F484642

General Info

Members Datasets Scaffolds Average Seq Length
884 413 1768 123

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0278086|Ga0496126_0278086_117_479
Length 120
Sequence MSQARSDTIRAIFASYRANDRNAVEAALTDDFRFTSPYDDALDKATYFERCWSVGWIEQQDIEKIFVEGDEAFVTYRCVAKGGKSFRNTEFFRFEGDRVKSIEVYFGAAYQDGVFVSQLK

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
236 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
237 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
238 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
239 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
255 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
256 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
283 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
284 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
296 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
304 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
305 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
319 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
320 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
321 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
337 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
338 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
339 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
340 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
341 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
346 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
347 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
353 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
354 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
355 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
362 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
363 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
366 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
367 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
368 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
369 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
370 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
371 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
372 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
373 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
374 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
375 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
376 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
377 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
378 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
379 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
380 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
381 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
382 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
383 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
384 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
385 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
386 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
387 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
388 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
389 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
390 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
391 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
392 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
393 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
394 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
395 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
396 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
397 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
398 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
399 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
400 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
401 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
402 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
403 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
404 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
405 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
406 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
407 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
408 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
409 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
410 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
411 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
412 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
413 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.25
Nodule 0.34
Rhizoplane 4.41
Rhizosphere 74.21
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0278086 3300048929 Bacteria 1387
2 JGI24744J21845_10043530 3300002077 Bacteria 836
3 JGI25404J52841_10053545 3300003659 Bacteria 847
4 Ga0070676_10102702 3300005328 Bacteria 1769
5 Ga0070683_100014532 3300005329 Bacteria 6891
6 Ga0070690_100320967 3300005330 Bacteria 1116
7 Ga0070670_100892181 3300005331 Bacteria 806
8 Ga0068869_100073753 3300005334 Bacteria 2531
9 Ga0070666_10111183 3300005335 Bacteria 1895
10 Ga0070666_10626139 3300005335 Bacteria 786
11 Ga0070666_11212691 3300005335 Bacteria 562
12 Ga0070680_100056302 3300005336 Bacteria 3214
13 Ga0068868_100071036 3300005338 Bacteria 2776
14 Ga0068868_101130448 3300005338 Bacteria 722
15 Ga0068868_101481752 3300005338 Bacteria 635
16 Ga0070660_100038114 3300005339 Bacteria 3647
17 Ga0070660_100323778 3300005339 Bacteria 1267
18 Ga0070689_100419948 3300005340 Unclassified 1133
19 Ga0070691_10067451 3300005341 Bacteria 1731
20 Ga0070687_100973402 3300005343 Bacteria 613
21 Ga0070661_100243690 3300005344 Bacteria 1385
22 Ga0070661_100738726 3300005344 Bacteria 804
23 Ga0070661_101024571 3300005344 Bacteria 685
24 Ga0070668_100026449 3300005347 Bacteria 4403
25 Ga0070668_100085277 3300005347 Bacteria 2482
26 Ga0070668_100097377 3300005347 Bacteria 2326
27 Ga0070668_100692124 3300005347 Bacteria 898
28 Ga0070669_100203006 3300005353 Bacteria 1561
29 Ga0070669_100472287 3300005353 Bacteria 1037
30 Ga0070675_100451557 3300005354 Bacteria 1153
31 Ga0070671_100238270 3300005355 Bacteria 1544
32 Ga0070671_100467478 3300005355 Bacteria 1083
33 Ga0070674_100018587 3300005356 Bacteria 4398
34 Ga0070674_100578969 3300005356 Bacteria 946
35 Ga0070674_100707462 3300005356 Bacteria 862
36 Ga0070673_100163417 3300005364 Bacteria 1895
37 Ga0070673_102138876 3300005364 Bacteria 532
38 Ga0070659_100028575 3300005366 Bacteria 4308
39 Ga0070659_100075124 3300005366 Bacteria 2693
40 Ga0070659_100364362 3300005366 Bacteria 1215
41 Ga0070667_100119710 3300005367 Bacteria 2290
42 Ga0070667_100531094 3300005367 Bacteria 1080
43 Ga0070667_101097795 3300005367 Bacteria 744
44 Ga0070709_10078603 3300005434 Bacteria 2147
45 Ga0070714_100415465 3300005435 Bacteria 1274
46 Ga0070713_100009306 3300005436 Bacteria 7023
47 Ga0070713_100288211 3300005436 Bacteria 1508
48 Ga0070710_10094767 3300005437 Bacteria 1767
49 Ga0070710_10823431 3300005437 Bacteria 665
50 Ga0070701_10605472 3300005438 Bacteria 726
51 Ga0070711_100379102 3300005439 Unclassified 1143
52 Ga0070700_100290777 3300005441 Bacteria 1189
53 Ga0070700_100421517 3300005441 Bacteria 1009
54 Ga0070700_100830463 3300005441 Bacteria 747
55 Ga0070663_100026089 3300005455 Bacteria 3953
56 Ga0070663_100073751 3300005455 Bacteria 2490
57 Ga0070663_100477610 3300005455 Bacteria 1031
58 Ga0070663_100513994 3300005455 Unclassified 996
59 Ga0070663_100933789 3300005455 Bacteria 751
60 Ga0070663_101291039 3300005455 Bacteria 644
61 Ga0070678_100175261 3300005456 Bacteria 1750
62 Ga0070678_100602979 3300005456 Bacteria 980
63 Ga0070678_100816301 3300005456 Bacteria 848
64 Ga0070662_100151366 3300005457 Bacteria 1806
65 Ga0070662_100234066 3300005457 Bacteria 1471
66 Ga0070681_10012465 3300005458 Bacteria 8435
67 Ga0070681_10017662 3300005458 Bacteria 7129
68 Ga0070681_10518198 3300005458 Bacteria 1105
69 Ga0070681_10977428 3300005458 Bacteria 766
70 Ga0068867_100274671 3300005459 Bacteria 1380
71 Ga0070698_100863586 3300005471 Bacteria 850
72 Ga0070679_100027556 3300005530 Bacteria 5593
73 Ga0070684_100078687 3300005535 Bacteria 2913
74 Ga0070684_100344182 3300005535 Bacteria 1371
75 Ga0070697_102136865 3300005536 Bacteria 501
76 Ga0068853_100003590 3300005539 Bacteria 11880
77 Ga0068853_100083821 3300005539 Bacteria 2793
78 Ga0068853_100435990 3300005539 Bacteria 1231
79 Ga0070672_100036650 3300005543 Bacteria 3738
80 Ga0070686_100079732 3300005544 Bacteria 2165
81 Ga0070686_100331646 3300005544 Bacteria 1137
82 Ga0070686_101398508 3300005544 Bacteria 587
83 Ga0070696_100645116 3300005546 Bacteria 858
84 Ga0070696_101518108 3300005546 Bacteria 574
85 Ga0070693_100418360 3300005547 Bacteria 933
86 Ga0070693_101145915 3300005547 Bacteria 595
87 Ga0070693_101666310 3300005547 Bacteria 502
88 Ga0070665_100045230 3300005548 Bacteria 4421
89 Ga0070665_100443448 3300005548 Bacteria 1307
90 Ga0070704_102297365 3300005549 Bacteria 502
91 Ga0068855_100007494 3300005563 Bacteria 13211
92 Ga0068855_100392383 3300005563 Bacteria 1522
93 Ga0068855_100651876 3300005563 Bacteria 1131
94 Ga0070664_100260739 3300005564 Bacteria 1560
95 Ga0070664_100889207 3300005564 Bacteria 835
96 Ga0070664_102225320 3300005564 Bacteria 520
97 Ga0068857_100046709 3300005577 Bacteria 3843
98 Ga0068857_100220672 3300005577 Bacteria 1732
99 Ga0068857_100491513 3300005577 Bacteria 1151
100 Ga0068857_101434558 3300005577 Bacteria 672
101 Ga0068854_100353313 3300005578 Bacteria 1204
102 Ga0068856_100192600 3300005614 Bacteria 2053
103 Ga0068856_100480897 3300005614 Bacteria 1263
104 Ga0068856_100621304 3300005614 Unclassified 1101
105 Ga0070702_101844266 3300005615 Bacteria 506
106 Ga0068852_100753655 3300005616 Bacteria 986
107 Ga0068852_100793222 3300005616 Bacteria 961
108 Ga0068859_100106589 3300005617 Bacteria 2862
109 Ga0068859_101164787 3300005617 Bacteria 849
110 Ga0068859_102152315 3300005617 Bacteria 616
111 Ga0068864_100031862 3300005618 Bacteria 4475
112 Ga0068864_100077689 3300005618 Bacteria 2904
113 Ga0068864_100743496 3300005618 Bacteria 961
114 Ga0068864_100805047 3300005618 Bacteria 924
115 Ga0068866_10037646 3300005718 Bacteria 2377
116 Ga0068866_10112487 3300005718 Bacteria 1522
117 Ga0068861_100305165 3300005719 Bacteria 1380
118 Ga0068861_100385529 3300005719 Bacteria 1239
119 Ga0068851_10028246 3300005834 Bacteria 2771
120 Ga0068851_10203580 3300005834 Bacteria 1106
121 Ga0068851_10318836 3300005834 Bacteria 897
122 Ga0068870_10252515 3300005840 Bacteria 1094
123 Ga0068863_100182124 3300005841 Bacteria 2016
124 Ga0068863_100646810 3300005841 Bacteria 1048
125 Ga0068863_101412933 3300005841 Bacteria 704
126 Ga0068858_100119536 3300005842 Bacteria 2463
127 Ga0068858_100169173 3300005842 Bacteria 2060
128 Ga0068858_100676302 3300005842 Bacteria 1004
129 Ga0068860_100004713 3300005843 Bacteria 13912
130 Ga0068860_100078497 3300005843 Bacteria 3139
131 Ga0068860_100251398 3300005843 Bacteria 1721
132 Ga0068860_100655432 3300005843 Bacteria 1058
133 Ga0068860_101059559 3300005843 Bacteria 830
134 Ga0068860_102320506 3300005843 Bacteria 557
135 Ga0068862_100092622 3300005844 Bacteria 2634
136 Ga0068862_101391834 3300005844 Bacteria 705
137 Ga0081455_10085152 3300005937 Bacteria 2578
138 Ga0081540_1001339 3300005983 Bacteria 21460
139 Ga0081540_1007993 3300005983 Bacteria 7446
140 Ga0081540_1052992 3300005983 Bacteria 1993
141 Ga0081540_1085712 3300005983 Bacteria 1402
142 Ga0070717_10000460 3300006028 Bacteria 25862
143 Ga0070717_10210029 3300006028 Unclassified 1708
144 Ga0070717_10752152 3300006028 Bacteria 886
145 Ga0070717_11110947 3300006028 Bacteria 720
146 Ga0075365_10016437 3300006038 Bacteria 4501
147 Ga0075365_10126190 3300006038 Bacteria 1768
148 Ga0075365_10252729 3300006038 Bacteria 1239
149 Ga0075365_11073538 3300006038 Bacteria 567
150 Ga0075368_10060713 3300006042 Bacteria 1513
151 Ga0075363_100014770 3300006048 Bacteria 3825
152 Ga0075363_100086862 3300006048 Bacteria 1718
153 Ga0075363_100474583 3300006048 Bacteria 741
154 Ga0075364_10058712 3300006051 Bacteria 2521
155 Ga0075364_10122169 3300006051 Bacteria 1744
156 Ga0075364_10140369 3300006051 Bacteria 1625
157 Ga0075364_10573042 3300006051 Bacteria 771
158 Ga0075364_11062067 3300006051 Bacteria 550
159 Ga0070715_10116317 3300006163 Bacteria 1268
160 Ga0070716_100034174 3300006173 Bacteria 2786
161 Ga0070716_100060413 3300006173 Bacteria 2189
162 Ga0070716_100150037 3300006173 Bacteria 1498
163 Ga0070716_100181211 3300006173 Unclassified 1383
164 Ga0070716_100298043 3300006173 Bacteria 1120
165 Ga0070716_100734151 3300006173 Bacteria 758
166 Ga0070712_100086935 3300006175 Bacteria 2279
167 Ga0070712_100183171 3300006175 Bacteria 1633
168 Ga0070712_101154218 3300006175 Bacteria 673
169 Ga0070712_101750274 3300006175 Unclassified 544
170 Ga0075362_10101680 3300006177 Bacteria 1345
171 Ga0075362_10462199 3300006177 Bacteria 646
172 Ga0075367_10072501 3300006178 Bacteria 2073
173 Ga0075367_10075171 3300006178 Bacteria 2037
174 Ga0075367_10164022 3300006178 Bacteria 1382
175 Ga0075367_10187014 3300006178 Bacteria 1292
176 Ga0075367_10270827 3300006178 Bacteria 1067
177 Ga0075367_10344378 3300006178 Bacteria 940
178 Ga0075369_10025724 3300006186 Bacteria 2450
179 Ga0075369_10032572 3300006186 Bacteria 2206
180 Ga0075369_10438016 3300006186 Bacteria 618
181 Ga0075366_10032034 3300006195 Bacteria 3094
182 Ga0075366_10054475 3300006195 Bacteria 2375
183 Ga0075366_10157772 3300006195 Bacteria 1374
184 Ga0075366_10263622 3300006195 Bacteria 1052
185 Ga0097621_100170504 3300006237 Bacteria 1876
186 Ga0097621_100185351 3300006237 Bacteria 1800
187 Ga0097621_100425989 3300006237 Bacteria 1192
188 Ga0097621_100691123 3300006237 Bacteria 939
189 Ga0097621_101085690 3300006237 Bacteria 751
190 Ga0075370_10020322 3300006353 Bacteria 3627
191 Ga0075370_10213801 3300006353 Bacteria 1139
192 Ga0075370_10353964 3300006353 Bacteria 877
193 Ga0075370_10599194 3300006353 Bacteria 667
194 Ga0068871_100104460 3300006358 Bacteria 2376
195 Ga0075428_100157112 3300006844 Bacteria 2469
196 Ga0075430_101210096 3300006846 Bacteria 622
197 Ga0075433_11308546 3300006852 Bacteria 628
198 Ga0075434_102490514 3300006871 Bacteria 519
199 Ga0075429_100558738 3300006880 Bacteria 1003
200 Ga0068865_100147919 3300006881 Bacteria 1779
201 Ga0097620_100106590 3300006931 Bacteria 2862
202 Ga0097620_101164826 3300006931 Bacteria 849
203 Ga0097620_102152131 3300006931 Bacteria 616
204 Ga0099794_10154805 3300007265 Bacteria 1164
205 Ga0099795_10002812 3300007788 Bacteria 4192
206 Ga0099795_10146457 3300007788 Bacteria 964
207 Ga0099795_10287041 3300007788 Bacteria 720
208 Ga0099795_10603796 3300007788 Bacteria 522
209 Ga0105240_10127518 3300009093 Bacteria 3056
210 Ga0105240_10233006 3300009093 Bacteria 2139
211 Ga0111539_10071397 3300009094 Bacteria 4097
212 Ga0111539_11171060 3300009094 Bacteria 893
213 Ga0105245_10060551 3300009098 Bacteria 3410
214 Ga0105245_10763409 3300009098 Bacteria 1003
215 Ga0105245_10886101 3300009098 Bacteria 934
216 Ga0105245_11250528 3300009098 Bacteria 791
217 Ga0105245_12009239 3300009098 Bacteria 632
218 Ga0105247_10201145 3300009101 Bacteria 1339
219 Ga0105247_10330818 3300009101 Bacteria 1066
220 Ga0105247_10408036 3300009101 Bacteria 970
221 Ga0105247_10465856 3300009101 Unclassified 914
222 Ga0105247_10489070 3300009101 Bacteria 894
223 Ga0114129_10273370 3300009147 Bacteria 2260
224 Ga0105243_10517890 3300009148 Bacteria 1134
225 Ga0105243_10964930 3300009148 Bacteria 852
226 Ga0105241_10012915 3300009174 Bacteria 6127
227 Ga0105242_10035582 3300009176 Bacteria 3993
228 Ga0105242_11160151 3300009176 Bacteria 790
229 Ga0105248_10185620 3300009177 Bacteria 2343
230 Ga0105248_10309220 3300009177 Bacteria 1780
231 Ga0105248_10330051 3300009177 Bacteria 1718
232 Ga0105248_11299240 3300009177 Bacteria 823
233 Ga0105237_10026579 3300009545 Bacteria 5916
234 Ga0105237_10088453 3300009545 Bacteria 3087
235 Ga0105237_10195982 3300009545 Bacteria 2020
236 Ga0105237_10201813 3300009545 Unclassified 1989
237 Ga0105237_10886306 3300009545 Bacteria 899
238 Ga0105237_11244927 3300009545 Bacteria 751
239 Ga0105237_12260263 3300009545 Bacteria 554
240 Ga0105238_10001743 3300009551 Bacteria 21842
241 Ga0105238_10259172 3300009551 Bacteria 1718
242 Ga0105249_10311478 3300009553 Bacteria 1583
243 Ga0105249_10412499 3300009553 Bacteria 1383
244 Ga0105249_10442293 3300009553 Bacteria 1337
245 Ga0105249_11338769 3300009553 Bacteria 788
246 Ga0099796_10009289 3300010159 Bacteria 2656
247 Ga0099796_10019927 3300010159 Bacteria 2041
248 Ga0099796_10030195 3300010159 Bacteria 1756
249 Ga0099796_10292698 3300010159 Bacteria 688
250 Ga0105239_10198152 3300010375 Bacteria 2249
251 Ga0105239_10490363 3300010375 Bacteria 1396
252 Ga0105239_10599445 3300010375 Unclassified 1256
253 Ga0105239_10679480 3300010375 Bacteria 1177
254 Ga0105239_10943337 3300010375 Bacteria 991
255 Ga0105246_10137707 3300011119 Bacteria 1832
256 Ga0105246_10336991 3300011119 Bacteria 1231
257 Ga0105246_10427790 3300011119 Bacteria 1107
258 Ga0105246_11435624 3300011119 Bacteria 645
259 Ga0105246_11557312 3300011119 Bacteria 623
260 Ga0157373_11595094 3300013100 Bacteria 500
261 Ga0157370_10026904 3300013104 Bacteria 5674
262 Ga0157370_10089660 3300013104 Bacteria 2888
263 Ga0157369_10016812 3300013105 Bacteria 8222
264 Ga0157374_10066182 3300013296 Bacteria 3396
265 Ga0157374_10574029 3300013296 Bacteria 1137
266 Ga0157378_10249042 3300013297 Bacteria 1700
267 Ga0157378_12600850 3300013297 Bacteria 558
268 Ga0163162_10216696 3300013306 Bacteria 2044
269 Ga0163162_10253894 3300013306 Bacteria 1890
270 Ga0163162_10264093 3300013306 Unclassified 1853
271 Ga0163162_10304071 3300013306 Bacteria 1727
272 Ga0163162_10369010 3300013306 Bacteria 1568
273 Ga0163162_10824983 3300013306 Bacteria 1044
274 Ga0163162_11670432 3300013306 Bacteria 727
275 Ga0157372_10393620 3300013307 Bacteria 1615
276 Ga0157375_10051920 3300013308 Bacteria 4029
277 Ga0157375_10252458 3300013308 Bacteria 1925
278 Ga0157375_10681913 3300013308 Bacteria 1182
279 Ga0157375_10896567 3300013308 Bacteria 1031
280 Ga0157375_11404423 3300013308 Bacteria 822
281 Ga0157375_11423589 3300013308 Bacteria 817
282 Ga0163163_10019817 3300014325 Bacteria 6326
283 Ga0163163_10105432 3300014325 Bacteria 2844
284 Ga0163163_10998564 3300014325 Bacteria 900
285 Ga0163163_12005022 3300014325 Bacteria 638
286 Ga0157380_10350002 3300014326 Bacteria 1382
287 Ga0157377_10081100 3300014745 Bacteria 1897
288 Ga0157377_10175628 3300014745 Bacteria 1343
289 Ga0157377_10378830 3300014745 Bacteria 957
290 Ga0157379_10063034 3300014968 Bacteria 3315
291 Ga0157379_10073749 3300014968 Bacteria 3055
292 Ga0157379_10093533 3300014968 Bacteria 2697
293 Ga0157379_10368141 3300014968 Bacteria 1318
294 Ga0157379_11738764 3300014968 Bacteria 612
295 Ga0157376_10892649 3300014969 Bacteria 906
296 Ga0157376_11179941 3300014969 Bacteria 793
297 Ga0163161_10058695 3300017792 Bacteria 2797
298 Ga0163161_10205747 3300017792 Bacteria 1518
299 Ga0163161_10938335 3300017792 Bacteria 735
300 Ga0163161_11399503 3300017792 Bacteria 611
301 Ga0213876_10322465 3300021384 Unclassified 821
302 Ga0213875_10460600 3300021388 Bacteria 609
303 Ga0209455_1001472 3300025272 Bacteria 10597
304 Ga0209758_1008851 3300025297 Bacteria 6405
305 Ga0207426_1029849 3300025302 Bacteria 1794
306 Ga0207697_10457948 3300025315 Bacteria 565
307 Ga0207692_10022084 3300025898 Bacteria 2924
308 Ga0207692_10184403 3300025898 Bacteria 1218
309 Ga0207692_10348456 3300025898 Bacteria 912
310 Ga0207692_10369846 3300025898 Bacteria 888
311 Ga0207642_10175212 3300025899 Bacteria 1164
312 Ga0207642_10214957 3300025899 Bacteria 1071
313 Ga0207642_10412032 3300025899 Bacteria 811
314 Ga0207710_10010195 3300025900 Bacteria 3953
315 Ga0207710_10035311 3300025900 Bacteria 2200
316 Ga0207710_10139436 3300025900 Bacteria 1170
317 Ga0207710_10238140 3300025900 Unclassified 907
318 Ga0207688_10069330 3300025901 Bacteria 1998
319 Ga0207688_10711141 3300025901 Bacteria 635
320 Ga0207680_10404148 3300025903 Bacteria 965
321 Ga0207680_10600745 3300025903 Bacteria 787
322 Ga0207647_10371401 3300025904 Bacteria 808
323 Ga0207647_10457144 3300025904 Bacteria 715
324 Ga0207685_10160775 3300025905 Bacteria 1025
325 Ga0207699_10034416 3300025906 Bacteria 2874
326 Ga0207699_10039242 3300025906 Bacteria 2719
327 Ga0207699_10471173 3300025906 Bacteria 903
328 Ga0207645_10316973 3300025907 Bacteria 1040
329 Ga0207643_10078550 3300025908 Bacteria 1909
330 Ga0207643_10246612 3300025908 Bacteria 1099
331 Ga0207705_10068983 3300025909 Bacteria 2560
332 Ga0207684_10988611 3300025910 Bacteria 704
333 Ga0207684_11078289 3300025910 Bacteria 669
334 Ga0207684_11448153 3300025910 Bacteria 561
335 Ga0207654_10014746 3300025911 Bacteria 4042
336 Ga0207654_10209517 3300025911 Bacteria 1287
337 Ga0207707_10001016 3300025912 Bacteria 26912
338 Ga0207707_10011000 3300025912 Bacteria 7874
339 Ga0207695_10211608 3300025913 Bacteria 1849
340 Ga0207695_10497098 3300025913 Bacteria 1102
341 Ga0207671_10031884 3300025914 Bacteria 3924
342 Ga0207671_10083323 3300025914 Bacteria 2401
343 Ga0207671_10244774 3300025914 Unclassified 1409
344 Ga0207671_10472851 3300025914 Bacteria 999
345 Ga0207693_10003327 3300025915 Bacteria 13757
346 Ga0207693_10009325 3300025915 Bacteria 8001
347 Ga0207693_10910633 3300025915 Bacteria 674
348 Ga0207663_10208349 3300025916 Bacteria 1415
349 Ga0207663_10256906 3300025916 Bacteria 1288
350 Ga0207660_10000924 3300025917 Bacteria 19378
351 Ga0207660_10973326 3300025917 Bacteria 692
352 Ga0207662_10052511 3300025918 Bacteria 2426
353 Ga0207657_10001391 3300025919 Bacteria 25799
354 Ga0207649_10802845 3300025920 Bacteria 735
355 Ga0207652_10003893 3300025921 Bacteria 12209
356 Ga0207652_10201418 3300025921 Bacteria 1791
357 Ga0207681_10174619 3300025923 Bacteria 1631
358 Ga0207681_10404589 3300025923 Bacteria 1103
359 Ga0207681_10469410 3300025923 Bacteria 1026
360 Ga0207681_11246197 3300025923 Bacteria 625
361 Ga0207694_10140020 3300025924 Bacteria 1945
362 Ga0207694_10327856 3300025924 Bacteria 1264
363 Ga0207650_10287566 3300025925 Bacteria 1340
364 Ga0207659_10133706 3300025926 Bacteria 1918
365 Ga0207687_10064946 3300025927 Bacteria 2590
366 Ga0207687_10183360 3300025927 Bacteria 1623
367 Ga0207700_10010911 3300025928 Bacteria 5768
368 Ga0207700_10221839 3300025928 Bacteria 1603
369 Ga0207700_10222161 3300025928 Bacteria 1602
370 Ga0207700_10351919 3300025928 Bacteria 1283
371 Ga0207664_10345711 3300025929 Bacteria 1316
372 Ga0207664_11447293 3300025929 Bacteria 608
373 Ga0207644_10054113 3300025931 Bacteria 2890
374 Ga0207644_10416586 3300025931 Bacteria 1100
375 Ga0207690_10106984 3300025932 Bacteria 2008
376 Ga0207690_10254619 3300025932 Bacteria 1358
377 Ga0207690_10329602 3300025932 Bacteria 1202
378 Ga0207706_10020636 3300025933 Bacteria 5921
379 Ga0207706_10195270 3300025933 Bacteria 1776
380 Ga0207686_10115229 3300025934 Bacteria 1820
381 Ga0207686_10188613 3300025934 Bacteria 1468
382 Ga0207686_10292320 3300025934 Bacteria 1207
383 Ga0207686_10440704 3300025934 Bacteria 1000
384 Ga0207709_10291620 3300025935 Bacteria 1209
385 Ga0207709_10685728 3300025935 Bacteria 819
386 Ga0207670_10039211 3300025936 Bacteria 3101
387 Ga0207670_10283796 3300025936 Bacteria 1291
388 Ga0207669_10007035 3300025937 Bacteria 5176
389 Ga0207669_10206535 3300025937 Bacteria 1430
390 Ga0207669_10459105 3300025937 Bacteria 1011
391 Ga0207704_10062027 3300025938 Bacteria 2322
392 Ga0207704_10107720 3300025938 Bacteria 1875
393 Ga0207665_10023296 3300025939 Bacteria 4078
394 Ga0207665_10415679 3300025939 Bacteria 1027
395 Ga0207665_10480806 3300025939 Bacteria 957
396 Ga0207665_10523112 3300025939 Bacteria 919
397 Ga0207665_11136232 3300025939 Bacteria 623
398 Ga0207691_10103322 3300025940 Bacteria 2541
399 Ga0207711_10252138 3300025941 Bacteria 1621
400 Ga0207711_10351249 3300025941 Bacteria 1365
401 Ga0207711_10916214 3300025941 Bacteria 815
402 Ga0207689_10083915 3300025942 Bacteria 2619
403 Ga0207689_10248168 3300025942 Bacteria 1472
404 Ga0207689_10971869 3300025942 Bacteria 716
405 Ga0207689_11271054 3300025942 Bacteria 619
406 Ga0207661_10295436 3300025944 Bacteria 1451
407 Ga0207679_10347825 3300025945 Bacteria 1291
408 Ga0207679_10787476 3300025945 Bacteria 866
409 Ga0207679_11955076 3300025945 Bacteria 534
410 Ga0207667_10015694 3300025949 Bacteria 8591
411 Ga0207667_10050380 3300025949 Bacteria 4394
412 Ga0207667_10288959 3300025949 Bacteria 1675
413 Ga0207651_10090347 3300025960 Bacteria 2239
414 Ga0207651_10609812 3300025960 Bacteria 955
415 Ga0207712_10383314 3300025961 Bacteria 1177
416 Ga0207712_10415949 3300025961 Bacteria 1133
417 Ga0207668_10008217 3300025972 Bacteria 6216
418 Ga0207668_10048530 3300025972 Bacteria 2914
419 Ga0207668_10066449 3300025972 Bacteria 2556
420 Ga0207658_10075824 3300025986 Bacteria 2560
421 Ga0207658_11137640 3300025986 Bacteria 713
422 Ga0207658_11175266 3300025986 Bacteria 701
423 Ga0207677_10734433 3300026023 Bacteria 879
424 Ga0207677_11415412 3300026023 Bacteria 641
425 Ga0207703_10024373 3300026035 Bacteria 4761
426 Ga0207703_10193232 3300026035 Bacteria 1804
427 Ga0207703_10198119 3300026035 Bacteria 1783
428 Ga0207703_10510924 3300026035 Bacteria 1129
429 Ga0207703_12326409 3300026035 Bacteria 511
430 Ga0207639_10052318 3300026041 Bacteria 3112
431 Ga0207639_10176771 3300026041 Bacteria 1812
432 Ga0207639_11575864 3300026041 Bacteria 616
433 Ga0207678_10023509 3300026067 Bacteria 5389
434 Ga0207678_10024243 3300026067 Bacteria 5299
435 Ga0207678_10131550 3300026067 Bacteria 2135
436 Ga0207678_10406429 3300026067 Bacteria 1179
437 Ga0207678_10463112 3300026067 Bacteria 1103
438 Ga0207708_10340791 3300026075 Bacteria 1228
439 Ga0207708_11289983 3300026075 Bacteria 640
440 Ga0207702_10128251 3300026078 Bacteria 2280
441 Ga0207702_10500892 3300026078 Bacteria 1184
442 Ga0207702_10557784 3300026078 Unclassified 1121
443 Ga0207702_11259183 3300026078 Bacteria 734
444 Ga0207641_10490815 3300026088 Bacteria 1191
445 Ga0207648_10013362 3300026089 Bacteria 7642
446 Ga0207648_10164719 3300026089 Bacteria 1959
447 Ga0207676_10062764 3300026095 Bacteria 2948
448 Ga0207674_10012767 3300026116 Bacteria 9383
449 Ga0207674_10362024 3300026116 Bacteria 1402
450 Ga0207674_10988621 3300026116 Bacteria 810
451 Ga0207675_100126297 3300026118 Bacteria 2423
452 Ga0207675_100363857 3300026118 Bacteria 1419
453 Ga0207675_100830973 3300026118 Bacteria 938
454 Ga0207675_101490869 3300026118 Bacteria 697
455 Ga0207675_102690770 3300026118 Bacteria 506
456 Ga0207683_10051305 3300026121 Bacteria 3614
457 Ga0207683_10060366 3300026121 Bacteria 3333
458 Ga0207683_10187081 3300026121 Bacteria 1879
459 Ga0207683_10556221 3300026121 Bacteria 1061
460 Ga0207683_11240423 3300026121 Bacteria 691
461 Ga0207698_10251865 3300026142 Bacteria 1616
462 Ga0207698_12181885 3300026142 Bacteria 567
463 Ga0209588_1019784 3300027671 Bacteria 2105
464 Ga0209588_1075924 3300027671 Bacteria 1086
465 Ga0209813_10157219 3300027866 Bacteria 818
466 Ga0209813_10509000 3300027866 Bacteria 501
467 Ga0207428_10152765 3300027907 Bacteria 1756
468 Ga0268266_10001136 3300028379 Bacteria 33101
469 Ga0268266_10003686 3300028379 Bacteria 15118
470 Ga0268266_10219898 3300028379 Bacteria 1745
471 Ga0268266_10371417 3300028379 Bacteria 1347
472 Ga0268266_10988638 3300028379 Bacteria 814
473 Ga0268265_10546295 3300028380 Bacteria 1099
474 Ga0268265_10757522 3300028380 Bacteria 943
475 Ga0268264_10000185 3300028381 Bacteria 131374
476 Ga0268264_10178953 3300028381 Bacteria 1924
477 Ga0268264_10476435 3300028381 Bacteria 1213
478 Ga0268264_10847626 3300028381 Bacteria 915
479 Ga0268264_11514599 3300028381 Bacteria 681
480 Ga0265334_10033183 3300028573 Bacteria 2056
481 Ga0307517_10111579 3300028786 Bacteria 2077
482 Ga0307517_10485688 3300028786 Bacteria 632
483 Ga0307517_10527851 3300028786 Bacteria 595
484 Ga0307515_10319320 3300028794 Bacteria 1221
485 Ga0307515_10382353 3300028794 Bacteria 1040
486 Ga0307511_10050282 3300030521 Bacteria 3359
487 Ga0265339_10078002 3300031249 Bacteria 1755
488 Ga0307513_10630587 3300031456 Bacteria 780
489 Ga0307513_10765124 3300031456 Bacteria 671
490 Ga0307513_10860286 3300031456 Bacteria 613
491 Ga0307509_10043196 3300031507 Bacteria 4879
492 Ga0307509_10071585 3300031507 Bacteria 3615
493 Ga0307509_10131294 3300031507 Bacteria 2460
494 Ga0307509_10799316 3300031507 Bacteria 608
495 Ga0307509_10862684 3300031507 Bacteria 570
496 Ga0307408_100364159 3300031548 Bacteria 1231
497 Ga0307408_101432447 3300031548 Bacteria 651
498 Ga0307508_10000012 3300031616 Bacteria 243167
499 Ga0307508_10183205 3300031616 Bacteria 1696
500 Ga0307508_10195551 3300031616 Bacteria 1624
501 Ga0307508_10625269 3300031616 Bacteria 680
502 Ga0307516_10026118 3300031730 Bacteria 5937
503 Ga0307516_10071216 3300031730 Bacteria 3338
504 Ga0307516_10178435 3300031730 Bacteria 1859
505 Ga0307516_10305701 3300031730 Bacteria 1265
506 Ga0307410_10563118 3300031852 Bacteria 946
507 Ga0307406_11527195 3300031901 Bacteria 588
508 Ga0307412_11287564 3300031911 Bacteria 658
509 Ga0307416_102360383 3300032002 Bacteria 632
510 Ga0307416_103394221 3300032002 Bacteria 533
511 Ga0307414_10280511 3300032004 Bacteria 1400
512 Ga0307411_10621726 3300032005 Bacteria 931
513 Ga0307411_10947007 3300032005 Bacteria 768
514 Ga0307415_100229384 3300032126 Bacteria 1494
515 Ga0307415_100414292 3300032126 Bacteria 1154
516 Ga0307507_10114758 3300033179 Bacteria 2183
517 Ga0307507_10562331 3300033179 Bacteria 598
518 Ga0307510_10007562 3300033180 Bacteria 12946
519 Ga0307510_10148006 3300033180 Bacteria 1975
520 Ga0307510_10149093 3300033180 Bacteria 1963
521 Ga0307510_10426018 3300033180 Bacteria 769
522 Ga0373926_0298145 3300035083 Bacteria 629
523 Ga0373934_0035721 3300035086 Bacteria 1956
524 Ga0373923_0001382 3300035111 Bacteria 6917
525 Ga0373923_0018852 3300035111 Bacteria 2663
526 Ga0373936_0043287 3300035113 Bacteria 1809
527 Ga0373945_0034762 3300035116 Bacteria 1798
528 Ga0373953_0000985 3300035117 Bacteria 8003
529 Ga0373954_0001160 3300035118 Bacteria 10599
530 Ga0373956_0001463 3300035119 Bacteria 9760
531 Ga0373943_0029418 3300035170 Bacteria 2595
532 Ga0373946_0026036 3300035171 Bacteria 2304
533 Ga0373955_0001372 3300035172 Bacteria 10349
534 Ga0373955_0071154 3300035172 Bacteria 1945
535 Ga0373955_0281934 3300035172 Bacteria 1000
536 Ga0373924_0048356 3300035410 Bacteria 1757
537 Ga0373931_0726798 3300035691 Bacteria 657
538 Ga0373935_0000520 3300035692 Bacteria 20054
539 Ga0373927_0000046 3300035695 Bacteria 88401
540 Ga0373927_0039246 3300035695 Bacteria 3073
541 Ga0373927_0179767 3300035695 Bacteria 1388
542 Ga0373933_0019482 3300035724 Bacteria 3833
543 Ga0373947_0001392 3300035725 Bacteria 14902
544 Ga0373947_0294583 3300035725 Bacteria 1081
545 Ga0373937_0015298 3300036401 Bacteria 6784
546 Ga0373937_0048844 3300036401 Bacteria 3874
547 Ga0373925_0009905 3300037068 Bacteria 6924
548 Ga0373925_0147994 3300037068 Bacteria 1842
549 Ga0373925_0688192 3300037068 Bacteria 843
550 Ga0395905_0081461 3300037471 Bacteria 3033
551 Ga0395901_0279019 3300038443 Bacteria 1736
552 Ga0436365_0258063 3300039437 Bacteria 1152
553 Ga0439465_0153328 3300041413 Bacteria 824
554 Ga0451791_1145889 3300041451 Bacteria 595
555 Ga0451800_0483909 3300041459 Bacteria 1085
556 Ga0451833_0965397 3300041491 Bacteria 699
557 Ga0451841_0946185 3300041498 Bacteria 504
558 Ga0451853_1498009 3300041512 Bacteria 738
559 Ga0451853_2499407 3300041512 Bacteria 702
560 Ga0495617_144149 3300046452 Bacteria 759
561 Ga0495592_0001238 3300046454 Bacteria 17695
562 Ga0495592_0036407 3300046454 Bacteria 3707
563 Ga0495603_0000051 3300046455 Bacteria 50402
564 Ga0495603_0053535 3300046455 Bacteria 2394
565 Ga0495603_0199197 3300046455 Bacteria 1157
566 Ga0495590_0118414 3300046457 Bacteria 948
567 Ga0495629_0000182 3300046459 Bacteria 56655
568 Ga0495629_0000750 3300046459 Bacteria 26239
569 Ga0495629_1052476 3300046459 Bacteria 528
570 Ga0495638_0021430 3300046460 Bacteria 4259
571 Ga0495638_0313958 3300046460 Bacteria 840
572 Ga0495641_0006374 3300046461 Bacteria 7658
573 Ga0495651_0080866 3300046462 Bacteria 2453
574 Ga0495653_0014575 3300046463 Bacteria 6416
575 Ga0495653_0390270 3300046463 Bacteria 887
576 Ga0495650_0219665 3300046471 Bacteria 655
577 Ga0495650_0220847 3300046471 Bacteria 653
578 Ga0495580_0004021 3300046472 Bacteria 12411
579 Ga0495580_0652689 3300046472 Bacteria 692
580 Ga0495582_0000137 3300046473 Bacteria 39425
581 Ga0495605_0075741 3300046474 Bacteria 1582
582 Ga0495605_0165343 3300046474 Bacteria 980
583 Ga0495639_0002873 3300046475 Bacteria 7493
584 Ga0495662_0000583 3300046476 Bacteria 16810
585 Ga0495664_0009075 3300046477 Bacteria 5560
586 Ga0495664_0648518 3300046477 Bacteria 626
587 Ga0495584_0097003 3300046491 Bacteria 1489
588 Ga0495584_0434820 3300046491 Bacteria 667
589 Ga0495585_0081939 3300046492 Bacteria 1747
590 Ga0495585_0433426 3300046492 Bacteria 630
591 Ga0495594_0001833 3300046499 Bacteria 11057
592 Ga0495594_0070484 3300046499 Bacteria 1943
593 Ga0495594_0133143 3300046499 Bacteria 1408
594 Ga0495596_0139113 3300046500 Bacteria 943
595 Ga0495596_0434709 3300046500 Bacteria 512
596 Ga0495607_0515914 3300046501 Bacteria 528
597 Ga0495606_0230654 3300046507 Bacteria 1038
598 Ga0495606_0319973 3300046507 Bacteria 834
599 Ga0495608_0020960 3300046511 Bacteria 4488
600 Ga0495610_0243781 3300046512 Bacteria 715
601 Ga0495616_0449890 3300046513 Bacteria 522
602 Ga0495618_0016660 3300046514 Bacteria 4501
603 Ga0495618_0087705 3300046514 Bacteria 1990
604 Ga0495618_0355628 3300046514 Bacteria 902
605 Ga0495620_0213462 3300046515 Bacteria 740
606 Ga0495628_0021321 3300046516 Bacteria 5332
607 Ga0495628_0034008 3300046516 Bacteria 4103
608 Ga0495630_0002625 3300046517 Bacteria 12446
609 Ga0495631_0244859 3300046518 Bacteria 764
610 Ga0495632_0055923 3300046519 Bacteria 1930
611 Ga0495632_0101059 3300046519 Bacteria 1359
612 Ga0495632_0220312 3300046519 Bacteria 858
613 Ga0495632_0326698 3300046519 Bacteria 677
614 Ga0495637_0244249 3300046520 Bacteria 648
615 Ga0495643_0096011 3300046522 Bacteria 1524
616 Ga0495643_0254922 3300046522 Bacteria 817
617 Ga0495644_0036932 3300046523 Bacteria 1843
618 Ga0495644_0064041 3300046523 Bacteria 1382
619 Ga0495644_0110850 3300046523 Bacteria 1041
620 Ga0495644_0161120 3300046523 Bacteria 860
621 Ga0495648_0001119 3300046524 Bacteria 27174
622 Ga0495648_0091446 3300046524 Bacteria 1702
623 Ga0495648_0118789 3300046524 Bacteria 1425
624 Ga0495648_0221551 3300046524 Bacteria 932
625 Ga0495663_0265713 3300046525 Bacteria 612
626 Ga0495666_0063168 3300046526 Bacteria 1768
627 Ga0495652_0037670 3300046529 Bacteria 4194
628 Ga0495665_0001239 3300046531 Bacteria 13612
629 Ga0495665_0555899 3300046531 Bacteria 576
630 Ga0495640_0004375 3300046533 Bacteria 11274
631 Ga0495640_0701848 3300046533 Bacteria 607
632 Ga0495598_0040996 3300046537 Bacteria 1353
633 Ga0495598_0053787 3300046537 Bacteria 1221
634 Ga0495598_0155839 3300046537 Bacteria 800
635 Ga0495609_0074119 3300046538 Bacteria 1493
636 Ga0495609_0198959 3300046538 Bacteria 838
637 Ga0495621_0059482 3300046539 Bacteria 1384
638 Ga0495597_0204020 3300046542 Bacteria 791
639 Ga0495645_0138086 3300046543 Bacteria 1703
640 Ga0495645_0973542 3300046543 Bacteria 500
641 Ga0495622_0005490 3300046557 Bacteria 5879
642 Ga0495622_0016785 3300046557 Bacteria 3410
643 Ga0495622_0127518 3300046557 Bacteria 1160
644 Ga0495622_0196546 3300046557 Bacteria 900
645 Ga0495633_0143423 3300046558 Bacteria 1104
646 Ga0495667_0011352 3300046559 Bacteria 6031
647 Ga0495667_0014203 3300046559 Bacteria 5377
648 Ga0495656_0016955 3300046615 Bacteria 2772
649 Ga0495656_0040582 3300046615 Bacteria 1940
650 Ga0495656_0115887 3300046615 Bacteria 1259
651 Ga0495656_0174123 3300046615 Bacteria 1054
652 Ga0495668_0029734 3300046616 Bacteria 3086
653 Ga0495668_0052320 3300046616 Bacteria 2260
654 Ga0495668_0072435 3300046616 Bacteria 1893
655 Ga0495668_0108203 3300046616 Bacteria 1520
656 Ga0495668_0584661 3300046616 Bacteria 617
657 Ga0495634_0002221 3300046642 Bacteria 16276
658 Ga0495634_0025310 3300046642 Bacteria 4155
659 Ga0495611_0392762 3300046648 Bacteria 634
660 Ga0495625_0333445 3300046660 Bacteria 963
661 Ga0495635_0001455 3300046663 Bacteria 15846
662 Ga0495635_0002383 3300046663 Bacteria 12797
663 Ga0495659_0168839 3300046664 Bacteria 886
664 Ga0495661_0407531 3300046665 Bacteria 660
665 Ga0495588_0007336 3300046674 Bacteria 5012
666 Ga0495588_0027904 3300046674 Bacteria 2823
667 Ga0495657_0004131 3300046675 Bacteria 11623
668 Ga0495623_0282221 3300046679 Bacteria 923
669 Ga0495646_0019980 3300046680 Bacteria 4235
670 Ga0495646_0048867 3300046680 Bacteria 2569
671 Ga0495647_0020010 3300046681 Bacteria 2399
672 Ga0495658_0008017 3300046683 Bacteria 5231
673 Ga0495669_0007993 3300046684 Bacteria 4439
674 Ga0495669_0092413 3300046684 Bacteria 1398
675 Ga0495669_0271394 3300046684 Bacteria 815
676 Ga0495669_0411578 3300046684 Bacteria 656
677 Ga0495613_0047965 3300046689 Bacteria 3154
678 Ga0495613_0591950 3300046689 Bacteria 739
679 Ga0495624_0000898 3300046690 Bacteria 23624
680 Ga0495624_0057040 3300046690 Bacteria 2456
681 Ga0495624_0254050 3300046690 Bacteria 1063
682 Ga0495670_0039207 3300046691 Bacteria 2362
683 Ga0495671_0068625 3300046692 Bacteria 1743
684 Ga0495671_0312816 3300046692 Bacteria 755
685 Ga0495649_0394575 3300046694 Bacteria 695
686 Ga0495589_0204065 3300046794 Bacteria 932
687 Ga0495600_0011474 3300046809 Bacteria 5522
688 Ga0495600_0012921 3300046809 Bacteria 5233
689 Ga0495581_0007805 3300047315 Bacteria 6197
690 Ga0495581_0642791 3300047315 Bacteria 613
691 Ga0495604_0013331 3300047317 Bacteria 6545
692 Ga0495604_0176387 3300047317 Bacteria 1498
693 Ga0495636_0091236 3300047318 Bacteria 1323
694 Ga0495636_0259766 3300047318 Bacteria 805
695 Ga0495674_0010092 3300047319 Bacteria 8948
696 Ga0495674_0034564 3300047319 Bacteria 4571
697 Ga0495672_0025981 3300047320 Bacteria 3742
698 Ga0495672_0162104 3300047320 Bacteria 1149
699 Ga0495672_0417741 3300047320 Bacteria 610
700 Ga0495676_0035661 3300047321 Bacteria 4159
701 Ga0495676_0085005 3300047321 Bacteria 2385
702 Ga0495676_0105143 3300047321 Bacteria 2082
703 Ga0495680_0129838 3300047322 Bacteria 1853
704 Ga0495680_0166754 3300047322 Bacteria 1596
705 Ga0495683_0107267 3300047323 Bacteria 1337
706 Ga0495675_0075686 3300047444 Bacteria 2121
707 Ga0495685_158124 3300047447 Bacteria 735
708 Ga0495673_0342522 3300047469 Bacteria 529
709 Ga0495684_0000643 3300047471 Bacteria 28074
710 Ga0495684_0045864 3300047471 Bacteria 3344
711 Ga0495686_0186699 3300047472 Bacteria 1197
712 Ga0495593_0000469 3300047673 Bacteria 22695
713 Ga0495593_0006819 3300047673 Bacteria 6685
714 Ga0495602_0155711 3300048088 Bacteria 1789
715 Ga0495602_0896825 3300048088 Unclassified 590
716 Ga0495614_0001926 3300048089 Bacteria 9106
717 Ga0496101_0168174 3300048904 Unclassified 1684
718 Ga0496102_0148673 3300048905 Bacteria 2200
719 Ga0496102_0213312 3300048905 Bacteria 1820
720 Ga0496102_0473772 3300048905 Bacteria 1173
721 Ga0496102_0611106 3300048905 Bacteria 1013
722 Ga0496102_0657915 3300048905 Bacteria 971
723 Ga0496103_0510572 3300048906 Bacteria 769
724 Ga0496104_0051923 3300048907 Bacteria 3871
725 Ga0496104_0116018 3300048907 Bacteria 2570
726 Ga0496105_0000208 3300048908 Bacteria 39305
727 Ga0496105_0471400 3300048908 Bacteria 989
728 Ga0496105_1176689 3300048908 Bacteria 566
729 Ga0496106_0002121 3300048909 Bacteria 14838
730 Ga0496106_0158975 3300048909 Bacteria 1786
731 Ga0496106_0198998 3300048909 Bacteria 1594
732 Ga0496106_0634377 3300048909 Unclassified 854
733 Ga0496107_0033519 3300048910 Bacteria 3675
734 Ga0496107_0190743 3300048910 Unclassified 1523
735 Ga0496108_0023301 3300048911 Bacteria 5093
736 Ga0496108_0320651 3300048911 Bacteria 1351
737 Ga0496109_0027672 3300048912 Bacteria 5066
738 Ga0496109_0236643 3300048912 Bacteria 1718
739 Ga0496111_0054327 3300048914 Bacteria 2895
740 Ga0496111_0356666 3300048914 Bacteria 1082
741 Ga0496111_0578547 3300048914 Bacteria 823
742 Ga0496111_0807267 3300048914 Unclassified 679
743 Ga0496112_0003971 3300048915 Bacteria 12388
744 Ga0496112_0160560 3300048915 Bacteria 2214
745 Ga0496113_0079054 3300048916 Unclassified 2517
746 Ga0496113_0192281 3300048916 Bacteria 1620
747 Ga0496113_0278216 3300048916 Bacteria 1338
748 Ga0496113_0858852 3300048916 Bacteria 719
749 Ga0496114_0047851 3300048917 Bacteria 3557
750 Ga0496114_0503192 3300048917 Bacteria 1072
751 Ga0496114_0579915 3300048917 Bacteria 990
752 Ga0496115_0833854 3300048918 Bacteria 715
753 Ga0496115_0906083 3300048918 Bacteria 680
754 Ga0496117_0008070 3300048920 Bacteria 10087
755 Ga0496118_0002570 3300048921 Bacteria 24239
756 Ga0496118_0435026 3300048921 Bacteria 671
757 Ga0496119_0111961 3300048922 Bacteria 1514
758 Ga0496119_0345573 3300048922 Bacteria 722
759 Ga0496119_0517529 3300048922 Bacteria 553
760 Ga0496121_0001125 3300048924 Bacteria 47001
761 Ga0496121_0155945 3300048924 Bacteria 1675
762 Ga0496121_0271860 3300048924 Bacteria 1164
763 Ga0496124_0001146 3300048927 Bacteria 41561
764 Ga0496124_0097944 3300048927 Bacteria 2381
765 Ga0496124_0212148 3300048927 Bacteria 1464
766 Ga0496125_0098775 3300048928 Bacteria 2159
767 Ga0496125_0282966 3300048928 Bacteria 1026
768 Ga0496125_0523158 3300048928 Bacteria 663
769 Ga0496126_0011852 3300048929 Bacteria 8969
770 Ga0496126_0033864 3300048929 Bacteria 4805
771 Ga0496126_0062247 3300048929 Bacteria 3349
772 Ga0496126_0257251 3300048929 Bacteria 1453
773 Ga0496126_0286417 3300048929 Bacteria 1363
774 Ga0496126_0348512 3300048929 Bacteria 1212
775 Ga0496126_0353182 3300048929 Bacteria 1202
776 Ga0495682_0110133 3300049460 Bacteria 987
777 Ga0501033_0388678 3300049570 Bacteria 974
778 Ga0501038_0063959 3300049574 Bacteria 3139
779 Ga0501039_0160079 3300049575 Bacteria 1769
780 Ga0501044_0604514 3300049823 Bacteria 989
781 nmdc:mga03683_177968_c1 3300050489 Bacteria 969
782 nmdc:mga03683_217060_c1 3300050489 Bacteria 881
783 nmdc:mga03683_39224_c1 3300050489 Bacteria 1938
784 nmdc:mga03n38_124409_c1 3300050490 Bacteria 1271
785 nmdc:mga03n38_12993_c1 3300050490 Bacteria 3150
786 nmdc:mga03n38_178695_c1 3300050490 Bacteria 1086
787 nmdc:mga00v17_122507_c1 3300050491 Bacteria 1657
788 nmdc:mga00v17_241812_c1 3300050491 Bacteria 1170
789 nmdc:mga00v17_628973_c1 3300050491 Bacteria 691
790 nmdc:mga00v17_668295_c1 3300050491 Bacteria 667
791 nmdc:mga00v17_86774_c1 3300050491 Bacteria 1961
792 nmdc:mga0yw44_1205040_c1 3300050492 Bacteria 511
793 nmdc:mga0yw44_286428_c1 3300050492 Bacteria 1102
794 nmdc:mga0yw44_31797_c1 3300050492 Bacteria 3071
795 nmdc:mga0yw44_5454_c2 3300050492 Bacteria 5426
796 nmdc:mga0yw44_793165_c1 3300050492 Bacteria 643
797 nmdc:mga0yw44_996035_c1 3300050492 Bacteria 567
798 nmdc:mga0k408_104327_c1 3300050493 Bacteria 1673
799 nmdc:mga0k408_264759_c1 3300050493 Bacteria 1026
800 nmdc:mga0k408_346376_c1 3300050493 Bacteria 886
801 nmdc:mga06z11_147595_c1 3300050494 Bacteria 698
802 nmdc:mga06z11_207910_c1 3300050494 Bacteria 1139
803 nmdc:mga06z11_267199_c1 3300050494 Bacteria 1011
804 nmdc:mga06z11_54727_c1 3300050494 Bacteria 2058
805 nmdc:mga06z11_654656_c1 3300050494 Bacteria 639
806 nmdc:mga06z11_8466_c1 3300050494 Bacteria 4291
807 nmdc:mga04h51_224914_c1 3300050495 Bacteria 745
808 nmdc:mga04h51_359437_c1 3300050495 Bacteria 603
809 nmdc:mga04h51_94693_c1 3300050495 Bacteria 1080
810 nmdc:mga07m45_126326_c2 3300050496 Bacteria 1074
811 nmdc:mga07m45_54052_c1 3300050496 Bacteria 2270
812 nmdc:mga05p37_228491_c1 3300050507 Bacteria 2243
813 nmdc:mga06r32_1197058_c1 3300050510 Bacteria 706
814 nmdc:mga08y16_1028348_c1 3300050511 Bacteria 802
815 nmdc:mga08y16_322099_c1 3300050511 Bacteria 1591
816 nmdc:mga0sz30_206707_c1 3300050516 Bacteria 872
817 Ga0495601_0047833 3300053077 Bacteria 2693
818 Ga0495612_0281086 3300053078 Bacteria 744
819 Ga0500635_0015817 3300053080 Bacteria 2234
820 Ga0495655_0024422 3300053083 Bacteria 1404
821 Ga0495595_0000332 3300053084 Bacteria 18218
822 Ga0495619_0000633 3300053085 Bacteria 23194
823 Ga0495619_0386961 3300053085 Bacteria 966
824 Ga0500646_0157643 3300053090 Bacteria 756
825 Ga0500583_0011788 3300053092 Bacteria 3309
826 Ga0500583_0218717 3300053092 Bacteria 945
827 Ga0500566_0000078 3300053094 Bacteria 47558
828 Ga0500566_0275722 3300053094 Bacteria 804
829 Ga0500640_000121 3300053095 Bacteria 14580
830 Ga0500641_0024457 3300053096 Bacteria 2329
831 Ga0500641_0206963 3300053096 Bacteria 836
832 Ga0500648_236018 3300053097 Bacteria 878
833 Ga0500650_0121221 3300053098 Bacteria 1219
834 Ga0500554_022998 3300053102 Bacteria 1748
835 Ga0500569_018952 3300053109 Bacteria 1785
836 Ga0500572_000170 3300053111 Bacteria 22863
837 Ga0500591_038026 3300053115 Bacteria 2302
838 Ga0500594_0075252 3300053118 Bacteria 1000
839 Ga0500595_001686 3300053119 Bacteria 11604
840 Ga0500595_004672 3300053119 Bacteria 6088
841 Ga0500595_154224 3300053119 Bacteria 641
842 Ga0500608_023056 3300053122 Bacteria 2892
843 Ga0500614_006004 3300053123 Bacteria 2551
844 Ga0500642_0008061 3300053130 Bacteria 3580
845 Ga0500642_0012158 3300053130 Bacteria 3111
846 Ga0500655_013060 3300053133 Bacteria 1514
847 Ga0500658_0094870 3300053134 Bacteria 1295
848 Ga0500559_0048045 3300053136 Bacteria 1875
849 Ga0500568_0037366 3300053139 Bacteria 1970
850 Ga0500568_0113131 3300053139 Bacteria 1014
851 Ga0500577_0027964 3300053142 Bacteria 1937
852 Ga0500589_155633 3300053147 Bacteria 925
853 Ga0500589_325558 3300053147 Bacteria 535
854 Ga0500590_091321 3300053148 Bacteria 1478
855 Ga0500603_000081 3300053150 Bacteria 22182
856 Ga0500603_001666 3300053150 Bacteria 5003
857 Ga0500627_0007990 3300053158 Bacteria 3728
858 Ga0500630_004509 3300053159 Bacteria 6772
859 Ga0500634_0188692 3300053161 Bacteria 919
860 Ga0500638_018006 3300053162 Bacteria 3289
861 Ga0500638_039456 3300053162 Bacteria 2292
862 Ga0500638_092290 3300053162 Bacteria 1424
863 Ga0500639_000028 3300053163 Bacteria 77951
864 Ga0500639_187440 3300053163 Bacteria 906
865 Ga0500636_0014860 3300053177 Bacteria 4583
866 Ga0500636_0348141 3300053177 Bacteria 708
867 Ga0500637_0020909 3300053178 Bacteria 3551
868 Ga0500637_0632110 3300053178 Bacteria 500
869 Ga0500576_151139 3300053725 Bacteria 867
870 Ga0500611_015104 3300053727 Bacteria 1362
871 Ga0500657_231834 3300053728 Bacteria 572
872 Ga0500645_038434 3300053730 Bacteria 1420
873 Ga0500645_093651 3300053730 Bacteria 851
874 Ga0500609_029640 3300053731 Bacteria 751
875 Ga0500596_002436 3300053735 Bacteria 3666
876 Ga0500596_092053 3300053735 Bacteria 538
877 Ga0500601_001222 3300053737 Bacteria 2860
878 Ga0500661_005491 3300055283 Bacteria 2367
879 Ga0500661_090012 3300055283 Bacteria 575
880 2524465864 2524023210 Bacteria 9029266
881 2876817816 2876808645 Bacteria 8824342
882 2879116808 2879110137 Bacteria 8907982
883 2885387307 2885383462 Bacteria 9473874
884 8056689809 8056681323 Bacteria 8472857
885 Ga0496126_0278086
886 JGI24744J21845_10043530
887 JGI25404J52841_10053545
888 Ga0070676_10102702
889 Ga0070683_100014532
890 Ga0070690_100320967
891 Ga0070670_100892181
892 Ga0068869_100073753
893 Ga0070666_10111183
894 Ga0070666_10626139
895 Ga0070666_11212691
896 Ga0070680_100056302
897 Ga0068868_100071036
898 Ga0068868_101130448
899 Ga0068868_101481752
900 Ga0070660_100038114
901 Ga0070660_100323778
902 Ga0070689_100419948
903 Ga0070691_10067451
904 Ga0070687_100973402
905 Ga0070661_100243690
906 Ga0070661_100738726
907 Ga0070661_101024571
908 Ga0070668_100026449
909 Ga0070668_100085277
910 Ga0070668_100097377
911 Ga0070668_100692124
912 Ga0070669_100203006
913 Ga0070669_100472287
914 Ga0070675_100451557
915 Ga0070671_100238270
916 Ga0070671_100467478
917 Ga0070674_100018587
918 Ga0070674_100578969
919 Ga0070674_100707462
920 Ga0070673_100163417
921 Ga0070673_102138876
922 Ga0070659_100028575
923 Ga0070659_100075124
924 Ga0070659_100364362
925 Ga0070667_100119710
926 Ga0070667_100531094
927 Ga0070667_101097795
928 Ga0070709_10078603
929 Ga0070714_100415465
930 Ga0070713_100009306
931 Ga0070713_100288211
932 Ga0070710_10094767
933 Ga0070710_10823431
934 Ga0070701_10605472
935 Ga0070711_100379102
936 Ga0070700_100290777
937 Ga0070700_100421517
938 Ga0070700_100830463
939 Ga0070663_100026089
940 Ga0070663_100073751
941 Ga0070663_100477610
942 Ga0070663_100513994
943 Ga0070663_100933789
944 Ga0070663_101291039
945 Ga0070678_100175261
946 Ga0070678_100602979
947 Ga0070678_100816301
948 Ga0070662_100151366
949 Ga0070662_100234066
950 Ga0070681_10012465
951 Ga0070681_10017662
952 Ga0070681_10518198
953 Ga0070681_10977428
954 Ga0068867_100274671
955 Ga0070698_100863586
956 Ga0070679_100027556
957 Ga0070684_100078687
958 Ga0070684_100344182
959 Ga0070697_102136865
960 Ga0068853_100003590
961 Ga0068853_100083821
962 Ga0068853_100435990
963 Ga0070672_100036650
964 Ga0070686_100079732
965 Ga0070686_100331646
966 Ga0070686_101398508
967 Ga0070696_100645116
968 Ga0070696_101518108
969 Ga0070693_100418360
970 Ga0070693_101145915
971 Ga0070693_101666310
972 Ga0070665_100045230
973 Ga0070665_100443448
974 Ga0070704_102297365
975 Ga0068855_100007494
976 Ga0068855_100392383
977 Ga0068855_100651876
978 Ga0070664_100260739
979 Ga0070664_100889207
980 Ga0070664_102225320
981 Ga0068857_100046709
982 Ga0068857_100220672
983 Ga0068857_100491513
984 Ga0068857_101434558
985 Ga0068854_100353313
986 Ga0068856_100192600
987 Ga0068856_100480897
988 Ga0068856_100621304
989 Ga0070702_101844266
990 Ga0068852_100753655
991 Ga0068852_100793222
992 Ga0068859_100106589
993 Ga0068859_101164787
994 Ga0068859_102152315
995 Ga0068864_100031862
996 Ga0068864_100077689
997 Ga0068864_100743496
998 Ga0068864_100805047
999 Ga0068866_10037646
1000 Ga0068866_10112487
1001 Ga0068861_100305165
1002 Ga0068861_100385529
1003 Ga0068851_10028246
1004 Ga0068851_10203580
1005 Ga0068851_10318836
1006 Ga0068870_10252515
1007 Ga0068863_100182124
1008 Ga0068863_100646810
1009 Ga0068863_101412933
1010 Ga0068858_100119536
1011 Ga0068858_100169173
1012 Ga0068858_100676302
1013 Ga0068860_100004713
1014 Ga0068860_100078497
1015 Ga0068860_100251398
1016 Ga0068860_100655432
1017 Ga0068860_101059559
1018 Ga0068860_102320506
1019 Ga0068862_100092622
1020 Ga0068862_101391834
1021 Ga0081455_10085152
1022 Ga0081540_1001339
1023 Ga0081540_1007993
1024 Ga0081540_1052992
1025 Ga0081540_1085712
1026 Ga0070717_10000460
1027 Ga0070717_10210029
1028 Ga0070717_10752152
1029 Ga0070717_11110947
1030 Ga0075365_10016437
1031 Ga0075365_10126190
1032 Ga0075365_10252729
1033 Ga0075365_11073538
1034 Ga0075368_10060713
1035 Ga0075363_100014770
1036 Ga0075363_100086862
1037 Ga0075363_100474583
1038 Ga0075364_10058712
1039 Ga0075364_10122169
1040 Ga0075364_10140369
1041 Ga0075364_10573042
1042 Ga0075364_11062067
1043 Ga0070715_10116317
1044 Ga0070716_100034174
1045 Ga0070716_100060413
1046 Ga0070716_100150037
1047 Ga0070716_100181211
1048 Ga0070716_100298043
1049 Ga0070716_100734151
1050 Ga0070712_100086935
1051 Ga0070712_100183171
1052 Ga0070712_101154218
1053 Ga0070712_101750274
1054 Ga0075362_10101680
1055 Ga0075362_10462199
1056 Ga0075367_10072501
1057 Ga0075367_10075171
1058 Ga0075367_10164022
1059 Ga0075367_10187014
1060 Ga0075367_10270827
1061 Ga0075367_10344378
1062 Ga0075369_10025724
1063 Ga0075369_10032572
1064 Ga0075369_10438016
1065 Ga0075366_10032034
1066 Ga0075366_10054475
1067 Ga0075366_10157772
1068 Ga0075366_10263622
1069 Ga0097621_100170504
1070 Ga0097621_100185351
1071 Ga0097621_100425989
1072 Ga0097621_100691123
1073 Ga0097621_101085690
1074 Ga0075370_10020322
1075 Ga0075370_10213801
1076 Ga0075370_10353964
1077 Ga0075370_10599194
1078 Ga0068871_100104460
1079 Ga0075428_100157112
1080 Ga0075430_101210096
1081 Ga0075433_11308546
1082 Ga0075434_102490514
1083 Ga0075429_100558738
1084 Ga0068865_100147919
1085 Ga0097620_100106590
1086 Ga0097620_101164826
1087 Ga0097620_102152131
1088 Ga0099794_10154805
1089 Ga0099795_10002812
1090 Ga0099795_10146457
1091 Ga0099795_10287041
1092 Ga0099795_10603796
1093 Ga0105240_10127518
1094 Ga0105240_10233006
1095 Ga0111539_10071397
1096 Ga0111539_11171060
1097 Ga0105245_10060551
1098 Ga0105245_10763409
1099 Ga0105245_10886101
1100 Ga0105245_11250528
1101 Ga0105245_12009239
1102 Ga0105247_10201145
1103 Ga0105247_10330818
1104 Ga0105247_10408036
1105 Ga0105247_10465856
1106 Ga0105247_10489070
1107 Ga0114129_10273370
1108 Ga0105243_10517890
1109 Ga0105243_10964930
1110 Ga0105241_10012915
1111 Ga0105242_10035582
1112 Ga0105242_11160151
1113 Ga0105248_10185620
1114 Ga0105248_10309220
1115 Ga0105248_10330051
1116 Ga0105248_11299240
1117 Ga0105237_10026579
1118 Ga0105237_10088453
1119 Ga0105237_10195982
1120 Ga0105237_10201813
1121 Ga0105237_10886306
1122 Ga0105237_11244927
1123 Ga0105237_12260263
1124 Ga0105238_10001743
1125 Ga0105238_10259172
1126 Ga0105249_10311478
1127 Ga0105249_10412499
1128 Ga0105249_10442293
1129 Ga0105249_11338769
1130 Ga0099796_10009289
1131 Ga0099796_10019927
1132 Ga0099796_10030195
1133 Ga0099796_10292698
1134 Ga0105239_10198152
1135 Ga0105239_10490363
1136 Ga0105239_10599445
1137 Ga0105239_10679480
1138 Ga0105239_10943337
1139 Ga0105246_10137707
1140 Ga0105246_10336991
1141 Ga0105246_10427790
1142 Ga0105246_11435624
1143 Ga0105246_11557312
1144 Ga0157373_11595094
1145 Ga0157370_10026904
1146 Ga0157370_10089660
1147 Ga0157369_10016812
1148 Ga0157374_10066182
1149 Ga0157374_10574029
1150 Ga0157378_10249042
1151 Ga0157378_12600850
1152 Ga0163162_10216696
1153 Ga0163162_10253894
1154 Ga0163162_10264093
1155 Ga0163162_10304071
1156 Ga0163162_10369010
1157 Ga0163162_10824983
1158 Ga0163162_11670432
1159 Ga0157372_10393620
1160 Ga0157375_10051920
1161 Ga0157375_10252458
1162 Ga0157375_10681913
1163 Ga0157375_10896567
1164 Ga0157375_11404423
1165 Ga0157375_11423589
1166 Ga0163163_10019817
1167 Ga0163163_10105432
1168 Ga0163163_10998564
1169 Ga0163163_12005022
1170 Ga0157380_10350002
1171 Ga0157377_10081100
1172 Ga0157377_10175628
1173 Ga0157377_10378830
1174 Ga0157379_10063034
1175 Ga0157379_10073749
1176 Ga0157379_10093533
1177 Ga0157379_10368141
1178 Ga0157379_11738764
1179 Ga0157376_10892649
1180 Ga0157376_11179941
1181 Ga0163161_10058695
1182 Ga0163161_10205747
1183 Ga0163161_10938335
1184 Ga0163161_11399503
1185 Ga0213876_10322465
1186 Ga0213875_10460600
1187 Ga0209455_1001472
1188 Ga0209758_1008851
1189 Ga0207426_1029849
1190 Ga0207697_10457948
1191 Ga0207692_10022084
1192 Ga0207692_10184403
1193 Ga0207692_10348456
1194 Ga0207692_10369846
1195 Ga0207642_10175212
1196 Ga0207642_10214957
1197 Ga0207642_10412032
1198 Ga0207710_10010195
1199 Ga0207710_10035311
1200 Ga0207710_10139436
1201 Ga0207710_10238140
1202 Ga0207688_10069330
1203 Ga0207688_10711141
1204 Ga0207680_10404148
1205 Ga0207680_10600745
1206 Ga0207647_10371401
1207 Ga0207647_10457144
1208 Ga0207685_10160775
1209 Ga0207699_10034416
1210 Ga0207699_10039242
1211 Ga0207699_10471173
1212 Ga0207645_10316973
1213 Ga0207643_10078550
1214 Ga0207643_10246612
1215 Ga0207705_10068983
1216 Ga0207684_10988611
1217 Ga0207684_11078289
1218 Ga0207684_11448153
1219 Ga0207654_10014746
1220 Ga0207654_10209517
1221 Ga0207707_10001016
1222 Ga0207707_10011000
1223 Ga0207695_10211608
1224 Ga0207695_10497098
1225 Ga0207671_10031884
1226 Ga0207671_10083323
1227 Ga0207671_10244774
1228 Ga0207671_10472851
1229 Ga0207693_10003327
1230 Ga0207693_10009325
1231 Ga0207693_10910633
1232 Ga0207663_10208349
1233 Ga0207663_10256906
1234 Ga0207660_10000924
1235 Ga0207660_10973326
1236 Ga0207662_10052511
1237 Ga0207657_10001391
1238 Ga0207649_10802845
1239 Ga0207652_10003893
1240 Ga0207652_10201418
1241 Ga0207681_10174619
1242 Ga0207681_10404589
1243 Ga0207681_10469410
1244 Ga0207681_11246197
1245 Ga0207694_10140020
1246 Ga0207694_10327856
1247 Ga0207650_10287566
1248 Ga0207659_10133706
1249 Ga0207687_10064946
1250 Ga0207687_10183360
1251 Ga0207700_10010911
1252 Ga0207700_10221839
1253 Ga0207700_10222161
1254 Ga0207700_10351919
1255 Ga0207664_10345711
1256 Ga0207664_11447293
1257 Ga0207644_10054113
1258 Ga0207644_10416586
1259 Ga0207690_10106984
1260 Ga0207690_10254619
1261 Ga0207690_10329602
1262 Ga0207706_10020636
1263 Ga0207706_10195270
1264 Ga0207686_10115229
1265 Ga0207686_10188613
1266 Ga0207686_10292320
1267 Ga0207686_10440704
1268 Ga0207709_10291620
1269 Ga0207709_10685728
1270 Ga0207670_10039211
1271 Ga0207670_10283796
1272 Ga0207669_10007035
1273 Ga0207669_10206535
1274 Ga0207669_10459105
1275 Ga0207704_10062027
1276 Ga0207704_10107720
1277 Ga0207665_10023296
1278 Ga0207665_10415679
1279 Ga0207665_10480806
1280 Ga0207665_10523112
1281 Ga0207665_11136232
1282 Ga0207691_10103322
1283 Ga0207711_10252138
1284 Ga0207711_10351249
1285 Ga0207711_10916214
1286 Ga0207689_10083915
1287 Ga0207689_10248168
1288 Ga0207689_10971869
1289 Ga0207689_11271054
1290 Ga0207661_10295436
1291 Ga0207679_10347825
1292 Ga0207679_10787476
1293 Ga0207679_11955076
1294 Ga0207667_10015694
1295 Ga0207667_10050380
1296 Ga0207667_10288959
1297 Ga0207651_10090347
1298 Ga0207651_10609812
1299 Ga0207712_10383314
1300 Ga0207712_10415949
1301 Ga0207668_10008217
1302 Ga0207668_10048530
1303 Ga0207668_10066449
1304 Ga0207658_10075824
1305 Ga0207658_11137640
1306 Ga0207658_11175266
1307 Ga0207677_10734433
1308 Ga0207677_11415412
1309 Ga0207703_10024373
1310 Ga0207703_10193232
1311 Ga0207703_10198119
1312 Ga0207703_10510924
1313 Ga0207703_12326409
1314 Ga0207639_10052318
1315 Ga0207639_10176771
1316 Ga0207639_11575864
1317 Ga0207678_10023509
1318 Ga0207678_10024243
1319 Ga0207678_10131550
1320 Ga0207678_10406429
1321 Ga0207678_10463112
1322 Ga0207708_10340791
1323 Ga0207708_11289983
1324 Ga0207702_10128251
1325 Ga0207702_10500892
1326 Ga0207702_10557784
1327 Ga0207702_11259183
1328 Ga0207641_10490815
1329 Ga0207648_10013362
1330 Ga0207648_10164719
1331 Ga0207676_10062764
1332 Ga0207674_10012767
1333 Ga0207674_10362024
1334 Ga0207674_10988621
1335 Ga0207675_100126297
1336 Ga0207675_100363857
1337 Ga0207675_100830973
1338 Ga0207675_101490869
1339 Ga0207675_102690770
1340 Ga0207683_10051305
1341 Ga0207683_10060366
1342 Ga0207683_10187081
1343 Ga0207683_10556221
1344 Ga0207683_11240423
1345 Ga0207698_10251865
1346 Ga0207698_12181885
1347 Ga0209588_1019784
1348 Ga0209588_1075924
1349 Ga0209813_10157219
1350 Ga0209813_10509000
1351 Ga0207428_10152765
1352 Ga0268266_10001136
1353 Ga0268266_10003686
1354 Ga0268266_10219898
1355 Ga0268266_10371417
1356 Ga0268266_10988638
1357 Ga0268265_10546295
1358 Ga0268265_10757522
1359 Ga0268264_10000185
1360 Ga0268264_10178953
1361 Ga0268264_10476435
1362 Ga0268264_10847626
1363 Ga0268264_11514599
1364 Ga0265334_10033183
1365 Ga0307517_10111579
1366 Ga0307517_10485688
1367 Ga0307517_10527851
1368 Ga0307515_10319320
1369 Ga0307515_10382353
1370 Ga0307511_10050282
1371 Ga0265339_10078002
1372 Ga0307513_10630587
1373 Ga0307513_10765124
1374 Ga0307513_10860286
1375 Ga0307509_10043196
1376 Ga0307509_10071585
1377 Ga0307509_10131294
1378 Ga0307509_10799316
1379 Ga0307509_10862684
1380 Ga0307408_100364159
1381 Ga0307408_101432447
1382 Ga0307508_10000012
1383 Ga0307508_10183205
1384 Ga0307508_10195551
1385 Ga0307508_10625269
1386 Ga0307516_10026118
1387 Ga0307516_10071216
1388 Ga0307516_10178435
1389 Ga0307516_10305701
1390 Ga0307410_10563118
1391 Ga0307406_11527195
1392 Ga0307412_11287564
1393 Ga0307416_102360383
1394 Ga0307416_103394221
1395 Ga0307414_10280511
1396 Ga0307411_10621726
1397 Ga0307411_10947007
1398 Ga0307415_100229384
1399 Ga0307415_100414292
1400 Ga0307507_10114758
1401 Ga0307507_10562331
1402 Ga0307510_10007562
1403 Ga0307510_10148006
1404 Ga0307510_10149093
1405 Ga0307510_10426018
1406 Ga0373926_0298145
1407 Ga0373934_0035721
1408 Ga0373923_0001382
1409 Ga0373923_0018852
1410 Ga0373936_0043287
1411 Ga0373945_0034762
1412 Ga0373953_0000985
1413 Ga0373954_0001160
1414 Ga0373956_0001463
1415 Ga0373943_0029418
1416 Ga0373946_0026036
1417 Ga0373955_0001372
1418 Ga0373955_0071154
1419 Ga0373955_0281934
1420 Ga0373924_0048356
1421 Ga0373931_0726798
1422 Ga0373935_0000520
1423 Ga0373927_0000046
1424 Ga0373927_0039246
1425 Ga0373927_0179767
1426 Ga0373933_0019482
1427 Ga0373947_0001392
1428 Ga0373947_0294583
1429 Ga0373937_0015298
1430 Ga0373937_0048844
1431 Ga0373925_0009905
1432 Ga0373925_0147994
1433 Ga0373925_0688192
1434 Ga0395905_0081461
1435 Ga0395901_0279019
1436 Ga0436365_0258063
1437 Ga0439465_0153328
1438 Ga0451791_1145889
1439 Ga0451800_0483909
1440 Ga0451833_0965397
1441 Ga0451841_0946185
1442 Ga0451853_1498009
1443 Ga0451853_2499407
1444 Ga0495617_144149
1445 Ga0495592_0001238
1446 Ga0495592_0036407
1447 Ga0495603_0000051
1448 Ga0495603_0053535
1449 Ga0495603_0199197
1450 Ga0495590_0118414
1451 Ga0495629_0000182
1452 Ga0495629_0000750
1453 Ga0495629_1052476
1454 Ga0495638_0021430
1455 Ga0495638_0313958
1456 Ga0495641_0006374
1457 Ga0495651_0080866
1458 Ga0495653_0014575
1459 Ga0495653_0390270
1460 Ga0495650_0219665
1461 Ga0495650_0220847
1462 Ga0495580_0004021
1463 Ga0495580_0652689
1464 Ga0495582_0000137
1465 Ga0495605_0075741
1466 Ga0495605_0165343
1467 Ga0495639_0002873
1468 Ga0495662_0000583
1469 Ga0495664_0009075
1470 Ga0495664_0648518
1471 Ga0495584_0097003
1472 Ga0495584_0434820
1473 Ga0495585_0081939
1474 Ga0495585_0433426
1475 Ga0495594_0001833
1476 Ga0495594_0070484
1477 Ga0495594_0133143
1478 Ga0495596_0139113
1479 Ga0495596_0434709
1480 Ga0495607_0515914
1481 Ga0495606_0230654
1482 Ga0495606_0319973
1483 Ga0495608_0020960
1484 Ga0495610_0243781
1485 Ga0495616_0449890
1486 Ga0495618_0016660
1487 Ga0495618_0087705
1488 Ga0495618_0355628
1489 Ga0495620_0213462
1490 Ga0495628_0021321
1491 Ga0495628_0034008
1492 Ga0495630_0002625
1493 Ga0495631_0244859
1494 Ga0495632_0055923
1495 Ga0495632_0101059
1496 Ga0495632_0220312
1497 Ga0495632_0326698
1498 Ga0495637_0244249
1499 Ga0495643_0096011
1500 Ga0495643_0254922
1501 Ga0495644_0036932
1502 Ga0495644_0064041
1503 Ga0495644_0110850
1504 Ga0495644_0161120
1505 Ga0495648_0001119
1506 Ga0495648_0091446
1507 Ga0495648_0118789
1508 Ga0495648_0221551
1509 Ga0495663_0265713
1510 Ga0495666_0063168
1511 Ga0495652_0037670
1512 Ga0495665_0001239
1513 Ga0495665_0555899
1514 Ga0495640_0004375
1515 Ga0495640_0701848
1516 Ga0495598_0040996
1517 Ga0495598_0053787
1518 Ga0495598_0155839
1519 Ga0495609_0074119
1520 Ga0495609_0198959
1521 Ga0495621_0059482
1522 Ga0495597_0204020
1523 Ga0495645_0138086
1524 Ga0495645_0973542
1525 Ga0495622_0005490
1526 Ga0495622_0016785
1527 Ga0495622_0127518
1528 Ga0495622_0196546
1529 Ga0495633_0143423
1530 Ga0495667_0011352
1531 Ga0495667_0014203
1532 Ga0495656_0016955
1533 Ga0495656_0040582
1534 Ga0495656_0115887
1535 Ga0495656_0174123
1536 Ga0495668_0029734
1537 Ga0495668_0052320
1538 Ga0495668_0072435
1539 Ga0495668_0108203
1540 Ga0495668_0584661
1541 Ga0495634_0002221
1542 Ga0495634_0025310
1543 Ga0495611_0392762
1544 Ga0495625_0333445
1545 Ga0495635_0001455
1546 Ga0495635_0002383
1547 Ga0495659_0168839
1548 Ga0495661_0407531
1549 Ga0495588_0007336
1550 Ga0495588_0027904
1551 Ga0495657_0004131
1552 Ga0495623_0282221
1553 Ga0495646_0019980
1554 Ga0495646_0048867
1555 Ga0495647_0020010
1556 Ga0495658_0008017
1557 Ga0495669_0007993
1558 Ga0495669_0092413
1559 Ga0495669_0271394
1560 Ga0495669_0411578
1561 Ga0495613_0047965
1562 Ga0495613_0591950
1563 Ga0495624_0000898
1564 Ga0495624_0057040
1565 Ga0495624_0254050
1566 Ga0495670_0039207
1567 Ga0495671_0068625
1568 Ga0495671_0312816
1569 Ga0495649_0394575
1570 Ga0495589_0204065
1571 Ga0495600_0011474
1572 Ga0495600_0012921
1573 Ga0495581_0007805
1574 Ga0495581_0642791
1575 Ga0495604_0013331
1576 Ga0495604_0176387
1577 Ga0495636_0091236
1578 Ga0495636_0259766
1579 Ga0495674_0010092
1580 Ga0495674_0034564
1581 Ga0495672_0025981
1582 Ga0495672_0162104
1583 Ga0495672_0417741
1584 Ga0495676_0035661
1585 Ga0495676_0085005
1586 Ga0495676_0105143
1587 Ga0495680_0129838
1588 Ga0495680_0166754
1589 Ga0495683_0107267
1590 Ga0495675_0075686
1591 Ga0495685_158124
1592 Ga0495673_0342522
1593 Ga0495684_0000643
1594 Ga0495684_0045864
1595 Ga0495686_0186699
1596 Ga0495593_0000469
1597 Ga0495593_0006819
1598 Ga0495602_0155711
1599 Ga0495602_0896825
1600 Ga0495614_0001926
1601 Ga0496101_0168174
1602 Ga0496102_0148673
1603 Ga0496102_0213312
1604 Ga0496102_0473772
1605 Ga0496102_0611106
1606 Ga0496102_0657915
1607 Ga0496103_0510572
1608 Ga0496104_0051923
1609 Ga0496104_0116018
1610 Ga0496105_0000208
1611 Ga0496105_0471400
1612 Ga0496105_1176689
1613 Ga0496106_0002121
1614 Ga0496106_0158975
1615 Ga0496106_0198998
1616 Ga0496106_0634377
1617 Ga0496107_0033519
1618 Ga0496107_0190743
1619 Ga0496108_0023301
1620 Ga0496108_0320651
1621 Ga0496109_0027672
1622 Ga0496109_0236643
1623 Ga0496111_0054327
1624 Ga0496111_0356666
1625 Ga0496111_0578547
1626 Ga0496111_0807267
1627 Ga0496112_0003971
1628 Ga0496112_0160560
1629 Ga0496113_0079054
1630 Ga0496113_0192281
1631 Ga0496113_0278216
1632 Ga0496113_0858852
1633 Ga0496114_0047851
1634 Ga0496114_0503192
1635 Ga0496114_0579915
1636 Ga0496115_0833854
1637 Ga0496115_0906083
1638 Ga0496117_0008070
1639 Ga0496118_0002570
1640 Ga0496118_0435026
1641 Ga0496119_0111961
1642 Ga0496119_0345573
1643 Ga0496119_0517529
1644 Ga0496121_0001125
1645 Ga0496121_0155945
1646 Ga0496121_0271860
1647 Ga0496124_0001146
1648 Ga0496124_0097944
1649 Ga0496124_0212148
1650 Ga0496125_0098775
1651 Ga0496125_0282966
1652 Ga0496125_0523158
1653 Ga0496126_0011852
1654 Ga0496126_0033864
1655 Ga0496126_0062247
1656 Ga0496126_0257251
1657 Ga0496126_0286417
1658 Ga0496126_0348512
1659 Ga0496126_0353182
1660 Ga0495682_0110133
1661 Ga0501033_0388678
1662 Ga0501038_0063959
1663 Ga0501039_0160079
1664 Ga0501044_0604514
1665 nmdc:mga03683_177968_c1
1666 nmdc:mga03683_217060_c1
1667 nmdc:mga03683_39224_c1
1668 nmdc:mga03n38_124409_c1
1669 nmdc:mga03n38_12993_c1
1670 nmdc:mga03n38_178695_c1
1671 nmdc:mga00v17_122507_c1
1672 nmdc:mga00v17_241812_c1
1673 nmdc:mga00v17_628973_c1
1674 nmdc:mga00v17_668295_c1
1675 nmdc:mga00v17_86774_c1
1676 nmdc:mga0yw44_1205040_c1
1677 nmdc:mga0yw44_286428_c1
1678 nmdc:mga0yw44_31797_c1
1679 nmdc:mga0yw44_5454_c2
1680 nmdc:mga0yw44_793165_c1
1681 nmdc:mga0yw44_996035_c1
1682 nmdc:mga0k408_104327_c1
1683 nmdc:mga0k408_264759_c1
1684 nmdc:mga0k408_346376_c1
1685 nmdc:mga06z11_147595_c1
1686 nmdc:mga06z11_207910_c1
1687 nmdc:mga06z11_267199_c1
1688 nmdc:mga06z11_54727_c1
1689 nmdc:mga06z11_654656_c1
1690 nmdc:mga06z11_8466_c1
1691 nmdc:mga04h51_224914_c1
1692 nmdc:mga04h51_359437_c1
1693 nmdc:mga04h51_94693_c1
1694 nmdc:mga07m45_126326_c2
1695 nmdc:mga07m45_54052_c1
1696 nmdc:mga05p37_228491_c1
1697 nmdc:mga06r32_1197058_c1
1698 nmdc:mga08y16_1028348_c1
1699 nmdc:mga08y16_322099_c1
1700 nmdc:mga0sz30_206707_c1
1701 Ga0495601_0047833
1702 Ga0495612_0281086
1703 Ga0500635_0015817
1704 Ga0495655_0024422
1705 Ga0495595_0000332
1706 Ga0495619_0000633
1707 Ga0495619_0386961
1708 Ga0500646_0157643
1709 Ga0500583_0011788
1710 Ga0500583_0218717
1711 Ga0500566_0000078
1712 Ga0500566_0275722
1713 Ga0500640_000121
1714 Ga0500641_0024457
1715 Ga0500641_0206963
1716 Ga0500648_236018
1717 Ga0500650_0121221
1718 Ga0500554_022998
1719 Ga0500569_018952
1720 Ga0500572_000170
1721 Ga0500591_038026
1722 Ga0500594_0075252
1723 Ga0500595_001686
1724 Ga0500595_004672
1725 Ga0500595_154224
1726 Ga0500608_023056
1727 Ga0500614_006004
1728 Ga0500642_0008061
1729 Ga0500642_0012158
1730 Ga0500655_013060
1731 Ga0500658_0094870
1732 Ga0500559_0048045
1733 Ga0500568_0037366
1734 Ga0500568_0113131
1735 Ga0500577_0027964
1736 Ga0500589_155633
1737 Ga0500589_325558
1738 Ga0500590_091321
1739 Ga0500603_000081
1740 Ga0500603_001666
1741 Ga0500627_0007990
1742 Ga0500630_004509
1743 Ga0500634_0188692
1744 Ga0500638_018006
1745 Ga0500638_039456
1746 Ga0500638_092290
1747 Ga0500639_000028
1748 Ga0500639_187440
1749 Ga0500636_0014860
1750 Ga0500636_0348141
1751 Ga0500637_0020909
1752 Ga0500637_0632110
1753 Ga0500576_151139
1754 Ga0500611_015104
1755 Ga0500657_231834
1756 Ga0500645_038434
1757 Ga0500645_093651
1758 Ga0500609_029640
1759 Ga0500596_002436
1760 Ga0500596_092053
1761 Ga0500601_001222
1762 Ga0500661_005491
1763 Ga0500661_090012
1764 2524465864
1765 2876817816
1766 2879116808
1767 2885387307
1768 8056689809

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

6

100

0.83

PF12680

SnoaL_2

SnoaL-like domain

9

102

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f40-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution 0.879 7 108
5evh-assembly1.cif.gz_A-2 crystal structure of known function protein from kribbella flavida dsm 17836 0.8751 8 108
5tpj-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.868 7 106
4pej-assembly1.cif.gz_A crystal structure of a computationally designed retro-aldolase, ra110.4 (cys free) 0.8677 8 109
3ecf-assembly2.cif.gz_C crystal structure of an ntf2-like protein (ava_4193) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8642 8 108
ID Description Score Start End Superfamily
3en8A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8764 7 109 3.10.450.50
5evhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8725 8 108 3.10.450.50
3f40A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8705 7 108 3.10.450.50
af_Q2FUS0_84_189_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8676 15 108 3.10.450.50
af_P72035_5_114_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.858 7 108 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1T4Y1D6-F1-model_v4 Ketosteroid isomerase-related protein 0.9857 7 108 GO:0016853
AF-A0A1M5HNV5-F1-model_v4 Ketosteroid isomerase-related protein 0.9768 4 122 GO:0016853
AF-A0A6N7GPB7-F1-model_v4 DUF4440 domain-containing protein 0.9757 7 121
AF-A0A2T3ECX4-F1-model_v4 DUF4440 domain-containing protein 0.9719 4 112
AF-A0A4Q5X3F2-F1-model_v4 Nuclear transport factor 2 family protein 0.969 6 96

Map