 | 319 | 3.40.640.10 |
| af_Q58696_369_458_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9599 | 339 | 425 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1AN13-F1-model_v4 | deleted | 0.9988 | 350 | 430 |
|
| AF-A0A355R1U6-F1-model_v4 | Aspartate aminotransferase family protein | 0.9935 | 178 | 431 |
GO:0005829
GO:0008483 GO:0030170 |
| AF-A0A1G3EAD8-F1-model_v4 | Aminotransferase | 0.9873 | 1 | 393 |
GO:0005829
GO:0008483 GO:0030170 |
| AF-A0A355R1U6-F1-model_v4 | Aspartate aminotransferase family protein | 0.9858 | 178 | 431 |
GO:0005829
GO:0008483 GO:0030170 |
| AF-A0A354FKU3-F1-model_v4 | Aspartate aminotransferase family protein | 0.9842 | 43 | 432 |
GO:0005829
GO:0008483 GO:0030170 |