F484641
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 884 | 337 | 1769 | 405 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0212890|Ga0496115_0212890_257_1453 |
| Length | 398 |
| Sequence | MNLHEYQGKEILASHGVRVQRGIVANSPAEAVAAAKQLTAETGTSWHVVKAQIHAGGRGKGGGVKLAKNLQQVEEIAGQIIGMDLITPQTPPTGKRVHKILVAEDVYYPGESETSEFYMSVLLNRGKGRNMIMYSTEGGMDIEEVAEHTPHLIFTEEIDPAVGLQGFQVRRIAFNLGLSGNAFKEMTAFVAALYKAYIDSDASMFEINPVLKTSDNKILAVDAKVALDDNALYRQKKYADMRDIREENPIEVEAKEVGLNYVDLDGTVGCMVNGAGLAMATMDLIKYAGFEPANFLDVGGTADAKRVETAFRIILKDENVKAILINIFGGIVRCDRVAQGVVDAYKNMGDSIKVPIIVRLQGTNAEIAKELIDNSGMPILSATLFQEAADQVKAALSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 187 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 196 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 205 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 215 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 216 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 217 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 218 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 219 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 222 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 223 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 251 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 252 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 253 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 266 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 267 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 270 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 272 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 273 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 277 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 278 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 281 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 288 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 290 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 291 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 292 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 293 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 294 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 295 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 296 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 298 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 299 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 300 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 301 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 302 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 304 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 305 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 307 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 309 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 310 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 311 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 312 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 313 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 314 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 315 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 316 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 317 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 318 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 319 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 320 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 321 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 322 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 323 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 324 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 325 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 326 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 327 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 328 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 329 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 330 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 331 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 332 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 333 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 334 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 335 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 336 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 337 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.61 |
| Metatranscriptomes | 0.23 |
| Isolates | 3.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.35 |
| Nodule | 0 |
| Rhizoplane | 0.68 |
| Rhizosphere | 85.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496115_0212890 | 3300048918 | Bacteria | 1596 |
| 2 | SwRhRL2b_contig_1663050 | 2162886007 | Bacteria | 482194 |
| 3 | JGI24751J29686_10000335 | 3300002459 | Bacteria | 17022 |
| 4 | JGI25154J39366_1000293 | 3300002738 | Bacteria | 29883 |
| 5 | JGI25406J46586_10012667 | 3300003203 | Bacteria | 3646 |
| 6 | JGI25153J46596_10001122 | 3300003215 | Bacteria | 16227 |
| 7 | rootH1_10026195 | 3300003316 | Bacteria | 28231 |
| 8 | rootH2_10008034 | 3300003320 | Bacteria | 73088 |
| 9 | rootH2_10009544 | 3300003320 | Bacteria | 42409 |
| 10 | rootL2_10007707 | 3300003322 | Bacteria | 12551 |
| 11 | rootH1_10000938 | 3300003323 | Bacteria | 9989 |
| 12 | rootH1_10000939 | 3300003323 | Bacteria | 3587 |
| 13 | rootH1_10000940 | 3300003323 | Bacteria | 88997 |
| 14 | rootH1_10007034 | 3300003323 | Bacteria | 6079 |
| 15 | rootH1_10009521 | 3300003316 | Bacteria | 3977 |
| 16 | rootH1_10009521 | 3300003323 | Bacteria | 38733 |
| 17 | rootH1_10204701 | 3300003323 | Bacteria | 3352 |
| 18 | JGI25160J50197_1003310 | 3300003354 | Bacteria | 7253 |
| 19 | JGI25160J50197_1005348 | 3300003354 | Bacteria | 5361 |
| 20 | Ga0055535_1001325 | 3300003761 | Bacteria | 13183 |
| 21 | Ga0055542_1003062 | 3300003762 | Bacteria | 4823 |
| 22 | Ga0055528_1001409 | 3300003790 | Bacteria | 14726 |
| 23 | Ga0055528_1003892 | 3300003790 | Bacteria | 7340 |
| 24 | Ga0055531_10000237 | 3300003794 | Bacteria | 60479 |
| 25 | Ga0065165_1000190 | 3300005262 | Bacteria | 107377 |
| 26 | Ga0065165_1009020 | 3300005262 | Bacteria | 4550 |
| 27 | Ga0065165_1014165 | 3300005262 | Bacteria | 3113 |
| 28 | Ga0065714_10003401 | 3300005288 | Bacteria | 9196 |
| 29 | Ga0065714_10106522 | 3300005288 | Bacteria | 1534 |
| 30 | Ga0065704_10070140 | 3300005289 | Bacteria | 482257 |
| 31 | Ga0065704_10071188 | 3300005289 | Bacteria | 12593 |
| 32 | Ga0065704_10155100 | 3300005289 | Bacteria | 1397 |
| 33 | Ga0065712_10071492 | 3300005290 | Bacteria | 5221 |
| 34 | Ga0065715_10120220 | 3300005293 | Bacteria | 2264 |
| 35 | Ga0070658_10021911 | 3300005327 | Bacteria | 5124 |
| 36 | Ga0070658_10074306 | 3300005327 | Bacteria | 2788 |
| 37 | Ga0070658_10096594 | 3300005327 | Bacteria | 2439 |
| 38 | Ga0070658_10180295 | 3300005327 | Bacteria | 1777 |
| 39 | Ga0070658_10256511 | 3300005327 | Bacteria | 1484 |
| 40 | Ga0070676_10003818 | 3300005328 | Bacteria | 7904 |
| 41 | Ga0070676_10012539 | 3300005328 | Bacteria | 4632 |
| 42 | Ga0070683_100001758 | 3300005329 | Bacteria | 16869 |
| 43 | Ga0070683_100002901 | 3300005329 | Bacteria | 13732 |
| 44 | Ga0070683_100004709 | 3300005329 | Bacteria | 11275 |
| 45 | Ga0070683_100018792 | 3300005329 | Bacteria | 6129 |
| 46 | Ga0070690_100112179 | 3300005330 | Bacteria | 1821 |
| 47 | Ga0070690_100134853 | 3300005330 | Bacteria | 1671 |
| 48 | Ga0070670_100042195 | 3300005331 | Bacteria | 3921 |
| 49 | Ga0070670_100067020 | 3300005331 | Bacteria | 3081 |
| 50 | Ga0070670_100073046 | 3300005331 | Bacteria | 2947 |
| 51 | Ga0070670_100085279 | 3300005331 | Bacteria | 2713 |
| 52 | Ga0070670_100087106 | 3300005331 | Bacteria | 2684 |
| 53 | Ga0070670_100098114 | 3300005331 | Bacteria | 2521 |
| 54 | Ga0070677_10004868 | 3300005333 | Bacteria | 4407 |
| 55 | Ga0068869_100009712 | 3300005334 | Bacteria | 6249 |
| 56 | Ga0068869_100027952 | 3300005334 | Bacteria | 3936 |
| 57 | Ga0068869_100060172 | 3300005334 | Bacteria | 2783 |
| 58 | Ga0070666_10000411 | 3300005335 | Bacteria | 26651 |
| 59 | Ga0070666_10002153 | 3300005335 | Bacteria | 11964 |
| 60 | Ga0070666_10008024 | 3300005335 | Bacteria | 6532 |
| 61 | Ga0070666_10069839 | 3300005335 | Bacteria | 2389 |
| 62 | Ga0070680_100001025 | 3300005336 | Bacteria | 19985 |
| 63 | Ga0070680_100011225 | 3300005336 | Bacteria | 6929 |
| 64 | Ga0070680_100029784 | 3300005336 | Bacteria | 4382 |
| 65 | Ga0070680_100055254 | 3300005336 | Bacteria | 3244 |
| 66 | Ga0070680_100105493 | 3300005336 | Bacteria | 2342 |
| 67 | Ga0070680_100235342 | 3300005336 | Bacteria | 1547 |
| 68 | Ga0070682_100000054 | 3300005337 | Bacteria | 112635 |
| 69 | Ga0070682_100011589 | 3300005337 | Bacteria | 5041 |
| 70 | Ga0070682_100129528 | 3300005337 | Bacteria | 1706 |
| 71 | Ga0070682_100192754 | 3300005337 | Bacteria | 1432 |
| 72 | Ga0068868_100003047 | 3300005338 | Bacteria | 11665 |
| 73 | Ga0068868_100052291 | 3300005338 | Bacteria | 3216 |
| 74 | Ga0068868_100079913 | 3300005338 | Bacteria | 2620 |
| 75 | Ga0068868_100083582 | 3300005338 | Bacteria | 2563 |
| 76 | Ga0070660_100010316 | 3300005339 | Bacteria | 6597 |
| 77 | Ga0070660_100062309 | 3300005339 | Bacteria | 2897 |
| 78 | Ga0070660_100113317 | 3300005339 | Bacteria | 2159 |
| 79 | Ga0070660_100118624 | 3300005339 | Bacteria | 2110 |
| 80 | Ga0070689_100027955 | 3300005340 | Bacteria | 4258 |
| 81 | Ga0070691_10015872 | 3300005341 | Bacteria | 3462 |
| 82 | Ga0070661_100118315 | 3300005344 | Bacteria | 1983 |
| 83 | Ga0070661_100145757 | 3300005344 | Bacteria | 1787 |
| 84 | Ga0070661_100187800 | 3300005344 | Bacteria | 1575 |
| 85 | Ga0070661_100286141 | 3300005344 | Bacteria | 1280 |
| 86 | Ga0070668_100000043 | 3300005347 | Bacteria | 78564 |
| 87 | Ga0070668_100046860 | 3300005347 | Bacteria | 3322 |
| 88 | Ga0070668_100158914 | 3300005347 | Bacteria | 1833 |
| 89 | Ga0070669_100000660 | 3300005353 | Bacteria | 25474 |
| 90 | Ga0070675_100002780 | 3300005354 | Bacteria | 13170 |
| 91 | Ga0070675_100004944 | 3300005354 | Bacteria | 10167 |
| 92 | Ga0070675_100021178 | 3300005354 | Bacteria | 5193 |
| 93 | Ga0070675_100032415 | 3300005354 | Bacteria | 4228 |
| 94 | Ga0070675_100063619 | 3300005354 | Bacteria | 3050 |
| 95 | Ga0070675_100091822 | 3300005354 | Bacteria | 2544 |
| 96 | Ga0070671_100035166 | 3300005355 | Bacteria | 4150 |
| 97 | Ga0070671_100123875 | 3300005355 | Bacteria | 2176 |
| 98 | Ga0070674_100022606 | 3300005356 | Bacteria | 4058 |
| 99 | Ga0070674_100099630 | 3300005356 | Bacteria | 2114 |
| 100 | Ga0070674_100234128 | 3300005356 | Bacteria | 1435 |
| 101 | Ga0070673_100002573 | 3300005364 | Bacteria | 11081 |
| 102 | Ga0070673_100095840 | 3300005364 | Bacteria | 2434 |
| 103 | Ga0070673_100179440 | 3300005364 | Bacteria | 1812 |
| 104 | Ga0070673_100193161 | 3300005364 | Bacteria | 1750 |
| 105 | Ga0070688_100003168 | 3300005365 | Bacteria | 8426 |
| 106 | Ga0070688_100011188 | 3300005365 | Bacteria | 4982 |
| 107 | Ga0070688_100213944 | 3300005365 | Bacteria | 1355 |
| 108 | Ga0070659_100003702 | 3300005366 | Bacteria | 10907 |
| 109 | Ga0070659_100024213 | 3300005366 | Bacteria | 4652 |
| 110 | Ga0070659_100180256 | 3300005366 | Bacteria | 1733 |
| 111 | Ga0070667_100000254 | 3300005367 | Bacteria | 60664 |
| 112 | Ga0070667_100019703 | 3300005367 | Bacteria | 5596 |
| 113 | Ga0070667_100027762 | 3300005367 | Bacteria | 4710 |
| 114 | Ga0070667_100053091 | 3300005367 | Bacteria | 3421 |
| 115 | Ga0070701_10019903 | 3300005438 | Bacteria | 3176 |
| 116 | Ga0070700_100040931 | 3300005441 | Bacteria | 2839 |
| 117 | Ga0070700_100097610 | 3300005441 | Bacteria | 1930 |
| 118 | Ga0070663_100067568 | 3300005455 | Bacteria | 2593 |
| 119 | Ga0070678_100025990 | 3300005456 | Bacteria | 3951 |
| 120 | Ga0070678_100039245 | 3300005456 | Bacteria | 3339 |
| 121 | Ga0070678_100048931 | 3300005456 | Bacteria | 3048 |
| 122 | Ga0070678_100153804 | 3300005456 | Bacteria | 1856 |
| 123 | Ga0070662_100002089 | 3300005457 | Bacteria | 12246 |
| 124 | Ga0070662_100015197 | 3300005457 | Bacteria | 5153 |
| 125 | Ga0070662_100027246 | 3300005457 | Bacteria | 3964 |
| 126 | Ga0070662_100031364 | 3300005457 | Bacteria | 3729 |
| 127 | Ga0070662_100091725 | 3300005457 | Bacteria | 2282 |
| 128 | Ga0070662_100179959 | 3300005457 | Bacteria | 1666 |
| 129 | Ga0070681_10038592 | 3300005458 | Bacteria | 4788 |
| 130 | Ga0070681_10051262 | 3300005458 | Bacteria | 4116 |
| 131 | Ga0070681_10052163 | 3300005458 | Bacteria | 4079 |
| 132 | Ga0070681_10095837 | 3300005458 | Bacteria | 2916 |
| 133 | Ga0070681_10112277 | 3300005458 | Bacteria | 2665 |
| 134 | Ga0068867_100007630 | 3300005459 | Bacteria | 7653 |
| 135 | Ga0068867_100027897 | 3300005459 | Bacteria | 4062 |
| 136 | Ga0068867_100226863 | 3300005459 | Bacteria | 1508 |
| 137 | Ga0070685_10004944 | 3300005466 | Bacteria | 6746 |
| 138 | Ga0070685_10085830 | 3300005466 | Bacteria | 1896 |
| 139 | Ga0070698_100000392 | 3300005471 | Bacteria | 46091 |
| 140 | Ga0070698_100010460 | 3300005471 | Bacteria | 9905 |
| 141 | Ga0070679_100000174 | 3300005530 | Bacteria | 51897 |
| 142 | Ga0070679_100001499 | 3300005530 | Bacteria | 20743 |
| 143 | Ga0070679_100003920 | 3300005530 | Bacteria | 13685 |
| 144 | Ga0070679_100019897 | 3300005530 | Bacteria | 6536 |
| 145 | Ga0070679_100046468 | 3300005530 | Bacteria | 4327 |
| 146 | Ga0070684_100000662 | 3300005535 | Bacteria | 23780 |
| 147 | Ga0070684_100003150 | 3300005535 | Bacteria | 12313 |
| 148 | Ga0070684_100064944 | 3300005535 | Bacteria | 3203 |
| 149 | Ga0070684_100107297 | 3300005535 | Bacteria | 2501 |
| 150 | Ga0070684_100249157 | 3300005535 | Bacteria | 1623 |
| 151 | Ga0068853_100000381 | 3300005539 | Bacteria | 30507 |
| 152 | Ga0068853_100004978 | 3300005539 | Bacteria | 10355 |
| 153 | Ga0068853_100023196 | 3300005539 | Bacteria | 5193 |
| 154 | Ga0068853_100270227 | 3300005539 | Bacteria | 1565 |
| 155 | Ga0070672_100000109 | 3300005543 | Bacteria | 41435 |
| 156 | Ga0070672_100026702 | 3300005543 | Bacteria | 4301 |
| 157 | Ga0070672_100036233 | 3300005543 | Bacteria | 3757 |
| 158 | Ga0070672_100050208 | 3300005543 | Bacteria | 3248 |
| 159 | Ga0070672_100167373 | 3300005543 | Bacteria | 1826 |
| 160 | Ga0070686_100034487 | 3300005544 | Bacteria | 3119 |
| 161 | Ga0070693_100002584 | 3300005547 | Bacteria | 8335 |
| 162 | Ga0070665_100000041 | 3300005548 | Bacteria | 297849 |
| 163 | Ga0070665_100002085 | 3300005548 | Bacteria | 22449 |
| 164 | Ga0070665_100020471 | 3300005548 | Bacteria | 6643 |
| 165 | Ga0070665_100027777 | 3300005548 | Bacteria | 5697 |
| 166 | Ga0070704_100152519 | 3300005549 | Bacteria | 1818 |
| 167 | Ga0068855_100000995 | 3300005563 | Bacteria | 35281 |
| 168 | Ga0068855_100003373 | 3300005563 | Bacteria | 19563 |
| 169 | Ga0068855_100015722 | 3300005563 | Bacteria | 9103 |
| 170 | Ga0068855_100023944 | 3300005563 | Bacteria | 7310 |
| 171 | Ga0068855_100030990 | 3300005563 | Bacteria | 6391 |
| 172 | Ga0068855_100042337 | 3300005563 | Bacteria | 5396 |
| 173 | Ga0068855_100042453 | 3300005563 | Bacteria | 5388 |
| 174 | Ga0068855_100091126 | 3300005563 | Bacteria | 3517 |
| 175 | Ga0068855_100107692 | 3300005563 | Bacteria | 3202 |
| 176 | Ga0068855_100143388 | 3300005563 | Bacteria | 2720 |
| 177 | Ga0070664_100003411 | 3300005564 | Bacteria | 12829 |
| 178 | Ga0070664_100012446 | 3300005564 | Bacteria | 6916 |
| 179 | Ga0070664_100042787 | 3300005564 | Bacteria | 3823 |
| 180 | Ga0070664_100140373 | 3300005564 | Bacteria | 2127 |
| 181 | Ga0070664_100144610 | 3300005564 | Bacteria | 2096 |
| 182 | Ga0068857_100019259 | 3300005577 | Bacteria | 5992 |
| 183 | Ga0068857_100081185 | 3300005577 | Bacteria | 2895 |
| 184 | Ga0068857_100084584 | 3300005577 | Bacteria | 2835 |
| 185 | Ga0068857_100250133 | 3300005577 | Bacteria | 1625 |
| 186 | Ga0068854_100141734 | 3300005578 | Bacteria | 1845 |
| 187 | Ga0068854_100308004 | 3300005578 | Bacteria | 1284 |
| 188 | Ga0068856_100020074 | 3300005614 | Bacteria | 6488 |
| 189 | Ga0068856_100049922 | 3300005614 | Bacteria | 4124 |
| 190 | Ga0068856_100123417 | 3300005614 | Bacteria | 2592 |
| 191 | Ga0068856_100133394 | 3300005614 | Bacteria | 2489 |
| 192 | Ga0068856_100273586 | 3300005614 | Bacteria | 1705 |
| 193 | Ga0068852_100004748 | 3300005616 | Bacteria | 9648 |
| 194 | Ga0068852_100024540 | 3300005616 | Bacteria | 4875 |
| 195 | Ga0068852_100032963 | 3300005616 | Bacteria | 4296 |
| 196 | Ga0068852_100034775 | 3300005616 | Bacteria | 4196 |
| 197 | Ga0068852_100039686 | 3300005616 | Bacteria | 3965 |
| 198 | Ga0068852_100061644 | 3300005616 | Bacteria | 3260 |
| 199 | Ga0068852_100159348 | 3300005616 | Bacteria | 2106 |
| 200 | Ga0068852_100174403 | 3300005616 | Bacteria | 2018 |
| 201 | Ga0068859_100000037 | 3300005617 | Bacteria | 165480 |
| 202 | Ga0068859_100024350 | 3300005617 | Bacteria | 6073 |
| 203 | Ga0068859_100048491 | 3300005617 | Bacteria | 4266 |
| 204 | Ga0068859_100065792 | 3300005617 | Unclassified | 3658 |
| 205 | Ga0068859_100173645 | 3300005617 | Bacteria | 2237 |
| 206 | Ga0068859_100386686 | 3300005617 | Bacteria | 1495 |
| 207 | Ga0068864_100001192 | 3300005618 | Bacteria | 21573 |
| 208 | Ga0068864_100029740 | 3300005618 | Bacteria | 4629 |
| 209 | Ga0068864_100032450 | 3300005618 | Bacteria | 4438 |
| 210 | Ga0068864_100039621 | 3300005618 | Bacteria | 4027 |
| 211 | Ga0068864_100040012 | 3300005618 | Bacteria | 4009 |
| 212 | Ga0068864_100061670 | 3300005618 | Bacteria | 3248 |
| 213 | Ga0068861_100003469 | 3300005719 | Bacteria | 10464 |
| 214 | Ga0068851_10001233 | 3300005834 | Bacteria | 11109 |
| 215 | Ga0068851_10030515 | 3300005834 | Bacteria | 2673 |
| 216 | Ga0068851_10057539 | 3300005834 | Bacteria | 1985 |
| 217 | Ga0068870_10037735 | 3300005840 | Bacteria | 2491 |
| 218 | Ga0068870_10048484 | 3300005840 | Bacteria | 2237 |
| 219 | Ga0068863_100002618 | 3300005841 | Bacteria | 17840 |
| 220 | Ga0068863_100002856 | 3300005841 | Bacteria | 17115 |
| 221 | Ga0068863_100074923 | 3300005841 | Bacteria | 3202 |
| 222 | Ga0068863_100154699 | 3300005841 | Bacteria | 2195 |
| 223 | Ga0068858_100000199 | 3300005842 | Bacteria | 64607 |
| 224 | Ga0068858_100018293 | 3300005842 | Bacteria | 6561 |
| 225 | Ga0068860_100000383 | 3300005843 | Bacteria | 57999 |
| 226 | Ga0068860_100000700 | 3300005843 | Bacteria | 38538 |
| 227 | Ga0068860_100013203 | 3300005843 | Bacteria | 8103 |
| 228 | Ga0068860_100152109 | 3300005843 | Bacteria | 2229 |
| 229 | Ga0068860_100217921 | 3300005843 | Bacteria | 1853 |
| 230 | Ga0068862_100007282 | 3300005844 | Bacteria | 9184 |
| 231 | Ga0068862_100010232 | 3300005844 | Bacteria | 7740 |
| 232 | Ga0081540_1018059 | 3300005983 | Bacteria | 4341 |
| 233 | Ga0081539_10003031 | 3300005985 | Bacteria | 21772 |
| 234 | Ga0081539_10004761 | 3300005985 | Bacteria | 14651 |
| 235 | Ga0075366_10056967 | 3300006195 | Bacteria | 2322 |
| 236 | Ga0097621_100001591 | 3300006237 | Bacteria | 15526 |
| 237 | Ga0097621_100003742 | 3300006237 | Bacteria | 10539 |
| 238 | Ga0097621_100004103 | 3300006237 | Bacteria | 10103 |
| 239 | Ga0097621_100024053 | 3300006237 | Bacteria | 4751 |
| 240 | Ga0075370_10062204 | 3300006353 | Bacteria | 2127 |
| 241 | Ga0068871_100000737 | 3300006358 | Bacteria | 22233 |
| 242 | Ga0068871_100002768 | 3300006358 | Bacteria | 11972 |
| 243 | Ga0068871_100008698 | 3300006358 | Bacteria | 7304 |
| 244 | Ga0068871_100018879 | 3300006358 | Bacteria | 5254 |
| 245 | Ga0068871_100024986 | 3300006358 | Bacteria | 4641 |
| 246 | Ga0068871_100088023 | 3300006358 | Bacteria | 2583 |
| 247 | Ga0068871_100129186 | 3300006358 | Bacteria | 2141 |
| 248 | Ga0068871_100277197 | 3300006358 | Bacteria | 1466 |
| 249 | Ga0075428_100009100 | 3300006844 | Bacteria | 11018 |
| 250 | Ga0075430_100002881 | 3300006846 | Bacteria | 14402 |
| 251 | Ga0075429_100002313 | 3300006880 | Bacteria | 15998 |
| 252 | Ga0075429_100027037 | 3300006880 | Bacteria | 4982 |
| 253 | Ga0068865_100010112 | 3300006881 | Bacteria | 5867 |
| 254 | Ga0097620_100000037 | 3300006931 | Bacteria | 165480 |
| 255 | Ga0097620_100024352 | 3300006931 | Bacteria | 6073 |
| 256 | Ga0097620_100048492 | 3300006931 | Bacteria | 4266 |
| 257 | Ga0097620_100065794 | 3300006931 | Unclassified | 3658 |
| 258 | Ga0097620_100173645 | 3300006931 | Bacteria | 2237 |
| 259 | Ga0097620_100386659 | 3300006931 | Bacteria | 1495 |
| 260 | Ga0105240_10000073 | 3300009093 | Bacteria | 201032 |
| 261 | Ga0105240_10000224 | 3300009093 | Bacteria | 113175 |
| 262 | Ga0105240_10002232 | 3300009093 | Bacteria | 31507 |
| 263 | Ga0105240_10003321 | 3300009093 | Bacteria | 25128 |
| 264 | Ga0105240_10005749 | 3300009093 | Bacteria | 18399 |
| 265 | Ga0105240_10008705 | 3300009093 | Bacteria | 14477 |
| 266 | Ga0105240_10036358 | 3300009093 | Bacteria | 6337 |
| 267 | Ga0105240_10077274 | 3300009093 | Bacteria | 4102 |
| 268 | Ga0105240_10111385 | 3300009093 | Bacteria | 3311 |
| 269 | Ga0105240_10213177 | 3300009093 | Bacteria | 2255 |
| 270 | Ga0111539_10017114 | 3300009094 | Bacteria | 8973 |
| 271 | Ga0111539_10019384 | 3300009094 | Bacteria | 8397 |
| 272 | Ga0111539_10202016 | 3300009094 | Bacteria | 2317 |
| 273 | Ga0105245_10040885 | 3300009098 | Bacteria | 4132 |
| 274 | Ga0105247_10000946 | 3300009101 | Bacteria | 21902 |
| 275 | Ga0105247_10075971 | 3300009101 | Bacteria | 2109 |
| 276 | Ga0114129_10023506 | 3300009147 | Bacteria | 8737 |
| 277 | Ga0114129_10156418 | 3300009147 | Bacteria | 3117 |
| 278 | Ga0105241_10000493 | 3300009174 | Bacteria | 29814 |
| 279 | Ga0105241_10012294 | 3300009174 | Bacteria | 6278 |
| 280 | Ga0105241_10039402 | 3300009174 | Bacteria | 3564 |
| 281 | Ga0105242_10023093 | 3300009176 | Bacteria | 4902 |
| 282 | Ga0105242_10047988 | 3300009176 | Bacteria | 3469 |
| 283 | Ga0105242_10060461 | 3300009176 | Bacteria | 3113 |
| 284 | Ga0105242_10104591 | 3300009176 | Bacteria | 2403 |
| 285 | Ga0105242_10171899 | 3300009176 | Bacteria | 1905 |
| 286 | Ga0105248_10027033 | 3300009177 | Bacteria | 6383 |
| 287 | Ga0105248_10075391 | 3300009177 | Bacteria | 3791 |
| 288 | Ga0105237_10000719 | 3300009545 | Bacteria | 45812 |
| 289 | Ga0105237_10001973 | 3300009545 | Bacteria | 26110 |
| 290 | Ga0105237_10002801 | 3300009545 | Bacteria | 21180 |
| 291 | Ga0105237_10003801 | 3300009545 | Bacteria | 17746 |
| 292 | Ga0105237_10004541 | 3300009545 | Bacteria | 16041 |
| 293 | Ga0105237_10006950 | 3300009545 | Bacteria | 12477 |
| 294 | Ga0105237_10018401 | 3300009545 | Bacteria | 7228 |
| 295 | Ga0105237_10025051 | 3300009545 | Bacteria | 6103 |
| 296 | Ga0105237_10110773 | 3300009545 | Bacteria | 2737 |
| 297 | Ga0105238_10000247 | 3300009551 | Bacteria | 60300 |
| 298 | Ga0105238_10023438 | 3300009551 | Bacteria | 6292 |
| 299 | Ga0105238_10042810 | 3300009551 | Bacteria | 4583 |
| 300 | Ga0105238_10178835 | 3300009551 | Bacteria | 2098 |
| 301 | Ga0105249_10001713 | 3300009553 | Bacteria | 19174 |
| 302 | Ga0105249_10003686 | 3300009553 | Bacteria | 13205 |
| 303 | Ga0105249_10004032 | 3300009553 | Bacteria | 12671 |
| 304 | Ga0105249_10004791 | 3300009553 | Bacteria | 11679 |
| 305 | Ga0105249_10012772 | 3300009553 | Bacteria | 7406 |
| 306 | Ga0105249_10020558 | 3300009553 | Bacteria | 5903 |
| 307 | Ga0105249_10034354 | 3300009553 | Bacteria | 4595 |
| 308 | Ga0105249_10057070 | 3300009553 | Bacteria | 3576 |
| 309 | Ga0105249_10075451 | 3300009553 | Bacteria | 3123 |
| 310 | Ga0105239_10000685 | 3300010375 | Bacteria | 48269 |
| 311 | Ga0105239_10000785 | 3300010375 | Bacteria | 45044 |
| 312 | Ga0105239_10003390 | 3300010375 | Bacteria | 19552 |
| 313 | Ga0105239_10019299 | 3300010375 | Bacteria | 7530 |
| 314 | Ga0105239_10024490 | 3300010375 | Bacteria | 6650 |
| 315 | Ga0105239_10025508 | 3300010375 | Bacteria | 6508 |
| 316 | Ga0105239_10029882 | 3300010375 | Bacteria | 5993 |
| 317 | Ga0105239_10044357 | 3300010375 | Bacteria | 4875 |
| 318 | Ga0105239_10100452 | 3300010375 | Bacteria | 3200 |
| 319 | Ga0105246_10030831 | 3300011119 | Bacteria | 3544 |
| 320 | Ga0157373_10004243 | 3300013100 | Bacteria | 10818 |
| 321 | Ga0157373_10006313 | 3300013100 | Bacteria | 8856 |
| 322 | Ga0157373_10035137 | 3300013100 | Bacteria | 3599 |
| 323 | Ga0157373_10105957 | 3300013100 | Bacteria | 1977 |
| 324 | Ga0157373_10117437 | 3300013100 | Bacteria | 1870 |
| 325 | Ga0157371_10000318 | 3300013102 | Bacteria | 62463 |
| 326 | Ga0157371_10000499 | 3300013102 | Bacteria | 47558 |
| 327 | Ga0157371_10006599 | 3300013102 | Bacteria | 9536 |
| 328 | Ga0157371_10009522 | 3300013102 | Bacteria | 7639 |
| 329 | Ga0157371_10012029 | 3300013102 | Bacteria | 6635 |
| 330 | Ga0157371_10012639 | 3300013102 | Bacteria | 6442 |
| 331 | Ga0157371_10013867 | 3300013102 | Bacteria | 6106 |
| 332 | Ga0157371_10017864 | 3300013102 | Bacteria | 5258 |
| 333 | Ga0157371_10033090 | 3300013102 | Bacteria | 3716 |
| 334 | Ga0157371_10061732 | 3300013102 | Bacteria | 2657 |
| 335 | Ga0157371_10174696 | 3300013102 | Bacteria | 1536 |
| 336 | Ga0157370_10000319 | 3300013104 | Bacteria | 60498 |
| 337 | Ga0157370_10000621 | 3300013104 | Bacteria | 44144 |
| 338 | Ga0157370_10001966 | 3300013104 | Bacteria | 25315 |
| 339 | Ga0157370_10005125 | 3300013104 | Bacteria | 14778 |
| 340 | Ga0157370_10013929 | 3300013104 | Bacteria | 8258 |
| 341 | Ga0157370_10024532 | 3300013104 | Bacteria | 5972 |
| 342 | Ga0157370_10035255 | 3300013104 | Bacteria | 4866 |
| 343 | Ga0157370_10040907 | 3300013104 | Unclassified | 4474 |
| 344 | Ga0157370_10237753 | 3300013104 | Bacteria | 1686 |
| 345 | Ga0157369_10006884 | 3300013105 | Bacteria | 13120 |
| 346 | Ga0157369_10053658 | 3300013105 | Bacteria | 4356 |
| 347 | Ga0157369_10164553 | 3300013105 | Bacteria | 2340 |
| 348 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 349 | Ga0157374_10023176 | 3300013296 | Bacteria | 5548 |
| 350 | Ga0157374_10038227 | 3300013296 | Bacteria | 4411 |
| 351 | Ga0157374_10067964 | 3300013296 | Bacteria | 3351 |
| 352 | Ga0157374_10101461 | 3300013296 | Bacteria | 2759 |
| 353 | Ga0157378_10003535 | 3300013297 | Bacteria | 13847 |
| 354 | Ga0157378_10011371 | 3300013297 | Bacteria | 7790 |
| 355 | Ga0157378_10015702 | 3300013297 | Bacteria | 6631 |
| 356 | Ga0157378_10044560 | 3300013297 | Bacteria | 3940 |
| 357 | Ga0157378_10080891 | 3300013297 | Bacteria | 2936 |
| 358 | Ga0157378_10226075 | 3300013297 | Bacteria | 1781 |
| 359 | Ga0163162_10000524 | 3300013306 | Bacteria | 35554 |
| 360 | Ga0163162_10000840 | 3300013306 | Bacteria | 28540 |
| 361 | Ga0163162_10001778 | 3300013306 | Bacteria | 20203 |
| 362 | Ga0163162_10001883 | 3300013306 | Bacteria | 19750 |
| 363 | Ga0163162_10003204 | 3300013306 | Bacteria | 15653 |
| 364 | Ga0163162_10005597 | 3300013306 | Bacteria | 12151 |
| 365 | Ga0163162_10005731 | 3300013306 | Bacteria | 12011 |
| 366 | Ga0163162_10010470 | 3300013306 | Bacteria | 9015 |
| 367 | Ga0163162_10012063 | 3300013306 | Bacteria | 8429 |
| 368 | Ga0163162_10017061 | 3300013306 | Bacteria | 7104 |
| 369 | Ga0163162_10166527 | 3300013306 | Bacteria | 2328 |
| 370 | Ga0157372_10001226 | 3300013307 | Bacteria | 27756 |
| 371 | Ga0157372_10005928 | 3300013307 | Bacteria | 12995 |
| 372 | Ga0157372_10019675 | 3300013307 | Bacteria | 7274 |
| 373 | Ga0157372_10022141 | 3300013307 | Bacteria | 6875 |
| 374 | Ga0157372_10036250 | 3300013307 | Bacteria | 5435 |
| 375 | Ga0157372_10038003 | 3300013307 | Bacteria | 5312 |
| 376 | Ga0157372_10038401 | 3300013307 | Bacteria | 5283 |
| 377 | Ga0157372_10047139 | 3300013307 | Bacteria | 4787 |
| 378 | Ga0157372_10074087 | 3300013307 | Bacteria | 3838 |
| 379 | Ga0157372_10086437 | 3300013307 | Bacteria | 3557 |
| 380 | Ga0157372_10111404 | 3300013307 | Bacteria | 3135 |
| 381 | Ga0157372_10130669 | 3300013307 | Bacteria | 2889 |
| 382 | Ga0157372_10154925 | 3300013307 | Bacteria | 2646 |
| 383 | Ga0157372_10194077 | 3300013307 | Bacteria | 2352 |
| 384 | Ga0157372_10296251 | 3300013307 | Bacteria | 1881 |
| 385 | Ga0157372_10392658 | 3300013307 | Bacteria | 1617 |
| 386 | Ga0157375_10004232 | 3300013308 | Bacteria | 12445 |
| 387 | Ga0157375_10005528 | 3300013308 | Bacteria | 10997 |
| 388 | Ga0157375_10006502 | 3300013308 | Bacteria | 10172 |
| 389 | Ga0157375_10023857 | 3300013308 | Bacteria | 5651 |
| 390 | Ga0157375_10025764 | 3300013308 | Bacteria | 5471 |
| 391 | Ga0157375_10110693 | 3300013308 | Bacteria | 2844 |
| 392 | Ga0157375_10131982 | 3300013308 | Unclassified | 2618 |
| 393 | Ga0157375_10244304 | 3300013308 | Bacteria | 1955 |
| 394 | Ga0163163_10000332 | 3300014325 | Bacteria | 45415 |
| 395 | Ga0163163_10000407 | 3300014325 | Bacteria | 40536 |
| 396 | Ga0163163_10109811 | 3300014325 | Bacteria | 2786 |
| 397 | Ga0163163_10217980 | 3300014325 | Bacteria | 1957 |
| 398 | Ga0163163_10253065 | 3300014325 | Bacteria | 1812 |
| 399 | Ga0157380_10001567 | 3300014326 | Bacteria | 15058 |
| 400 | Ga0157380_10002076 | 3300014326 | Bacteria | 13432 |
| 401 | Ga0157380_10004048 | 3300014326 | Bacteria | 10111 |
| 402 | Ga0157380_10022571 | 3300014326 | Bacteria | 4742 |
| 403 | Ga0157380_10034929 | 3300014326 | Bacteria | 3880 |
| 404 | Ga0157380_10041792 | 3300014326 | Bacteria | 3580 |
| 405 | Ga0157380_10064388 | 3300014326 | Bacteria | 2943 |
| 406 | Ga0157380_10071237 | 3300014326 | Bacteria | 2812 |
| 407 | Ga0157377_10004234 | 3300014745 | Bacteria | 6569 |
| 408 | Ga0157377_10045316 | 3300014745 | Bacteria | 2456 |
| 409 | Ga0157379_10000340 | 3300014968 | Bacteria | 37587 |
| 410 | Ga0157379_10032196 | 3300014968 | Bacteria | 4673 |
| 411 | Ga0157379_10069083 | 3300014968 | Bacteria | 3159 |
| 412 | Ga0157379_10078430 | 3300014968 | Bacteria | 2958 |
| 413 | Ga0157379_10108069 | 3300014968 | Bacteria | 2497 |
| 414 | Ga0157376_10001605 | 3300014969 | Bacteria | 14956 |
| 415 | Ga0157376_10003155 | 3300014969 | Bacteria | 11323 |
| 416 | Ga0157376_10012276 | 3300014969 | Bacteria | 6353 |
| 417 | Ga0157376_10017890 | 3300014969 | Bacteria | 5418 |
| 418 | Ga0157376_10019002 | 3300014969 | Bacteria | 5285 |
| 419 | Ga0157376_10037870 | 3300014969 | Bacteria | 3920 |
| 420 | Ga0182005_1000023 | 3300015265 | Bacteria | 246328 |
| 421 | Ga0163161_10000823 | 3300017792 | Bacteria | 24283 |
| 422 | Ga0213876_10000584 | 3300021384 | Bacteria | 27185 |
| 423 | Ga0213876_10002362 | 3300021384 | Bacteria | 11106 |
| 424 | Ga0209258_100068 | 3300025242 | Bacteria | 286288 |
| 425 | Ga0209646_1000025 | 3300025246 | Bacteria | 406493 |
| 426 | Ga0209646_1001893 | 3300025246 | Bacteria | 5113 |
| 427 | Ga0209026_1000097 | 3300025250 | Bacteria | 163212 |
| 428 | Ga0209148_1000343 | 3300025254 | Bacteria | 61260 |
| 429 | Ga0209673_1000403 | 3300025273 | Bacteria | 76872 |
| 430 | Ga0209676_1000564 | 3300025292 | Bacteria | 55947 |
| 431 | Ga0209564_1009069 | 3300025295 | Bacteria | 4790 |
| 432 | Ga0209758_1001939 | 3300025297 | Bacteria | 22471 |
| 433 | Ga0209758_1023582 | 3300025297 | Bacteria | 2778 |
| 434 | Ga0209050_1000136 | 3300025298 | Bacteria | 179113 |
| 435 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 436 | Ga0207426_1000164 | 3300025302 | Bacteria | 171465 |
| 437 | Ga0207426_1000220 | 3300025302 | Bacteria | 134979 |
| 438 | Ga0207426_1000543 | 3300025302 | Bacteria | 53486 |
| 439 | Ga0207426_1030313 | 3300025302 | Bacteria | 1775 |
| 440 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 441 | Ga0209257_1002647 | 3300025304 | Bacteria | 17224 |
| 442 | Ga0207656_10002336 | 3300025321 | Bacteria | 6364 |
| 443 | Ga0207656_10019561 | 3300025321 | Bacteria | 2680 |
| 444 | Ga0207656_10070388 | 3300025321 | Bacteria | 1553 |
| 445 | Ga0207642_10034382 | 3300025899 | Bacteria | 2155 |
| 446 | Ga0207642_10076630 | 3300025899 | Bacteria | 1610 |
| 447 | Ga0207710_10008776 | 3300025900 | Bacteria | 4259 |
| 448 | Ga0207688_10119833 | 3300025901 | Bacteria | 1535 |
| 449 | Ga0207680_10000619 | 3300025903 | Bacteria | 16749 |
| 450 | Ga0207680_10020374 | 3300025903 | Bacteria | 3568 |
| 451 | Ga0207647_10012039 | 3300025904 | Bacteria | 6037 |
| 452 | Ga0207647_10013257 | 3300025904 | Bacteria | 5721 |
| 453 | Ga0207647_10044871 | 3300025904 | Bacteria | 2760 |
| 454 | Ga0207645_10000378 | 3300025907 | Bacteria | 36697 |
| 455 | Ga0207645_10000763 | 3300025907 | Bacteria | 26753 |
| 456 | Ga0207645_10084313 | 3300025907 | Bacteria | 2039 |
| 457 | Ga0207643_10001933 | 3300025908 | Bacteria | 11464 |
| 458 | Ga0207643_10002437 | 3300025908 | Bacteria | 10060 |
| 459 | Ga0207705_10000717 | 3300025909 | Bacteria | 27323 |
| 460 | Ga0207705_10002776 | 3300025909 | Bacteria | 13384 |
| 461 | Ga0207705_10055536 | 3300025909 | Bacteria | 2855 |
| 462 | Ga0207705_10110743 | 3300025909 | Bacteria | 2028 |
| 463 | Ga0207654_10000775 | 3300025911 | Bacteria | 17563 |
| 464 | Ga0207654_10005854 | 3300025911 | Bacteria | 6200 |
| 465 | Ga0207654_10032775 | 3300025911 | Bacteria | 2874 |
| 466 | Ga0207707_10000323 | 3300025912 | Bacteria | 50505 |
| 467 | Ga0207707_10020931 | 3300025912 | Bacteria | 5714 |
| 468 | Ga0207707_10190794 | 3300025912 | Bacteria | 1788 |
| 469 | Ga0207707_10220986 | 3300025912 | Bacteria | 1649 |
| 470 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 471 | Ga0207695_10000031 | 3300025913 | Bacteria | 526801 |
| 472 | Ga0207695_10000110 | 3300025913 | Bacteria | 250079 |
| 473 | Ga0207695_10000151 | 3300025913 | Bacteria | 206493 |
| 474 | Ga0207695_10005271 | 3300025913 | Bacteria | 17237 |
| 475 | Ga0207695_10017407 | 3300025913 | Bacteria | 8363 |
| 476 | Ga0207695_10018132 | 3300025913 | Bacteria | 8147 |
| 477 | Ga0207695_10043735 | 3300025913 | Bacteria | 4771 |
| 478 | Ga0207695_10065212 | 3300025913 | Bacteria | 3745 |
| 479 | Ga0207695_10077325 | 3300025913 | Bacteria | 3381 |
| 480 | Ga0207671_10000149 | 3300025914 | Bacteria | 107722 |
| 481 | Ga0207671_10001536 | 3300025914 | Bacteria | 26452 |
| 482 | Ga0207671_10002088 | 3300025914 | Bacteria | 21861 |
| 483 | Ga0207671_10002513 | 3300025914 | Bacteria | 19573 |
| 484 | Ga0207671_10005116 | 3300025914 | Bacteria | 12220 |
| 485 | Ga0207671_10006479 | 3300025914 | Bacteria | 10419 |
| 486 | Ga0207671_10047911 | 3300025914 | Bacteria | 3163 |
| 487 | Ga0207660_10012104 | 3300025917 | Bacteria | 5639 |
| 488 | Ga0207662_10030759 | 3300025918 | Bacteria | 3117 |
| 489 | Ga0207657_10005727 | 3300025919 | Bacteria | 12961 |
| 490 | Ga0207657_10011956 | 3300025919 | Bacteria | 8590 |
| 491 | Ga0207657_10072488 | 3300025919 | Bacteria | 2914 |
| 492 | Ga0207657_10094429 | 3300025919 | Bacteria | 2490 |
| 493 | Ga0207649_10077560 | 3300025920 | Bacteria | 2141 |
| 494 | Ga0207649_10145606 | 3300025920 | Bacteria | 1626 |
| 495 | Ga0207652_10000132 | 3300025921 | Bacteria | 80345 |
| 496 | Ga0207652_10000713 | 3300025921 | Bacteria | 32283 |
| 497 | Ga0207652_10017662 | 3300025921 | Bacteria | 5840 |
| 498 | Ga0207681_10019898 | 3300025923 | Bacteria | 4250 |
| 499 | Ga0207694_10011872 | 3300025924 | Bacteria | 6568 |
| 500 | Ga0207650_10070537 | 3300025925 | Bacteria | 2627 |
| 501 | Ga0207659_10032682 | 3300025926 | Bacteria | 3574 |
| 502 | Ga0207659_10037741 | 3300025926 | Bacteria | 3356 |
| 503 | Ga0207644_10038614 | 3300025931 | Bacteria | 3365 |
| 504 | Ga0207644_10097004 | 3300025931 | Bacteria | 2208 |
| 505 | Ga0207690_10013324 | 3300025932 | Bacteria | 4939 |
| 506 | Ga0207690_10028354 | 3300025932 | Bacteria | 3549 |
| 507 | Ga0207706_10005229 | 3300025933 | Bacteria | 12114 |
| 508 | Ga0207706_10009726 | 3300025933 | Bacteria | 8826 |
| 509 | Ga0207706_10012289 | 3300025933 | Bacteria | 7802 |
| 510 | Ga0207706_10013804 | 3300025933 | Bacteria | 7330 |
| 511 | Ga0207706_10041013 | 3300025933 | Bacteria | 4104 |
| 512 | Ga0207706_10094724 | 3300025933 | Unclassified | 2627 |
| 513 | Ga0207686_10038744 | 3300025934 | Bacteria | 2887 |
| 514 | Ga0207670_10048750 | 3300025936 | Bacteria | 2829 |
| 515 | Ga0207670_10083764 | 3300025936 | Bacteria | 2238 |
| 516 | Ga0207670_10119845 | 3300025936 | Bacteria | 1911 |
| 517 | Ga0207704_10005264 | 3300025938 | Bacteria | 5958 |
| 518 | Ga0207704_10034464 | 3300025938 | Bacteria | 2889 |
| 519 | Ga0207691_10000227 | 3300025940 | Bacteria | 54652 |
| 520 | Ga0207691_10013965 | 3300025940 | Bacteria | 7662 |
| 521 | Ga0207691_10062119 | 3300025940 | Bacteria | 3391 |
| 522 | Ga0207691_10096532 | 3300025940 | Bacteria | 2642 |
| 523 | Ga0207691_10103237 | 3300025940 | Bacteria | 2542 |
| 524 | Ga0207689_10002045 | 3300025942 | Bacteria | 19049 |
| 525 | Ga0207689_10003446 | 3300025942 | Bacteria | 14441 |
| 526 | Ga0207689_10003531 | 3300025942 | Bacteria | 14286 |
| 527 | Ga0207689_10004234 | 3300025942 | Bacteria | 13052 |
| 528 | Ga0207689_10011373 | 3300025942 | Bacteria | 7628 |
| 529 | Ga0207689_10025901 | 3300025942 | Bacteria | 4912 |
| 530 | Ga0207689_10056715 | 3300025942 | Bacteria | 3224 |
| 531 | Ga0207689_10143286 | 3300025942 | Bacteria | 1969 |
| 532 | Ga0207661_10045478 | 3300025944 | Bacteria | 3475 |
| 533 | Ga0207661_10109524 | 3300025944 | Bacteria | 2333 |
| 534 | Ga0207661_10120246 | 3300025944 | Bacteria | 2235 |
| 535 | Ga0207679_10003970 | 3300025945 | Bacteria | 9193 |
| 536 | Ga0207679_10102601 | 3300025945 | Bacteria | 2240 |
| 537 | Ga0207679_10157092 | 3300025945 | Bacteria | 1858 |
| 538 | Ga0207667_10000144 | 3300025949 | Bacteria | 108295 |
| 539 | Ga0207667_10004138 | 3300025949 | Bacteria | 17827 |
| 540 | Ga0207667_10005340 | 3300025949 | Bacteria | 15665 |
| 541 | Ga0207667_10023124 | 3300025949 | Bacteria | 6847 |
| 542 | Ga0207667_10039915 | 3300025949 | Bacteria | 4999 |
| 543 | Ga0207667_10052787 | 3300025949 | Bacteria | 4279 |
| 544 | Ga0207651_10002380 | 3300025960 | Bacteria | 8980 |
| 545 | Ga0207651_10018126 | 3300025960 | Unclassified | 4181 |
| 546 | Ga0207651_10075712 | 3300025960 | Bacteria | 2403 |
| 547 | Ga0207651_10145571 | 3300025960 | Bacteria | 1837 |
| 548 | Ga0207712_10003315 | 3300025961 | Bacteria | 10203 |
| 549 | Ga0207712_10007921 | 3300025961 | Bacteria | 6711 |
| 550 | Ga0207712_10008082 | 3300025961 | Bacteria | 6655 |
| 551 | Ga0207712_10014895 | 3300025961 | Bacteria | 5007 |
| 552 | Ga0207712_10032658 | 3300025961 | Bacteria | 3514 |
| 553 | Ga0207712_10070570 | 3300025961 | Bacteria | 2510 |
| 554 | Ga0207712_10120156 | 3300025961 | Bacteria | 1987 |
| 555 | Ga0207712_10290390 | 3300025961 | Unclassified | 1338 |
| 556 | Ga0207668_10000679 | 3300025972 | Bacteria | 20879 |
| 557 | Ga0207668_10008809 | 3300025972 | Bacteria | 6030 |
| 558 | Ga0207668_10038350 | 3300025972 | Bacteria | 3215 |
| 559 | Ga0207668_10083481 | 3300025972 | Bacteria | 2325 |
| 560 | Ga0207668_10132718 | 3300025972 | Bacteria | 1904 |
| 561 | Ga0207640_10119688 | 3300025981 | Unclassified | 1883 |
| 562 | Ga0207640_10202917 | 3300025981 | Bacteria | 1504 |
| 563 | Ga0207640_10213358 | 3300025981 | Bacteria | 1472 |
| 564 | Ga0207658_10000176 | 3300025986 | Bacteria | 68501 |
| 565 | Ga0207658_10081045 | 3300025986 | Bacteria | 2488 |
| 566 | Ga0207658_10097445 | 3300025986 | Bacteria | 2296 |
| 567 | Ga0207677_10026360 | 3300026023 | Bacteria | 3644 |
| 568 | Ga0207677_10200572 | 3300026023 | Bacteria | 1585 |
| 569 | Ga0207703_10000433 | 3300026035 | Bacteria | 44015 |
| 570 | Ga0207703_10003126 | 3300026035 | Bacteria | 13978 |
| 571 | Ga0207703_10274415 | 3300026035 | Bacteria | 1529 |
| 572 | Ga0207639_10010289 | 3300026041 | Bacteria | 6475 |
| 573 | Ga0207639_10134275 | 3300026041 | Bacteria | 2053 |
| 574 | Ga0207639_10226161 | 3300026041 | Bacteria | 1619 |
| 575 | Ga0207702_10040374 | 3300026078 | Bacteria | 3913 |
| 576 | Ga0207702_10083529 | 3300026078 | Bacteria | 2779 |
| 577 | Ga0207702_10164195 | 3300026078 | Bacteria | 2030 |
| 578 | Ga0207702_10282799 | 3300026078 | Bacteria | 1569 |
| 579 | Ga0207641_10000226 | 3300026088 | Bacteria | 72539 |
| 580 | Ga0207641_10012826 | 3300026088 | Bacteria | 6871 |
| 581 | Ga0207641_10014131 | 3300026088 | Bacteria | 6543 |
| 582 | Ga0207641_10135852 | 3300026088 | Bacteria | 2213 |
| 583 | Ga0207648_10003768 | 3300026089 | Bacteria | 15840 |
| 584 | Ga0207648_10007506 | 3300026089 | Bacteria | 10709 |
| 585 | Ga0207648_10013131 | 3300026089 | Bacteria | 7720 |
| 586 | Ga0207648_10040889 | 3300026089 | Bacteria | 4072 |
| 587 | Ga0207648_10047172 | 3300026089 | Bacteria | 3777 |
| 588 | Ga0207648_10057857 | 3300026089 | Bacteria | 3382 |
| 589 | Ga0207676_10001240 | 3300026095 | Bacteria | 18994 |
| 590 | Ga0207676_10013461 | 3300026095 | Bacteria | 5876 |
| 591 | Ga0207676_10020222 | 3300026095 | Bacteria | 4867 |
| 592 | Ga0207676_10038784 | 3300026095 | Bacteria | 3639 |
| 593 | Ga0207676_10046530 | 3300026095 | Bacteria | 3358 |
| 594 | Ga0207676_10048482 | 3300026095 | Bacteria | 3298 |
| 595 | Ga0207674_10005115 | 3300026116 | Bacteria | 15654 |
| 596 | Ga0207674_10006654 | 3300026116 | Bacteria | 13576 |
| 597 | Ga0207674_10015073 | 3300026116 | Bacteria | 8510 |
| 598 | Ga0207674_10017055 | 3300026116 | Bacteria | 7926 |
| 599 | Ga0207674_10017645 | 3300026116 | Bacteria | 7784 |
| 600 | Ga0207674_10031117 | 3300026116 | Bacteria | 5607 |
| 601 | Ga0207674_10122929 | 3300026116 | Bacteria | 2561 |
| 602 | Ga0207674_10137166 | 3300026116 | Bacteria | 2407 |
| 603 | Ga0207674_10167353 | 3300026116 | Bacteria | 2152 |
| 604 | Ga0207675_100008068 | 3300026118 | Bacteria | 9918 |
| 605 | Ga0207675_100057429 | 3300026118 | Bacteria | 3631 |
| 606 | Ga0207675_100089718 | 3300026118 | Bacteria | 2889 |
| 607 | Ga0207675_100139676 | 3300026118 | Bacteria | 2301 |
| 608 | Ga0207675_100280555 | 3300026118 | Bacteria | 1619 |
| 609 | Ga0207683_10001455 | 3300026121 | Bacteria | 21350 |
| 610 | Ga0207683_10100585 | 3300026121 | Bacteria | 2581 |
| 611 | Ga0207683_10120369 | 3300026121 | Unclassified | 2356 |
| 612 | Ga0207683_10163987 | 3300026121 | Bacteria | 2010 |
| 613 | Ga0207683_10177500 | 3300026121 | Bacteria | 1931 |
| 614 | Ga0207698_10002228 | 3300026142 | Bacteria | 11462 |
| 615 | Ga0207698_10004129 | 3300026142 | Bacteria | 8823 |
| 616 | Ga0207698_10029722 | 3300026142 | Bacteria | 3917 |
| 617 | Ga0207698_10033022 | 3300026142 | Bacteria | 3756 |
| 618 | Ga0207698_10104374 | 3300026142 | Bacteria | 2358 |
| 619 | Ga0207698_10130927 | 3300026142 | Bacteria | 2143 |
| 620 | Ga0207698_10193103 | 3300026142 | Bacteria | 1816 |
| 621 | Ga0207698_10195203 | 3300026142 | Unclassified | 1807 |
| 622 | Ga0207698_10268755 | 3300026142 | Bacteria | 1571 |
| 623 | Ga0207698_10286375 | 3300026142 | Bacteria | 1526 |
| 624 | Ga0207428_10138124 | 3300027907 | Bacteria | 1862 |
| 625 | Ga0207428_10191013 | 3300027907 | Bacteria | 1544 |
| 626 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 627 | Ga0268266_10011164 | 3300028379 | Bacteria | 7819 |
| 628 | Ga0268266_10018579 | 3300028379 | Bacteria | 5924 |
| 629 | Ga0268265_10011975 | 3300028380 | Bacteria | 5870 |
| 630 | Ga0268265_10039803 | 3300028380 | Bacteria | 3467 |
| 631 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 632 | Ga0268264_10002959 | 3300028381 | Bacteria | 14756 |
| 633 | Ga0268264_10006197 | 3300028381 | Bacteria | 10100 |
| 634 | Ga0268264_10009695 | 3300028381 | Bacteria | 7975 |
| 635 | Ga0268264_10017026 | 3300028381 | Bacteria | 5951 |
| 636 | Ga0268264_10086619 | 3300028381 | Bacteria | 2692 |
| 637 | Ga0268264_10140300 | 3300028381 | Bacteria | 2154 |
| 638 | Ga0268264_10217134 | 3300028381 | Bacteria | 1759 |
| 639 | Ga0265334_10044384 | 3300028573 | Bacteria | 1726 |
| 640 | Ga0265323_10001043 | 3300028653 | Bacteria | 14359 |
| 641 | Ga0307517_10002168 | 3300028786 | Bacteria | 31819 |
| 642 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 643 | Ga0307515_10000469 | 3300028794 | Bacteria | 96345 |
| 644 | Ga0307515_10001093 | 3300028794 | Bacteria | 62142 |
| 645 | Ga0307515_10130111 | 3300028794 | Bacteria | 2780 |
| 646 | Ga0307511_10000139 | 3300030521 | Bacteria | 67385 |
| 647 | Ga0316179_1031295 | 3300030734 | Bacteria | 2938 |
| 648 | Ga0265327_10000197 | 3300031251 | Bacteria | 126837 |
| 649 | Ga0265327_10000248 | 3300031251 | Bacteria | 107284 |
| 650 | Ga0265327_10000272 | 3300031251 | Bacteria | 102100 |
| 651 | Ga0265327_10000344 | 3300031251 | Bacteria | 87965 |
| 652 | Ga0265327_10007740 | 3300031251 | Bacteria | 8208 |
| 653 | Ga0265316_10000989 | 3300031344 | Bacteria | 30846 |
| 654 | Ga0265316_10011439 | 3300031344 | Bacteria | 8002 |
| 655 | Ga0307509_10025149 | 3300031507 | Bacteria | 6653 |
| 656 | Ga0307509_10231184 | 3300031507 | Bacteria | 1652 |
| 657 | Ga0265313_10032946 | 3300031595 | Bacteria | 2639 |
| 658 | Ga0307508_10067215 | 3300031616 | Bacteria | 3153 |
| 659 | Ga0307508_10122302 | 3300031616 | Bacteria | 2206 |
| 660 | Ga0307514_10015943 | 3300031649 | Bacteria | 6189 |
| 661 | Ga0265342_10043284 | 3300031712 | Bacteria | 2718 |
| 662 | Ga0316576_10098873 | 3300031727 | Bacteria | 2179 |
| 663 | Ga0307516_10001339 | 3300031730 | Bacteria | 34211 |
| 664 | Ga0307516_10048026 | 3300031730 | Bacteria | 4202 |
| 665 | Ga0307405_10058628 | 3300031731 | Bacteria | 2424 |
| 666 | Ga0307412_10058409 | 3300031911 | Bacteria | 2580 |
| 667 | Ga0307409_100219993 | 3300031995 | Bacteria | 1714 |
| 668 | Ga0307416_100096360 | 3300032002 | Bacteria | 2558 |
| 669 | Ga0307416_100221109 | 3300032002 | Bacteria | 1816 |
| 670 | Ga0307414_10000080 | 3300032004 | Bacteria | 89531 |
| 671 | Ga0307414_10014853 | 3300032004 | Bacteria | 4684 |
| 672 | Ga0307414_10228856 | 3300032004 | Bacteria | 1531 |
| 673 | Ga0307411_10002742 | 3300032005 | Bacteria | 7915 |
| 674 | Ga0307415_100036116 | 3300032126 | Bacteria | 3235 |
| 675 | Ga0307510_10048530 | 3300033180 | Bacteria | 4528 |
| 676 | Ga0316588_1023036 | 3300033528 | Bacteria | 1426 |
| 677 | Ga0373933_0120653 | 3300035724 | Bacteria | 1642 |
| 678 | Ga0373937_0132909 | 3300036401 | Bacteria | 2325 |
| 679 | Ga0373937_0278049 | 3300036401 | Bacteria | 1581 |
| 680 | Ga0395899_0006685 | 3300037312 | Bacteria | 8935 |
| 681 | Ga0395899_0011397 | 3300037312 | Bacteria | 6808 |
| 682 | Ga0395899_0057450 | 3300037312 | Bacteria | 2872 |
| 683 | Ga0395900_0007443 | 3300037418 | Bacteria | 11310 |
| 684 | Ga0395900_0040022 | 3300037418 | Bacteria | 4830 |
| 685 | Ga0395900_0064927 | 3300037418 | Unclassified | 3749 |
| 686 | Ga0395900_0145350 | 3300037418 | Bacteria | 2425 |
| 687 | Ga0395898_0002124 | 3300037466 | Bacteria | 24470 |
| 688 | Ga0395898_0002566 | 3300037466 | Bacteria | 21273 |
| 689 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 690 | Ga0395905_0001098 | 3300037471 | Bacteria | 34054 |
| 691 | Ga0395905_0010903 | 3300037471 | Bacteria | 8801 |
| 692 | Ga0395905_0104734 | 3300037471 | Bacteria | 2656 |
| 693 | Ga0395901_0001075 | 3300038443 | Bacteria | 29195 |
| 694 | Ga0395901_0010128 | 3300038443 | Bacteria | 9552 |
| 695 | Ga0395901_0034989 | 3300038443 | Bacteria | 5189 |
| 696 | Ga0395901_0041287 | 3300038443 | Bacteria | 4780 |
| 697 | Ga0395901_0177080 | 3300038443 | Bacteria | 2237 |
| 698 | Ga0395901_0317988 | 3300038443 | Bacteria | 1611 |
| 699 | Ga0436365_0585774 | 3300039437 | Bacteria | 54587 |
| 700 | Ga0436365_0678933 | 3300039437 | Bacteria | 1874 |
| 701 | Ga0436365_1029016 | 3300039437 | Bacteria | 11135 |
| 702 | Ga0436365_1894125 | 3300039437 | Bacteria | 1935 |
| 703 | Ga0451833_1482918 | 3300041491 | Bacteria | 1356 |
| 704 | Ga0439431_0000240 | 3300041997 | Bacteria | 11132 |
| 705 | Ga0439445_0005873 | 3300042004 | Bacteria | 2807 |
| 706 | Ga0439449_0000099 | 3300042007 | Bacteria | 27712 |
| 707 | Ga0439457_000696 | 3300042014 | Bacteria | 9932 |
| 708 | Ga0439462_0000918 | 3300042015 | Bacteria | 6239 |
| 709 | Ga0451577_0000452 | 3300042876 | Bacteria | 71587 |
| 710 | Ga0466969_0000238 | 3300044656 | Bacteria | 30098 |
| 711 | Ga0466972_0000003 | 3300044658 | Bacteria | 391452 |
| 712 | Ga0466972_0000039 | 3300044658 | Bacteria | 135618 |
| 713 | Ga0453683_0065909 | 3300044673 | Bacteria | 2264 |
| 714 | Ga0466966_0000136 | 3300044684 | Bacteria | 47038 |
| 715 | Ga0466964_0012435 | 3300044706 | Bacteria | 3220 |
| 716 | Ga0453684_0033978 | 3300044712 | Bacteria | 7092 |
| 717 | Ga0453684_0092446 | 3300044712 | Bacteria | 3730 |
| 718 | Ga0453684_0257288 | 3300044712 | Bacteria | 2002 |
| 719 | Ga0466970_0000460 | 3300044765 | Bacteria | 20110 |
| 720 | Ga0466970_0015787 | 3300044765 | Bacteria | 3888 |
| 721 | Ga0466970_0056323 | 3300044765 | Bacteria | 2101 |
| 722 | Ga0466957_0001467 | 3300044842 | Bacteria | 12361 |
| 723 | Ga0466957_0096749 | 3300044842 | Bacteria | 1856 |
| 724 | Ga0466959_0000002 | 3300045049 | Bacteria | 362671 |
| 725 | Ga0466959_0044378 | 3300045049 | Bacteria | 3276 |
| 726 | Ga0466959_0229430 | 3300045049 | Bacteria | 1285 |
| 727 | Ga0495627_013728 | 3300046453 | Bacteria | 2845 |
| 728 | Ga0495629_0236814 | 3300046459 | Bacteria | 1257 |
| 729 | Ga0495638_0039053 | 3300046460 | Bacteria | 3015 |
| 730 | Ga0495638_0040748 | 3300046460 | Bacteria | 2942 |
| 731 | Ga0495651_0157060 | 3300046462 | Bacteria | 1634 |
| 732 | Ga0495594_0138503 | 3300046499 | Bacteria | 1380 |
| 733 | Ga0495606_0002871 | 3300046507 | Bacteria | 19056 |
| 734 | Ga0495606_0090956 | 3300046507 | Bacteria | 1877 |
| 735 | Ga0495628_0011990 | 3300046516 | Bacteria | 7311 |
| 736 | Ga0495630_0051189 | 3300046517 | Bacteria | 3091 |
| 737 | Ga0495643_0039118 | 3300046522 | Bacteria | 2595 |
| 738 | Ga0495633_0000774 | 3300046558 | Bacteria | 28642 |
| 739 | Ga0495668_0000310 | 3300046616 | Bacteria | 67405 |
| 740 | Ga0495668_0000751 | 3300046616 | Bacteria | 38311 |
| 741 | Ga0495668_0001166 | 3300046616 | Bacteria | 26773 |
| 742 | Ga0495611_0000316 | 3300046648 | Bacteria | 32353 |
| 743 | Ga0495658_0004160 | 3300046683 | Bacteria | 7128 |
| 744 | Ga0495636_0000138 | 3300047318 | Bacteria | 29235 |
| 745 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 746 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 747 | Ga0495686_0000595 | 3300047472 | Bacteria | 50402 |
| 748 | Ga0496104_0188665 | 3300048907 | Bacteria | 1973 |
| 749 | Ga0496108_0256381 | 3300048911 | Bacteria | 1522 |
| 750 | Ga0496110_0070127 | 3300048913 | Bacteria | 3105 |
| 751 | Ga0496114_0000439 | 3300048917 | Bacteria | 30666 |
| 752 | Ga0496114_0248159 | 3300048917 | Bacteria | 1566 |
| 753 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 754 | Ga0496125_0000443 | 3300048928 | Bacteria | 75675 |
| 755 | Ga0496126_0095277 | 3300048929 | Bacteria | 2611 |
| 756 | Ga0501319_002049 | 3300049535 | Bacteria | 1244 |
| 757 | Ga0501031_0008920 | 3300049568 | Bacteria | 6520 |
| 758 | Ga0501032_0071251 | 3300049569 | Bacteria | 2317 |
| 759 | Ga0501032_0108954 | 3300049569 | Bacteria | 1834 |
| 760 | Ga0501033_0075824 | 3300049570 | Bacteria | 2468 |
| 761 | Ga0501033_0255734 | 3300049570 | Bacteria | 1240 |
| 762 | Ga0501034_0000277 | 3300049571 | Bacteria | 92445 |
| 763 | Ga0501034_0009006 | 3300049571 | Bacteria | 10483 |
| 764 | Ga0501034_0009656 | 3300049571 | Bacteria | 10090 |
| 765 | Ga0501034_0024994 | 3300049571 | Bacteria | 6078 |
| 766 | Ga0501034_0025394 | 3300049571 | Bacteria | 6031 |
| 767 | Ga0501034_0052389 | 3300049571 | Bacteria | 4111 |
| 768 | Ga0501034_0066202 | 3300049571 | Bacteria | 3626 |
| 769 | Ga0501034_0193412 | 3300049571 | Bacteria | 1996 |
| 770 | Ga0501036_0095881 | 3300049572 | Bacteria | 2508 |
| 771 | Ga0501036_0098463 | 3300049572 | Bacteria | 2472 |
| 772 | Ga0501037_0013639 | 3300049573 | Bacteria | 5987 |
| 773 | Ga0501037_0040682 | 3300049573 | Bacteria | 3420 |
| 774 | Ga0501037_0083724 | 3300049573 | Bacteria | 2311 |
| 775 | Ga0501038_0035496 | 3300049574 | Bacteria | 4377 |
| 776 | Ga0501038_0173163 | 3300049574 | Bacteria | 1746 |
| 777 | Ga0501043_0013312 | 3300049579 | Bacteria | 6432 |
| 778 | Ga0501043_0148836 | 3300049579 | Bacteria | 1832 |
| 779 | Ga0501047_0019100 | 3300049581 | Bacteria | 6576 |
| 780 | Ga0501047_0038244 | 3300049581 | Bacteria | 4642 |
| 781 | Ga0501047_0192609 | 3300049581 | Bacteria | 1902 |
| 782 | Ga0501069_0013494 | 3300049585 | Bacteria | 4357 |
| 783 | Ga0501073_0003496 | 3300049589 | Bacteria | 11804 |
| 784 | Ga0501202_002713 | 3300049652 | Bacteria | 2990 |
| 785 | Ga0501207_011727 | 3300049654 | Bacteria | 1308 |
| 786 | Ga0501235_004888 | 3300049669 | Bacteria | 2904 |
| 787 | Ga0501236_000375 | 3300049670 | Bacteria | 4955 |
| 788 | Ga0501242_003333 | 3300049674 | Bacteria | 1733 |
| 789 | Ga0501252_000726 | 3300049682 | Bacteria | 2713 |
| 790 | Ga0501219_001064 | 3300049703 | Bacteria | 3153 |
| 791 | Ga0501221_000433 | 3300049704 | Bacteria | 6494 |
| 792 | Ga0501225_0028234 | 3300049705 | Bacteria | 1543 |
| 793 | Ga0501234_006306 | 3300049707 | Bacteria | 1855 |
| 794 | Ga0501080_0141640 | 3300049742 | Bacteria | 2223 |
| 795 | Ga0501080_0224180 | 3300049742 | Bacteria | 1719 |
| 796 | Ga0501080_0244120 | 3300049742 | Bacteria | 1638 |
| 797 | Ga0501241_000078 | 3300049758 | Bacteria | 21770 |
| 798 | Ga0501241_000560 | 3300049758 | Bacteria | 7966 |
| 799 | Ga0501266_006658 | 3300049763 | Bacteria | 1438 |
| 800 | Ga0501035_0033293 | 3300049822 | Bacteria | 4687 |
| 801 | Ga0501035_0037822 | 3300049822 | Bacteria | 4368 |
| 802 | Ga0501035_0074981 | 3300049822 | Bacteria | 2992 |
| 803 | Ga0501035_0092700 | 3300049822 | Bacteria | 2658 |
| 804 | Ga0501035_0176330 | 3300049822 | Bacteria | 1844 |
| 805 | Ga0501044_0064792 | 3300049823 | Bacteria | 3729 |
| 806 | Ga0501044_0065167 | 3300049823 | Bacteria | 3716 |
| 807 | Ga0501044_0069714 | 3300049823 | Bacteria | 3579 |
| 808 | Ga0501044_0218251 | 3300049823 | Bacteria | 1858 |
| 809 | Ga0501044_0328652 | 3300049823 | Bacteria | 1452 |
| 810 | Ga0501284_00011 | 3300050005 | Bacteria | 131008 |
| 811 | Ga0501284_00565 | 3300050005 | Bacteria | 1917 |
| 812 | nmdc:mga0k408_32148_c1 | 3300050493 | Bacteria | 2998 |
| 813 | nmdc:mga0k408_54335_c1 | 3300050493 | Bacteria | 2321 |
| 814 | nmdc:mga05p37_1503_c1 | 3300050507 | Bacteria | 27101 |
| 815 | nmdc:mga09592_137274_c1 | 3300050508 | Bacteria | 2107 |
| 816 | nmdc:mga09592_8593_c1 | 3300050508 | Bacteria | 8308 |
| 817 | nmdc:mga06r32_98436_c1 | 3300050510 | Bacteria | 2867 |
| 818 | nmdc:mga08y16_24983_c1 | 3300050511 | Bacteria | 6303 |
| 819 | nmdc:mga08y16_95741_c1 | 3300050511 | Bacteria | 3092 |
| 820 | Ga0495619_0020579 | 3300053085 | Bacteria | 4205 |
| 821 | Ga0500578_0000034 | 3300053086 | Bacteria | 136582 |
| 822 | Ga0500644_0000475 | 3300053088 | Bacteria | 17705 |
| 823 | Ga0500644_0007039 | 3300053088 | Bacteria | 2912 |
| 824 | Ga0500646_0010394 | 3300053090 | Bacteria | 2388 |
| 825 | Ga0500583_0002199 | 3300053092 | Bacteria | 5793 |
| 826 | Ga0500583_0047440 | 3300053092 | Bacteria | 1979 |
| 827 | Ga0500641_0000188 | 3300053096 | Bacteria | 23249 |
| 828 | Ga0500641_0012559 | 3300053096 | Bacteria | 3094 |
| 829 | Ga0500562_000077 | 3300053108 | Bacteria | 45189 |
| 830 | Ga0500562_000935 | 3300053108 | Bacteria | 7111 |
| 831 | Ga0500569_000194 | 3300053109 | Bacteria | 9667 |
| 832 | Ga0500642_0067126 | 3300053130 | Bacteria | 1625 |
| 833 | Ga0500652_012467 | 3300053131 | Bacteria | 2983 |
| 834 | Ga0500658_0005885 | 3300053134 | Bacteria | 4564 |
| 835 | Ga0500559_0012611 | 3300053136 | Bacteria | 3589 |
| 836 | Ga0500559_0015288 | 3300053136 | Bacteria | 3241 |
| 837 | Ga0500568_0002131 | 3300053139 | Bacteria | 11940 |
| 838 | Ga0500568_0039990 | 3300053139 | Bacteria | 1890 |
| 839 | Ga0500573_0054826 | 3300053140 | Bacteria | 2289 |
| 840 | Ga0500589_032472 | 3300053147 | Bacteria | 2434 |
| 841 | Ga0500589_037593 | 3300053147 | Bacteria | 2260 |
| 842 | Ga0500604_0000511 | 3300053151 | Bacteria | 10771 |
| 843 | Ga0500604_0006844 | 3300053151 | Bacteria | 3017 |
| 844 | Ga0500616_0002819 | 3300053153 | Bacteria | 13977 |
| 845 | Ga0500616_0006055 | 3300053153 | Bacteria | 8026 |
| 846 | Ga0500622_0000014 | 3300053156 | Bacteria | 368189 |
| 847 | Ga0500622_0000020 | 3300053156 | Bacteria | 271239 |
| 848 | Ga0500622_0000725 | 3300053156 | Bacteria | 28810 |
| 849 | Ga0500622_0001543 | 3300053156 | Bacteria | 18252 |
| 850 | Ga0500622_0020151 | 3300053156 | Bacteria | 3541 |
| 851 | Ga0500634_0031992 | 3300053161 | Bacteria | 2870 |
| 852 | Ga0500636_0020568 | 3300053177 | Bacteria | 3908 |
| 853 | Ga0500636_0026467 | 3300053177 | Bacteria | 3427 |
| 854 | Ga0500611_000031 | 3300053727 | Bacteria | 85821 |
| 855 | Ga0501084_0058451 | 3300054114 | Bacteria | 3226 |
| 856 | Ga0500661_000526 | 3300055283 | Bacteria | 7108 |
| 857 | Ga0466962_0011997 | 3300061719 | Bacteria | 4168 |
| 858 | 2522548210 | 2522125168 | Bacteria | 7376607 |
| 859 | 2738727080 | 2738541278 | Bacteria | 9755573 |
| 860 | 2817415207 | 2816332280 | Bacteria | 5109718 |
| 861 | 2819572431 | 2818991442 | Bacteria | 8318214 |
| 862 | 2819590748 | 2818991444 | Bacteria | 6968812 |
| 863 | 2819680595 | 2818991460 | Bacteria | 7595395 |
| 864 | 2821140200 | 2821136567 | Bacteria | 8080116 |
| 865 | 2833642984 | 2833640130 | Bacteria | 4858325 |
| 866 | 2840677769 | 2840677318 | Bacteria | 2664183 |
| 867 | 2881956394 | 2881955468 | Bacteria | 3545609 |
| 868 | 2883071100 | 2883068021 | Bacteria | 6192739 |
| 869 | 2884634894 | 2884634485 | Bacteria | 3928637 |
| 870 | 2884797980 | 2884791551 | Bacteria | 8511252 |
| 871 | 2890807304 | 2890804823 | Bacteria | 3717572 |
| 872 | 2896085587 | 2896085136 | Bacteria | 6129793 |
| 873 | 2896113791 | 2896109856 | Bacteria | 7140722 |
| 874 | 2904472323 | 2904467357 | Bacteria | 8057758 |
| 875 | 2911143019 | 2911138879 | Bacteria | 5811561 |
| 876 | 2914761826 | 2914759650 | Bacteria | 4701441 |
| 877 | 2919510987 | 2919509842 | Bacteria | 4104664 |
| 878 | 2919693138 | 2919692658 | Bacteria | 5943958 |
| 879 | 2929157771 | 2929154850 | Bacteria | 6753285 |
| 880 | 2929182886 | 2929177148 | Bacteria | 7883697 |
| 881 | 2929245018 | 2929239360 | Bacteria | 7745570 |
| 882 | 2929927293 | 2929921140 | Bacteria | 8649150 |
| 883 | 2945978841 | 2945977869 | Bacteria | 7777518 |
| 884 | 2946015293 | 2946013367 | Bacteria | 7766675 |
| 885 | 8003151177 | 8003151029 | Bacteria | 8187759 |
| 886 | Ga0496115_0212890 | |||
| 887 | SwRhRL2b_contig_1663050 | |||
| 888 | JGI24751J29686_10000335 | |||
| 889 | JGI25154J39366_1000293 | |||
| 890 | JGI25406J46586_10012667 | |||
| 891 | JGI25153J46596_10001122 | |||
| 892 | rootH1_10026195 | |||
| 893 | rootH2_10008034 | |||
| 894 | rootH2_10009544 | |||
| 895 | rootL2_10007707 | |||
| 896 | rootH1_10000938 | |||
| 897 | rootH1_10000939 | |||
| 898 | rootH1_10000940 | |||
| 899 | rootH1_10007034 | |||
| 900 | rootH1_10009521 | |||
| 901 | rootH1_10204701 | |||
| 902 | JGI25160J50197_1003310 | |||
| 903 | JGI25160J50197_1005348 | |||
| 904 | Ga0055535_1001325 | |||
| 905 | Ga0055542_1003062 | |||
| 906 | Ga0055528_1001409 | |||
| 907 | Ga0055528_1003892 | |||
| 908 | Ga0055531_10000237 | |||
| 909 | Ga0065165_1000190 | |||
| 910 | Ga0065165_1009020 | |||
| 911 | Ga0065165_1014165 | |||
| 912 | Ga0065714_10003401 | |||
| 913 | Ga0065714_10106522 | |||
| 914 | Ga0065704_10070140 | |||
| 915 | Ga0065704_10071188 | |||
| 916 | Ga0065704_10155100 | |||
| 917 | Ga0065712_10071492 | |||
| 918 | Ga0065715_10120220 | |||
| 919 | Ga0070658_10021911 | |||
| 920 | Ga0070658_10074306 | |||
| 921 | Ga0070658_10096594 | |||
| 922 | Ga0070658_10180295 | |||
| 923 | Ga0070658_10256511 | |||
| 924 | Ga0070676_10003818 | |||
| 925 | Ga0070676_10012539 | |||
| 926 | Ga0070683_100001758 | |||
| 927 | Ga0070683_100002901 | |||
| 928 | Ga0070683_100004709 | |||
| 929 | Ga0070683_100018792 | |||
| 930 | Ga0070690_100112179 | |||
| 931 | Ga0070690_100134853 | |||
| 932 | Ga0070670_100042195 | |||
| 933 | Ga0070670_100067020 | |||
| 934 | Ga0070670_100073046 | |||
| 935 | Ga0070670_100085279 | |||
| 936 | Ga0070670_100087106 | |||
| 937 | Ga0070670_100098114 | |||
| 938 | Ga0070677_10004868 | |||
| 939 | Ga0068869_100009712 | |||
| 940 | Ga0068869_100027952 | |||
| 941 | Ga0068869_100060172 | |||
| 942 | Ga0070666_10000411 | |||
| 943 | Ga0070666_10002153 | |||
| 944 | Ga0070666_10008024 | |||
| 945 | Ga0070666_10069839 | |||
| 946 | Ga0070680_100001025 | |||
| 947 | Ga0070680_100011225 | |||
| 948 | Ga0070680_100029784 | |||
| 949 | Ga0070680_100055254 | |||
| 950 | Ga0070680_100105493 | |||
| 951 | Ga0070680_100235342 | |||
| 952 | Ga0070682_100000054 | |||
| 953 | Ga0070682_100011589 | |||
| 954 | Ga0070682_100129528 | |||
| 955 | Ga0070682_100192754 | |||
| 956 | Ga0068868_100003047 | |||
| 957 | Ga0068868_100052291 | |||
| 958 | Ga0068868_100079913 | |||
| 959 | Ga0068868_100083582 | |||
| 960 | Ga0070660_100010316 | |||
| 961 | Ga0070660_100062309 | |||
| 962 | Ga0070660_100113317 | |||
| 963 | Ga0070660_100118624 | |||
| 964 | Ga0070689_100027955 | |||
| 965 | Ga0070691_10015872 | |||
| 966 | Ga0070661_100118315 | |||
| 967 | Ga0070661_100145757 | |||
| 968 | Ga0070661_100187800 | |||
| 969 | Ga0070661_100286141 | |||
| 970 | Ga0070668_100000043 | |||
| 971 | Ga0070668_100046860 | |||
| 972 | Ga0070668_100158914 | |||
| 973 | Ga0070669_100000660 | |||
| 974 | Ga0070675_100002780 | |||
| 975 | Ga0070675_100004944 | |||
| 976 | Ga0070675_100021178 | |||
| 977 | Ga0070675_100032415 | |||
| 978 | Ga0070675_100063619 | |||
| 979 | Ga0070675_100091822 | |||
| 980 | Ga0070671_100035166 | |||
| 981 | Ga0070671_100123875 | |||
| 982 | Ga0070674_100022606 | |||
| 983 | Ga0070674_100099630 | |||
| 984 | Ga0070674_100234128 | |||
| 985 | Ga0070673_100002573 | |||
| 986 | Ga0070673_100095840 | |||
| 987 | Ga0070673_100179440 | |||
| 988 | Ga0070673_100193161 | |||
| 989 | Ga0070688_100003168 | |||
| 990 | Ga0070688_100011188 | |||
| 991 | Ga0070688_100213944 | |||
| 992 | Ga0070659_100003702 | |||
| 993 | Ga0070659_100024213 | |||
| 994 | Ga0070659_100180256 | |||
| 995 | Ga0070667_100000254 | |||
| 996 | Ga0070667_100019703 | |||
| 997 | Ga0070667_100027762 | |||
| 998 | Ga0070667_100053091 | |||
| 999 | Ga0070701_10019903 | |||
| 1000 | Ga0070700_100040931 | |||
| 1001 | Ga0070700_100097610 | |||
| 1002 | Ga0070663_100067568 | |||
| 1003 | Ga0070678_100025990 | |||
| 1004 | Ga0070678_100039245 | |||
| 1005 | Ga0070678_100048931 | |||
| 1006 | Ga0070678_100153804 | |||
| 1007 | Ga0070662_100002089 | |||
| 1008 | Ga0070662_100015197 | |||
| 1009 | Ga0070662_100027246 | |||
| 1010 | Ga0070662_100031364 | |||
| 1011 | Ga0070662_100091725 | |||
| 1012 | Ga0070662_100179959 | |||
| 1013 | Ga0070681_10038592 | |||
| 1014 | Ga0070681_10051262 | |||
| 1015 | Ga0070681_10052163 | |||
| 1016 | Ga0070681_10095837 | |||
| 1017 | Ga0070681_10112277 | |||
| 1018 | Ga0068867_100007630 | |||
| 1019 | Ga0068867_100027897 | |||
| 1020 | Ga0068867_100226863 | |||
| 1021 | Ga0070685_10004944 | |||
| 1022 | Ga0070685_10085830 | |||
| 1023 | Ga0070698_100000392 | |||
| 1024 | Ga0070698_100010460 | |||
| 1025 | Ga0070679_100000174 | |||
| 1026 | Ga0070679_100001499 | |||
| 1027 | Ga0070679_100003920 | |||
| 1028 | Ga0070679_100019897 | |||
| 1029 | Ga0070679_100046468 | |||
| 1030 | Ga0070684_100000662 | |||
| 1031 | Ga0070684_100003150 | |||
| 1032 | Ga0070684_100064944 | |||
| 1033 | Ga0070684_100107297 | |||
| 1034 | Ga0070684_100249157 | |||
| 1035 | Ga0068853_100000381 | |||
| 1036 | Ga0068853_100004978 | |||
| 1037 | Ga0068853_100023196 | |||
| 1038 | Ga0068853_100270227 | |||
| 1039 | Ga0070672_100000109 | |||
| 1040 | Ga0070672_100026702 | |||
| 1041 | Ga0070672_100036233 | |||
| 1042 | Ga0070672_100050208 | |||
| 1043 | Ga0070672_100167373 | |||
| 1044 | Ga0070686_100034487 | |||
| 1045 | Ga0070693_100002584 | |||
| 1046 | Ga0070665_100000041 | |||
| 1047 | Ga0070665_100002085 | |||
| 1048 | Ga0070665_100020471 | |||
| 1049 | Ga0070665_100027777 | |||
| 1050 | Ga0070704_100152519 | |||
| 1051 | Ga0068855_100000995 | |||
| 1052 | Ga0068855_100003373 | |||
| 1053 | Ga0068855_100015722 | |||
| 1054 | Ga0068855_100023944 | |||
| 1055 | Ga0068855_100030990 | |||
| 1056 | Ga0068855_100042337 | |||
| 1057 | Ga0068855_100042453 | |||
| 1058 | Ga0068855_100091126 | |||
| 1059 | Ga0068855_100107692 | |||
| 1060 | Ga0068855_100143388 | |||
| 1061 | Ga0070664_100003411 | |||
| 1062 | Ga0070664_100012446 | |||
| 1063 | Ga0070664_100042787 | |||
| 1064 | Ga0070664_100140373 | |||
| 1065 | Ga0070664_100144610 | |||
| 1066 | Ga0068857_100019259 | |||
| 1067 | Ga0068857_100081185 | |||
| 1068 | Ga0068857_100084584 | |||
| 1069 | Ga0068857_100250133 | |||
| 1070 | Ga0068854_100141734 | |||
| 1071 | Ga0068854_100308004 | |||
| 1072 | Ga0068856_100020074 | |||
| 1073 | Ga0068856_100049922 | |||
| 1074 | Ga0068856_100123417 | |||
| 1075 | Ga0068856_100133394 | |||
| 1076 | Ga0068856_100273586 | |||
| 1077 | Ga0068852_100004748 | |||
| 1078 | Ga0068852_100024540 | |||
| 1079 | Ga0068852_100032963 | |||
| 1080 | Ga0068852_100034775 | |||
| 1081 | Ga0068852_100039686 | |||
| 1082 | Ga0068852_100061644 | |||
| 1083 | Ga0068852_100159348 | |||
| 1084 | Ga0068852_100174403 | |||
| 1085 | Ga0068859_100000037 | |||
| 1086 | Ga0068859_100024350 | |||
| 1087 | Ga0068859_100048491 | |||
| 1088 | Ga0068859_100065792 | |||
| 1089 | Ga0068859_100173645 | |||
| 1090 | Ga0068859_100386686 | |||
| 1091 | Ga0068864_100001192 | |||
| 1092 | Ga0068864_100029740 | |||
| 1093 | Ga0068864_100032450 | |||
| 1094 | Ga0068864_100039621 | |||
| 1095 | Ga0068864_100040012 | |||
| 1096 | Ga0068864_100061670 | |||
| 1097 | Ga0068861_100003469 | |||
| 1098 | Ga0068851_10001233 | |||
| 1099 | Ga0068851_10030515 | |||
| 1100 | Ga0068851_10057539 | |||
| 1101 | Ga0068870_10037735 | |||
| 1102 | Ga0068870_10048484 | |||
| 1103 | Ga0068863_100002618 | |||
| 1104 | Ga0068863_100002856 | |||
| 1105 | Ga0068863_100074923 | |||
| 1106 | Ga0068863_100154699 | |||
| 1107 | Ga0068858_100000199 | |||
| 1108 | Ga0068858_100018293 | |||
| 1109 | Ga0068860_100000383 | |||
| 1110 | Ga0068860_100000700 | |||
| 1111 | Ga0068860_100013203 | |||
| 1112 | Ga0068860_100152109 | |||
| 1113 | Ga0068860_100217921 | |||
| 1114 | Ga0068862_100007282 | |||
| 1115 | Ga0068862_100010232 | |||
| 1116 | Ga0081540_1018059 | |||
| 1117 | Ga0081539_10003031 | |||
| 1118 | Ga0081539_10004761 | |||
| 1119 | Ga0075366_10056967 | |||
| 1120 | Ga0097621_100001591 | |||
| 1121 | Ga0097621_100003742 | |||
| 1122 | Ga0097621_100004103 | |||
| 1123 | Ga0097621_100024053 | |||
| 1124 | Ga0075370_10062204 | |||
| 1125 | Ga0068871_100000737 | |||
| 1126 | Ga0068871_100002768 | |||
| 1127 | Ga0068871_100008698 | |||
| 1128 | Ga0068871_100018879 | |||
| 1129 | Ga0068871_100024986 | |||
| 1130 | Ga0068871_100088023 | |||
| 1131 | Ga0068871_100129186 | |||
| 1132 | Ga0068871_100277197 | |||
| 1133 | Ga0075428_100009100 | |||
| 1134 | Ga0075430_100002881 | |||
| 1135 | Ga0075429_100002313 | |||
| 1136 | Ga0075429_100027037 | |||
| 1137 | Ga0068865_100010112 | |||
| 1138 | Ga0097620_100000037 | |||
| 1139 | Ga0097620_100024352 | |||
| 1140 | Ga0097620_100048492 | |||
| 1141 | Ga0097620_100065794 | |||
| 1142 | Ga0097620_100173645 | |||
| 1143 | Ga0097620_100386659 | |||
| 1144 | Ga0105240_10000073 | |||
| 1145 | Ga0105240_10000224 | |||
| 1146 | Ga0105240_10002232 | |||
| 1147 | Ga0105240_10003321 | |||
| 1148 | Ga0105240_10005749 | |||
| 1149 | Ga0105240_10008705 | |||
| 1150 | Ga0105240_10036358 | |||
| 1151 | Ga0105240_10077274 | |||
| 1152 | Ga0105240_10111385 | |||
| 1153 | Ga0105240_10213177 | |||
| 1154 | Ga0111539_10017114 | |||
| 1155 | Ga0111539_10019384 | |||
| 1156 | Ga0111539_10202016 | |||
| 1157 | Ga0105245_10040885 | |||
| 1158 | Ga0105247_10000946 | |||
| 1159 | Ga0105247_10075971 | |||
| 1160 | Ga0114129_10023506 | |||
| 1161 | Ga0114129_10156418 | |||
| 1162 | Ga0105241_10000493 | |||
| 1163 | Ga0105241_10012294 | |||
| 1164 | Ga0105241_10039402 | |||
| 1165 | Ga0105242_10023093 | |||
| 1166 | Ga0105242_10047988 | |||
| 1167 | Ga0105242_10060461 | |||
| 1168 | Ga0105242_10104591 | |||
| 1169 | Ga0105242_10171899 | |||
| 1170 | Ga0105248_10027033 | |||
| 1171 | Ga0105248_10075391 | |||
| 1172 | Ga0105237_10000719 | |||
| 1173 | Ga0105237_10001973 | |||
| 1174 | Ga0105237_10002801 | |||
| 1175 | Ga0105237_10003801 | |||
| 1176 | Ga0105237_10004541 | |||
| 1177 | Ga0105237_10006950 | |||
| 1178 | Ga0105237_10018401 | |||
| 1179 | Ga0105237_10025051 | |||
| 1180 | Ga0105237_10110773 | |||
| 1181 | Ga0105238_10000247 | |||
| 1182 | Ga0105238_10023438 | |||
| 1183 | Ga0105238_10042810 | |||
| 1184 | Ga0105238_10178835 | |||
| 1185 | Ga0105249_10001713 | |||
| 1186 | Ga0105249_10003686 | |||
| 1187 | Ga0105249_10004032 | |||
| 1188 | Ga0105249_10004791 | |||
| 1189 | Ga0105249_10012772 | |||
| 1190 | Ga0105249_10020558 | |||
| 1191 | Ga0105249_10034354 | |||
| 1192 | Ga0105249_10057070 | |||
| 1193 | Ga0105249_10075451 | |||
| 1194 | Ga0105239_10000685 | |||
| 1195 | Ga0105239_10000785 | |||
| 1196 | Ga0105239_10003390 | |||
| 1197 | Ga0105239_10019299 | |||
| 1198 | Ga0105239_10024490 | |||
| 1199 | Ga0105239_10025508 | |||
| 1200 | Ga0105239_10029882 | |||
| 1201 | Ga0105239_10044357 | |||
| 1202 | Ga0105239_10100452 | |||
| 1203 | Ga0105246_10030831 | |||
| 1204 | Ga0157373_10004243 | |||
| 1205 | Ga0157373_10006313 | |||
| 1206 | Ga0157373_10035137 | |||
| 1207 | Ga0157373_10105957 | |||
| 1208 | Ga0157373_10117437 | |||
| 1209 | Ga0157371_10000318 | |||
| 1210 | Ga0157371_10000499 | |||
| 1211 | Ga0157371_10006599 | |||
| 1212 | Ga0157371_10009522 | |||
| 1213 | Ga0157371_10012029 | |||
| 1214 | Ga0157371_10012639 | |||
| 1215 | Ga0157371_10013867 | |||
| 1216 | Ga0157371_10017864 | |||
| 1217 | Ga0157371_10033090 | |||
| 1218 | Ga0157371_10061732 | |||
| 1219 | Ga0157371_10174696 | |||
| 1220 | Ga0157370_10000319 | |||
| 1221 | Ga0157370_10000621 | |||
| 1222 | Ga0157370_10001966 | |||
| 1223 | Ga0157370_10005125 | |||
| 1224 | Ga0157370_10013929 | |||
| 1225 | Ga0157370_10024532 | |||
| 1226 | Ga0157370_10035255 | |||
| 1227 | Ga0157370_10040907 | |||
| 1228 | Ga0157370_10237753 | |||
| 1229 | Ga0157369_10006884 | |||
| 1230 | Ga0157369_10053658 | |||
| 1231 | Ga0157369_10164553 | |||
| 1232 | Ga0157374_10000001 | |||
| 1233 | Ga0157374_10023176 | |||
| 1234 | Ga0157374_10038227 | |||
| 1235 | Ga0157374_10067964 | |||
| 1236 | Ga0157374_10101461 | |||
| 1237 | Ga0157378_10003535 | |||
| 1238 | Ga0157378_10011371 | |||
| 1239 | Ga0157378_10015702 | |||
| 1240 | Ga0157378_10044560 | |||
| 1241 | Ga0157378_10080891 | |||
| 1242 | Ga0157378_10226075 | |||
| 1243 | Ga0163162_10000524 | |||
| 1244 | Ga0163162_10000840 | |||
| 1245 | Ga0163162_10001778 | |||
| 1246 | Ga0163162_10001883 | |||
| 1247 | Ga0163162_10003204 | |||
| 1248 | Ga0163162_10005597 | |||
| 1249 | Ga0163162_10005731 | |||
| 1250 | Ga0163162_10010470 | |||
| 1251 | Ga0163162_10012063 | |||
| 1252 | Ga0163162_10017061 | |||
| 1253 | Ga0163162_10166527 | |||
| 1254 | Ga0157372_10001226 | |||
| 1255 | Ga0157372_10005928 | |||
| 1256 | Ga0157372_10019675 | |||
| 1257 | Ga0157372_10022141 | |||
| 1258 | Ga0157372_10036250 | |||
| 1259 | Ga0157372_10038003 | |||
| 1260 | Ga0157372_10038401 | |||
| 1261 | Ga0157372_10047139 | |||
| 1262 | Ga0157372_10074087 | |||
| 1263 | Ga0157372_10086437 | |||
| 1264 | Ga0157372_10111404 | |||
| 1265 | Ga0157372_10130669 | |||
| 1266 | Ga0157372_10154925 | |||
| 1267 | Ga0157372_10194077 | |||
| 1268 | Ga0157372_10296251 | |||
| 1269 | Ga0157372_10392658 | |||
| 1270 | Ga0157375_10004232 | |||
| 1271 | Ga0157375_10005528 | |||
| 1272 | Ga0157375_10006502 | |||
| 1273 | Ga0157375_10023857 | |||
| 1274 | Ga0157375_10025764 | |||
| 1275 | Ga0157375_10110693 | |||
| 1276 | Ga0157375_10131982 | |||
| 1277 | Ga0157375_10244304 | |||
| 1278 | Ga0163163_10000332 | |||
| 1279 | Ga0163163_10000407 | |||
| 1280 | Ga0163163_10109811 | |||
| 1281 | Ga0163163_10217980 | |||
| 1282 | Ga0163163_10253065 | |||
| 1283 | Ga0157380_10001567 | |||
| 1284 | Ga0157380_10002076 | |||
| 1285 | Ga0157380_10004048 | |||
| 1286 | Ga0157380_10022571 | |||
| 1287 | Ga0157380_10034929 | |||
| 1288 | Ga0157380_10041792 | |||
| 1289 | Ga0157380_10064388 | |||
| 1290 | Ga0157380_10071237 | |||
| 1291 | Ga0157377_10004234 | |||
| 1292 | Ga0157377_10045316 | |||
| 1293 | Ga0157379_10000340 | |||
| 1294 | Ga0157379_10032196 | |||
| 1295 | Ga0157379_10069083 | |||
| 1296 | Ga0157379_10078430 | |||
| 1297 | Ga0157379_10108069 | |||
| 1298 | Ga0157376_10001605 | |||
| 1299 | Ga0157376_10003155 | |||
| 1300 | Ga0157376_10012276 | |||
| 1301 | Ga0157376_10017890 | |||
| 1302 | Ga0157376_10019002 | |||
| 1303 | Ga0157376_10037870 | |||
| 1304 | Ga0182005_1000023 | |||
| 1305 | Ga0163161_10000823 | |||
| 1306 | Ga0213876_10000584 | |||
| 1307 | Ga0213876_10002362 | |||
| 1308 | Ga0209258_100068 | |||
| 1309 | Ga0209646_1000025 | |||
| 1310 | Ga0209646_1001893 | |||
| 1311 | Ga0209026_1000097 | |||
| 1312 | Ga0209148_1000343 | |||
| 1313 | Ga0209673_1000403 | |||
| 1314 | Ga0209676_1000564 | |||
| 1315 | Ga0209564_1009069 | |||
| 1316 | Ga0209758_1001939 | |||
| 1317 | Ga0209758_1023582 | |||
| 1318 | Ga0209050_1000136 | |||
| 1319 | Ga0207426_1000002 | |||
| 1320 | Ga0207426_1000164 | |||
| 1321 | Ga0207426_1000220 | |||
| 1322 | Ga0207426_1000543 | |||
| 1323 | Ga0207426_1030313 | |||
| 1324 | Ga0209257_1000025 | |||
| 1325 | Ga0209257_1002647 | |||
| 1326 | Ga0207656_10002336 | |||
| 1327 | Ga0207656_10019561 | |||
| 1328 | Ga0207656_10070388 | |||
| 1329 | Ga0207642_10034382 | |||
| 1330 | Ga0207642_10076630 | |||
| 1331 | Ga0207710_10008776 | |||
| 1332 | Ga0207688_10119833 | |||
| 1333 | Ga0207680_10000619 | |||
| 1334 | Ga0207680_10020374 | |||
| 1335 | Ga0207647_10012039 | |||
| 1336 | Ga0207647_10013257 | |||
| 1337 | Ga0207647_10044871 | |||
| 1338 | Ga0207645_10000378 | |||
| 1339 | Ga0207645_10000763 | |||
| 1340 | Ga0207645_10084313 | |||
| 1341 | Ga0207643_10001933 | |||
| 1342 | Ga0207643_10002437 | |||
| 1343 | Ga0207705_10000717 | |||
| 1344 | Ga0207705_10002776 | |||
| 1345 | Ga0207705_10055536 | |||
| 1346 | Ga0207705_10110743 | |||
| 1347 | Ga0207654_10000775 | |||
| 1348 | Ga0207654_10005854 | |||
| 1349 | Ga0207654_10032775 | |||
| 1350 | Ga0207707_10000323 | |||
| 1351 | Ga0207707_10020931 | |||
| 1352 | Ga0207707_10190794 | |||
| 1353 | Ga0207707_10220986 | |||
| 1354 | Ga0207695_10000023 | |||
| 1355 | Ga0207695_10000031 | |||
| 1356 | Ga0207695_10000110 | |||
| 1357 | Ga0207695_10000151 | |||
| 1358 | Ga0207695_10005271 | |||
| 1359 | Ga0207695_10017407 | |||
| 1360 | Ga0207695_10018132 | |||
| 1361 | Ga0207695_10043735 | |||
| 1362 | Ga0207695_10065212 | |||
| 1363 | Ga0207695_10077325 | |||
| 1364 | Ga0207671_10000149 | |||
| 1365 | Ga0207671_10001536 | |||
| 1366 | Ga0207671_10002088 | |||
| 1367 | Ga0207671_10002513 | |||
| 1368 | Ga0207671_10005116 | |||
| 1369 | Ga0207671_10006479 | |||
| 1370 | Ga0207671_10047911 | |||
| 1371 | Ga0207660_10012104 | |||
| 1372 | Ga0207662_10030759 | |||
| 1373 | Ga0207657_10005727 | |||
| 1374 | Ga0207657_10011956 | |||
| 1375 | Ga0207657_10072488 | |||
| 1376 | Ga0207657_10094429 | |||
| 1377 | Ga0207649_10077560 | |||
| 1378 | Ga0207649_10145606 | |||
| 1379 | Ga0207652_10000132 | |||
| 1380 | Ga0207652_10000713 | |||
| 1381 | Ga0207652_10017662 | |||
| 1382 | Ga0207681_10019898 | |||
| 1383 | Ga0207694_10011872 | |||
| 1384 | Ga0207650_10070537 | |||
| 1385 | Ga0207659_10032682 | |||
| 1386 | Ga0207659_10037741 | |||
| 1387 | Ga0207644_10038614 | |||
| 1388 | Ga0207644_10097004 | |||
| 1389 | Ga0207690_10013324 | |||
| 1390 | Ga0207690_10028354 | |||
| 1391 | Ga0207706_10005229 | |||
| 1392 | Ga0207706_10009726 | |||
| 1393 | Ga0207706_10012289 | |||
| 1394 | Ga0207706_10013804 | |||
| 1395 | Ga0207706_10041013 | |||
| 1396 | Ga0207706_10094724 | |||
| 1397 | Ga0207686_10038744 | |||
| 1398 | Ga0207670_10048750 | |||
| 1399 | Ga0207670_10083764 | |||
| 1400 | Ga0207670_10119845 | |||
| 1401 | Ga0207704_10005264 | |||
| 1402 | Ga0207704_10034464 | |||
| 1403 | Ga0207691_10000227 | |||
| 1404 | Ga0207691_10013965 | |||
| 1405 | Ga0207691_10062119 | |||
| 1406 | Ga0207691_10096532 | |||
| 1407 | Ga0207691_10103237 | |||
| 1408 | Ga0207689_10002045 | |||
| 1409 | Ga0207689_10003446 | |||
| 1410 | Ga0207689_10003531 | |||
| 1411 | Ga0207689_10004234 | |||
| 1412 | Ga0207689_10011373 | |||
| 1413 | Ga0207689_10025901 | |||
| 1414 | Ga0207689_10056715 | |||
| 1415 | Ga0207689_10143286 | |||
| 1416 | Ga0207661_10045478 | |||
| 1417 | Ga0207661_10109524 | |||
| 1418 | Ga0207661_10120246 | |||
| 1419 | Ga0207679_10003970 | |||
| 1420 | Ga0207679_10102601 | |||
| 1421 | Ga0207679_10157092 | |||
| 1422 | Ga0207667_10000144 | |||
| 1423 | Ga0207667_10004138 | |||
| 1424 | Ga0207667_10005340 | |||
| 1425 | Ga0207667_10023124 | |||
| 1426 | Ga0207667_10039915 | |||
| 1427 | Ga0207667_10052787 | |||
| 1428 | Ga0207651_10002380 | |||
| 1429 | Ga0207651_10018126 | |||
| 1430 | Ga0207651_10075712 | |||
| 1431 | Ga0207651_10145571 | |||
| 1432 | Ga0207712_10003315 | |||
| 1433 | Ga0207712_10007921 | |||
| 1434 | Ga0207712_10008082 | |||
| 1435 | Ga0207712_10014895 | |||
| 1436 | Ga0207712_10032658 | |||
| 1437 | Ga0207712_10070570 | |||
| 1438 | Ga0207712_10120156 | |||
| 1439 | Ga0207712_10290390 | |||
| 1440 | Ga0207668_10000679 | |||
| 1441 | Ga0207668_10008809 | |||
| 1442 | Ga0207668_10038350 | |||
| 1443 | Ga0207668_10083481 | |||
| 1444 | Ga0207668_10132718 | |||
| 1445 | Ga0207640_10119688 | |||
| 1446 | Ga0207640_10202917 | |||
| 1447 | Ga0207640_10213358 | |||
| 1448 | Ga0207658_10000176 | |||
| 1449 | Ga0207658_10081045 | |||
| 1450 | Ga0207658_10097445 | |||
| 1451 | Ga0207677_10026360 | |||
| 1452 | Ga0207677_10200572 | |||
| 1453 | Ga0207703_10000433 | |||
| 1454 | Ga0207703_10003126 | |||
| 1455 | Ga0207703_10274415 | |||
| 1456 | Ga0207639_10010289 | |||
| 1457 | Ga0207639_10134275 | |||
| 1458 | Ga0207639_10226161 | |||
| 1459 | Ga0207702_10040374 | |||
| 1460 | Ga0207702_10083529 | |||
| 1461 | Ga0207702_10164195 | |||
| 1462 | Ga0207702_10282799 | |||
| 1463 | Ga0207641_10000226 | |||
| 1464 | Ga0207641_10012826 | |||
| 1465 | Ga0207641_10014131 | |||
| 1466 | Ga0207641_10135852 | |||
| 1467 | Ga0207648_10003768 | |||
| 1468 | Ga0207648_10007506 | |||
| 1469 | Ga0207648_10013131 | |||
| 1470 | Ga0207648_10040889 | |||
| 1471 | Ga0207648_10047172 | |||
| 1472 | Ga0207648_10057857 | |||
| 1473 | Ga0207676_10001240 | |||
| 1474 | Ga0207676_10013461 | |||
| 1475 | Ga0207676_10020222 | |||
| 1476 | Ga0207676_10038784 | |||
| 1477 | Ga0207676_10046530 | |||
| 1478 | Ga0207676_10048482 | |||
| 1479 | Ga0207674_10005115 | |||
| 1480 | Ga0207674_10006654 | |||
| 1481 | Ga0207674_10015073 | |||
| 1482 | Ga0207674_10017055 | |||
| 1483 | Ga0207674_10017645 | |||
| 1484 | Ga0207674_10031117 | |||
| 1485 | Ga0207674_10122929 | |||
| 1486 | Ga0207674_10137166 | |||
| 1487 | Ga0207674_10167353 | |||
| 1488 | Ga0207675_100008068 | |||
| 1489 | Ga0207675_100057429 | |||
| 1490 | Ga0207675_100089718 | |||
| 1491 | Ga0207675_100139676 | |||
| 1492 | Ga0207675_100280555 | |||
| 1493 | Ga0207683_10001455 | |||
| 1494 | Ga0207683_10100585 | |||
| 1495 | Ga0207683_10120369 | |||
| 1496 | Ga0207683_10163987 | |||
| 1497 | Ga0207683_10177500 | |||
| 1498 | Ga0207698_10002228 | |||
| 1499 | Ga0207698_10004129 | |||
| 1500 | Ga0207698_10029722 | |||
| 1501 | Ga0207698_10033022 | |||
| 1502 | Ga0207698_10104374 | |||
| 1503 | Ga0207698_10130927 | |||
| 1504 | Ga0207698_10193103 | |||
| 1505 | Ga0207698_10195203 | |||
| 1506 | Ga0207698_10268755 | |||
| 1507 | Ga0207698_10286375 | |||
| 1508 | Ga0207428_10138124 | |||
| 1509 | Ga0207428_10191013 | |||
| 1510 | Ga0268266_10000049 | |||
| 1511 | Ga0268266_10011164 | |||
| 1512 | Ga0268266_10018579 | |||
| 1513 | Ga0268265_10011975 | |||
| 1514 | Ga0268265_10039803 | |||
| 1515 | Ga0268264_10000041 | |||
| 1516 | Ga0268264_10002959 | |||
| 1517 | Ga0268264_10006197 | |||
| 1518 | Ga0268264_10009695 | |||
| 1519 | Ga0268264_10017026 | |||
| 1520 | Ga0268264_10086619 | |||
| 1521 | Ga0268264_10140300 | |||
| 1522 | Ga0268264_10217134 | |||
| 1523 | Ga0265334_10044384 | |||
| 1524 | Ga0265323_10001043 | |||
| 1525 | Ga0307517_10002168 | |||
| 1526 | Ga0307515_10000001 | |||
| 1527 | Ga0307515_10000469 | |||
| 1528 | Ga0307515_10001093 | |||
| 1529 | Ga0307515_10130111 | |||
| 1530 | Ga0307511_10000139 | |||
| 1531 | Ga0316179_1031295 | |||
| 1532 | Ga0265327_10000197 | |||
| 1533 | Ga0265327_10000248 | |||
| 1534 | Ga0265327_10000272 | |||
| 1535 | Ga0265327_10000344 | |||
| 1536 | Ga0265327_10007740 | |||
| 1537 | Ga0265316_10000989 | |||
| 1538 | Ga0265316_10011439 | |||
| 1539 | Ga0307509_10025149 | |||
| 1540 | Ga0307509_10231184 | |||
| 1541 | Ga0265313_10032946 | |||
| 1542 | Ga0307508_10067215 | |||
| 1543 | Ga0307508_10122302 | |||
| 1544 | Ga0307514_10015943 | |||
| 1545 | Ga0265342_10043284 | |||
| 1546 | Ga0316576_10098873 | |||
| 1547 | Ga0307516_10001339 | |||
| 1548 | Ga0307516_10048026 | |||
| 1549 | Ga0307405_10058628 | |||
| 1550 | Ga0307412_10058409 | |||
| 1551 | Ga0307409_100219993 | |||
| 1552 | Ga0307416_100096360 | |||
| 1553 | Ga0307416_100221109 | |||
| 1554 | Ga0307414_10000080 | |||
| 1555 | Ga0307414_10014853 | |||
| 1556 | Ga0307414_10228856 | |||
| 1557 | Ga0307411_10002742 | |||
| 1558 | Ga0307415_100036116 | |||
| 1559 | Ga0307510_10048530 | |||
| 1560 | Ga0316588_1023036 | |||
| 1561 | Ga0373933_0120653 | |||
| 1562 | Ga0373937_0132909 | |||
| 1563 | Ga0373937_0278049 | |||
| 1564 | Ga0395899_0006685 | |||
| 1565 | Ga0395899_0011397 | |||
| 1566 | Ga0395899_0057450 | |||
| 1567 | Ga0395900_0007443 | |||
| 1568 | Ga0395900_0040022 | |||
| 1569 | Ga0395900_0064927 | |||
| 1570 | Ga0395900_0145350 | |||
| 1571 | Ga0395898_0002124 | |||
| 1572 | Ga0395898_0002566 | |||
| 1573 | Ga0395905_0000003 | |||
| 1574 | Ga0395905_0001098 | |||
| 1575 | Ga0395905_0010903 | |||
| 1576 | Ga0395905_0104734 | |||
| 1577 | Ga0395901_0001075 | |||
| 1578 | Ga0395901_0010128 | |||
| 1579 | Ga0395901_0034989 | |||
| 1580 | Ga0395901_0041287 | |||
| 1581 | Ga0395901_0177080 | |||
| 1582 | Ga0395901_0317988 | |||
| 1583 | Ga0436365_0585774 | |||
| 1584 | Ga0436365_0678933 | |||
| 1585 | Ga0436365_1029016 | |||
| 1586 | Ga0436365_1894125 | |||
| 1587 | Ga0451833_1482918 | |||
| 1588 | Ga0439431_0000240 | |||
| 1589 | Ga0439445_0005873 | |||
| 1590 | Ga0439449_0000099 | |||
| 1591 | Ga0439457_000696 | |||
| 1592 | Ga0439462_0000918 | |||
| 1593 | Ga0451577_0000452 | |||
| 1594 | Ga0466969_0000238 | |||
| 1595 | Ga0466972_0000003 | |||
| 1596 | Ga0466972_0000039 | |||
| 1597 | Ga0453683_0065909 | |||
| 1598 | Ga0466966_0000136 | |||
| 1599 | Ga0466964_0012435 | |||
| 1600 | Ga0453684_0033978 | |||
| 1601 | Ga0453684_0092446 | |||
| 1602 | Ga0453684_0257288 | |||
| 1603 | Ga0466970_0000460 | |||
| 1604 | Ga0466970_0015787 | |||
| 1605 | Ga0466970_0056323 | |||
| 1606 | Ga0466957_0001467 | |||
| 1607 | Ga0466957_0096749 | |||
| 1608 | Ga0466959_0000002 | |||
| 1609 | Ga0466959_0044378 | |||
| 1610 | Ga0466959_0229430 | |||
| 1611 | Ga0495627_013728 | |||
| 1612 | Ga0495629_0236814 | |||
| 1613 | Ga0495638_0039053 | |||
| 1614 | Ga0495638_0040748 | |||
| 1615 | Ga0495651_0157060 | |||
| 1616 | Ga0495594_0138503 | |||
| 1617 | Ga0495606_0002871 | |||
| 1618 | Ga0495606_0090956 | |||
| 1619 | Ga0495628_0011990 | |||
| 1620 | Ga0495630_0051189 | |||
| 1621 | Ga0495643_0039118 | |||
| 1622 | Ga0495633_0000774 | |||
| 1623 | Ga0495668_0000310 | |||
| 1624 | Ga0495668_0000751 | |||
| 1625 | Ga0495668_0001166 | |||
| 1626 | Ga0495611_0000316 | |||
| 1627 | Ga0495658_0004160 | |||
| 1628 | Ga0495636_0000138 | |||
| 1629 | Ga0495687_000001 | |||
| 1630 | Ga0495686_0000004 | |||
| 1631 | Ga0495686_0000595 | |||
| 1632 | Ga0496104_0188665 | |||
| 1633 | Ga0496108_0256381 | |||
| 1634 | Ga0496110_0070127 | |||
| 1635 | Ga0496114_0000439 | |||
| 1636 | Ga0496114_0248159 | |||
| 1637 | Ga0496121_0000010 | |||
| 1638 | Ga0496125_0000443 | |||
| 1639 | Ga0496126_0095277 | |||
| 1640 | Ga0501319_002049 | |||
| 1641 | Ga0501031_0008920 | |||
| 1642 | Ga0501032_0071251 | |||
| 1643 | Ga0501032_0108954 | |||
| 1644 | Ga0501033_0075824 | |||
| 1645 | Ga0501033_0255734 | |||
| 1646 | Ga0501034_0000277 | |||
| 1647 | Ga0501034_0009006 | |||
| 1648 | Ga0501034_0009656 | |||
| 1649 | Ga0501034_0024994 | |||
| 1650 | Ga0501034_0025394 | |||
| 1651 | Ga0501034_0052389 | |||
| 1652 | Ga0501034_0066202 | |||
| 1653 | Ga0501034_0193412 | |||
| 1654 | Ga0501036_0095881 | |||
| 1655 | Ga0501036_0098463 | |||
| 1656 | Ga0501037_0013639 | |||
| 1657 | Ga0501037_0040682 | |||
| 1658 | Ga0501037_0083724 | |||
| 1659 | Ga0501038_0035496 | |||
| 1660 | Ga0501038_0173163 | |||
| 1661 | Ga0501043_0013312 | |||
| 1662 | Ga0501043_0148836 | |||
| 1663 | Ga0501047_0019100 | |||
| 1664 | Ga0501047_0038244 | |||
| 1665 | Ga0501047_0192609 | |||
| 1666 | Ga0501069_0013494 | |||
| 1667 | Ga0501073_0003496 | |||
| 1668 | Ga0501202_002713 | |||
| 1669 | Ga0501207_011727 | |||
| 1670 | Ga0501235_004888 | |||
| 1671 | Ga0501236_000375 | |||
| 1672 | Ga0501242_003333 | |||
| 1673 | Ga0501252_000726 | |||
| 1674 | Ga0501219_001064 | |||
| 1675 | Ga0501221_000433 | |||
| 1676 | Ga0501225_0028234 | |||
| 1677 | Ga0501234_006306 | |||
| 1678 | Ga0501080_0141640 | |||
| 1679 | Ga0501080_0224180 | |||
| 1680 | Ga0501080_0244120 | |||
| 1681 | Ga0501241_000078 | |||
| 1682 | Ga0501241_000560 | |||
| 1683 | Ga0501266_006658 | |||
| 1684 | Ga0501035_0033293 | |||
| 1685 | Ga0501035_0037822 | |||
| 1686 | Ga0501035_0074981 | |||
| 1687 | Ga0501035_0092700 | |||
| 1688 | Ga0501035_0176330 | |||
| 1689 | Ga0501044_0064792 | |||
| 1690 | Ga0501044_0065167 | |||
| 1691 | Ga0501044_0069714 | |||
| 1692 | Ga0501044_0218251 | |||
| 1693 | Ga0501044_0328652 | |||
| 1694 | Ga0501284_00011 | |||
| 1695 | Ga0501284_00565 | |||
| 1696 | nmdc:mga0k408_32148_c1 | |||
| 1697 | nmdc:mga0k408_54335_c1 | |||
| 1698 | nmdc:mga05p37_1503_c1 | |||
| 1699 | nmdc:mga09592_137274_c1 | |||
| 1700 | nmdc:mga09592_8593_c1 | |||
| 1701 | nmdc:mga06r32_98436_c1 | |||
| 1702 | nmdc:mga08y16_24983_c1 | |||
| 1703 | nmdc:mga08y16_95741_c1 | |||
| 1704 | Ga0495619_0020579 | |||
| 1705 | Ga0500578_0000034 | |||
| 1706 | Ga0500644_0000475 | |||
| 1707 | Ga0500644_0007039 | |||
| 1708 | Ga0500646_0010394 | |||
| 1709 | Ga0500583_0002199 | |||
| 1710 | Ga0500583_0047440 | |||
| 1711 | Ga0500641_0000188 | |||
| 1712 | Ga0500641_0012559 | |||
| 1713 | Ga0500562_000077 | |||
| 1714 | Ga0500562_000935 | |||
| 1715 | Ga0500569_000194 | |||
| 1716 | Ga0500642_0067126 | |||
| 1717 | Ga0500652_012467 | |||
| 1718 | Ga0500658_0005885 | |||
| 1719 | Ga0500559_0012611 | |||
| 1720 | Ga0500559_0015288 | |||
| 1721 | Ga0500568_0002131 | |||
| 1722 | Ga0500568_0039990 | |||
| 1723 | Ga0500573_0054826 | |||
| 1724 | Ga0500589_032472 | |||
| 1725 | Ga0500589_037593 | |||
| 1726 | Ga0500604_0000511 | |||
| 1727 | Ga0500604_0006844 | |||
| 1728 | Ga0500616_0002819 | |||
| 1729 | Ga0500616_0006055 | |||
| 1730 | Ga0500622_0000014 | |||
| 1731 | Ga0500622_0000020 | |||
| 1732 | Ga0500622_0000725 | |||
| 1733 | Ga0500622_0001543 | |||
| 1734 | Ga0500622_0020151 | |||
| 1735 | Ga0500634_0031992 | |||
| 1736 | Ga0500636_0020568 | |||
| 1737 | Ga0500636_0026467 | |||
| 1738 | Ga0500611_000031 | |||
| 1739 | Ga0501084_0058451 | |||
| 1740 | Ga0500661_000526 | |||
| 1741 | Ga0466962_0011997 | |||
| 1742 | 2522548210 | |||
| 1743 | 2738727080 | |||
| 1744 | 2817415207 | |||
| 1745 | 2819572431 | |||
| 1746 | 2819590748 | |||
| 1747 | 2819680595 | |||
| 1748 | 2821140200 | |||
| 1749 | 2833642984 | |||
| 1750 | 2840677769 | |||
| 1751 | 2881956394 | |||
| 1752 | 2883071100 | |||
| 1753 | 2884634894 | |||
| 1754 | 2884797980 | |||
| 1755 | 2890807304 | |||
| 1756 | 2896085587 | |||
| 1757 | 2896113791 | |||
| 1758 | 2904472323 | |||
| 1759 | 2911143019 | |||
| 1760 | 2914761826 | |||
| 1761 | 2919510987 | |||
| 1762 | 2919693138 | |||
| 1763 | 2929157771 | |||
| 1764 | 2929182886 | |||
| 1765 | 2929245018 | |||
| 1766 | 2929927293 | |||
| 1767 | 2945978841 | |||
| 1768 | 2946015293 | |||
| 1769 | 8003151177 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mel-assembly1.cif.gz_B | succinyl-coa synthase from campylobacter jejuni | 0.9387 | 1 | 403 |
| 6mel-assembly1.cif.gz_B | succinyl-coa synthase from campylobacter jejuni | 0.9364 | 1 | 403 |
| 6no6-assembly1.cif.gz_B | k46be&k114bd mutant atp-grasp fold of blastocystis hominis succinyl-coa synthetase | 0.9346 | 1 | 236 |
| 6no3-assembly1.cif.gz_B | adp bound to v113bl mutant atp-grasp fold of blastocystis hominis succinyl-coa synthetase | 0.9324 | 1 | 236 |
| 6no0-assembly1.cif.gz_B | adp bound to atp-grasp fold of blastocystis hominis succinyl-coa synthetase | 0.9319 | 1 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4xx0B01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9703 | 123 | 256 | 3.30.470.20 |
| af_Q2FZ37_21_104_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9573 | 21 | 113 | 3.30.470.20 |
| 3ufxE01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9449 | 1 | 250 | 3.30.470.20 |
| 1jkjB01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9437 | 119 | 256 | 3.30.470.20 |
| af_P53312_51_141_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9341 | 21 | 116 | 3.30.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520AIY0-F1-model_v4 | Succinate--CoA ligase subunit beta (EC 6.2.1.5) | 0.982 | 1 | 267 |
GO:0004775
GO:0005524 GO:0005829 GO:0006099 GO:0006104 GO:0042709 |
| AF-A0A520AIY0-F1-model_v4 | Succinate--CoA ligase subunit beta (EC 6.2.1.5) | 0.9783 | 1 | 267 |
GO:0004775
GO:0005524 GO:0005829 GO:0006099 GO:0006104 GO:0042709 |
| AF-A0A382W310-F1-model_v4 | ATP-grasp domain-containing protein | 0.9763 | 1 | 256 |
GO:0004775
GO:0005524 GO:0005829 GO:0006099 GO:0006104 GO:0042709 GO:0046872 |
| AF-A0A7V3AH90-F1-model_v4 | Succinate--CoA ligase subunit beta (EC 6.2.1.5) | 0.9728 | 148 | 257 |
GO:0004775
GO:0005829 GO:0006099 GO:0006104 GO:0042709 |
| AF-A0A382W310-F1-model_v4 | ATP-grasp domain-containing protein | 0.9723 | 1 | 256 |
GO:0004775
GO:0005524 GO:0005829 GO:0006099 GO:0006104 GO:0042709 GO:0046872 |