F484645

General Info

Members Datasets Scaffolds Average Seq Length
884 662 1768 229

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0029916|Ga0500573_0029916_1539_2261
Length 240
Sequence MASLRVIRRNRRERTPMQPHDFWQDIHPPQSFANGGSHEGFFPVTLDDGRQLQLPIRPLADEKHALASLIINQASFAVQAALAEQLAKKLAVFEPEVIVGLPTLGLTLASAVAKALGHSRYVPLGTSRKFWYLETLSVPLSSITTEQQKRLYIDPRMLPLLEGRRVALIDDVISSGSSIVAGLGLLAASGIAPVVVGAAMLQSERWRARLADFGAHWPQRTVGVFATPMLRKNAGGGWTG

Samples

Sample ID Description Type Environment
1 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
48 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
49 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
60 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
61 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
62 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
103 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
104 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
105 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
106 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
107 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
108 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
109 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
110 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
111 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
112 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
113 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
114 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
115 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
213 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
214 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
218 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
221 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
222 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 2508501050 Microvirga lupini Lut6 Isolate Nodule
227 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
228 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
229 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
230 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
231 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
232 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
233 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
234 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
235 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
236 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
237 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
238 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
239 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
240 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
241 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
242 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
243 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
244 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
245 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
246 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
247 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
248 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
249 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
250 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
251 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
252 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
253 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
254 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
255 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
256 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
257 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
258 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
259 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
260 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
261 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
262 2519899620 Rhizobium sp. Pop5 Isolate Nodule
263 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
264 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
265 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
266 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
267 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
268 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
269 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
270 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
271 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
272 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
273 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
274 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
275 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
276 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
277 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
278 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
279 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
280 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
281 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
282 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
283 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
284 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
285 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
286 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
287 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
288 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
289 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
290 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
291 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
292 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
293 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
294 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
295 2643221557 Ensifer sp. Root558 Isolate Unclassified
296 2643221568 Rhizobium sp. Root564 Isolate Unclassified
297 2643221599 Rhizobium sp. Root708 Isolate Unclassified
298 2643221610 Ensifer sp. Root74 Isolate Unclassified
299 2643221618 Ensifer sp. Root231 Isolate Unclassified
300 2643221626 Ensifer sp. Root31 Isolate Unclassified
301 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
302 2643221655 Ensifer sp. Root1252 Isolate Unclassified
303 2643221659 Ensifer sp. Root127 Isolate Unclassified
304 2643221675 Ensifer sp. Root1298 Isolate Unclassified
305 2643221680 Ensifer sp. Root1312 Isolate Unclassified
306 2643221698 Ensifer sp. Root142 Isolate Unclassified
307 2643221712 Ensifer sp. Root258 Isolate Unclassified
308 2643221723 Ensifer sp. Root278 Isolate Unclassified
309 2643221726 Ensifer sp. Root954 Isolate Unclassified
310 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
311 2718217882 Rhizobium sp. N741 Isolate Nodule
312 2718217927 Rhizobium sp. N324 Isolate Nodule
313 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
314 2718218009 Rhizobium sp. N561 Isolate Nodule
315 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
316 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
317 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
318 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
319 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
320 2718218363 Rhizobium sp. N113 Isolate Nodule
321 2718218365 Rhizobium sp. N731 Isolate Nodule
322 2718218366 Rhizobium sp. N621 Isolate Nodule
323 2718218423 Rhizobium sp. N941 Isolate Nodule
324 2721755514 Rhizobium sp. N6212 Isolate Nodule
325 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
326 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
327 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
328 2721755809 Rhizobium sp. N541 Isolate Nodule
329 2721755810 Rhizobium sp. N871 Isolate Nodule
330 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
331 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
332 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
333 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
334 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
335 2728369365 Rhizobium sp. N1341 Isolate Nodule
336 2728369397 Rhizobium sp. N1314 Isolate Nodule
337 2738541293 Rhizobium sp. GV031 Isolate Unclassified
338 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
339 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
340 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
341 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
342 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
343 2791355256 Rhizobium sp. M10 Isolate Nodule
344 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
345 2791355260 Rhizobium sp. L9 Isolate Nodule
346 2791355261 Rhizobium sp. J15 Isolate Nodule
347 2791355262 Rhizobium sp. M1 Isolate Nodule
348 2791355263 Rhizobium chutanense C5 Isolate Nodule
349 2791355264 Rhizobium sp. S9 Isolate Nodule
350 2791355265 Rhizobium sp. H4 Isolate Nodule
351 2791355266 Rhizobium sp. L43 Isolate Nodule
352 2791355267 Rhizobium sp. L18 Isolate Nodule
353 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
354 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
355 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
356 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
357 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
358 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
359 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
360 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
361 2802429633 Rhizobium anhuiense J3 Isolate Nodule
362 2802429634 Rhizobium anhuiense S10 Isolate Nodule
363 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
364 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
365 2802429637 Rhizobium anhuiense C15 Isolate Nodule
366 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
367 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
368 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
369 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
370 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
371 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
372 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
373 2838048938 Rhizobium pisi 27/80 Isolate Nodule
374 2838061910 Rhizobium phaseoli L15 Isolate Nodule
375 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
376 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
377 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
378 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
379 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
380 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
381 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
382 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
383 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
384 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
385 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
386 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
387 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
388 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
389 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
390 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
391 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
392 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
393 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
394 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
395 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
396 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
397 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
398 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
399 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
400 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
401 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
402 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
403 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
404 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
405 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
406 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
407 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
408 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
409 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
410 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
411 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
412 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
413 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
414 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
415 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
416 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
417 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
418 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
419 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
420 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
421 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
422 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
423 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
424 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
425 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
426 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
427 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
428 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
429 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
430 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
431 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
432 2844163670 Ensifer sp. 1H6 Isolate Unclassified
433 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
434 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
435 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
436 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
437 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
438 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
439 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
440 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
441 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
442 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
443 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
444 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
445 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
446 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
447 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
448 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
449 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
450 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
451 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
452 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
453 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
454 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
455 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
456 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
457 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
458 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
459 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
460 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
461 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
462 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
463 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
464 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
465 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
466 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
467 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
468 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
469 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
470 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
471 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
472 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
473 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
474 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
475 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
476 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
477 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
478 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
479 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
480 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
481 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
482 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
483 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
484 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
485 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
486 2933599457 Rhizobium phaseoli M3 Isolate Nodule
487 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
488 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
489 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
490 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
491 2936381700 Rhizobium chutanense C16 Isolate Unclassified
492 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
493 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
494 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
495 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
496 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
497 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
498 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
499 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
500 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
501 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
502 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
503 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
504 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
505 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
506 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
507 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
508 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
509 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
510 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
511 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
512 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
513 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
514 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
515 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
516 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
517 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
518 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
519 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
520 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
521 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
522 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
523 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
524 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
525 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
526 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
527 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
528 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
529 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
530 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
531 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
532 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
533 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
534 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
535 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
536 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
537 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
538 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
539 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
540 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
541 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
542 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
543 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
544 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
545 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
546 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
547 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
548 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
549 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
550 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
551 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
552 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
553 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
554 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
555 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
556 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
557 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
558 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
559 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
560 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
561 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
562 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
563 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
564 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
565 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
566 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
567 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
568 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
569 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
570 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
571 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
572 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
573 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
574 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
575 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
576 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
577 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
578 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
579 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
580 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
581 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
582 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
583 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
584 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
585 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
586 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
587 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
588 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
589 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
590 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
591 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
592 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
593 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
594 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
595 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
596 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
597 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
598 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
599 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
600 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
601 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
602 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
603 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
604 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
605 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
606 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
607 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
608 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
609 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
610 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
611 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
612 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
613 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
614 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
615 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
616 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
617 2996887358 Rhizobium sp. R711 Isolate Nodule
618 2996893221 Rhizobium sp. R635 Isolate Nodule
619 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
620 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
621 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
622 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
623 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
624 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
625 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
626 8005258706 Rhizobium sp. R693 Isolate Nodule
627 8005275841 Rhizobium sp. N4311 Isolate Nodule
628 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
629 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
630 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
631 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
632 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
633 8005321885 Rhizobium sp. R72 Isolate Nodule
634 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
635 8005382845 Rhizobium sp. R634 Isolate Nodule
636 8005395548 Rhizobium sp. R339 Isolate Nodule
637 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
638 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
639 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
640 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
641 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
642 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
643 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
644 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
645 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
646 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
647 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
648 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
649 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
650 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
651 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
652 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
653 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
654 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
655 8018176218 Rhizobium sp. N122 Isolate Nodule
656 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
657 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
658 8024501048 Rhizobium sp. H4 Isolate Nodule
659 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
660 8056382006 Rhizobium croatiense 13T Isolate Nodule
661 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
662 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.57
Metatranscriptomes 0
Isolates 49.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.91
Nodule 41.74
Rhizoplane 1.92
Rhizosphere 20.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500573_0029916 3300053140 Bacteria 3140
2 JGI24740J21852_10000539 3300001979 Bacteria 16193
3 JGI25155J39150_1000069 3300002704 Bacteria 64645
4 JGI25156J39149_1000095 3300002705 Bacteria 64645
5 JGI25162J39368_1001254 3300002737 Bacteria 14520
6 JGI25162J39368_1001406 3300002737 Bacteria 13125
7 JGI25154J39366_1000856 3300002738 Bacteria 13204
8 JGI25158J39367_1000276 3300002739 Bacteria 11708
9 JGI25158J39367_1003261 3300002739 Bacteria 2526
10 JGI25157J39369_1000216 3300002741 Bacteria 47231
11 JGI25163J39215_1005438 3300002771 Bacteria 811
12 JGI25152J39213_1001298 3300002773 Bacteria 11188
13 JGI25152J39213_1002837 3300002773 Bacteria 6223
14 JGI25152J39213_1016736 3300002773 Bacteria 1405
15 JGI25150J39212_1000758 3300002774 Bacteria 11192
16 JGI25159J45721_1000100 3300002987 Bacteria 41372
17 JGI25159J45721_1000155 3300002987 Bacteria 32010
18 JGI25159J45721_1000377 3300002987 Bacteria 20611
19 JGI25159J45721_1009950 3300002987 Bacteria 2466
20 JGI25151J46595_10002440 3300003187 Bacteria 11192
21 JGI25151J46595_10009392 3300003187 Bacteria 4634
22 JGI25151J46595_10020286 3300003187 Bacteria 2805
23 JGI25165J46597_1001859 3300003214 Bacteria 8722
24 JGI25165J46597_1001944 3300003214 Bacteria 8140
25 JGI25165J46597_1004988 3300003214 Bacteria 2666
26 JGI25153J46596_10002854 3300003215 Bacteria 9813
27 JGI25153J46596_10003119 3300003215 Bacteria 9346
28 rootH2_10074397 3300003320 Bacteria 3113
29 rootH2_10255824 3300003320 Bacteria 1142
30 rootL2_10039230 3300003322 Bacteria 10979
31 rootL2_10192180 3300003322 Bacteria 2653
32 JGI25160J50197_1000086 3300003354 Bacteria 94046
33 JGI25160J50197_1000326 3300003354 Bacteria 32667
34 JGI25160J50197_1008558 3300003354 Bacteria 3889
35 JGI25161J50226_1000244 3300003374 Bacteria 32663
36 JGI25161J50226_1000389 3300003374 Bacteria 22186
37 Ga0055526_1000664 3300003771 Bacteria 26413
38 Ga0055526_1000684 3300003771 Bacteria 25937
39 Ga0055526_1006983 3300003771 Bacteria 5990
40 Ga0055526_1014356 3300003771 Bacteria 3265
41 Ga0055526_1017789 3300003771 Bacteria 2693
42 Ga0055524_1001927 3300003775 Bacteria 11190
43 Ga0055524_1017974 3300003775 Bacteria 2473
44 Ga0055524_1028865 3300003775 Bacteria 1654
45 Ga0055536_1006158 3300003781 Bacteria 5671
46 Ga0055528_1003603 3300003790 Bacteria 7704
47 Ga0055528_1003953 3300003790 Bacteria 7269
48 Ga0055528_1004732 3300003790 Bacteria 6492
49 Ga0055528_1005353 3300003790 Bacteria 5992
50 Ga0055528_1006966 3300003790 Bacteria 5059
51 Ga0055528_1013422 3300003790 Bacteria 3101
52 Ga0055528_1015785 3300003790 Bacteria 2708
53 Ga0055540_1003293 3300003792 Bacteria 7891
54 Ga0055531_10024040 3300003794 Bacteria 2262
55 Ga0055543_1000114 3300004625 Bacteria 69144
56 Ga0055543_1000166 3300004625 Bacteria 55052
57 Ga0055543_1000296 3300004625 Bacteria 35540
58 Ga0055543_1007358 3300004625 Bacteria 2554
59 Ga0065165_1000511 3300005262 Bacteria 59722
60 Ga0065165_1000813 3300005262 Bacteria 41429
61 Ga0065165_1008324 3300005262 Bacteria 4879
62 Ga0065165_1013126 3300005262 Bacteria 3315
63 Ga0070666_10138935 3300005335 Bacteria 1692
64 Ga0070671_100007941 3300005355 Bacteria 8486
65 Ga0070667_100251760 3300005367 Bacteria 1579
66 Ga0070663_100029985 3300005455 Bacteria 3723
67 Ga0070665_100093721 3300005548 Bacteria 3008
68 Ga0068854_100340770 3300005578 Bacteria 1224
69 Ga0075365_10000225 3300006038 Bacteria 19139
70 Ga0075365_10000513 3300006038 Bacteria 14784
71 Ga0075363_100120981 3300006048 Bacteria 1462
72 Ga0075364_10000074 3300006051 Bacteria 38784
73 Ga0075362_10004332 3300006177 Bacteria 5083
74 Ga0075367_10002628 3300006178 Bacteria 8259
75 Ga0075367_10008640 3300006178 Bacteria 5284
76 Ga0075369_10015256 3300006186 Bacteria 3081
77 Ga0075370_10002082 3300006353 Bacteria 9114
78 Ga0079104_1000063 3300006946 Bacteria 159519
79 Ga0105250_10018660 3300009092 Bacteria 2807
80 Ga0105240_10000310 3300009093 Bacteria 93883
81 Ga0105243_10198150 3300009148 Bacteria 1759
82 Ga0105248_10022722 3300009177 Bacteria 6961
83 Ga0105237_10010854 3300009545 Bacteria 9665
84 Ga0123340_1065979 3300009763 Bacteria 940
85 Ga0123341_1000068 3300009765 Bacteria 44096
86 Ga0123341_1076233 3300009765 Bacteria 1377
87 Ga0123342_1008973 3300009766 Bacteria 12246
88 Ga0123342_1016517 3300009766 Bacteria 6399
89 Ga0105239_10011757 3300010375 Bacteria 9771
90 Ga0157326_1007274 3300012513 Bacteria 1194
91 Ga0157370_10006275 3300013104 Bacteria 13151
92 Ga0157370_10799413 3300013104 Bacteria 858
93 Ga0157369_10389105 3300013105 Bacteria 1447
94 Ga0157369_10491157 3300013105 Bacteria 1270
95 Ga0171463_1010 3300013249 Bacteria 269975
96 Ga0163162_10311638 3300013306 Bacteria 1706
97 Ga0182008_10089462 3300014497 Bacteria 1517
98 Ga0182007_10003022 3300015262 Bacteria 8127
99 Ga0182005_1023562 3300015265 Bacteria 1682
100 Ga0183363_1036 3300015690 Bacteria 44926
101 Ga0228710_1000058 3300022740 Bacteria 83050
102 Ga0209435_100049 3300025206 Bacteria 92067
103 Ga0209436_100023 3300025208 Bacteria 96401
104 Ga0209436_100046 3300025208 Bacteria 68624
105 Ga0209672_102141 3300025228 Bacteria 5236
106 Ga0209437_100376 3300025233 Bacteria 45400
107 Ga0209437_100448 3300025233 Bacteria 34068
108 Ga0207425_1001227 3300025245 Bacteria 11246
109 Ga0207425_1006483 3300025245 Bacteria 3197
110 Ga0207425_1024339 3300025245 Bacteria 1259
111 Ga0209646_1000159 3300025246 Bacteria 92067
112 Ga0209646_1016960 3300025246 Bacteria 1077
113 Ga0209026_1000183 3300025250 Bacteria 92067
114 Ga0209759_1000206 3300025256 Bacteria 92067
115 Ga0209129_1000128 3300025258 Bacteria 130420
116 Ga0209129_1000313 3300025258 Bacteria 43280
117 Ga0209129_1001726 3300025258 Bacteria 11782
118 Ga0209129_1001845 3300025258 Bacteria 11218
119 Ga0209129_1002817 3300025258 Bacteria 8073
120 Ga0209129_1006329 3300025258 Bacteria 3867
121 Ga0209129_1011136 3300025258 Bacteria 2174
122 Ga0209233_1000368 3300025261 Bacteria 40743
123 Ga0209233_1000726 3300025261 Bacteria 15249
124 Ga0209233_1000818 3300025261 Bacteria 13854
125 Ga0209673_1000060 3300025273 Bacteria 263602
126 Ga0209673_1000233 3300025273 Bacteria 108504
127 Ga0209673_1000978 3300025273 Bacteria 35222
128 Ga0209673_1000980 3300025273 Bacteria 35156
129 Ga0209673_1004122 3300025273 Bacteria 7976
130 Ga0209673_1007018 3300025273 Bacteria 5298
131 Ga0209673_1011179 3300025273 Bacteria 3717
132 Ga0209673_1053341 3300025273 Bacteria 1055
133 Ga0209130_1000074 3300025284 Bacteria 173309
134 Ga0209130_1000173 3300025284 Bacteria 92248
135 Ga0209130_1000377 3300025284 Bacteria 50153
136 Ga0209676_1002284 3300025292 Bacteria 14013
137 Ga0209676_1032826 3300025292 Bacteria 1555
138 Ga0209025_1000758 3300025294 Bacteria 53948
139 Ga0209025_1003257 3300025294 Bacteria 15637
140 Ga0209025_1004914 3300025294 Bacteria 11246
141 Ga0209025_1006988 3300025294 Bacteria 8568
142 Ga0209025_1020783 3300025294 Bacteria 3568
143 Ga0209025_1025725 3300025294 Bacteria 2984
144 Ga0209025_1060929 3300025294 Bacteria 1412
145 Ga0209564_1000116 3300025295 Bacteria 207889
146 Ga0209564_1000125 3300025295 Bacteria 201709
147 Ga0209564_1000856 3300025295 Bacteria 40580
148 Ga0209564_1001100 3300025295 Bacteria 32100
149 Ga0209564_1028771 3300025295 Bacteria 1766
150 Ga0209564_1030493 3300025295 Bacteria 1669
151 Ga0209564_1033749 3300025295 Bacteria 1515
152 Ga0209564_1036982 3300025295 Bacteria 1383
153 Ga0209758_1000105 3300025297 Bacteria 221415
154 Ga0209758_1001294 3300025297 Bacteria 30724
155 Ga0209758_1002006 3300025297 Bacteria 21897
156 Ga0209758_1002976 3300025297 Bacteria 16243
157 Ga0209758_1004660 3300025297 Bacteria 11216
158 Ga0209758_1015102 3300025297 Bacteria 4033
159 Ga0209758_1015283 3300025297 Bacteria 3991
160 Ga0209050_1002732 3300025298 Bacteria 14233
161 Ga0209050_1009759 3300025298 Bacteria 4849
162 Ga0209050_1025324 3300025298 Bacteria 2020
163 Ga0209256_1000164 3300025299 Bacteria 135612
164 Ga0209256_1000772 3300025299 Bacteria 41509
165 Ga0209256_1003329 3300025299 Bacteria 11400
166 Ga0209256_1005430 3300025299 Bacteria 7350
167 Ga0209256_1006743 3300025299 Bacteria 5945
168 Ga0209256_1008738 3300025299 Bacteria 4620
169 Ga0209256_1009138 3300025299 Bacteria 4410
170 Ga0209256_1026622 3300025299 Bacteria 1662
171 Ga0207426_1000047 3300025302 Bacteria 417011
172 Ga0207426_1000165 3300025302 Bacteria 170244
173 Ga0207426_1000276 3300025302 Bacteria 106148
174 Ga0207426_1000330 3300025302 Bacteria 89992
175 Ga0207426_1002258 3300025302 Bacteria 12753
176 Ga0209051_1000217 3300025303 Bacteria 97218
177 Ga0209051_1001739 3300025303 Bacteria 17361
178 Ga0209051_1007259 3300025303 Bacteria 6091
179 Ga0209051_1020696 3300025303 Bacteria 2822
180 Ga0209051_1032123 3300025303 Bacteria 2007
181 Ga0209051_1033854 3300025303 Bacteria 1924
182 Ga0209257_1002649 3300025304 Bacteria 17210
183 Ga0209257_1002865 3300025304 Bacteria 16091
184 Ga0209257_1020240 3300025304 Bacteria 2468
185 Ga0209257_1021222 3300025304 Bacteria 2368
186 Ga0209257_1033343 3300025304 Bacteria 1620
187 Ga0209257_1057225 3300025304 Bacteria 1073
188 Ga0207680_10159732 3300025903 Bacteria 1510
189 Ga0207695_10000403 3300025913 Bacteria 96385
190 Ga0207671_10007001 3300025914 Bacteria 9889
191 Ga0207644_10042630 3300025931 Bacteria 3217
192 Ga0207709_10514381 3300025935 Bacteria 936
193 Ga0207667_10722228 3300025949 Bacteria 997
194 Ga0207640_10685444 3300025981 Bacteria 877
195 Ga0209281_1000110 3300027111 Bacteria 215631
196 Ga0209281_1000226 3300027111 Bacteria 119980
197 Ga0209813_10100045 3300027866 Bacteria 985
198 Ga0268266_10702546 3300028379 Bacteria 975
199 Ga0307515_10002178 3300028794 Bacteria 43027
200 Ga0307515_10024859 3300028794 Bacteria 10399
201 Ga0307513_10005733 3300031456 Bacteria 16340
202 Ga0307513_10018268 3300031456 Bacteria 8387
203 Ga0307408_100046766 3300031548 Bacteria 3096
204 Ga0307408_100168273 3300031548 Bacteria 1748
205 Ga0307405_10006156 3300031731 Bacteria 5877
206 Ga0307406_10572336 3300031901 Bacteria 927
207 Ga0307407_10271484 3300031903 Bacteria 1171
208 Ga0307412_10007550 3300031911 Bacteria 6175
209 Ga0307412_10715366 3300031911 Bacteria 861
210 Ga0307409_100121448 3300031995 Bacteria 2213
211 Ga0307416_100105887 3300032002 Bacteria 2463
212 Ga0307416_101468893 3300032002 Bacteria 787
213 Ga0395905_0388870 3300037471 Bacteria 1289
214 Ga0439465_0014503 3300041413 Bacteria 2456
215 Ga0439465_0022582 3300041413 Bacteria 1977
216 Ga0451787_515154 3300041441 Bacteria 1512
217 Ga0451798_0281256 3300041458 Bacteria 1213
218 Ga0451804_1151623 3300041463 Bacteria 922
219 Ga0451833_1410064 3300041491 Bacteria 1050
220 Ga0451835_0289993 3300041492 Bacteria 1424
221 Ga0451835_0666526 3300041492 Bacteria 2910
222 Ga0451837_0365013 3300041494 Bacteria 4085
223 Ga0451841_0308011 3300041498 Bacteria 1012
224 Ga0451845_0001155 3300041501 Bacteria 2025
225 Ga0451847_0112209 3300041503 Bacteria 2565
226 Ga0451849_0526961 3300041505 Bacteria 1417
227 Ga0451851_1003856 3300041507 Bacteria 1809
228 Ga0451843_0439469 3300041509 Bacteria 995
229 Ga0451843_1432342 3300041509 Bacteria 2783
230 Ga0451855_1775390 3300041511 Bacteria 1046
231 Ga0451855_1940470 3300041511 Bacteria 1196
232 Ga0451855_1955456 3300041511 Bacteria 1118
233 Ga0439431_0034036 3300041997 Bacteria 1276
234 Ga0439445_0119740 3300042004 Bacteria 755
235 Ga0439449_0020659 3300042007 Bacteria 2467
236 Ga0466972_0198200 3300044658 Bacteria 941
237 Ga0466965_0027786 3300044683 Bacteria 2747
238 Ga0466963_0107711 3300044694 Bacteria 1911
239 Ga0466970_0001973 3300044765 Bacteria 9922
240 Ga0466970_0326479 3300044765 Bacteria 868
241 Ga0466960_0125933 3300044901 Bacteria 1347
242 Ga0466959_0461977 3300045049 Bacteria 860
243 Ga0451576_0086718 3300045051 Bacteria 3256
244 Ga0466967_0219795 3300045976 Bacteria 1805
245 Ga0495638_0003894 3300046460 Bacteria 11555
246 Ga0495638_0034056 3300046460 Bacteria 3253
247 Ga0495605_0016385 3300046474 Bacteria 4011
248 Ga0495605_0020739 3300046474 Bacteria 3490
249 Ga0495605_0061099 3300046474 Bacteria 1804
250 Ga0495662_0101646 3300046476 Bacteria 1406
251 Ga0495585_0016306 3300046492 Bacteria 4305
252 Ga0495585_0017012 3300046492 Bacteria 4209
253 Ga0495596_0021504 3300046500 Bacteria 2633
254 Ga0495607_0025498 3300046501 Bacteria 3677
255 Ga0495607_0033373 3300046501 Bacteria 3132
256 Ga0495607_0069287 3300046501 Bacteria 1975
257 Ga0495583_0004468 3300046506 Bacteria 9997
258 Ga0495583_0026629 3300046506 Bacteria 2862
259 Ga0495583_0103859 3300046506 Bacteria 1210
260 Ga0495606_0007626 3300046507 Bacteria 9620
261 Ga0495606_0021019 3300046507 Bacteria 4791
262 Ga0495606_0040844 3300046507 Bacteria 3114
263 Ga0495610_0027510 3300046512 Bacteria 3020
264 Ga0495610_0029781 3300046512 Bacteria 2869
265 Ga0495610_0065473 3300046512 Bacteria 1715
266 Ga0495616_0053711 3300046513 Bacteria 2001
267 Ga0495616_0077134 3300046513 Bacteria 1600
268 Ga0495616_0154205 3300046513 Bacteria 1037
269 Ga0495620_0027734 3300046515 Bacteria 2645
270 Ga0495620_0032546 3300046515 Bacteria 2374
271 Ga0495620_0035062 3300046515 Bacteria 2261
272 Ga0495620_0063460 3300046515 Bacteria 1531
273 Ga0495631_0002202 3300046518 Bacteria 11208
274 Ga0495631_0053265 3300046518 Bacteria 1766
275 Ga0495632_0004949 3300046519 Bacteria 8929
276 Ga0495632_0025308 3300046519 Bacteria 3141
277 Ga0495632_0025805 3300046519 Bacteria 3104
278 Ga0495643_0010849 3300046522 Bacteria 5584
279 Ga0495643_0049415 3300046522 Bacteria 2268
280 Ga0495643_0089504 3300046522 Bacteria 1590
281 Ga0495643_0105404 3300046522 Bacteria 1440
282 Ga0495648_0042256 3300046524 Bacteria 2870
283 Ga0495663_0121807 3300046525 Bacteria 874
284 Ga0495652_0188008 3300046529 Bacteria 1579
285 Ga0495654_0046331 3300046530 Bacteria 2142
286 Ga0495587_0169157 3300046536 Bacteria 1242
287 Ga0495609_0024320 3300046538 Bacteria 2779
288 Ga0495609_0094272 3300046538 Bacteria 1300
289 Ga0495622_0045913 3300046557 Bacteria 2030
290 Ga0495633_0015520 3300046558 Bacteria 3949
291 Ga0495633_0048621 3300046558 Bacteria 2002
292 Ga0495668_0013062 3300046616 Bacteria 4914
293 Ga0495668_0051097 3300046616 Bacteria 2289
294 Ga0495668_0057126 3300046616 Bacteria 2153
295 Ga0495668_0148145 3300046616 Bacteria 1285
296 Ga0495611_0062626 3300046648 Bacteria 1692
297 Ga0495625_0033570 3300046660 Bacteria 3793
298 Ga0495625_0048632 3300046660 Bacteria 3052
299 Ga0495625_0126970 3300046660 Bacteria 1730
300 Ga0495635_0209101 3300046663 Bacteria 1322
301 Ga0495661_0118793 3300046665 Bacteria 1463
302 Ga0495588_0067705 3300046674 Bacteria 1853
303 Ga0495657_0144218 3300046675 Bacteria 1482
304 Ga0495624_0159142 3300046690 Bacteria 1380
305 Ga0495671_0198879 3300046692 Bacteria 972
306 Ga0495671_0251012 3300046692 Bacteria 854
307 Ga0495649_0043451 3300046694 Bacteria 2453
308 Ga0495589_0107938 3300046794 Bacteria 1344
309 Ga0495660_0025477 3300046810 Bacteria 3359
310 Ga0495672_0043685 3300047320 Bacteria 2693
311 Ga0495683_0235135 3300047323 Bacteria 811
312 Ga0495687_015705 3300047443 Bacteria 3840
313 Ga0495687_114870 3300047443 Bacteria 982
314 Ga0495679_064750 3300047446 Bacteria 1065
315 Ga0495685_006175 3300047447 Bacteria 3917
316 Ga0495673_0024882 3300047469 Bacteria 2883
317 Ga0495681_0022554 3300047470 Bacteria 3366
318 Ga0495686_0001009 3300047472 Bacteria 34155
319 Ga0495686_0026745 3300047472 Bacteria 3774
320 Ga0495686_0039795 3300047472 Bacteria 3000
321 Ga0496100_0005866 3300048903 Bacteria 6650
322 Ga0496101_0011732 3300048904 Bacteria 5825
323 Ga0496101_0149878 3300048904 Bacteria 1783
324 Ga0496102_0003609 3300048905 Bacteria 13100
325 Ga0496103_0003409 3300048906 Bacteria 9714
326 Ga0496106_0000245 3300048909 Bacteria 37807
327 Ga0496106_0313256 3300048909 Bacteria 1259
328 Ga0496110_0452911 3300048913 Bacteria 1169
329 Ga0496113_0061526 3300048916 Bacteria 2833
330 Ga0496113_0162713 3300048916 Bacteria 1765
331 Ga0496114_0030158 3300048917 Bacteria 4461
332 Ga0496116_0005898 3300048919 Bacteria 11246
333 Ga0496116_0007260 3300048919 Bacteria 9874
334 Ga0496116_0011549 3300048919 Bacteria 7297
335 Ga0496116_0013204 3300048919 Bacteria 6679
336 Ga0496117_0005216 3300048920 Bacteria 13816
337 Ga0496117_0034752 3300048920 Bacteria 3793
338 Ga0496117_0049870 3300048920 Bacteria 2973
339 Ga0496117_0051189 3300048920 Bacteria 2922
340 Ga0496118_0006282 3300048921 Bacteria 13137
341 Ga0496118_0011384 3300048921 Bacteria 8690
342 Ga0496118_0023230 3300048921 Bacteria 5391
343 Ga0496118_0057211 3300048921 Bacteria 2925
344 Ga0496119_0015993 3300048922 Bacteria 5735
345 Ga0496119_0017889 3300048922 Bacteria 5308
346 Ga0496119_0055142 3300048922 Bacteria 2415
347 Ga0496119_0158484 3300048922 Bacteria 1206
348 Ga0496119_0168056 3300048922 Bacteria 1161
349 Ga0496120_0007930 3300048923 Bacteria 7823
350 Ga0496120_0037002 3300048923 Bacteria 2900
351 Ga0496121_0000003 3300048924 Bacteria 1191431
352 Ga0496121_0000180 3300048924 Bacteria 141128
353 Ga0496121_0007528 3300048924 Bacteria 13131
354 Ga0496121_0017187 3300048924 Bacteria 7408
355 Ga0496121_0021666 3300048924 Bacteria 6283
356 Ga0496121_0034476 3300048924 Bacteria 4555
357 Ga0496121_0065254 3300048924 Bacteria 2963
358 Ga0496121_0068065 3300048924 Bacteria 2882
359 Ga0496121_0099410 3300048924 Bacteria 2248
360 Ga0496121_0234504 3300048924 Bacteria 1283
361 Ga0496121_0375723 3300048924 Bacteria 939
362 Ga0496121_0492150 3300048924 Bacteria 780
363 Ga0496122_0000107 3300048925 Bacteria 193163
364 Ga0496122_0006721 3300048925 Bacteria 13088
365 Ga0496122_0011947 3300048925 Bacteria 8713
366 Ga0496122_0018249 3300048925 Bacteria 6495
367 Ga0496122_0024001 3300048925 Bacteria 5352
368 Ga0496122_0028240 3300048925 Bacteria 4769
369 Ga0496122_0101348 3300048925 Bacteria 1924
370 Ga0496122_0103482 3300048925 Bacteria 1894
371 Ga0496123_0000063 3300048926 Bacteria 216072
372 Ga0496123_0007318 3300048926 Bacteria 10465
373 Ga0496123_0026372 3300048926 Bacteria 4353
374 Ga0496123_0027399 3300048926 Bacteria 4245
375 Ga0496123_0030032 3300048926 Bacteria 3987
376 Ga0496123_0045118 3300048926 Bacteria 3006
377 Ga0496123_0052925 3300048926 Bacteria 2688
378 Ga0496123_0153074 3300048926 Bacteria 1241
379 Ga0496124_0004497 3300048927 Bacteria 16260
380 Ga0496124_0015352 3300048927 Bacteria 7348
381 Ga0496124_0017855 3300048927 Bacteria 6669
382 Ga0496124_0030569 3300048927 Bacteria 4778
383 Ga0496124_0031363 3300048927 Bacteria 4705
384 Ga0496124_0050143 3300048927 Bacteria 3558
385 Ga0496124_0060245 3300048927 Bacteria 3185
386 Ga0496124_0173420 3300048927 Bacteria 1667
387 Ga0496124_0229687 3300048927 Bacteria 1388
388 Ga0496124_0233786 3300048927 Bacteria 1372
389 Ga0496124_0361228 3300048927 Bacteria 1023
390 Ga0496125_0000200 3300048928 Bacteria 126369
391 Ga0496125_0005420 3300048928 Bacteria 14199
392 Ga0496125_0007958 3300048928 Bacteria 11194
393 Ga0496125_0018601 3300048928 Bacteria 6595
394 Ga0496126_0022635 3300048929 Bacteria 6107
395 Ga0496126_0149142 3300048929 Bacteria 2005
396 Ga0495678_010187 3300049459 Bacteria 4582
397 Ga0495678_012362 3300049459 Bacteria 4051
398 Ga0495678_021585 3300049459 Bacteria 2832
399 Ga0501031_0086409 3300049568 Bacteria 2045
400 Ga0501032_0482982 3300049569 Bacteria 792
401 Ga0501033_0000079 3300049570 Bacteria 92135
402 Ga0501033_0193273 3300049570 Bacteria 1455
403 Ga0501034_0023379 3300049571 Bacteria 6297
404 Ga0501034_0337134 3300049571 Bacteria 1438
405 Ga0501038_0305987 3300049574 Bacteria 1246
406 Ga0501043_0354336 3300049579 Bacteria 1114
407 Ga0501048_0131952 3300049582 Bacteria 1765
408 Ga0501068_0087009 3300049584 Bacteria 1924
409 Ga0501070_0003222 3300049586 Bacteria 14197
410 Ga0501073_0052887 3300049589 Bacteria 2843
411 Ga0501074_0370848 3300049590 Bacteria 1015
412 Ga0501083_0170226 3300049744 Bacteria 1424
413 Ga0501035_0001129 3300049822 Bacteria 27882
414 nmdc:mga03n38_45459_c1 3300050490 Bacteria 1933
415 nmdc:mga03n38_97476_c1 3300050490 Bacteria 1412
416 nmdc:mga00v17_2539_c1 3300050491 Bacteria 9344
417 nmdc:mga00v17_78_c2 3300050491 Bacteria 19083
418 nmdc:mga00v17_95268_c1 3300050491 Bacteria 1873
419 nmdc:mga0yw44_115_c1 3300050492 Bacteria 24900
420 nmdc:mga0yw44_16254_c1 3300050492 Bacteria 4016
421 nmdc:mga0k408_225780_c1 3300050493 Bacteria 1118
422 nmdc:mga06z11_53266_c1 3300050494 Bacteria 2080
423 Ga0495601_0380765 3300053077 Bacteria 916
424 Ga0500643_042371 3300053087 Bacteria 1333
425 Ga0500556_0066161 3300053104 Bacteria 1342
426 Ga0500557_002749 3300053105 Bacteria 3315
427 Ga0500562_038113 3300053108 Bacteria 1277
428 Ga0500569_002475 3300053109 Bacteria 3643
429 Ga0500569_002962 3300053109 Bacteria 3405
430 Ga0500594_0001733 3300053118 Bacteria 4747
431 Ga0500618_029420 3300053125 Bacteria 1296
432 Ga0500658_0003813 3300053134 Bacteria 5672
433 Ga0500658_0176699 3300053134 Bacteria 971
434 Ga0500568_0004458 3300053139 Bacteria 7477
435 Ga0500568_0008221 3300053139 Bacteria 5050
436 Ga0500573_0025793 3300053140 Bacteria 3379
437 Ga0500586_148979 3300053145 Bacteria 800
438 Ga0500590_000188 3300053148 Bacteria 18658
439 Ga0500616_0000402 3300053153 Bacteria 59210
440 Ga0500616_0003771 3300053153 Bacteria 11286
441 Ga0500622_0002154 3300053156 Bacteria 14609
442 Ga0500633_0068377 3300053160 Bacteria 1264
443 Ga0500636_0000039 3300053177 Bacteria 69891
444 Ga0500636_0075491 3300053177 Bacteria 1950
445 Ga0500645_014791 3300053730 Bacteria 2483
446 Ga0500596_026736 3300053735 Bacteria 884
447 Ga0501084_0298355 3300054114 Bacteria 1361
448 2508726618 2508501050 Bacteria 9633614
449 2509390043 2509276021 Bacteria 7634384
450 2509447704 2509276033 Bacteria 7180565
451 2510134629 2510065019 Bacteria 6903379
452 2510305888 2510065057 Bacteria 6649661
453 2510840662 2510461069 Bacteria 5505000
454 2510895981 2510461076 Bacteria 8618824
455 2511132107 2510917022 Bacteria 6504556
456 2511194976 2510917030 Bacteria 7460662
457 2511498144 2511231052 Bacteria 6974333
458 2512529301 2512047086 Bacteria 6850303
459 2512969455 2512875026 Bacteria 6861065
460 2513573319 2513237084 Bacteria 7231967
461 2513578434 2513237085 Bacteria 7695351
462 2513600973 2513237088 Bacteria 6927906
463 2513606357 2513237089 Bacteria 6553624
464 2513618186 2513237091 Bacteria 6900273
465 2513631538 2513237093 Bacteria 7545552
466 2513710531 2513237103 Bacteria 7647401
467 2513885096 2513237140 Bacteria 7076289
468 2513905598 2513237143 Bacteria 6664116
469 2513930599 2513237146 Bacteria 7166346
470 2514008069 2513237160 Bacteria 6650282
471 2514023482 2513237162 Bacteria 7468464
472 2515113720 2515075009 Bacteria 7288508
473 2515610698 2515154107 Bacteria 6795637
474 2515634585 2515154113 Bacteria 7807172
475 2515645371 2515154114 Bacteria 7848616
476 2515660823 2515154116 Bacteria 7552979
477 2515743437 2515154134 Bacteria 7220242
478 2516896212 2516653046 Bacteria 6989037
479 2517037327 2516653077 Bacteria 7555578
480 2517077636 2516653085 Bacteria 7346596
481 2517096429 2517093000 Bacteria 7412387
482 2517410523 2517287029 Bacteria 6905599
483 2517565666 2517487022 Bacteria 7227575
484 2520381561 2519899620 Bacteria 6499161
485 2524449646 2524023207 Bacteria 6813453
486 2530646751 2529292951 Bacteria 6916614
487 2535519645 2534681796 Bacteria 7146037
488 2551674785 2551306084 Bacteria 8942552
489 2551684998 2551306085 Bacteria 7347181
490 2585169382 2582581283 Bacteria 6030556
491 2585206007 2582581294 Bacteria 6626667
492 2585225010 2582581298 Bacteria 7315509
493 2585233970 2582581299 Bacteria 6518058
494 2585259662 2582581304 Bacteria 5831370
495 2585264433 2582581306 Bacteria 6450535
496 2585276403 2582581307 Bacteria 6597605
497 2585282428 2582581308 Bacteria 7413247
498 2585328607 2582581315 Bacteria 7318924
499 2585336090 2582581316 Bacteria 7774528
500 2585389797 2582581865 Bacteria 6644329
501 2585529545 2585427526 Bacteria 7258840
502 2585536567 2585427527 Bacteria 7273426
503 2585541216 2585427528 Bacteria 6842387
504 2585547566 2585427529 Bacteria 7395659
505 2585557222 2585427530 Bacteria 7383882
506 2585564203 2585427531 Bacteria 6992870
507 2585848098 2585427594 Bacteria 6180594
508 2585897335 2585427608 Bacteria 6544331
509 2585902936 2585427609 Bacteria 6667127
510 2587978489 2585428125 Bacteria 6662905
511 2599335425 2599185156 Bacteria 5403036
512 2599420761 2599185170 Bacteria 7295545
513 2600197504 2599185352 Bacteria 7228948
514 2616311540 2615840626 Bacteria 7921970
515 2616551672 2615840698 Bacteria 7319877
516 2617386415 2617270742 Bacteria 6808054
517 2643809048 2643221557 Bacteria 7184309
518 2643853650 2643221568 Bacteria 5187270
519 2644005692 2643221599 Bacteria 6292121
520 2644069107 2643221610 Bacteria 7480339
521 2644104744 2643221618 Bacteria 7717186
522 2644151175 2643221626 Bacteria 8069654
523 2644196091 2643221634 Bacteria 6705461
524 2644313163 2643221655 Bacteria 7722067
525 2644336249 2643221659 Bacteria 7890716
526 2644420178 2643221675 Bacteria 7473456
527 2644453585 2643221680 Bacteria 7473610
528 2644547086 2643221698 Bacteria 7756764
529 2644612786 2643221712 Bacteria 7729434
530 2644674529 2643221723 Bacteria 7095460
531 2644692284 2643221726 Bacteria 7455827
532 2671116377 2667528174 Bacteria 6435400
533 2719182398 2718217882 Bacteria 6556348
534 2719386973 2718217927 Bacteria 6972593
535 2719666706 2718217997 Bacteria 6740740
536 2719733117 2718218009 Bacteria 6478651
537 2720493126 2718218199 Bacteria 6740745
538 2720614604 2718218232 Bacteria 6720332
539 2720621378 2718218233 Bacteria 6662049
540 2720632704 2718218235 Bacteria 6630699
541 2720776428 2718218269 Bacteria 6906114
542 2721148511 2718218363 Bacteria 6524337
543 2721159896 2718218365 Bacteria 6274507
544 2721165325 2718218366 Bacteria 6425255
545 2721400696 2718218423 Bacteria 6438183
546 2722841495 2721755514 Bacteria 6424414
547 2723028017 2721755556 Bacteria 6745503
548 2723561647 2721755684 Bacteria 6859907
549 2723568276 2721755685 Bacteria 6704835
550 2724039509 2721755809 Bacteria 6438790
551 2724045873 2721755810 Bacteria 6479005
552 2724091035 2721755819 Bacteria 6906405
553 2724105541 2721755822 Bacteria 6726041
554 2724111367 2721755823 Bacteria 6752556
555 2725949744 2724679232 Bacteria 7646494
556 2730108953 2728369352 Bacteria 6745171
557 2730165633 2728369365 Bacteria 6555560
558 2730299528 2728369397 Bacteria 6274511
559 2738805911 2738541293 Bacteria 7065685
560 2738946816 2738541317 Bacteria 5340176
561 2739035769 2738541333 Bacteria 7106503
562 2766065542 2765235942 Bacteria 7445910
563 2776260665 2775506901 Bacteria 9631051
564 2778179390 2775507266 Bacteria 7392367
565 2793293843 2791355256 Bacteria 6798008
566 2793313274 2791355259 Bacteria 7254731
567 2793319930 2791355260 Bacteria 6598818
568 2793328059 2791355261 Bacteria 6661293
569 2793333172 2791355262 Bacteria 6774204
570 2793344934 2791355263 Bacteria 6872478
571 2793347166 2791355264 Bacteria 6429314
572 2793356688 2791355265 Bacteria 6539969
573 2793362851 2791355266 Bacteria 7116587
574 2793370123 2791355267 Bacteria 7222458
575 2802721324 2802428858 Bacteria 6636079
576 2802728266 2802428859 Bacteria 6667919
577 2802733918 2802428860 Bacteria 6525526
578 2802740654 2802428861 Bacteria 6534206
579 2802746945 2802428862 Bacteria 6633353
580 2802748699 2802428863 Bacteria 6410669
581 2805931921 2802429605 Bacteria 6875453
582 2805938166 2802429606 Bacteria 6346811
583 2806044757 2802429633 Bacteria 7341974
584 2806056606 2802429634 Bacteria 7083200
585 2806063879 2802429635 Bacteria 7650140
586 2806068080 2802429636 Bacteria 7597525
587 2806074201 2802429637 Bacteria 7067217
588 2819613285 2818991448 Bacteria 6772224
589 2819643753 2818991453 Bacteria 7181617
590 2838018902 2838016132 Bacteria 6577831
591 2838024506 2838022645 Bacteria 6494267
592 2838034286 2838029111 Bacteria 6603031
593 2838042850 2838035591 Bacteria 7166484
594 2838046450 2838042994 Bacteria 6046894
595 2838051382 2838048938 Bacteria 6044578
596 2838063636 2838061910 Bacteria 6794874
597 2838074211 2838068647 Bacteria 6208656
598 2838668676 2838661181 Bacteria 7385261
599 2838671383 2838668709 Bacteria 6671819
600 2838685168 2838680041 Bacteria 6545511
601 2838691531 2838686498 Bacteria 7807632
602 2838698996 2838694306 Bacteria 6853137
603 2838703436 2838701080 Bacteria 6669771
604 2838712477 2838707686 Bacteria 6619912
605 2838733490 2838729681 Bacteria 7400765
606 2838745938 2838742623 Bacteria 7396178
607 2841853650 2841851746 Bacteria 7532261
608 2842081954 2842077413 Bacteria 6508645
609 2842113661 2842110456 Bacteria 7656360
610 2842122876 2842118031 Bacteria 7033875
611 2842149562 2842146304 Bacteria 5957337
612 2842162343 2842156927 Bacteria 6894975
613 2842169902 2842163707 Bacteria 6916235
614 2842185269 2842180545 Bacteria 6888678
615 2842197679 2842192696 Bacteria 6147454
616 2842200049 2842198810 Bacteria 6608673
617 2842208100 2842205361 Bacteria 6340321
618 2842220295 2842217011 Bacteria 7497767
619 2842233756 2842229732 Bacteria 7475766
620 2842242222 2842237096 Bacteria 6620661
621 2842247800 2842243621 Bacteria 7421798
622 2842253800 2842250916 Bacteria 6579627
623 2842261932 2842257432 Bacteria 7401195
624 2842266408 2842264693 Bacteria 6472963
625 2842276005 2842271015 Bacteria 7807131
626 2842281891 2842278818 Bacteria 6340002
627 2842288996 2842285085 Bacteria 6011953
628 2842295954 2842291075 Bacteria 7076806
629 2842308011 2842304105 Bacteria 7023636
630 2842316102 2842311132 Bacteria 6616990
631 2842321636 2842317721 Bacteria 6793725
632 2842344790 2842341865 Bacteria 7003929
633 2842369431 2842363717 Bacteria 6844742
634 2842377235 2842370503 Bacteria 7038661
635 2842382353 2842377471 Bacteria 7140707
636 2842389754 2842384541 Bacteria 7057858
637 2842401751 2842395702 Bacteria 6780583
638 2842406337 2842402390 Bacteria 6681310
639 2842413236 2842409023 Bacteria 6687331
640 2842419879 2842415677 Bacteria 6596907
641 2842427835 2842422224 Bacteria 6239196
642 2842429727 2842428310 Bacteria 6767288
643 2842436613 2842434925 Bacteria 6502746
644 2842446750 2842441272 Bacteria 6769273
645 2842450817 2842447887 Bacteria 6754142
646 2842464148 2842462802 Bacteria 6588055
647 2842470942 2842469257 Bacteria 6752936
648 2842481032 2842475841 Bacteria 6603183
649 2842487720 2842482326 Bacteria 7212537
650 2842493029 2842489311 Bacteria 6620893
651 2842499403 2842495871 Bacteria 6820686
652 2842507836 2842502639 Bacteria 6604161
653 2842515285 2842509118 Bacteria 6850950
654 2844169706 2844163670 Bacteria 7266046
655 2844457784 2844454524 Bacteria 7952546
656 2852387718 2852387548 Bacteria 8025568
657 2855828963 2855825444 Bacteria 6785811
658 2855844080 2855839649 Bacteria 7135830
659 2857519125 2857516855 Bacteria 7787325
660 2858806670 2858800743 Bacteria 6603254
661 2894242134 2894232714 Bacteria 8834183
662 2899808779 2899803654 Bacteria 5577784
663 2913311824 2913308742 Bacteria 5350706
664 2915985912 2915980308 Bacteria 6624279
665 2915991668 2915986958 Bacteria 6739310
666 2915998367 2915993759 Bacteria 7016183
667 2916006703 2916000859 Bacteria 6865702
668 2916009800 2916007675 Bacteria 6898660
669 2916016710 2916014648 Bacteria 6946486
670 2916024290 2916021584 Bacteria 6854472
671 2916030367 2916028427 Bacteria 6748433
672 2916039449 2916035215 Bacteria 6755766
673 2916047590 2916041962 Bacteria 6820487
674 2916049691 2916048683 Bacteria 6543552
675 2916060956 2916055098 Bacteria 6758838
676 2916063039 2916061851 Bacteria 6737736
677 2916070054 2916068649 Bacteria 6943657
678 2916081164 2916076590 Bacteria 6596108
679 2919104334 2919100787 Bacteria 7710546
680 2919168079 2919166419 Bacteria 4952238
681 2919414059 2919408235 Bacteria 6149349
682 2920826701 2920822456 Bacteria 6897201
683 2921213444 2921208531 Bacteria 6745326
684 2921242897 2921237296 Bacteria 6876710
685 2921248839 2921244191 Bacteria 6568419
686 2921256569 2921250672 Bacteria 6677771
687 2921262943 2921257292 Bacteria 6808382
688 2921269059 2921263974 Bacteria 6864552
689 2921288986 2921282425 Bacteria 6826397
690 2921295575 2921289301 Bacteria 7316391
691 2921297425 2921296804 Bacteria 7176999
692 2924145105 2924144063 Bacteria 6883928
693 2924156829 2924150972 Bacteria 7169444
694 2924162147 2924158325 Bacteria 7188855
695 2924169217 2924165586 Bacteria 7260590
696 2924173815 2924172951 Bacteria 6749356
697 2924185691 2924179722 Bacteria 6843264
698 2924192296 2924186466 Bacteria 6876637
699 2924196195 2924193448 Bacteria 6955718
700 2924203728 2924200457 Bacteria 6757188
701 2924209599 2924207177 Bacteria 6917007
702 2924221558 2924214083 Bacteria 7080103
703 2924226617 2924221636 Bacteria 7113495
704 2924231285 2924228884 Bacteria 6633132
705 2933018870 2933016740 Bacteria 6355406
706 2933574461 2933570622 Bacteria 7023390
707 2933589049 2933586486 Bacteria 7667493
708 2933604667 2933599457 Bacteria 5858799
709 2935899941 2935894831 Bacteria 6620579
710 2935907122 2935901341 Bacteria 7341747
711 2936375097 2936367885 Bacteria 7324495
712 2936380773 2936375103 Bacteria 6652732
713 2936382061 2936381700 Bacteria 7006523
714 2937002316 2936996657 Bacteria 6298727
715 2937003582 2937002841 Bacteria 6934057
716 2937012094 2937009748 Bacteria 6746052
717 2937017458 2937016420 Bacteria 6782579
718 2937024966 2937023124 Bacteria 6815156
719 2937033286 2937029754 Bacteria 6424026
720 2937040602 2937036028 Bacteria 6846469
721 2937043810 2937042894 Bacteria 6741576
722 2937058244 2937056579 Bacteria 7107896
723 2937069778 2937063883 Bacteria 7199456
724 2937074321 2937071275 Bacteria 6984483
725 2937083736 2937078374 Bacteria 6610289
726 2937086392 2937084907 Bacteria 6618516
727 2937097554 2937091812 Bacteria 6979387
728 2937102418 2937098957 Bacteria 7249374
729 2937111085 2937106411 Bacteria 6947143
730 2937114799 2937113482 Bacteria 6505872
731 2937122882 2937119839 Bacteria 6597547
732 2937126939 2937126314 Bacteria 6771275
733 2941504379 2941499720 Bacteria 7599444
734 2957379181 2957375807 Bacteria 6425588
735 2957383233 2957382221 Bacteria 6737050
736 2957390529 2957388812 Bacteria 6778072
737 2957399425 2957395598 Bacteria 6822399
738 2957403533 2957402308 Bacteria 6741770
739 2957411292 2957408893 Bacteria 6558585
740 2957417762 2957415311 Bacteria 6991633
741 2957426882 2957422303 Bacteria 7172205
742 2957432662 2957430029 Bacteria 7022557
743 2957445126 2957443900 Bacteria 6869977
744 2957452538 2957450854 Bacteria 6765715
745 2957458832 2957457609 Bacteria 6967680
746 2957466798 2957464669 Bacteria 6568877
747 2957472669 2957471148 Bacteria 6797643
748 2957484189 2957478035 Bacteria 6756658
749 2957490332 2957484790 Bacteria 6703082
750 2957495485 2957491536 Bacteria 6695180
751 2957500830 2957498199 Bacteria 7126688
752 2957508513 2957505466 Bacteria 7253085
753 2960590953 2960584000 Bacteria 6864594
754 2960595035 2960591022 Bacteria 6622873
755 2960601681 2960597568 Bacteria 6550735
756 2960608946 2960603979 Bacteria 6898737
757 2960613054 2960610863 Bacteria 6691244
758 2960619886 2960617483 Bacteria 6727748
759 2960628055 2960624210 Bacteria 6875384
760 2960633060 2960631154 Bacteria 6732508
761 2960641729 2960637947 Bacteria 7296468
762 2960647846 2960645483 Bacteria 7211087
763 2960658831 2960652885 Bacteria 7083688
764 2960661847 2960660292 Bacteria 7041660
765 2960668612 2960667422 Bacteria 6763020
766 2960676681 2960674078 Bacteria 6609048
767 2960684348 2960680706 Bacteria 6624464
768 2960688407 2960687367 Bacteria 6535474
769 2960700875 2960693952 Bacteria 6749742
770 2964609902 2964607997 Bacteria 7101408
771 2964618471 2964615318 Bacteria 6809089
772 2964623387 2964621998 Bacteria 6834995
773 2964629221 2964628898 Bacteria 7083044
774 2964640848 2964636051 Bacteria 7091832
775 2964646499 2964643177 Bacteria 6820887
776 2964654273 2964649959 Bacteria 6675118
777 2964661486 2964656573 Bacteria 7100150
778 2964665494 2964663802 Bacteria 7019362
779 2964676821 2964670856 Bacteria 6851364
780 2964681873 2964678106 Bacteria 6792020
781 2964688878 2964685014 Bacteria 6839111
782 2964696454 2964691889 Bacteria 6802758
783 2964704420 2964698721 Bacteria 6765331
784 2964706666 2964705432 Bacteria 7114648
785 2964715545 2964712639 Bacteria 6695970
786 2964726337 2964719344 Bacteria 7286602
787 2967665750 2967664464 Bacteria 6948836
788 2967676176 2967671571 Bacteria 7021409
789 2967684670 2967678726 Bacteria 7264382
790 2967689180 2967686174 Bacteria 6678622
791 2967694307 2967693043 Bacteria 6804451
792 2967700941 2967699805 Bacteria 6854538
793 2967708831 2967706974 Bacteria 7186053
794 2967716201 2967714385 Bacteria 7000047
795 2967724325 2967721400 Bacteria 7073753
796 2967732074 2967728569 Bacteria 6641507
797 2967736630 2967735183 Bacteria 6827012
798 2967747899 2967742019 Bacteria 6794534
799 2967752003 2967748971 Bacteria 6733771
800 2967758517 2967755722 Bacteria 6814706
801 2967765585 2967762386 Bacteria 6923502
802 2967772549 2967769361 Bacteria 6587838
803 2967781498 2967775926 Bacteria 6738189
804 2970024501 2970019648 Bacteria 7072033
805 2970035420 2970033650 Bacteria 7118744
806 2970047040 2970040964 Bacteria 6731123
807 2970048661 2970047711 Bacteria 7088379
808 2970057310 2970054988 Bacteria 6611507
809 2970065871 2970061556 Bacteria 7099761
810 2970071769 2970068827 Bacteria 7123112
811 2970078654 2970076120 Bacteria 6697332
812 2970087162 2970082768 Bacteria 6183754
813 2970090678 2970088815 Bacteria 6933825
814 2970097160 2970095765 Bacteria 6936963
815 2970105244 2970102677 Bacteria 6812532
816 2970110105 2970109326 Bacteria 6863976
817 2970119725 2970116247 Bacteria 6501857
818 2970127298 2970122695 Bacteria 6625855
819 2970135643 2970129317 Bacteria 6806560
820 2970136631 2970136068 Bacteria 7207982
821 2970146793 2970143518 Bacteria 6446480
822 2970155911 2970149975 Bacteria 6779706
823 2970163285 2970156795 Bacteria 7168044
824 2970166675 2970164137 Bacteria 6861252
825 2970173156 2970170962 Bacteria 6876229
826 2970180886 2970177841 Bacteria 6768001
827 2970187502 2970184632 Bacteria 7054431
828 2970194805 2970191845 Bacteria 7032787
829 2977521831 2977516862 Bacteria 6940108
830 2977525386 2977523885 Bacteria 6960446
831 2977534735 2977530762 Bacteria 6951399
832 2977539186 2977537788 Bacteria 6929320
833 2977547490 2977544691 Bacteria 6875412
834 2977555482 2977551784 Bacteria 7125765
835 2977563911 2977558990 Bacteria 6863948
836 2977568515 2977565890 Bacteria 6901543
837 2977575242 2977572785 Bacteria 6763888
838 2977581136 2977579622 Bacteria 6772100
839 2996890024 2996887358 Bacteria 5795980
840 2996895837 2996893221 Bacteria 5823108
841 3005419235 3005416602 Bacteria 7064308
842 3005449056 3005445848 Bacteria 6906074
843 3005455336 3005452660 Bacteria 5889319
844 639649750 639633055 Bacteria 7751309
845 648738708 648276728 Bacteria 6968865
846 8003996660 8003992118 Bacteria 7266902
847 8004004146 8003999396 Bacteria 7063185
848 8005262211 8005258706 Bacteria 6184835
849 8005281787 8005275841 Bacteria 6929066
850 8005288781 8005282627 Bacteria 6675747
851 8005294497 8005289223 Bacteria 6634003
852 8005306895 8005301065 Bacteria 6614431
853 8005310739 8005307578 Bacteria 7395396
854 8005318862 8005314921 Bacteria 7072929
855 8005324551 8005321885 Bacteria 5795980
856 8005378371 8005376324 Bacteria 6590079
857 8005385631 8005382845 Bacteria 6732062
858 8005401394 8005395548 Bacteria 6806915
859 8005434328 8005430974 Bacteria 6689030
860 8005464408 8005460587 Bacteria 7157962
861 8005489327 8005484373 Bacteria 6297373
862 8005501451 8005497431 Bacteria 6477605
863 8005547347 8005542996 Bacteria 7077758
864 8005560910 8005556819 Bacteria 6908598
865 8005566555 8005563573 Bacteria 7153261
866 8005575143 8005570704 Bacteria 6957481
867 8005622814 8005619151 Bacteria 7030230
868 8005631886 8005626139 Bacteria 6534237
869 8005645460 8005645114 Bacteria 6950293
870 8005661922 8005658619 Bacteria 4500593
871 8005672872 8005668836 Bacteria 6953162
872 8005687681 8005682033 Bacteria 6726518
873 8005693358 8005688590 Bacteria 6610080
874 8005700641 8005695170 Bacteria 6912330
875 8018133819 8018127388 Bacteria 7351159
876 8018169999 8018163183 Bacteria 7277977
877 8018178719 8018176218 Bacteria 6896178
878 8023687763 8023680758 Bacteria 7729763
879 8024481565 8024479707 Bacteria 6954785
880 8024506188 8024501048 Bacteria 6427847
881 8046771567 8046767195 Bacteria 7547379
882 8056386822 8056382006 Bacteria 6408074
883 8057577845 8057575449 Bacteria 7367519
884 8057876601 8057874678 Bacteria 7494653
885 Ga0500573_0029916
886 JGI24740J21852_10000539
887 JGI25155J39150_1000069
888 JGI25156J39149_1000095
889 JGI25162J39368_1001254
890 JGI25162J39368_1001406
891 JGI25154J39366_1000856
892 JGI25158J39367_1000276
893 JGI25158J39367_1003261
894 JGI25157J39369_1000216
895 JGI25163J39215_1005438
896 JGI25152J39213_1001298
897 JGI25152J39213_1002837
898 JGI25152J39213_1016736
899 JGI25150J39212_1000758
900 JGI25159J45721_1000100
901 JGI25159J45721_1000155
902 JGI25159J45721_1000377
903 JGI25159J45721_1009950
904 JGI25151J46595_10002440
905 JGI25151J46595_10009392
906 JGI25151J46595_10020286
907 JGI25165J46597_1001859
908 JGI25165J46597_1001944
909 JGI25165J46597_1004988
910 JGI25153J46596_10002854
911 JGI25153J46596_10003119
912 rootH2_10074397
913 rootH2_10255824
914 rootL2_10039230
915 rootL2_10192180
916 JGI25160J50197_1000086
917 JGI25160J50197_1000326
918 JGI25160J50197_1008558
919 JGI25161J50226_1000244
920 JGI25161J50226_1000389
921 Ga0055526_1000664
922 Ga0055526_1000684
923 Ga0055526_1006983
924 Ga0055526_1014356
925 Ga0055526_1017789
926 Ga0055524_1001927
927 Ga0055524_1017974
928 Ga0055524_1028865
929 Ga0055536_1006158
930 Ga0055528_1003603
931 Ga0055528_1003953
932 Ga0055528_1004732
933 Ga0055528_1005353
934 Ga0055528_1006966
935 Ga0055528_1013422
936 Ga0055528_1015785
937 Ga0055540_1003293
938 Ga0055531_10024040
939 Ga0055543_1000114
940 Ga0055543_1000166
941 Ga0055543_1000296
942 Ga0055543_1007358
943 Ga0065165_1000511
944 Ga0065165_1000813
945 Ga0065165_1008324
946 Ga0065165_1013126
947 Ga0070666_10138935
948 Ga0070671_100007941
949 Ga0070667_100251760
950 Ga0070663_100029985
951 Ga0070665_100093721
952 Ga0068854_100340770
953 Ga0075365_10000225
954 Ga0075365_10000513
955 Ga0075363_100120981
956 Ga0075364_10000074
957 Ga0075362_10004332
958 Ga0075367_10002628
959 Ga0075367_10008640
960 Ga0075369_10015256
961 Ga0075370_10002082
962 Ga0079104_1000063
963 Ga0105250_10018660
964 Ga0105240_10000310
965 Ga0105243_10198150
966 Ga0105248_10022722
967 Ga0105237_10010854
968 Ga0123340_1065979
969 Ga0123341_1000068
970 Ga0123341_1076233
971 Ga0123342_1008973
972 Ga0123342_1016517
973 Ga0105239_10011757
974 Ga0157326_1007274
975 Ga0157370_10006275
976 Ga0157370_10799413
977 Ga0157369_10389105
978 Ga0157369_10491157
979 Ga0171463_1010
980 Ga0163162_10311638
981 Ga0182008_10089462
982 Ga0182007_10003022
983 Ga0182005_1023562
984 Ga0183363_1036
985 Ga0228710_1000058
986 Ga0209435_100049
987 Ga0209436_100023
988 Ga0209436_100046
989 Ga0209672_102141
990 Ga0209437_100376
991 Ga0209437_100448
992 Ga0207425_1001227
993 Ga0207425_1006483
994 Ga0207425_1024339
995 Ga0209646_1000159
996 Ga0209646_1016960
997 Ga0209026_1000183
998 Ga0209759_1000206
999 Ga0209129_1000128
1000 Ga0209129_1000313
1001 Ga0209129_1001726
1002 Ga0209129_1001845
1003 Ga0209129_1002817
1004 Ga0209129_1006329
1005 Ga0209129_1011136
1006 Ga0209233_1000368
1007 Ga0209233_1000726
1008 Ga0209233_1000818
1009 Ga0209673_1000060
1010 Ga0209673_1000233
1011 Ga0209673_1000978
1012 Ga0209673_1000980
1013 Ga0209673_1004122
1014 Ga0209673_1007018
1015 Ga0209673_1011179
1016 Ga0209673_1053341
1017 Ga0209130_1000074
1018 Ga0209130_1000173
1019 Ga0209130_1000377
1020 Ga0209676_1002284
1021 Ga0209676_1032826
1022 Ga0209025_1000758
1023 Ga0209025_1003257
1024 Ga0209025_1004914
1025 Ga0209025_1006988
1026 Ga0209025_1020783
1027 Ga0209025_1025725
1028 Ga0209025_1060929
1029 Ga0209564_1000116
1030 Ga0209564_1000125
1031 Ga0209564_1000856
1032 Ga0209564_1001100
1033 Ga0209564_1028771
1034 Ga0209564_1030493
1035 Ga0209564_1033749
1036 Ga0209564_1036982
1037 Ga0209758_1000105
1038 Ga0209758_1001294
1039 Ga0209758_1002006
1040 Ga0209758_1002976
1041 Ga0209758_1004660
1042 Ga0209758_1015102
1043 Ga0209758_1015283
1044 Ga0209050_1002732
1045 Ga0209050_1009759
1046 Ga0209050_1025324
1047 Ga0209256_1000164
1048 Ga0209256_1000772
1049 Ga0209256_1003329
1050 Ga0209256_1005430
1051 Ga0209256_1006743
1052 Ga0209256_1008738
1053 Ga0209256_1009138
1054 Ga0209256_1026622
1055 Ga0207426_1000047
1056 Ga0207426_1000165
1057 Ga0207426_1000276
1058 Ga0207426_1000330
1059 Ga0207426_1002258
1060 Ga0209051_1000217
1061 Ga0209051_1001739
1062 Ga0209051_1007259
1063 Ga0209051_1020696
1064 Ga0209051_1032123
1065 Ga0209051_1033854
1066 Ga0209257_1002649
1067 Ga0209257_1002865
1068 Ga0209257_1020240
1069 Ga0209257_1021222
1070 Ga0209257_1033343
1071 Ga0209257_1057225
1072 Ga0207680_10159732
1073 Ga0207695_10000403
1074 Ga0207671_10007001
1075 Ga0207644_10042630
1076 Ga0207709_10514381
1077 Ga0207667_10722228
1078 Ga0207640_10685444
1079 Ga0209281_1000110
1080 Ga0209281_1000226
1081 Ga0209813_10100045
1082 Ga0268266_10702546
1083 Ga0307515_10002178
1084 Ga0307515_10024859
1085 Ga0307513_10005733
1086 Ga0307513_10018268
1087 Ga0307408_100046766
1088 Ga0307408_100168273
1089 Ga0307405_10006156
1090 Ga0307406_10572336
1091 Ga0307407_10271484
1092 Ga0307412_10007550
1093 Ga0307412_10715366
1094 Ga0307409_100121448
1095 Ga0307416_100105887
1096 Ga0307416_101468893
1097 Ga0395905_0388870
1098 Ga0439465_0014503
1099 Ga0439465_0022582
1100 Ga0451787_515154
1101 Ga0451798_0281256
1102 Ga0451804_1151623
1103 Ga0451833_1410064
1104 Ga0451835_0289993
1105 Ga0451835_0666526
1106 Ga0451837_0365013
1107 Ga0451841_0308011
1108 Ga0451845_0001155
1109 Ga0451847_0112209
1110 Ga0451849_0526961
1111 Ga0451851_1003856
1112 Ga0451843_0439469
1113 Ga0451843_1432342
1114 Ga0451855_1775390
1115 Ga0451855_1940470
1116 Ga0451855_1955456
1117 Ga0439431_0034036
1118 Ga0439445_0119740
1119 Ga0439449_0020659
1120 Ga0466972_0198200
1121 Ga0466965_0027786
1122 Ga0466963_0107711
1123 Ga0466970_0001973
1124 Ga0466970_0326479
1125 Ga0466960_0125933
1126 Ga0466959_0461977
1127 Ga0451576_0086718
1128 Ga0466967_0219795
1129 Ga0495638_0003894
1130 Ga0495638_0034056
1131 Ga0495605_0016385
1132 Ga0495605_0020739
1133 Ga0495605_0061099
1134 Ga0495662_0101646
1135 Ga0495585_0016306
1136 Ga0495585_0017012
1137 Ga0495596_0021504
1138 Ga0495607_0025498
1139 Ga0495607_0033373
1140 Ga0495607_0069287
1141 Ga0495583_0004468
1142 Ga0495583_0026629
1143 Ga0495583_0103859
1144 Ga0495606_0007626
1145 Ga0495606_0021019
1146 Ga0495606_0040844
1147 Ga0495610_0027510
1148 Ga0495610_0029781
1149 Ga0495610_0065473
1150 Ga0495616_0053711
1151 Ga0495616_0077134
1152 Ga0495616_0154205
1153 Ga0495620_0027734
1154 Ga0495620_0032546
1155 Ga0495620_0035062
1156 Ga0495620_0063460
1157 Ga0495631_0002202
1158 Ga0495631_0053265
1159 Ga0495632_0004949
1160 Ga0495632_0025308
1161 Ga0495632_0025805
1162 Ga0495643_0010849
1163 Ga0495643_0049415
1164 Ga0495643_0089504
1165 Ga0495643_0105404
1166 Ga0495648_0042256
1167 Ga0495663_0121807
1168 Ga0495652_0188008
1169 Ga0495654_0046331
1170 Ga0495587_0169157
1171 Ga0495609_0024320
1172 Ga0495609_0094272
1173 Ga0495622_0045913
1174 Ga0495633_0015520
1175 Ga0495633_0048621
1176 Ga0495668_0013062
1177 Ga0495668_0051097
1178 Ga0495668_0057126
1179 Ga0495668_0148145
1180 Ga0495611_0062626
1181 Ga0495625_0033570
1182 Ga0495625_0048632
1183 Ga0495625_0126970
1184 Ga0495635_0209101
1185 Ga0495661_0118793
1186 Ga0495588_0067705
1187 Ga0495657_0144218
1188 Ga0495624_0159142
1189 Ga0495671_0198879
1190 Ga0495671_0251012
1191 Ga0495649_0043451
1192 Ga0495589_0107938
1193 Ga0495660_0025477
1194 Ga0495672_0043685
1195 Ga0495683_0235135
1196 Ga0495687_015705
1197 Ga0495687_114870
1198 Ga0495679_064750
1199 Ga0495685_006175
1200 Ga0495673_0024882
1201 Ga0495681_0022554
1202 Ga0495686_0001009
1203 Ga0495686_0026745
1204 Ga0495686_0039795
1205 Ga0496100_0005866
1206 Ga0496101_0011732
1207 Ga0496101_0149878
1208 Ga0496102_0003609
1209 Ga0496103_0003409
1210 Ga0496106_0000245
1211 Ga0496106_0313256
1212 Ga0496110_0452911
1213 Ga0496113_0061526
1214 Ga0496113_0162713
1215 Ga0496114_0030158
1216 Ga0496116_0005898
1217 Ga0496116_0007260
1218 Ga0496116_0011549
1219 Ga0496116_0013204
1220 Ga0496117_0005216
1221 Ga0496117_0034752
1222 Ga0496117_0049870
1223 Ga0496117_0051189
1224 Ga0496118_0006282
1225 Ga0496118_0011384
1226 Ga0496118_0023230
1227 Ga0496118_0057211
1228 Ga0496119_0015993
1229 Ga0496119_0017889
1230 Ga0496119_0055142
1231 Ga0496119_0158484
1232 Ga0496119_0168056
1233 Ga0496120_0007930
1234 Ga0496120_0037002
1235 Ga0496121_0000003
1236 Ga0496121_0000180
1237 Ga0496121_0007528
1238 Ga0496121_0017187
1239 Ga0496121_0021666
1240 Ga0496121_0034476
1241 Ga0496121_0065254
1242 Ga0496121_0068065
1243 Ga0496121_0099410
1244 Ga0496121_0234504
1245 Ga0496121_0375723
1246 Ga0496121_0492150
1247 Ga0496122_0000107
1248 Ga0496122_0006721
1249 Ga0496122_0011947
1250 Ga0496122_0018249
1251 Ga0496122_0024001
1252 Ga0496122_0028240
1253 Ga0496122_0101348
1254 Ga0496122_0103482
1255 Ga0496123_0000063
1256 Ga0496123_0007318
1257 Ga0496123_0026372
1258 Ga0496123_0027399
1259 Ga0496123_0030032
1260 Ga0496123_0045118
1261 Ga0496123_0052925
1262 Ga0496123_0153074
1263 Ga0496124_0004497
1264 Ga0496124_0015352
1265 Ga0496124_0017855
1266 Ga0496124_0030569
1267 Ga0496124_0031363
1268 Ga0496124_0050143
1269 Ga0496124_0060245
1270 Ga0496124_0173420
1271 Ga0496124_0229687
1272 Ga0496124_0233786
1273 Ga0496124_0361228
1274 Ga0496125_0000200
1275 Ga0496125_0005420
1276 Ga0496125_0007958
1277 Ga0496125_0018601
1278 Ga0496126_0022635
1279 Ga0496126_0149142
1280 Ga0495678_010187
1281 Ga0495678_012362
1282 Ga0495678_021585
1283 Ga0501031_0086409
1284 Ga0501032_0482982
1285 Ga0501033_0000079
1286 Ga0501033_0193273
1287 Ga0501034_0023379
1288 Ga0501034_0337134
1289 Ga0501038_0305987
1290 Ga0501043_0354336
1291 Ga0501048_0131952
1292 Ga0501068_0087009
1293 Ga0501070_0003222
1294 Ga0501073_0052887
1295 Ga0501074_0370848
1296 Ga0501083_0170226
1297 Ga0501035_0001129
1298 nmdc:mga03n38_45459_c1
1299 nmdc:mga03n38_97476_c1
1300 nmdc:mga00v17_2539_c1
1301 nmdc:mga00v17_78_c2
1302 nmdc:mga00v17_95268_c1
1303 nmdc:mga0yw44_115_c1
1304 nmdc:mga0yw44_16254_c1
1305 nmdc:mga0k408_225780_c1
1306 nmdc:mga06z11_53266_c1
1307 Ga0495601_0380765
1308 Ga0500643_042371
1309 Ga0500556_0066161
1310 Ga0500557_002749
1311 Ga0500562_038113
1312 Ga0500569_002475
1313 Ga0500569_002962
1314 Ga0500594_0001733
1315 Ga0500618_029420
1316 Ga0500658_0003813
1317 Ga0500658_0176699
1318 Ga0500568_0004458
1319 Ga0500568_0008221
1320 Ga0500573_0025793
1321 Ga0500586_148979
1322 Ga0500590_000188
1323 Ga0500616_0000402
1324 Ga0500616_0003771
1325 Ga0500622_0002154
1326 Ga0500633_0068377
1327 Ga0500636_0000039
1328 Ga0500636_0075491
1329 Ga0500645_014791
1330 Ga0500596_026736
1331 Ga0501084_0298355
1332 2508726618
1333 2509390043
1334 2509447704
1335 2510134629
1336 2510305888
1337 2510840662
1338 2510895981
1339 2511132107
1340 2511194976
1341 2511498144
1342 2512529301
1343 2512969455
1344 2513573319
1345 2513578434
1346 2513600973
1347 2513606357
1348 2513618186
1349 2513631538
1350 2513710531
1351 2513885096
1352 2513905598
1353 2513930599
1354 2514008069
1355 2514023482
1356 2515113720
1357 2515610698
1358 2515634585
1359 2515645371
1360 2515660823
1361 2515743437
1362 2516896212
1363 2517037327
1364 2517077636
1365 2517096429
1366 2517410523
1367 2517565666
1368 2520381561
1369 2524449646
1370 2530646751
1371 2535519645
1372 2551674785
1373 2551684998
1374 2585169382
1375 2585206007
1376 2585225010
1377 2585233970
1378 2585259662
1379 2585264433
1380 2585276403
1381 2585282428
1382 2585328607
1383 2585336090
1384 2585389797
1385 2585529545
1386 2585536567
1387 2585541216
1388 2585547566
1389 2585557222
1390 2585564203
1391 2585848098
1392 2585897335
1393 2585902936
1394 2587978489
1395 2599335425
1396 2599420761
1397 2600197504
1398 2616311540
1399 2616551672
1400 2617386415
1401 2643809048
1402 2643853650
1403 2644005692
1404 2644069107
1405 2644104744
1406 2644151175
1407 2644196091
1408 2644313163
1409 2644336249
1410 2644420178
1411 2644453585
1412 2644547086
1413 2644612786
1414 2644674529
1415 2644692284
1416 2671116377
1417 2719182398
1418 2719386973
1419 2719666706
1420 2719733117
1421 2720493126
1422 2720614604
1423 2720621378
1424 2720632704
1425 2720776428
1426 2721148511
1427 2721159896
1428 2721165325
1429 2721400696
1430 2722841495
1431 2723028017
1432 2723561647
1433 2723568276
1434 2724039509
1435 2724045873
1436 2724091035
1437 2724105541
1438 2724111367
1439 2725949744
1440 2730108953
1441 2730165633
1442 2730299528
1443 2738805911
1444 2738946816
1445 2739035769
1446 2766065542
1447 2776260665
1448 2778179390
1449 2793293843
1450 2793313274
1451 2793319930
1452 2793328059
1453 2793333172
1454 2793344934
1455 2793347166
1456 2793356688
1457 2793362851
1458 2793370123
1459 2802721324
1460 2802728266
1461 2802733918
1462 2802740654
1463 2802746945
1464 2802748699
1465 2805931921
1466 2805938166
1467 2806044757
1468 2806056606
1469 2806063879
1470 2806068080
1471 2806074201
1472 2819613285
1473 2819643753
1474 2838018902
1475 2838024506
1476 2838034286
1477 2838042850
1478 2838046450
1479 2838051382
1480 2838063636
1481 2838074211
1482 2838668676
1483 2838671383
1484 2838685168
1485 2838691531
1486 2838698996
1487 2838703436
1488 2838712477
1489 2838733490
1490 2838745938
1491 2841853650
1492 2842081954
1493 2842113661
1494 2842122876
1495 2842149562
1496 2842162343
1497 2842169902
1498 2842185269
1499 2842197679
1500 2842200049
1501 2842208100
1502 2842220295
1503 2842233756
1504 2842242222
1505 2842247800
1506 2842253800
1507 2842261932
1508 2842266408
1509 2842276005
1510 2842281891
1511 2842288996
1512 2842295954
1513 2842308011
1514 2842316102
1515 2842321636
1516 2842344790
1517 2842369431
1518 2842377235
1519 2842382353
1520 2842389754
1521 2842401751
1522 2842406337
1523 2842413236
1524 2842419879
1525 2842427835
1526 2842429727
1527 2842436613
1528 2842446750
1529 2842450817
1530 2842464148
1531 2842470942
1532 2842481032
1533 2842487720
1534 2842493029
1535 2842499403
1536 2842507836
1537 2842515285
1538 2844169706
1539 2844457784
1540 2852387718
1541 2855828963
1542 2855844080
1543 2857519125
1544 2858806670
1545 2894242134
1546 2899808779
1547 2913311824
1548 2915985912
1549 2915991668
1550 2915998367
1551 2916006703
1552 2916009800
1553 2916016710
1554 2916024290
1555 2916030367
1556 2916039449
1557 2916047590
1558 2916049691
1559 2916060956
1560 2916063039
1561 2916070054
1562 2916081164
1563 2919104334
1564 2919168079
1565 2919414059
1566 2920826701
1567 2921213444
1568 2921242897
1569 2921248839
1570 2921256569
1571 2921262943
1572 2921269059
1573 2921288986
1574 2921295575
1575 2921297425
1576 2924145105
1577 2924156829
1578 2924162147
1579 2924169217
1580 2924173815
1581 2924185691
1582 2924192296
1583 2924196195
1584 2924203728
1585 2924209599
1586 2924221558
1587 2924226617
1588 2924231285
1589 2933018870
1590 2933574461
1591 2933589049
1592 2933604667
1593 2935899941
1594 2935907122
1595 2936375097
1596 2936380773
1597 2936382061
1598 2937002316
1599 2937003582
1600 2937012094
1601 2937017458
1602 2937024966
1603 2937033286
1604 2937040602
1605 2937043810
1606 2937058244
1607 2937069778
1608 2937074321
1609 2937083736
1610 2937086392
1611 2937097554
1612 2937102418
1613 2937111085
1614 2937114799
1615 2937122882
1616 2937126939
1617 2941504379
1618 2957379181
1619 2957383233
1620 2957390529
1621 2957399425
1622 2957403533
1623 2957411292
1624 2957417762
1625 2957426882
1626 2957432662
1627 2957445126
1628 2957452538
1629 2957458832
1630 2957466798
1631 2957472669
1632 2957484189
1633 2957490332
1634 2957495485
1635 2957500830
1636 2957508513
1637 2960590953
1638 2960595035
1639 2960601681
1640 2960608946
1641 2960613054
1642 2960619886
1643 2960628055
1644 2960633060
1645 2960641729
1646 2960647846
1647 2960658831
1648 2960661847
1649 2960668612
1650 2960676681
1651 2960684348
1652 2960688407
1653 2960700875
1654 2964609902
1655 2964618471
1656 2964623387
1657 2964629221
1658 2964640848
1659 2964646499
1660 2964654273
1661 2964661486
1662 2964665494
1663 2964676821
1664 2964681873
1665 2964688878
1666 2964696454
1667 2964704420
1668 2964706666
1669 2964715545
1670 2964726337
1671 2967665750
1672 2967676176
1673 2967684670
1674 2967689180
1675 2967694307
1676 2967700941
1677 2967708831
1678 2967716201
1679 2967724325
1680 2967732074
1681 2967736630
1682 2967747899
1683 2967752003
1684 2967758517
1685 2967765585
1686 2967772549
1687 2967781498
1688 2970024501
1689 2970035420
1690 2970047040
1691 2970048661
1692 2970057310
1693 2970065871
1694 2970071769
1695 2970078654
1696 2970087162
1697 2970090678
1698 2970097160
1699 2970105244
1700 2970110105
1701 2970119725
1702 2970127298
1703 2970135643
1704 2970136631
1705 2970146793
1706 2970155911
1707 2970163285
1708 2970166675
1709 2970173156
1710 2970180886
1711 2970187502
1712 2970194805
1713 2977521831
1714 2977525386
1715 2977534735
1716 2977539186
1717 2977547490
1718 2977555482
1719 2977563911
1720 2977568515
1721 2977575242
1722 2977581136
1723 2996890024
1724 2996895837
1725 3005419235
1726 3005449056
1727 3005455336
1728 639649750
1729 648738708
1730 8003996660
1731 8004004146
1732 8005262211
1733 8005281787
1734 8005288781
1735 8005294497
1736 8005306895
1737 8005310739
1738 8005318862
1739 8005324551
1740 8005378371
1741 8005385631
1742 8005401394
1743 8005434328
1744 8005464408
1745 8005489327
1746 8005501451
1747 8005547347
1748 8005560910
1749 8005566555
1750 8005575143
1751 8005622814
1752 8005631886
1753 8005645460
1754 8005661922
1755 8005672872
1756 8005687681
1757 8005693358
1758 8005700641
1759 8018133819
1760 8018169999
1761 8018178719
1762 8023687763
1763 8024481565
1764 8024506188
1765 8046771567
1766 8056386822
1767 8057577845
1768 8057876601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

66

215

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f06-assembly2.cif.gz_B crystal structure of 1144 0.8584 20 214
7f06-assembly2.cif.gz_B crystal structure of 1144 0.8401 20 214
1vch-assembly2.cif.gz_C crystal structure of a phosphoribosyltransferase-related protein from thermus thermophilus 0.8352 24 215
1vch-assembly2.cif.gz_D crystal structure of a phosphoribosyltransferase-related protein from thermus thermophilus 0.8326 24 215
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.8319 61 212
ID Description Score Start End Superfamily
af_F1QWW2_6_189_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8597 59 184 3.40.50.2020
1vchA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8265 24 215 3.40.50.2020
af_P9WQ07_33_212_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8263 59 212 3.40.50.2020
1vchA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8221 24 215 3.40.50.2020
6fd5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8221 65 212 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A5M8TS44-F1-model_v4 deleted 0.9643 1 225
AF-A0A1E3YAA1-F1-model_v4 Phosphoribosyltransferase 0.9494 1 226 GO:0016757
AF-A0A1E3YAA1-F1-model_v4 Phosphoribosyltransferase 0.9453 1 226 GO:0016757
AF-A0A0T6XWV1-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9438 1 225
AF-A0A840LPQ6-F1-model_v4 deleted 0.9438 1 183

Map