F484650

General Info

Members Datasets Scaffolds Average Seq Length
885 483 565 165

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1005991|Ga0055526_10059917
Length 197
Sequence MLRTRIVFSISATGGARARKLADKEDIMATNSTKTLDDLFLDTLKDIYFAEKQILKALPKMARAAQSEEGKAGFLQHRDETQGQIDRLEQVFEILGKPARGKTCEAIQGIISEGEEIMEEFKGSPALDAGLISSAQAVEHYEIARYGTLIAWAKQLGLKDAVALLEANLQEEEATDQKLTHLAEAQANPKGKGSKAA

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
5 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
6 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
7 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
11 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
12 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
13 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
19 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
20 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
21 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
22 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
23 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
24 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
25 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
26 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
27 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
28 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
29 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
30 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
31 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
32 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
33 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
34 2643221568 Rhizobium sp. Root564 Isolate Unclassified
35 2643221599 Rhizobium sp. Root708 Isolate Unclassified
36 2643221607 Rhizobium sp. Root73 Isolate Unclassified
37 2643221618 Ensifer sp. Root231 Isolate Unclassified
38 2643221626 Ensifer sp. Root31 Isolate Unclassified
39 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
40 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
41 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
42 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
43 2643221655 Ensifer sp. Root1252 Isolate Unclassified
44 2643221659 Ensifer sp. Root127 Isolate Unclassified
45 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
46 2643221712 Ensifer sp. Root258 Isolate Unclassified
47 2643221718 Rhizobium sp. Root268 Isolate Unclassified
48 2718217882 Rhizobium sp. N741 Isolate Nodule
49 2718217927 Rhizobium sp. N324 Isolate Nodule
50 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
51 2718218009 Rhizobium sp. N561 Isolate Nodule
52 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
53 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
54 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
55 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
56 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
57 2718218363 Rhizobium sp. N113 Isolate Nodule
58 2718218365 Rhizobium sp. N731 Isolate Nodule
59 2718218366 Rhizobium sp. N621 Isolate Nodule
60 2718218423 Rhizobium sp. N941 Isolate Nodule
61 2721755514 Rhizobium sp. N6212 Isolate Nodule
62 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
63 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
64 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
65 2721755809 Rhizobium sp. N541 Isolate Nodule
66 2721755810 Rhizobium sp. N871 Isolate Nodule
67 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
68 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
69 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
70 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
71 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
72 2728369365 Rhizobium sp. N1341 Isolate Nodule
73 2728369397 Rhizobium sp. N1314 Isolate Nodule
74 2738541293 Rhizobium sp. GV031 Isolate Unclassified
75 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
76 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
77 2791355256 Rhizobium sp. M10 Isolate Nodule
78 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
79 2791355260 Rhizobium sp. L9 Isolate Nodule
80 2791355261 Rhizobium sp. J15 Isolate Nodule
81 2791355262 Rhizobium sp. M1 Isolate Nodule
82 2791355263 Rhizobium chutanense C5 Isolate Nodule
83 2791355264 Rhizobium sp. S9 Isolate Nodule
84 2791355265 Rhizobium sp. H4 Isolate Nodule
85 2791355267 Rhizobium sp. L18 Isolate Nodule
86 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
87 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
88 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
89 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
90 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
91 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
92 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
93 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
94 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
95 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
96 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
97 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
98 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
99 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
100 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
101 2838048938 Rhizobium pisi 27/80 Isolate Nodule
102 2838061910 Rhizobium phaseoli L15 Isolate Nodule
103 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
104 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
105 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
106 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
107 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
108 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
109 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
110 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
111 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
112 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
113 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
114 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
115 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
116 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
117 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
118 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
119 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
120 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
121 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
122 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
123 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
124 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
125 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
126 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
127 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
128 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
129 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
130 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
131 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
132 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
133 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
134 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
135 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
136 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
137 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
138 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
139 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
140 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
141 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
142 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
143 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
144 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
145 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
146 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
147 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
148 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
149 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
150 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
151 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
152 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
153 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
154 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
155 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
156 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
157 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
158 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
159 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
160 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
161 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
162 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
163 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
164 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
165 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
166 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
167 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
168 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
169 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
170 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
171 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
172 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
173 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
174 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
175 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
176 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
177 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
178 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
179 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
180 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
181 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
182 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
183 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
184 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
185 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
186 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
187 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
188 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
189 2933599457 Rhizobium phaseoli M3 Isolate Nodule
190 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
191 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
192 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
193 2936381700 Rhizobium chutanense C16 Isolate Unclassified
194 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
195 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
196 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
197 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
198 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
199 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
200 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
201 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
202 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
203 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
204 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
205 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
206 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
207 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
208 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
209 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
210 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
211 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
212 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
213 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
214 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
215 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
216 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
217 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
218 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
219 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
220 2996893221 Rhizobium sp. R635 Isolate Nodule
221 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
222 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
223 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
224 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
225 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
226 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
227 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
228 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
229 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
230 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
231 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
232 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
233 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
234 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
235 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
236 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
237 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
238 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
239 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
240 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
241 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
242 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
243 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
244 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
245 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
246 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
247 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
248 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
249 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
250 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
251 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
252 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
253 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
254 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
255 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
256 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
257 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
258 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
259 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
260 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
261 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
262 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
263 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
264 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
265 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
266 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
267 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
268 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
269 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
270 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
271 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
272 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
273 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
274 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
275 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
276 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
277 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
278 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
279 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
280 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
281 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
282 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
283 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
284 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
285 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
288 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
289 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
290 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
291 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
292 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
293 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
294 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
295 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
296 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
297 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
299 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
301 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
304 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
317 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
318 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
320 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
321 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
322 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
323 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
324 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
325 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
326 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
327 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
328 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
329 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
330 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
331 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
332 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
333 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
334 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
335 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
336 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
337 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
338 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
339 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
340 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
341 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
342 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
343 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
344 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
345 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
346 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
347 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
348 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
349 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
350 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
351 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
352 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
353 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
354 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
355 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
356 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
357 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
358 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
359 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
360 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
361 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
362 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
363 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
364 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
365 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
366 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
367 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
368 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
369 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
370 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
371 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
372 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
373 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
374 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
375 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
376 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
377 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
378 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
379 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
380 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
381 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
382 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
383 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
384 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
385 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
386 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
387 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
388 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
389 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
390 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
391 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
392 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
393 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
394 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
395 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
396 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
397 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
398 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
399 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
400 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
401 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
402 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
403 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
404 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
405 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
406 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
407 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
408 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
409 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
410 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
418 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
419 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
420 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
421 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
422 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
423 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
427 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
428 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
429 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
430 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
431 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
432 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
433 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
434 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
435 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
436 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
437 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
438 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
439 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
440 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
441 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
442 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
443 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
444 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
445 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
446 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
447 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
448 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
449 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
450 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
451 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
455 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
456 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
457 8005275841 Rhizobium sp. N4311 Isolate Nodule
458 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
459 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
460 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
461 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
462 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
463 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
464 8005382845 Rhizobium sp. R634 Isolate Nodule
465 8005395548 Rhizobium sp. R339 Isolate Nodule
466 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
467 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
468 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
469 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
470 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
471 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
472 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
473 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
474 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
475 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
476 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
477 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
478 8018176218 Rhizobium sp. N122 Isolate Nodule
479 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
480 8024501048 Rhizobium sp. H4 Isolate Nodule
481 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
482 8056382006 Rhizobium croatiense 13T Isolate Nodule
483 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.16
Metatranscriptomes 0.79
Isolates 36.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 24.63
Nodule 27.91
Rhizoplane 2.94
Rhizosphere 21.92
Stem 0
Stem Tuber 0
Unclassified 22.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000008 3300002705 Bacteria 229035
2 JGI25162J39368_1000071 3300002737 Bacteria 123224
3 JGI25154J39366_1000050 3300002738 Bacteria 124480
4 JGI25158J39367_1000023 3300002739 Bacteria 37790
5 JGI25158J39367_1000852 3300002739 Bacteria 5836
6 JGI25157J39369_1000028 3300002741 Bacteria 147384
7 JGI25152J39213_1000941 3300002773 Bacteria 14276
8 JGI25152J39213_1002023 3300002773 Bacteria 7994
9 JGI25152J39213_1002378 3300002773 Bacteria 7211
10 JGI25152J39213_1004282 3300002773 Bacteria 4552
11 JGI25152J39213_1007246 3300002773 Bacteria 2897
12 JGI25150J39212_1000048 3300002774 Bacteria 75029
13 JGI25150J39212_1000089 3300002774 Bacteria 53159
14 JGI25150J39212_1000597 3300002774 Bacteria 14103
15 JGI25159J45721_1001401 3300002987 Bacteria 10010
16 JGI25159J45721_1002493 3300002987 Bacteria 6938
17 JGI25159J45721_1006757 3300002987 Bacteria 3379
18 JGI25159J45721_1008290 3300002987 Bacteria 2871
19 JGI25151J46595_10000172 3300003187 Bacteria 83323
20 JGI25151J46595_10000905 3300003187 Bacteria 23229
21 JGI25151J46595_10001095 3300003187 Bacteria 20016
22 JGI25151J46595_10001479 3300003187 Bacteria 15853
23 JGI25151J46595_10020496 3300003187 Bacteria 2786
24 JGI25151J46595_10080247 3300003187 Bacteria 948
25 JGI25165J46597_1000134 3300003214 Bacteria 123225
26 JGI25153J46596_10000245 3300003215 Bacteria 45345
27 JGI25153J46596_10000863 3300003215 Bacteria 18486
28 JGI25153J46596_10001172 3300003215 Bacteria 15825
29 JGI25153J46596_10001376 3300003215 Bacteria 14549
30 JGI25153J46596_10004228 3300003215 Bacteria 7773
31 rootL2_10113588 3300003322 Bacteria 4720
32 rootL2_10115729 3300003322 Bacteria 1212
33 rootL2_10126102 3300003322 Bacteria 6391
34 rootH1_10125649 3300003323 Bacteria 7279
35 JGI25160J50197_1001898 3300003354 Bacteria 10010
36 JGI25160J50197_1004721 3300003354 Bacteria 5837
37 JGI25160J50197_1012703 3300003354 Bacteria 2907
38 JGI25160J50197_1012918 3300003354 Bacteria 2871
39 JGI25161J50226_1000045 3300003374 Bacteria 116781
40 JGI25161J50226_1000189 3300003374 Bacteria 40035
41 JGI25161J50226_1000989 3300003374 Bacteria 10010
42 JGI25161J50226_1003768 3300003374 Bacteria 3363
43 Ga0055526_1000056 3300003771 Bacteria 110574
44 Ga0055526_1003386 3300003771 Bacteria 10159
45 Ga0055526_1005991 3300003771 Bacteria 6756
46 Ga0055526_1008663 3300003771 Bacteria 5026
47 Ga0055526_1008794 3300003771 Bacteria 4970
48 Ga0055526_1014903 3300003771 Bacteria 3161
49 Ga0055524_1000366 3300003775 Bacteria 40062
50 Ga0055524_1001261 3300003775 Bacteria 14851
51 Ga0055524_1001709 3300003775 Bacteria 12201
52 Ga0055524_1004684 3300003775 Bacteria 6267
53 Ga0055524_1005153 3300003775 Bacteria 5894
54 Ga0055536_1000901 3300003781 Bacteria 19246
55 Ga0055528_1000096 3300003790 Bacteria 70375
56 Ga0055528_1000210 3300003790 Bacteria 49470
57 Ga0055528_1000411 3300003790 Bacteria 34607
58 Ga0055528_1001638 3300003790 Bacteria 13172
59 Ga0055528_1002634 3300003790 Bacteria 9489
60 Ga0055528_1008132 3300003790 Bacteria 4541
61 Ga0055528_1021690 3300003790 Bacteria 2026
62 Ga0055530_10054348 3300003791 Bacteria 916
63 Ga0055540_1000273 3300003792 Bacteria 46613
64 Ga0055540_1000327 3300003792 Bacteria 41590
65 Ga0055540_1000861 3300003792 Bacteria 20219
66 Ga0055540_1002032 3300003792 Bacteria 11197
67 Ga0055540_1003219 3300003792 Bacteria 8010
68 Ga0055540_1003341 3300003792 Bacteria 7804
69 Ga0055540_1059022 3300003792 Bacteria 771
70 Ga0055531_10000106 3300003794 Bacteria 91868
71 Ga0055531_10001169 3300003794 Bacteria 20194
72 Ga0055531_10035621 3300003794 Bacteria 1554
73 Ga0055531_10037448 3300003794 Bacteria 1475
74 Ga0055531_10044973 3300003794 Bacteria 1231
75 Ga0055543_1000105 3300004625 Bacteria 73426
76 Ga0055543_1000142 3300004625 Bacteria 59886
77 Ga0055543_1001314 3300004625 Bacteria 10167
78 Ga0055543_1002585 3300004625 Bacteria 5858
79 Ga0065165_1003820 3300005262 Bacteria 10048
80 Ga0065165_1004657 3300005262 Bacteria 8307
81 Ga0065165_1006131 3300005262 Bacteria 6432
82 Ga0065165_1006770 3300005262 Bacteria 5865
83 Ga0065704_10203769 3300005289 Bacteria 1135
84 Ga0070670_100000116 3300005331 Bacteria 74586
85 Ga0070682_100029184 3300005337 Bacteria 3320
86 Ga0070682_100260992 3300005337 Bacteria 1254
87 Ga0070671_100054542 3300005355 Bacteria 3324
88 Ga0070667_100219993 3300005367 Bacteria 1690
89 Ga0070663_100528262 3300005455 Bacteria 983
90 Ga0070672_101726736 3300005543 Bacteria 562
91 Ga0070665_100128304 3300005548 Bacteria 2539
92 Ga0070665_100268933 3300005548 Bacteria 1706
93 Ga0070665_100597702 3300005548 Bacteria 1116
94 Ga0068852_100564953 3300005616 Bacteria 1139
95 Ga0081540_1026982 3300005983 Bacteria 3265
96 Ga0075365_10049980 3300006038 Bacteria 2757
97 Ga0075363_100034256 3300006048 Bacteria 2650
98 Ga0075363_100174014 3300006048 Bacteria 1223
99 Ga0075364_10000121 3300006051 Bacteria 32388
100 Ga0075364_10003206 3300006051 Bacteria 9274
101 Ga0075364_10004254 3300006051 Bacteria 8221
102 Ga0075364_10114867 3300006051 Bacteria 1799
103 Ga0075367_10120259 3300006178 Bacteria 1618
104 Ga0075369_10102469 3300006186 Bacteria 1285
105 Ga0075366_10059977 3300006195 Bacteria 2260
106 Ga0075370_10012042 3300006353 Bacteria 4561
107 Ga0075370_10049062 3300006353 Bacteria 2393
108 Ga0075370_10101168 3300006353 Bacteria 1668
109 Ga0075370_10301998 3300006353 Bacteria 952
110 Ga0079104_1000405 3300006946 Bacteria 49902
111 Ga0105251_10006612 3300009011 Bacteria 7346
112 Ga0105244_10113224 3300009036 Bacteria 1318
113 Ga0105244_10169406 3300009036 Bacteria 1040
114 Ga0105250_10026217 3300009092 Bacteria 2348
115 Ga0105248_10389598 3300009177 Bacteria 1569
116 Ga0105238_10451829 3300009551 Bacteria 1282
117 Ga0105238_10598912 3300009551 Bacteria 1110
118 Ga0123341_1000010 3300009765 Bacteria 118450
119 Ga0105246_10348417 3300011119 Bacteria 1213
120 Ga0157373_10096033 3300013100 Bacteria 2087
121 Ga0157370_10168969 3300013104 Bacteria 2033
122 Ga0157370_11130196 3300013104 Bacteria 708
123 Ga0157378_10358184 3300013297 Bacteria 1427
124 Ga0157378_12256563 3300013297 Bacteria 596
125 Ga0163162_12043075 3300013306 Bacteria 657
126 Ga0157372_10858533 3300013307 Bacteria 1054
127 Ga0157372_10879084 3300013307 Bacteria 1040
128 Ga0157380_10217637 3300014326 Bacteria 1707
129 Ga0157380_11459748 3300014326 Bacteria 736
130 Ga0183363_1062 3300015690 Bacteria 33573
131 Ga0224712_10498140 3300022467 Bacteria 589
132 Ga0228711_1000006 3300022739 Bacteria 202437
133 Ga0228710_1000004 3300022740 Bacteria 250560
134 Ga0209435_100020 3300025206 Bacteria 229105
135 Ga0209436_100001 3300025208 Bacteria 304543
136 Ga0209436_100003 3300025208 Bacteria 220530
137 Ga0209436_100022 3300025208 Bacteria 96695
138 Ga0209436_100157 3300025208 Bacteria 32790
139 Ga0209672_111167 3300025228 Bacteria 1175
140 Ga0209563_101593 3300025230 Bacteria 5877
141 Ga0209437_100191 3300025233 Bacteria 123276
142 Ga0207425_1000083 3300025245 Bacteria 96984
143 Ga0207425_1000100 3300025245 Bacteria 83378
144 Ga0207425_1002533 3300025245 Bacteria 6381
145 Ga0209646_1000070 3300025246 Bacteria 229105
146 Ga0209026_1000057 3300025250 Bacteria 229105
147 Ga0209759_1000047 3300025256 Bacteria 229105
148 Ga0209129_1000045 3300025258 Bacteria 272407
149 Ga0209129_1000098 3300025258 Bacteria 163406
150 Ga0209129_1000191 3300025258 Bacteria 83378
151 Ga0209129_1000405 3300025258 Bacteria 34205
152 Ga0209129_1000684 3300025258 Bacteria 22341
153 Ga0209129_1000833 3300025258 Bacteria 19447
154 Ga0209233_1000200 3300025261 Bacteria 123594
155 Ga0209565_1026833 3300025263 Bacteria 1151
156 Ga0209673_1000252 3300025273 Bacteria 101552
157 Ga0209673_1000397 3300025273 Bacteria 77638
158 Ga0209673_1000416 3300025273 Bacteria 74754
159 Ga0209673_1000489 3300025273 Bacteria 65739
160 Ga0209673_1000688 3300025273 Bacteria 48492
161 Ga0209673_1001777 3300025273 Bacteria 17890
162 Ga0209673_1004294 3300025273 Bacteria 7705
163 Ga0209673_1015354 3300025273 Bacteria 2915
164 Ga0209673_1077467 3300025273 Bacteria 771
165 Ga0209130_1000002 3300025284 Bacteria 722648
166 Ga0209130_1000049 3300025284 Bacteria 226841
167 Ga0209130_1000651 3300025284 Bacteria 31966
168 Ga0209130_1004002 3300025284 Bacteria 5871
169 Ga0209676_1002652 3300025292 Bacteria 12157
170 Ga0209676_1009389 3300025292 Bacteria 4224
171 Ga0209676_1017652 3300025292 Bacteria 2517
172 Ga0209676_1032166 3300025292 Bacteria 1581
173 Ga0209025_1000142 3300025294 Bacteria 183903
174 Ga0209025_1000148 3300025294 Bacteria 179802
175 Ga0209025_1000376 3300025294 Bacteria 92939
176 Ga0209025_1000427 3300025294 Bacteria 83378
177 Ga0209025_1000653 3300025294 Bacteria 60534
178 Ga0209025_1001202 3300025294 Bacteria 36375
179 Ga0209025_1006314 3300025294 Bacteria 9255
180 Ga0209025_1006941 3300025294 Bacteria 8615
181 Ga0209025_1125452 3300025294 Bacteria 757
182 Ga0209564_1000255 3300025295 Bacteria 113017
183 Ga0209564_1000262 3300025295 Bacteria 112256
184 Ga0209564_1000306 3300025295 Bacteria 96600
185 Ga0209564_1002329 3300025295 Bacteria 15374
186 Ga0209564_1011171 3300025295 Bacteria 4050
187 Ga0209564_1069343 3300025295 Bacteria 741
188 Ga0209758_1000175 3300025297 Bacteria 145649
189 Ga0209758_1000300 3300025297 Bacteria 97000
190 Ga0209758_1000352 3300025297 Bacteria 83378
191 Ga0209758_1000786 3300025297 Bacteria 45428
192 Ga0209758_1002560 3300025297 Bacteria 18300
193 Ga0209758_1038565 3300025297 Bacteria 1830
194 Ga0209758_1069869 3300025297 Bacteria 1111
195 Ga0209050_1010187 3300025298 Bacteria 4670
196 Ga0209050_1039757 3300025298 Bacteria 1320
197 Ga0209256_1000246 3300025299 Bacteria 96612
198 Ga0209256_1000379 3300025299 Bacteria 71301
199 Ga0209256_1000463 3300025299 Bacteria 61298
200 Ga0209256_1001363 3300025299 Bacteria 25683
201 Ga0209256_1001590 3300025299 Bacteria 22227
202 Ga0209256_1001700 3300025299 Bacteria 21237
203 Ga0209256_1011575 3300025299 Bacteria 3507
204 Ga0207426_1000013 3300025302 Bacteria 721897
205 Ga0207426_1000043 3300025302 Bacteria 432827
206 Ga0207426_1000856 3300025302 Bacteria 31966
207 Ga0207426_1001095 3300025302 Bacteria 24972
208 Ga0207426_1005388 3300025302 Bacteria 5863
209 Ga0209051_1000192 3300025303 Bacteria 108667
210 Ga0209051_1000245 3300025303 Bacteria 91350
211 Ga0209051_1000480 3300025303 Bacteria 51550
212 Ga0209051_1001053 3300025303 Bacteria 25837
213 Ga0209051_1003127 3300025303 Bacteria 11151
214 Ga0209051_1003955 3300025303 Bacteria 9437
215 Ga0209051_1023325 3300025303 Bacteria 2576
216 Ga0209051_1026193 3300025303 Bacteria 2356
217 Ga0209257_1000300 3300025304 Bacteria 108786
218 Ga0209257_1002138 3300025304 Bacteria 20583
219 Ga0209257_1002184 3300025304 Bacteria 20253
220 Ga0209257_1006475 3300025304 Bacteria 7515
221 Ga0209257_1010503 3300025304 Bacteria 4669
222 Ga0209257_1025048 3300025304 Bacteria 2048
223 Ga0209257_1045796 3300025304 Bacteria 1268
224 Ga0209257_1045883 3300025304 Bacteria 1266
225 Ga0207655_1108665 3300025728 Bacteria 941
226 Ga0207680_10484188 3300025903 Bacteria 880
227 Ga0207649_10705014 3300025920 Bacteria 783
228 Ga0207681_10155775 3300025923 Bacteria 1717
229 Ga0207681_10194364 3300025923 Bacteria 1554
230 Ga0207650_10000797 3300025925 Bacteria 24176
231 Ga0207644_10095151 3300025931 Bacteria 2227
232 Ga0207691_11454331 3300025940 Bacteria 562
233 Ga0207711_10417641 3300025941 Bacteria 1247
234 Ga0207658_10204444 3300025986 Bacteria 1651
235 Ga0207678_10122345 3300026067 Bacteria 2220
236 Ga0209281_1000134 3300027111 Bacteria 185406
237 Ga0209281_1000513 3300027111 Bacteria 50634
238 Ga0209282_1000013 3300027666 Bacteria 215053
239 Ga0268266_10100666 3300028379 Bacteria 2546
240 Ga0268266_10413884 3300028379 Bacteria 1277
241 Ga0268266_10480573 3300028379 Bacteria 1184
242 Ga0307515_10001651 3300028794 Bacteria 49639
243 Ga0307515_10250375 3300028794 Bacteria 1525
244 Ga0307405_10006988 3300031731 Bacteria 5608
245 Ga0307406_10004304 3300031901 Bacteria 7744
246 Ga0307406_10378438 3300031901 Bacteria 1115
247 Ga0307412_10006600 3300031911 Bacteria 6569
248 Ga0307412_10016775 3300031911 Bacteria 4371
249 Ga0307412_10081314 3300031911 Bacteria 2240
250 Ga0315914_1000004 3300031967 Bacteria 288534
251 Ga0315913_1000011 3300033430 Bacteria 140532
252 Ga0315915_1000003 3300033464 Bacteria 407996
253 Ga0439436_0141087 3300041404 Bacteria 677
254 Ga0439465_0002404 3300041413 Bacteria 6130
255 Ga0439465_0020102 3300041413 Bacteria 2089
256 Ga0439465_0032272 3300041413 Bacteria 1671
257 Ga0451789_1056321 3300041443 Bacteria 1329
258 Ga0451789_1219991 3300041443 Bacteria 866
259 Ga0451797_1251711 3300041453 Bacteria 1629
260 Ga0451797_1400354 3300041453 Bacteria 939
261 Ga0451798_0683035 3300041458 Bacteria 912
262 Ga0451800_0107967 3300041459 Bacteria 1095
263 Ga0451807_2057839 3300041486 Bacteria 1678
264 Ga0451833_0041652 3300041491 Bacteria 1047
265 Ga0451833_0550258 3300041491 Bacteria 3335
266 Ga0451835_0600583 3300041492 Bacteria 1331
267 Ga0451837_0587038 3300041494 Bacteria 1539
268 Ga0451837_1281686 3300041494 Bacteria 1741
269 Ga0451839_0025619 3300041496 Bacteria 4414
270 Ga0451839_0628215 3300041496 Bacteria 1235
271 Ga0451841_0405338 3300041498 Bacteria 5675
272 Ga0451841_1009422 3300041498 Bacteria 1232
273 Ga0451841_1189662 3300041498 Bacteria 1448
274 Ga0451845_0246094 3300041501 Bacteria 5416
275 Ga0451845_0431176 3300041501 Bacteria 3089
276 Ga0451847_0306313 3300041503 Bacteria 1379
277 Ga0451851_0424964 3300041507 Bacteria 1013
278 Ga0451851_1042277 3300041507 Bacteria 644
279 Ga0451843_0278965 3300041509 Bacteria 2373
280 Ga0451843_1003149 3300041509 Bacteria 1452
281 Ga0451843_1721569 3300041509 Bacteria 709
282 Ga0451855_1081656 3300041511 Bacteria 4474
283 Ga0451855_1727606 3300041511 Bacteria 1590
284 Ga0451853_0323784 3300041512 Bacteria 2619
285 Ga0451853_0415950 3300041512 Bacteria 1470
286 Ga0451853_1968180 3300041512 Bacteria 12882
287 Ga0451853_3792942 3300041512 Bacteria 1194
288 Ga0439445_0057078 3300042004 Bacteria 1063
289 Ga0439449_0012315 3300042007 Bacteria 3215
290 Ga0439449_0026917 3300042007 Bacteria 2146
291 Ga0439449_0046608 3300042007 Bacteria 1606
292 Ga0450907_045408 3300042146 Bacteria 754
293 Ga0466960_0601899 3300044901 Bacteria 652
294 Ga0495617_082978 3300046452 Bacteria 1049
295 Ga0495590_0063074 3300046457 Bacteria 1297
296 Ga0495638_0065667 3300046460 Bacteria 2232
297 Ga0495638_0078423 3300046460 Bacteria 2010
298 Ga0495650_0113508 3300046471 Bacteria 1004
299 Ga0495605_0020349 3300046474 Bacteria 3527
300 Ga0495585_0039713 3300046492 Bacteria 2645
301 Ga0495585_0057492 3300046492 Bacteria 2146
302 Ga0495596_0139635 3300046500 Bacteria 941
303 Ga0495607_0002062 3300046501 Bacteria 16809
304 Ga0495607_0025542 3300046501 Bacteria 3673
305 Ga0495607_0048648 3300046501 Bacteria 2478
306 Ga0495583_0154658 3300046506 Bacteria 949
307 Ga0495606_0005017 3300046507 Bacteria 12907
308 Ga0495606_0011287 3300046507 Bacteria 7305
309 Ga0495606_0012421 3300046507 Bacteria 6829
310 Ga0495606_0013330 3300046507 Bacteria 6506
311 Ga0495606_0015452 3300046507 Bacteria 5879
312 Ga0495606_0129703 3300046507 Bacteria 1500
313 Ga0495606_0163326 3300046507 Bacteria 1298
314 Ga0495610_0002757 3300046512 Bacteria 14402
315 Ga0495610_0007425 3300046512 Bacteria 7296
316 Ga0495610_0025221 3300046512 Bacteria 3195
317 Ga0495610_0365207 3300046512 Bacteria 540
318 Ga0495616_0087061 3300046513 Bacteria 1485
319 Ga0495620_0009675 3300046515 Bacteria 5117
320 Ga0495620_0035539 3300046515 Bacteria 2238
321 Ga0495620_0147015 3300046515 Bacteria 920
322 Ga0495631_0043216 3300046518 Bacteria 1988
323 Ga0495631_0049327 3300046518 Bacteria 1843
324 Ga0495631_0073289 3300046518 Bacteria 1479
325 Ga0495632_0001480 3300046519 Bacteria 19499
326 Ga0495632_0001547 3300046519 Bacteria 18996
327 Ga0495632_0041838 3300046519 Bacteria 2300
328 Ga0495643_0002657 3300046522 Bacteria 13855
329 Ga0495643_0014336 3300046522 Bacteria 4718
330 Ga0495643_0024665 3300046522 Bacteria 3409
331 Ga0495643_0046685 3300046522 Bacteria 2347
332 Ga0495643_0100749 3300046522 Bacteria 1480
333 Ga0495643_0118155 3300046522 Bacteria 1342
334 Ga0495648_0029734 3300046524 Bacteria 3622
335 Ga0495648_0148472 3300046524 Bacteria 1225
336 Ga0495663_0288166 3300046525 Bacteria 589
337 Ga0495654_0238317 3300046530 Bacteria 762
338 Ga0495654_0264875 3300046530 Bacteria 711
339 Ga0495597_0006785 3300046542 Bacteria 5890
340 Ga0495597_0018032 3300046542 Bacteria 3316
341 Ga0495622_0106514 3300046557 Bacteria 1284
342 Ga0495633_0015168 3300046558 Bacteria 4002
343 Ga0495633_0271283 3300046558 Bacteria 772
344 Ga0495633_0307191 3300046558 Bacteria 720
345 Ga0495656_0134244 3300046615 Bacteria 1180
346 Ga0495668_0080434 3300046616 Bacteria 1788
347 Ga0495668_0322933 3300046616 Bacteria 847
348 Ga0495668_0384992 3300046616 Bacteria 770
349 Ga0495625_0056504 3300046660 Bacteria 2793
350 Ga0495625_0057176 3300046660 Bacteria 2775
351 Ga0495657_0200709 3300046675 Bacteria 1216
352 Ga0495670_0134412 3300046691 Bacteria 1291
353 Ga0495671_0228113 3300046692 Bacteria 901
354 Ga0495649_0000467 3300046694 Bacteria 34802
355 Ga0495649_0067349 3300046694 Bacteria 1921
356 Ga0495649_0110431 3300046694 Bacteria 1458
357 Ga0495649_0168037 3300046694 Bacteria 1149
358 Ga0495600_0011202 3300046809 Bacteria 5586
359 Ga0495660_0010022 3300046810 Bacteria 5512
360 Ga0495660_0019703 3300046810 Bacteria 3871
361 Ga0495604_0147039 3300047317 Bacteria 1678
362 Ga0495636_0070094 3300047318 Bacteria 1495
363 Ga0495687_028474 3300047443 Bacteria 2599
364 Ga0495681_0042119 3300047470 Bacteria 2212
365 Ga0495681_0157129 3300047470 Bacteria 949
366 Ga0495686_0013818 3300047472 Bacteria 5590
367 Ga0495686_0014146 3300047472 Bacteria 5503
368 Ga0495686_0028275 3300047472 Bacteria 3652
369 Ga0495686_0034676 3300047472 Bacteria 3249
370 Ga0495686_0125527 3300047472 Bacteria 1526
371 Ga0495615_0008064 3300048090 Bacteria 2022
372 Ga0495626_0011516 3300048091 Bacteria 4677
373 Ga0496101_0549376 3300048904 Bacteria 913
374 Ga0496102_0048473 3300048905 Bacteria 3862
375 Ga0496104_0045738 3300048907 Bacteria 4118
376 Ga0496105_0069820 3300048908 Bacteria 2903
377 Ga0496106_0000858 3300048909 Bacteria 22078
378 Ga0496106_0000945 3300048909 Bacteria 21174
379 Ga0496106_0009110 3300048909 Bacteria 7334
380 Ga0496106_0010954 3300048909 Bacteria 6703
381 Ga0496107_0042252 3300048910 Bacteria 3274
382 Ga0496107_0235603 3300048910 Bacteria 1362
383 Ga0496108_0097075 3300048911 Bacteria 2511
384 Ga0496109_1360185 3300048912 Bacteria 646
385 Ga0496110_0020326 3300048913 Bacteria 5606
386 Ga0496111_0027349 3300048914 Bacteria 4034
387 Ga0496113_0077476 3300048916 Bacteria 2542
388 Ga0496114_0459256 3300048917 Bacteria 1127
389 Ga0496116_0001077 3300048919 Bacteria 32839
390 Ga0496116_0016851 3300048919 Bacteria 5701
391 Ga0496116_0041493 3300048919 Bacteria 3156
392 Ga0496116_0051077 3300048919 Bacteria 2749
393 Ga0496116_0063331 3300048919 Bacteria 2383
394 Ga0496116_0095514 3300048919 Bacteria 1794
395 Ga0496116_0128029 3300048919 Bacteria 1453
396 Ga0496116_0133730 3300048919 Bacteria 1408
397 Ga0496116_0260502 3300048919 Bacteria 855
398 Ga0496117_0004366 3300048920 Bacteria 15687
399 Ga0496117_0007375 3300048920 Bacteria 10764
400 Ga0496117_0015965 3300048920 Bacteria 6362
401 Ga0496117_0044019 3300048920 Bacteria 3237
402 Ga0496117_0073631 3300048920 Bacteria 2278
403 Ga0496117_0292447 3300048920 Bacteria 866
404 Ga0496117_0447235 3300048920 Bacteria 640
405 Ga0496118_0008953 3300048921 Bacteria 10215
406 Ga0496118_0017439 3300048921 Bacteria 6536
407 Ga0496118_0023971 3300048921 Bacteria 5282
408 Ga0496118_0121563 3300048921 Bacteria 1701
409 Ga0496118_0122039 3300048921 Bacteria 1696
410 Ga0496118_0147100 3300048921 Bacteria 1482
411 Ga0496118_0150028 3300048921 Bacteria 1461
412 Ga0496118_0266879 3300048921 Bacteria 962
413 Ga0496118_0304238 3300048921 Bacteria 874
414 Ga0496118_0374848 3300048921 Bacteria 749
415 Ga0496119_0014757 3300048922 Bacteria 6081
416 Ga0496119_0021140 3300048922 Bacteria 4715
417 Ga0496119_0025026 3300048922 Bacteria 4179
418 Ga0496119_0043761 3300048922 Bacteria 2826
419 Ga0496119_0094480 3300048922 Bacteria 1691
420 Ga0496119_0115853 3300048922 Bacteria 1480
421 Ga0496119_0201185 3300048922 Bacteria 1031
422 Ga0496119_0297491 3300048922 Bacteria 797
423 Ga0496119_0479265 3300048922 Bacteria 582
424 Ga0496120_0010917 3300048923 Bacteria 6283
425 Ga0496120_0180638 3300048923 Bacteria 1036
426 Ga0496121_0000115 3300048924 Bacteria 178411
427 Ga0496121_0001493 3300048924 Bacteria 39397
428 Ga0496121_0004938 3300048924 Bacteria 17495
429 Ga0496121_0006670 3300048924 Bacteria 14200
430 Ga0496121_0018935 3300048924 Bacteria 6908
431 Ga0496121_0026828 3300048924 Bacteria 5412
432 Ga0496121_0037053 3300048924 Bacteria 4337
433 Ga0496121_0041293 3300048924 Bacteria 4034
434 Ga0496121_0050309 3300048924 Bacteria 3522
435 Ga0496121_0063940 3300048924 Bacteria 3003
436 Ga0496121_0077099 3300048924 Bacteria 2655
437 Ga0496121_0189264 3300048924 Bacteria 1477
438 Ga0496121_0196383 3300048924 Bacteria 1442
439 Ga0496121_0543955 3300048924 Bacteria 728
440 Ga0496121_0572098 3300048924 Bacteria 703
441 Ga0496121_0707281 3300048924 Bacteria 605
442 Ga0496122_0000032 3300048925 Bacteria 327099
443 Ga0496122_0000172 3300048925 Bacteria 153862
444 Ga0496122_0004334 3300048925 Bacteria 17746
445 Ga0496122_0009735 3300048925 Bacteria 10043
446 Ga0496122_0012567 3300048925 Bacteria 8407
447 Ga0496122_0109780 3300048925 Bacteria 1814
448 Ga0496122_0111808 3300048925 Bacteria 1790
449 Ga0496122_0117214 3300048925 Bacteria 1729
450 Ga0496122_0150481 3300048925 Bacteria 1437
451 Ga0496122_0168951 3300048925 Bacteria 1321
452 Ga0496123_0000094 3300048926 Bacteria 178612
453 Ga0496123_0000132 3300048926 Bacteria 153568
454 Ga0496123_0023761 3300048926 Bacteria 4682
455 Ga0496123_0073891 3300048926 Bacteria 2113
456 Ga0496123_0124758 3300048926 Bacteria 1439
457 Ga0496124_0000072 3300048927 Bacteria 219914
458 Ga0496124_0000153 3300048927 Bacteria 139859
459 Ga0496124_0001217 3300048927 Bacteria 39811
460 Ga0496124_0001539 3300048927 Bacteria 33474
461 Ga0496124_0002519 3300048927 Bacteria 23803
462 Ga0496124_0010326 3300048927 Bacteria 9472
463 Ga0496124_0010758 3300048927 Bacteria 9222
464 Ga0496124_0012380 3300048927 Bacteria 8424
465 Ga0496124_0025519 3300048927 Bacteria 5352
466 Ga0496124_0038139 3300048927 Bacteria 4173
467 Ga0496124_0079846 3300048927 Bacteria 2693
468 Ga0496124_0135368 3300048927 Bacteria 1951
469 Ga0496124_0197675 3300048927 Bacteria 1532
470 Ga0496124_0215595 3300048927 Bacteria 1448
471 Ga0496124_0347901 3300048927 Bacteria 1050
472 Ga0496124_0354453 3300048927 Bacteria 1037
473 Ga0496124_0396526 3300048927 Bacteria 959
474 Ga0496124_0477014 3300048927 Bacteria 843
475 Ga0496125_0000034 3300048928 Bacteria 348231
476 Ga0496125_0000143 3300048928 Bacteria 156688
477 Ga0496125_0000631 3300048928 Bacteria 59156
478 Ga0496125_0019293 3300048928 Bacteria 6437
479 Ga0496125_0065345 3300048928 Bacteria 2883
480 Ga0496125_0066836 3300048928 Bacteria 2837
481 Ga0496125_0143194 3300048928 Bacteria 1658
482 Ga0496125_0145292 3300048928 Bacteria 1640
483 Ga0496125_0176925 3300048928 Bacteria 1426
484 Ga0496125_0302556 3300048928 Bacteria 979
485 Ga0496126_0002532 3300048929 Bacteria 24465
486 Ga0496126_0011432 3300048929 Bacteria 9187
487 Ga0496126_0013497 3300048929 Bacteria 8302
488 Ga0496126_0020488 3300048929 Bacteria 6478
489 Ga0496126_0045889 3300048929 Bacteria 4013
490 Ga0496126_0105512 3300048929 Bacteria 2460
491 Ga0496126_0140640 3300048929 Bacteria 2078
492 Ga0496126_0413865 3300048929 Bacteria 1091
493 Ga0495678_028477 3300049459 Bacteria 2357
494 Ga0495678_105170 3300049459 Bacteria 972
495 Ga0501031_0240088 3300049568 Bacteria 1178
496 Ga0501031_0324140 3300049568 Bacteria 998
497 Ga0501032_0053495 3300049569 Bacteria 2719
498 Ga0501033_0004453 3300049570 Bacteria 11204
499 Ga0501033_0019663 3300049570 Bacteria 5104
500 Ga0501034_1308673 3300049571 Bacteria 601
501 Ga0501037_0535276 3300049573 Bacteria 792
502 Ga0501038_0141209 3300049574 Bacteria 1970
503 Ga0501047_0042347 3300049581 Bacteria 4401
504 Ga0501069_0063674 3300049585 Bacteria 2060
505 Ga0501070_0000700 3300049586 Bacteria 30808
506 Ga0501070_0341369 3300049586 Bacteria 1216
507 Ga0501073_0395468 3300049589 Bacteria 955
508 Ga0501074_0000650 3300049590 Bacteria 21612
509 Ga0501074_0012781 3300049590 Bacteria 6104
510 Ga0501079_0544000 3300049741 Bacteria 913
511 Ga0501080_0020953 3300049742 Bacteria 6050
512 Ga0501080_0613975 3300049742 Bacteria 964
513 Ga0501083_0064095 3300049744 Bacteria 2450
514 Ga0501035_0001499 3300049822 Bacteria 23898
515 Ga0501035_0001514 3300049822 Bacteria 23764
516 Ga0501044_0003308 3300049823 Bacteria 18160
517 nmdc:mga03n38_75815_c1 3300050490 Bacteria 1567
518 nmdc:mga00v17_19018_c1 3300050491 Bacteria 3914
519 nmdc:mga00v17_3391_c1 3300050491 Bacteria 8228
520 nmdc:mga00v17_49_c1 3300050491 Bacteria 74057
521 nmdc:mga0yw44_482011_c1 3300050492 Bacteria 841
522 nmdc:mga0k408_92006_c1 3300050493 Bacteria 1782
523 nmdc:mga06z11_77235_c1 3300050494 Bacteria 1777
524 nmdc:mga07m45_103081_c1 3300050496 Bacteria 1639
525 nmdc:mga07m45_348054_c1 3300050496 Bacteria 861
526 nmdc:mga07m45_573835_c1 3300050496 Bacteria 652
527 nmdc:mga0sz30_25180_c1 3300050516 Bacteria 2433
528 nmdc:mga0sz30_472802_c1 3300050516 Bacteria 563
529 Ga0495655_0047838 3300053083 Bacteria 1121
530 Ga0495655_0104889 3300053083 Bacteria 842
531 Ga0500578_0042114 3300053086 Bacteria 2932
532 Ga0500651_0153193 3300053093 Bacteria 1383
533 Ga0500651_0271762 3300053093 Bacteria 980
534 Ga0500562_115993 3300053108 Bacteria 729
535 Ga0500569_000621 3300053109 Bacteria 6028
536 Ga0500569_232252 3300053109 Bacteria 626
537 Ga0500594_0005004 3300053118 Bacteria 2932
538 Ga0500628_025103 3300053129 Bacteria 1244
539 Ga0500655_011122 3300053133 Bacteria 1628
540 Ga0500658_0000176 3300053134 Bacteria 30599
541 Ga0500658_0013451 3300053134 Bacteria 3023
542 Ga0500658_0026039 3300053134 Bacteria 2251
543 Ga0500568_0000517 3300053139 Bacteria 28448
544 Ga0500568_0001042 3300053139 Bacteria 18934
545 Ga0500568_0025416 3300053139 Bacteria 2499
546 Ga0500568_0051956 3300053139 Bacteria 1611
547 Ga0500568_0101591 3300053139 Bacteria 1078
548 Ga0500604_0002311 3300053151 Bacteria 5209
549 Ga0500604_0008630 3300053151 Bacteria 2705
550 Ga0500604_0014673 3300053151 Bacteria 2136
551 Ga0500616_0028823 3300053153 Bacteria 3057
552 Ga0500616_0030590 3300053153 Bacteria 2955
553 Ga0500619_137637 3300053154 Bacteria 832
554 Ga0500620_044088 3300053155 Bacteria 1475
555 Ga0500622_0000064 3300053156 Bacteria 127531
556 Ga0500627_0162813 3300053158 Bacteria 1006
557 Ga0500633_0004763 3300053160 Bacteria 3152
558 Ga0500633_0010298 3300053160 Bacteria 2493
559 Ga0500636_0291763 3300053177 Bacteria 808
560 Ga0587083_0111149 3300059505 Bacteria 696
561 Ga0587088_006200 3300059508 Bacteria 1603
562 Ga0587088_006754 3300059508 Bacteria 1562
563 Ga0587088_026121 3300059508 Bacteria 1012
564 Ga0587072_014124 3300059643 Bacteria 1342
565 Ga0587072_021968 3300059643 Bacteria 1137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_1360185 Ga0496109_1360185_139_633 149
2 3300048920 Ga0496117_0015965 Ga0496117_0015965_5429_5923 149
3 3300048921 Ga0496118_0017439 Ga0496118_0017439_4102_4596 149
4 3300048922 Ga0496119_0025026 Ga0496119_0025026_3211_3705 149
5 3300048924 Ga0496121_0004938 Ga0496121_0004938_2441_2935 149
6 3300048926 Ga0496123_0023761 Ga0496123_0023761_3775_4269 149
7 3300048927 Ga0496124_0010758 Ga0496124_0010758_3635_4129 149
8 3300048928 Ga0496125_0066836 Ga0496125_0066836_44_538 149
9 3300048929 Ga0496126_0045889 Ga0496126_0045889_3364_3858 149
10 3300050492 nmdc:mga0yw44_482011_c1 nmdc:mga0yw44_482011_c1_258_752 149
11 3300050516 nmdc:mga0sz30_472802_c1 nmdc:mga0sz30_472802_c1_16_510 149
12 3300014326 Ga0157380_11459748 Ga0157380_114597481 150
13 3300005548 Ga0070665_100128304 Ga0070665_1001283041 158
14 3300028379 Ga0268266_10100666 Ga0268266_101006661 158
15 3300048925 Ga0496122_0000172 Ga0496122_0000172_18929_19426 158
16 3300048926 Ga0496123_0000132 Ga0496123_0000132_18977_19474 158
17 3300048927 Ga0496124_0012380 Ga0496124_0012380_7396_7893 158
18 3300047472 Ga0495686_0028275 Ga0495686_0028275_1860_2387 159
19 iso_pu_bacteria 2512875026 2512973151 159
20 iso_pu_bacteria 2513237088 2513600261 159
21 iso_pu_bacteria 2513237089 2513603512 159
22 iso_pu_bacteria 2513237156 2513983214 159
23 iso_pu_bacteria 2513237160 2514005752 159
24 iso_pu_bacteria 2517487022 2517571846 159
25 iso_pu_bacteria 2582581294 2585205125 159
26 iso_pu_bacteria 2802428858 2802720792 159
27 iso_pu_bacteria 2802428859 2802724398 159
28 iso_pu_bacteria 2802428860 2802729937 159
29 iso_pu_bacteria 2802428861 2802737281 159
30 iso_pu_bacteria 2802428862 2802746411 159
31 iso_pu_bacteria 2802428863 2802748880 159
32 iso_pu_bacteria 2838074704 2838075924 159
33 iso_pu_bacteria 2842304105 2842309213 159
34 iso_pu_bacteria 2894652903 2894657246 159
35 iso_pu_bacteria 2896384573 2896384626 159
36 iso_pu_bacteria 2915980308 2915982648 159
37 iso_pu_bacteria 2916061851 2916063966 159
38 iso_pu_bacteria 2921250672 2921256377 159
39 iso_pu_bacteria 2933570622 2933575686 159
40 iso_pu_bacteria 2937029754 2937030534 159
41 iso_pu_bacteria 2937036028 2937039001 159
42 iso_pu_bacteria 2937078374 2937083874 159
43 iso_pu_bacteria 2937084907 2937088592 159
44 iso_pu_bacteria 2957375807 2957377968 159
45 iso_pu_bacteria 2957437181 2957442510 159
46 iso_pu_bacteria 2960591022 2960593218 159
47 iso_pu_bacteria 2960631154 2960635323 159
48 iso_pu_bacteria 2960680706 2960682608 159
49 iso_pu_bacteria 2960693952 2960697823 159
50 iso_pu_bacteria 2967686174 2967688502 159
51 iso_pu_bacteria 2967728569 2967732861 159
52 iso_pu_bacteria 2970026789 2970031912 159
53 iso_pu_bacteria 2970122695 2970122729 159
54 iso_pu_bacteria 2970143518 2970145252 159
55 iso_pu_bacteria 2977530762 2977530951 159
56 iso_pu_bacteria 2977544691 2977546977 159
57 iso_pu_bacteria 2989771324 2989776281 159
58 iso_pu_bacteria 8003999396 8004003517 159
59 iso_pu_bacteria 2643221618 2644109848 160
60 iso_pu_bacteria 2643221626 2644145422 160
61 iso_pu_bacteria 2643221636 2644203361 160
62 iso_pu_bacteria 2643221637 2644208447 160
63 iso_pu_bacteria 2643221655 2644312726 160
64 iso_pu_bacteria 2643221659 2644336685 160
65 iso_pu_bacteria 2643221712 2644618457 160
66 iso_pu_bacteria 2643221718 2644651699 160
67 iso_pu_bacteria 2919166419 2919166958 160
68 iso_pu_bacteria 2919171160 2919177264 160
69 iso_pu_bacteria 650716007 650741507 160
70 iso_pu_bacteria 2509276021 2509388925 161
71 iso_pu_bacteria 2509276033 2509444510 161
72 iso_pu_bacteria 2510461076 2510897219 161
73 iso_pu_bacteria 2513237085 2513574888 161
74 iso_pu_bacteria 2513237093 2513636373 161
75 iso_pu_bacteria 2513237103 2513707512 161
76 iso_pu_bacteria 2513237146 2513924073 161
77 iso_pu_bacteria 2513237162 2514022269 161
78 iso_pu_bacteria 2515154113 2515633830 161
79 iso_pu_bacteria 2515154114 2515641348 161
80 iso_pu_bacteria 2515154116 2515659652 161
81 iso_pu_bacteria 2515154134 2515741114 161
82 iso_pu_bacteria 2516653077 2517038528 161
83 iso_pu_bacteria 2516653085 2517078795 161
84 iso_pu_bacteria 2517093000 2517097547 161
85 iso_pu_bacteria 2529292951 2530648275 161
86 iso_pu_bacteria 2534681796 2535518306 161
87 iso_pu_bacteria 2537561587 2537875745 161
88 iso_pu_bacteria 2585427526 2585523873 161
89 iso_pu_bacteria 2599185170 2599416118 161
90 iso_pu_bacteria 2599185210 2599605887 161
91 iso_pu_bacteria 2599185236 2599723197 161
92 iso_pu_bacteria 2643221568 2643856275 161
93 iso_pu_bacteria 2643221634 2644192018 161
94 iso_pu_bacteria 2718217882 2719183414 161
95 iso_pu_bacteria 2718217927 2719388158 161
96 iso_pu_bacteria 2718218009 2719734131 161
97 iso_pu_bacteria 2718218363 2721149526 161
98 iso_pu_bacteria 2718218365 2721160928 161
99 iso_pu_bacteria 2718218366 2721166363 161
100 iso_pu_bacteria 2718218423 2721401793 161
101 iso_pu_bacteria 2721755514 2722842533 161
102 iso_pu_bacteria 2721755809 2724040607 161
103 iso_pu_bacteria 2721755810 2724046887 161
104 iso_pu_bacteria 2724679232 2725947630 161
105 iso_pu_bacteria 2728369365 2730166649 161
106 iso_pu_bacteria 2728369397 2730300560 161
107 iso_pu_bacteria 2765235942 2766063231 161
108 iso_pu_bacteria 2775507049 2776910816 161
109 iso_pu_bacteria 2791355256 2793296686 161
110 iso_pu_bacteria 2791355259 2793314144 161
111 iso_pu_bacteria 2791355260 2793322425 161
112 iso_pu_bacteria 2791355261 2793327646 161
113 iso_pu_bacteria 2791355262 2793336671 161
114 iso_pu_bacteria 2791355263 2793341114 161
115 iso_pu_bacteria 2791355264 2793349600 161
116 iso_pu_bacteria 2791355265 2793352552 161
117 iso_pu_bacteria 2791355267 2793365403 161
118 iso_pu_bacteria 2802429605 2805928291 161
119 iso_pu_bacteria 2802429606 2805936617 161
120 iso_pu_bacteria 2818991439 2819561432 161
121 iso_pu_bacteria 2818991461 2819687685 161
122 iso_pu_bacteria 2821123053 2821130283 161
123 iso_pu_bacteria 2838022645 2838028916 161
124 iso_pu_bacteria 2838035591 2838036240 161
125 iso_pu_bacteria 2838042994 2838044788 161
126 iso_pu_bacteria 2838661181 2838666518 161
127 iso_pu_bacteria 2838668709 2838674094 161
128 iso_pu_bacteria 2838675328 2838679414 161
129 iso_pu_bacteria 2838686498 2838689773 161
130 iso_pu_bacteria 2838701080 2838706466 161
131 iso_pu_bacteria 2838714209 2838718771 161
132 iso_pu_bacteria 2838719591 2838723769 161
133 iso_pu_bacteria 2838724970 2838729092 161
134 iso_pu_bacteria 2838729681 2838731531 161
135 iso_pu_bacteria 2838742623 2838744472 161
136 iso_pu_bacteria 2841846520 2841851140 161
137 iso_pu_bacteria 2841851746 2841853012 161
138 iso_pu_bacteria 2841859092 2841863946 161
139 iso_pu_bacteria 2841864319 2841869043 161
140 iso_pu_bacteria 2842110456 2842112672 161
141 iso_pu_bacteria 2842124991 2842129789 161
142 iso_pu_bacteria 2842130223 2842134467 161
143 iso_pu_bacteria 2842146304 2842151124 161
144 iso_pu_bacteria 2842152218 2842156463 161
145 iso_pu_bacteria 2842156927 2842160339 161
146 iso_pu_bacteria 2842163707 2842165683 161
147 iso_pu_bacteria 2842170452 2842175016 161
148 iso_pu_bacteria 2842175837 2842179933 161
149 iso_pu_bacteria 2842180545 2842183995 161
150 iso_pu_bacteria 2842187318 2842191649 161
151 iso_pu_bacteria 2842198810 2842204972 161
152 iso_pu_bacteria 2842205361 2842208989 161
153 iso_pu_bacteria 2842211629 2842215966 161
154 iso_pu_bacteria 2842217011 2842219353 161
155 iso_pu_bacteria 2842224351 2842228534 161
156 iso_pu_bacteria 2842229732 2842231577 161
157 iso_pu_bacteria 2842243621 2842245954 161
158 iso_pu_bacteria 2842250916 2842256180 161
159 iso_pu_bacteria 2842257432 2842260332 161
160 iso_pu_bacteria 2842271015 2842273743 161
161 iso_pu_bacteria 2842278818 2842282321 161
162 iso_pu_bacteria 2842285085 2842286358 161
163 iso_pu_bacteria 2842304105 2842308396 161
164 iso_pu_bacteria 2842317721 2842321885 161
165 iso_pu_bacteria 2842341865 2842344572 161
166 iso_pu_bacteria 2842363717 2842367851 161
167 iso_pu_bacteria 2842395702 2842397772 161
168 iso_pu_bacteria 2842402390 2842404089 161
169 iso_pu_bacteria 2842409023 2842410208 161
170 iso_pu_bacteria 2842415677 2842416856 161
171 iso_pu_bacteria 2842495871 2842499784 161
172 iso_pu_bacteria 2842509118 2842515590 161
173 iso_pu_bacteria 2842515876 2842520728 161
174 iso_pu_bacteria 2844454524 2844456521 161
175 iso_pu_bacteria 2857516855 2857524445 161
176 iso_pu_bacteria 2869162929 2869164296 161
177 iso_pu_bacteria 2899792073 2899794679 161
178 iso_pu_bacteria 2915650412 2915653743 161
179 iso_pu_bacteria 2919100787 2919104971 161
180 iso_pu_bacteria 2919114240 2919118855 161
181 iso_pu_bacteria 2919166419 2919170892 161
182 iso_pu_bacteria 2920822456 2920828328 161
183 iso_pu_bacteria 2926754445 2926758124 161
184 iso_pu_bacteria 2929138655 2929143090 161
185 iso_pu_bacteria 2933006813 2933011237 161
186 iso_pu_bacteria 2933011516 2933016222 161
187 iso_pu_bacteria 2933016740 2933018311 161
188 iso_pu_bacteria 2933570622 2933574845 161
189 iso_pu_bacteria 2933586486 2933588439 161
190 iso_pu_bacteria 2935901341 2935902392 161
191 iso_pu_bacteria 2936381700 2936388281 161
192 iso_pu_bacteria 2978969890 2978973377 161
193 iso_pu_bacteria 2979100975 2979101643 161
194 iso_pu_bacteria 2984509177 2984510406 161
195 iso_pu_bacteria 2984518228 2984518890 161
196 iso_pu_bacteria 2984537506 2984538755 161
197 iso_pu_bacteria 2984587000 2984591659 161
198 iso_pu_bacteria 2984601300 2984605461 161
199 iso_pu_bacteria 2996893221 2996897677 161
200 iso_pu_bacteria 639633055 639646143 161
201 iso_pu_bacteria 8005275841 8005278361 161
202 iso_pu_bacteria 8005289223 8005291569 161
203 iso_pu_bacteria 8005301065 8005305550 161
204 iso_pu_bacteria 8005307578 8005310322 161
205 iso_pu_bacteria 8005382845 8005384021 161
206 iso_pu_bacteria 8005395548 8005399683 161
207 iso_pu_bacteria 8005542996 8005549203 161
208 iso_pu_bacteria 8005563573 8005565272 161
209 iso_pu_bacteria 8005688590 8005692697 161
210 iso_pu_bacteria 8005695170 8005701384 161
211 iso_pu_bacteria 8018150411 8018152239 161
212 iso_pu_bacteria 8018176218 8018182001 161
213 iso_pu_bacteria 8023680758 8023681201 161
214 iso_pu_bacteria 8023680758 8023687865 161
215 iso_pu_bacteria 8024501048 8024506402 161
216 iso_pu_bacteria 8056375014 8056381105 161
217 iso_pu_bacteria 8056382006 8056382613 161
218 iso_pu_bacteria 8057874678 8057878623 161
219 3300003322 rootL2_10113588 rootL2_101135884 162
220 3300005983 Ga0081540_1026982 Ga0081540_10269822 162
221 3300031901 Ga0307406_10378438 Ga0307406_103784381 162
222 iso_pu_bacteria 2513237146 2513924368 162
223 iso_pu_bacteria 2516653077 2517042795 162
224 iso_pu_bacteria 2517093000 2517100038 162
225 iso_pu_bacteria 2517287029 2517409659 162
226 iso_pu_bacteria 2582581304 2585258153 162
227 iso_pu_bacteria 2582581304 2585259009 162
228 iso_pu_bacteria 2585427526 2585530137 162
229 iso_pu_bacteria 2585427594 2585847411 162
230 iso_pu_bacteria 2599185170 2599419673 162
231 iso_pu_bacteria 2599185236 2599723208 162
232 iso_pu_bacteria 2615840624 2616294785 162
233 iso_pu_bacteria 2643221599 2644005018 162
234 iso_pu_bacteria 2643221599 2644005101 162
235 iso_pu_bacteria 2643221607 2644048045 162
236 iso_pu_bacteria 2643221643 2644238970 162
237 iso_pu_bacteria 2643221686 2644480840 162
238 iso_pu_bacteria 2718217882 2719184449 162
239 iso_pu_bacteria 2718217997 2719668297 162
240 iso_pu_bacteria 2718218009 2719728469 162
241 iso_pu_bacteria 2718218199 2720488990 162
242 iso_pu_bacteria 2718218232 2720609682 162
243 iso_pu_bacteria 2718218233 2720617113 162
244 iso_pu_bacteria 2718218235 2720628245 162
245 iso_pu_bacteria 2718218269 2720772209 162
246 iso_pu_bacteria 2718218363 2721144157 162
247 iso_pu_bacteria 2718218365 2721156253 162
248 iso_pu_bacteria 2718218366 2721161532 162
249 iso_pu_bacteria 2721755514 2722842677 162
250 iso_pu_bacteria 2721755556 2723029629 162
251 iso_pu_bacteria 2721755684 2723563998 162
252 iso_pu_bacteria 2721755685 2723569533 162
253 iso_pu_bacteria 2721755810 2724041494 162
254 iso_pu_bacteria 2721755819 2724092238 162
255 iso_pu_bacteria 2721755822 2724101080 162
256 iso_pu_bacteria 2721755823 2724112606 162
257 iso_pu_bacteria 2728369352 2730110162 162
258 iso_pu_bacteria 2728369365 2730160565 162
259 iso_pu_bacteria 2728369397 2730295786 162
260 iso_pu_bacteria 2738541293 2738805579 162
261 iso_pu_bacteria 2791355260 2793325292 162
262 iso_pu_bacteria 2791355261 2793329204 162
263 iso_pu_bacteria 2791355261 2793330481 162
264 iso_pu_bacteria 2791355264 2793345333 162
265 iso_pu_bacteria 2802429605 2805927096 162
266 iso_pu_bacteria 2802429605 2805929818 162
267 iso_pu_bacteria 2802429606 2805934480 162
268 iso_pu_bacteria 2821123053 2821129635 162
269 iso_pu_bacteria 2838016132 2838016487 162
270 iso_pu_bacteria 2838022645 2838029075 162
271 iso_pu_bacteria 2838035591 2838039794 162
272 iso_pu_bacteria 2838048938 2838050068 162
273 iso_pu_bacteria 2838061910 2838068272 162
274 iso_pu_bacteria 2838068647 2838069023 162
275 iso_pu_bacteria 2838661181 2838664076 162
276 iso_pu_bacteria 2838668709 2838669603 162
277 iso_pu_bacteria 2838701080 2838701975 162
278 iso_pu_bacteria 2842192696 2842198490 162
279 iso_pu_bacteria 2842198810 2842205220 162
280 iso_pu_bacteria 2842250916 2842251602 162
281 iso_pu_bacteria 2842264693 2842265360 162
282 iso_pu_bacteria 2842285085 2842289199 162
283 iso_pu_bacteria 2842311132 2842313518 162
284 iso_pu_bacteria 2842317721 2842323410 162
285 iso_pu_bacteria 2842402390 2842407405 162
286 iso_pu_bacteria 2842409023 2842413346 162
287 iso_pu_bacteria 2842415677 2842419989 162
288 iso_pu_bacteria 2842422224 2842423169 162
289 iso_pu_bacteria 2842428310 2842428587 162
290 iso_pu_bacteria 2842434925 2842435201 162
291 iso_pu_bacteria 2842441272 2842441936 162
292 iso_pu_bacteria 2842447887 2842448017 162
293 iso_pu_bacteria 2842462802 2842463013 162
294 iso_pu_bacteria 2842469257 2842469533 162
295 iso_pu_bacteria 2842489311 2842489578 162
296 iso_pu_bacteria 2842489311 2842490665 162
297 iso_pu_bacteria 2842495871 2842500413 162
298 iso_pu_bacteria 2857516855 2857521450 162
299 iso_pu_bacteria 2857531043 2857535986 162
300 iso_pu_bacteria 2857531043 2857536851 162
301 iso_pu_bacteria 2891373044 2891373939 162
302 iso_pu_bacteria 2891373044 2891375848 162
303 iso_pu_bacteria 2929138655 2929142728 162
304 iso_pu_bacteria 2929138655 2929142805 162
305 iso_pu_bacteria 2933599457 2933599690 162
306 iso_pu_bacteria 2989349275 2989351252 162
307 iso_pu_bacteria 3005409236 3005410697 162
308 iso_pu_bacteria 3005416602 3005422444 162
309 iso_pu_bacteria 3005452660 3005455295 162
310 iso_pu_bacteria 8005282627 8005286201 162
311 iso_pu_bacteria 8005301065 8005306356 162
312 iso_pu_bacteria 8005314921 8005320227 162
313 iso_pu_bacteria 8005382845 8005383524 162
314 iso_pu_bacteria 8005395548 8005399062 162
315 iso_pu_bacteria 8005430974 8005434690 162
316 iso_pu_bacteria 8005497431 8005502503 162
317 iso_pu_bacteria 8005619151 8005623711 162
318 iso_pu_bacteria 8005626139 8005626269 162
319 iso_pu_bacteria 8005668836 8005673931 162
320 iso_pu_bacteria 8005682033 8005686145 162
321 iso_pu_bacteria 8005688590 8005693948 162
322 iso_pu_bacteria 8018127388 8018131858 162
323 iso_pu_bacteria 8024501048 8024506967 162
324 iso_pu_bacteria 8024501048 8024507119 162
325 3300002987 JGI25159J45721_1006757 JGI25159J45721_10067573 163
326 3300003354 JGI25160J50197_1004721 JGI25160J50197_10047219 163
327 3300003374 JGI25161J50226_1003768 JGI25161J50226_10037683 163
328 3300003791 Ga0055530_10054348 Ga0055530_100543481 163
329 3300004625 Ga0055543_1002585 Ga0055543_10025858 163
330 3300005262 Ga0065165_1006770 Ga0065165_10067709 163
331 3300022739 Ga0228711_1000006 Ga0228711_10000069 163
332 3300022740 Ga0228710_1000004 Ga0228710_100000457 163
333 3300025208 Ga0209436_100157 Ga0209436_1001576 163
334 3300025284 Ga0209130_1004002 Ga0209130_100400210 163
335 3300025298 Ga0209050_1039757 Ga0209050_10397571 163
336 3300025302 Ga0207426_1005388 Ga0207426_10053886 163
337 3300025304 Ga0209257_1045883 Ga0209257_10458832 163
338 3300025903 Ga0207680_10484188 Ga0207680_104841882 163
339 3300027111 Ga0209281_1000134 Ga0209281_10001347 163
340 3300027666 Ga0209282_1000013 Ga0209282_100001327 163
341 3300031967 Ga0315914_1000004 Ga0315914_100000462 163
342 3300033430 Ga0315913_1000011 Ga0315913_1000011128 163
343 3300033464 Ga0315915_1000003 Ga0315915_1000003169 163
344 3300041453 Ga0451797_1400354 Ga0451797_1400354_310_801 163
345 3300042004 Ga0439445_0057078 Ga0439445_0057078_524_1015 163
346 3300048921 Ga0496118_0122039 Ga0496118_0122039_767_1258 163
347 3300050494 nmdc:mga06z11_77235_c1 nmdc:mga06z11_77235_c1_633_1127 163
348 3300053133 Ga0500655_011122 Ga0500655_011122_1122_1613 163
349 iso_pu_bacteria 2517093000 2517100060 163
350 iso_pu_bacteria 2529292951 2530645070 163
351 iso_pu_bacteria 2643221643 2644238040 163
352 iso_pu_bacteria 2765235942 2766064526 163
353 iso_pu_bacteria 2791355259 2793317078 163
354 iso_pu_bacteria 2791355267 2793370652 163
355 iso_pu_bacteria 2842110456 2842113920 163
356 iso_pu_bacteria 2857516855 2857521428 163
357 iso_pu_bacteria 2933586486 2933589445 163
358 iso_pu_bacteria 2936367885 2936371009 163
359 iso_pu_bacteria 2936375103 2936375743 163
360 iso_pu_bacteria 8005376324 8005380411 163
361 iso_pu_bacteria 8056375014 8056378730 163
362 3300002774 JGI25150J39212_1000597 JGI25150J39212_10005977 164
363 3300003187 JGI25151J46595_10001479 JGI25151J46595_100014799 164
364 3300003215 JGI25153J46596_10001172 JGI25153J46596_100011729 164
365 3300003771 Ga0055526_1008663 Ga0055526_10086634 164
366 3300003781 Ga0055536_1000901 Ga0055536_100090111 164
367 3300003792 Ga0055540_1000273 Ga0055540_100027354 164
368 3300003792 Ga0055540_1000861 Ga0055540_100086112 164
369 3300003794 Ga0055531_10000106 Ga0055531_100001062 164
370 3300003794 Ga0055531_10001169 Ga0055531_1000116911 164
371 3300006051 Ga0075364_10003206 Ga0075364_100032062 164
372 3300013100 Ga0157373_10096033 Ga0157373_100960332 164
373 3300022467 Ga0224712_10498140 Ga0224712_104981401 164
374 3300025245 Ga0207425_1000083 Ga0207425_10000839 164
375 3300025258 Ga0209129_1000098 Ga0209129_100009877 164
376 3300025273 Ga0209673_1077467 Ga0209673_10774671 164
377 3300025292 Ga0209676_1002652 Ga0209676_100265213 164
378 3300025292 Ga0209676_1017652 Ga0209676_10176523 164
379 3300025294 Ga0209025_1000142 Ga0209025_100014268 164
380 3300025295 Ga0209564_1000306 Ga0209564_10003067 164
381 3300025297 Ga0209758_1000300 Ga0209758_10003009 164
382 3300025298 Ga0209050_1010187 Ga0209050_10101877 164
383 3300025299 Ga0209256_1000246 Ga0209256_10002467 164
384 3300025303 Ga0209051_1000192 Ga0209051_1000192115 164
385 3300025303 Ga0209051_1000480 Ga0209051_100048055 164
386 3300025304 Ga0209257_1000300 Ga0209257_10003002 164
387 3300025304 Ga0209257_1002184 Ga0209257_100218413 164
388 3300025920 Ga0207649_10705014 Ga0207649_107050141 164
389 3300041507 Ga0451851_1042277 Ga0451851_1042277_101_601 164
390 3300046507 Ga0495606_0163326 Ga0495606_0163326_13_510 164
391 3300047472 Ga0495686_0034676 Ga0495686_0034676_1822_2322 164
392 3300047472 Ga0495686_0125527 Ga0495686_0125527_628_1125 164
393 3300048919 Ga0496116_0128029 Ga0496116_0128029_302_802 164
394 3300048919 Ga0496116_0260502 Ga0496116_0260502_58_555 164
395 3300048920 Ga0496117_0073631 Ga0496117_0073631_1429_1926 164
396 3300048920 Ga0496117_0447235 Ga0496117_0447235_75_572 164
397 3300048921 Ga0496118_0374848 Ga0496118_0374848_182_679 164
398 3300048922 Ga0496119_0094480 Ga0496119_0094480_80_577 164
399 3300048924 Ga0496121_0001493 Ga0496121_0001493_6934_7431 164
400 3300048925 Ga0496122_0004334 Ga0496122_0004334_2189_2686 164
401 3300048925 Ga0496122_0150481 Ga0496122_0150481_664_1164 164
402 3300048927 Ga0496124_0197675 Ga0496124_0197675_21_518 164
403 3300048927 Ga0496124_0215595 Ga0496124_0215595_648_1148 164
404 3300048927 Ga0496124_0396526 Ga0496124_0396526_79_579 164
405 3300048928 Ga0496125_0000034 Ga0496125_0000034_305109_305606 164
406 3300048928 Ga0496125_0176925 Ga0496125_0176925_238_738 164
407 3300048929 Ga0496126_0011432 Ga0496126_0011432_6504_7001 164
408 3300049568 Ga0501031_0240088 Ga0501031_0240088_515_1009 164
409 3300049568 Ga0501031_0324140 Ga0501031_0324140_289_783 164
410 3300049570 Ga0501033_0019663 Ga0501033_0019663_4083_4577 164
411 3300049573 Ga0501037_0535276 Ga0501037_0535276_96_590 164
412 3300049574 Ga0501038_0141209 Ga0501038_0141209_504_998 164
413 3300049581 Ga0501047_0042347 Ga0501047_0042347_1790_2284 164
414 3300049585 Ga0501069_0063674 Ga0501069_0063674_658_1152 164
415 3300049586 Ga0501070_0000700 Ga0501070_0000700_13481_13975 164
416 3300049586 Ga0501070_0341369 Ga0501070_0341369_307_801 164
417 3300049589 Ga0501073_0395468 Ga0501073_0395468_415_909 164
418 3300049590 Ga0501074_0000650 Ga0501074_0000650_1130_1624 164
419 3300049590 Ga0501074_0012781 Ga0501074_0012781_3016_3510 164
420 3300049741 Ga0501079_0544000 Ga0501079_0544000_82_576 164
421 3300049742 Ga0501080_0020953 Ga0501080_0020953_369_863 164
422 3300049742 Ga0501080_0613975 Ga0501080_0613975_431_925 164
423 3300049822 Ga0501035_0001514 Ga0501035_0001514_10692_11186 164
424 3300049823 Ga0501044_0003308 Ga0501044_0003308_4600_5094 164
425 3300050491 nmdc:mga00v17_19018_c1 nmdc:mga00v17_19018_c1_2634_3131 164
426 3300053083 Ga0495655_0047838 Ga0495655_0047838_179_676 164
427 3300053139 Ga0500568_0025416 Ga0500568_0025416_1245_1745 164
428 3300059508 Ga0587088_006200 Ga0587088_006200_658_1158 164
429 3300059643 Ga0587072_014124 Ga0587072_014124_714_1214 164
430 iso_pu_bacteria 2643221643 2644239181 164
431 iso_pu_bacteria 2738541293 2738802760 164
432 3300002739 JGI25158J39367_1000852 JGI25158J39367_10008523 165
433 3300002773 JGI25152J39213_1002023 JGI25152J39213_100202311 165
434 3300002773 JGI25152J39213_1004282 JGI25152J39213_10042824 165
435 3300002774 JGI25150J39212_1000048 JGI25150J39212_100004812 165
436 3300002774 JGI25150J39212_1000089 JGI25150J39212_100008950 165
437 3300002987 JGI25159J45721_1008290 JGI25159J45721_10082903 165
438 3300003187 JGI25151J46595_10000172 JGI25151J46595_1000017280 165
439 3300003215 JGI25153J46596_10000245 JGI25153J46596_1000024531 165
440 3300003215 JGI25153J46596_10000863 JGI25153J46596_1000086316 165
441 3300003215 JGI25153J46596_10001376 JGI25153J46596_1000137611 165
442 3300003354 JGI25160J50197_1012918 JGI25160J50197_10129183 165
443 3300003374 JGI25161J50226_1000045 JGI25161J50226_100004544 165
444 3300003771 Ga0055526_1000056 Ga0055526_1000056134 165
445 3300003771 Ga0055526_1008794 Ga0055526_10087947 165
446 3300003775 Ga0055524_1004684 Ga0055524_10046845 165
447 3300003790 Ga0055528_1008132 Ga0055528_10081322 165
448 3300003790 Ga0055528_1021690 Ga0055528_10216903 165
449 3300003792 Ga0055540_1000327 Ga0055540_100032742 165
450 3300003792 Ga0055540_1003219 Ga0055540_10032195 165
451 3300003792 Ga0055540_1003341 Ga0055540_100334111 165
452 3300003794 Ga0055531_10035621 Ga0055531_100356212 165
453 3300003794 Ga0055531_10044973 Ga0055531_100449731 165
454 3300004625 Ga0055543_1000142 Ga0055543_10001429 165
455 3300005262 Ga0065165_1006131 Ga0065165_100613110 165
456 3300005331 Ga0070670_100000116 Ga0070670_10000011659 165
457 3300005337 Ga0070682_100029184 Ga0070682_1000291844 165
458 3300006038 Ga0075365_10049980 Ga0075365_100499804 165
459 3300006048 Ga0075363_100034256 Ga0075363_1000342562 165
460 3300006048 Ga0075363_100174014 Ga0075363_1001740142 165
461 3300006051 Ga0075364_10000121 Ga0075364_1000012135 165
462 3300006186 Ga0075369_10102469 Ga0075369_101024693 165
463 3300006195 Ga0075366_10059977 Ga0075366_100599772 165
464 3300006353 Ga0075370_10049062 Ga0075370_100490622 165
465 3300006353 Ga0075370_10101168 Ga0075370_101011681 165
466 3300006946 Ga0079104_1000405 Ga0079104_100040510 165
467 3300009765 Ga0123341_1000010 Ga0123341_100001041 165
468 3300013297 Ga0157378_10358184 Ga0157378_103581842 165
469 3300013306 Ga0163162_12043075 Ga0163162_120430751 165
470 3300014326 Ga0157380_10217637 Ga0157380_102176371 165
471 3300015690 Ga0183363_1062 Ga0183363_106222 165
472 3300025208 Ga0209436_100001 Ga0209436_100001204 165
473 3300025208 Ga0209436_100003 Ga0209436_10000339 165
474 3300025228 Ga0209672_111167 Ga0209672_1111672 165
475 3300025245 Ga0207425_1000100 Ga0207425_100010017 165
476 3300025245 Ga0207425_1002533 Ga0207425_10025336 165
477 3300025258 Ga0209129_1000191 Ga0209129_100019117 165
478 3300025258 Ga0209129_1000405 Ga0209129_100040529 165
479 3300025273 Ga0209673_1000397 Ga0209673_100039767 165
480 3300025273 Ga0209673_1000489 Ga0209673_100048916 165
481 3300025273 Ga0209673_1004294 Ga0209673_10042944 165
482 3300025273 Ga0209673_1015354 Ga0209673_10153543 165
483 3300025284 Ga0209130_1000049 Ga0209130_100004993 165
484 3300025294 Ga0209025_1000427 Ga0209025_100042717 165
485 3300025294 Ga0209025_1125452 Ga0209025_11254521 165
486 3300025295 Ga0209564_1000255 Ga0209564_1000255121 165
487 3300025295 Ga0209564_1069343 Ga0209564_10693431 165
488 3300025297 Ga0209758_1000175 Ga0209758_100017580 165
489 3300025297 Ga0209758_1000352 Ga0209758_100035276 165
490 3300025297 Ga0209758_1002560 Ga0209758_100256012 165
491 3300025297 Ga0209758_1038565 Ga0209758_10385652 165
492 3300025297 Ga0209758_1069869 Ga0209758_10698692 165
493 3300025299 Ga0209256_1000379 Ga0209256_100037922 165
494 3300025299 Ga0209256_1011575 Ga0209256_10115755 165
495 3300025302 Ga0207426_1000043 Ga0207426_1000043125 165
496 3300025303 Ga0209051_1000245 Ga0209051_100024576 165
497 3300025303 Ga0209051_1003127 Ga0209051_100312711 165
498 3300025303 Ga0209051_1003955 Ga0209051_10039554 165
499 3300025303 Ga0209051_1023325 Ga0209051_10233252 165
500 3300025304 Ga0209257_1006475 Ga0209257_10064753 165
501 3300025923 Ga0207681_10155775 Ga0207681_101557753 165
502 3300025925 Ga0207650_10000797 Ga0207650_1000079714 165
503 3300027111 Ga0209281_1000513 Ga0209281_100051310 165
504 3300028794 Ga0307515_10250375 Ga0307515_102503752 165
505 3300031731 Ga0307405_10006988 Ga0307405_100069887 165
506 3300031901 Ga0307406_10004304 Ga0307406_100043046 165
507 3300031911 Ga0307412_10081314 Ga0307412_100813145 165
508 3300041404 Ga0439436_0141087 Ga0439436_0141087_47_544 165
509 3300041413 Ga0439465_0002404 Ga0439465_0002404_4488_4988 165
510 3300041413 Ga0439465_0032272 Ga0439465_0032272_232_729 165
511 3300041443 Ga0451789_1056321 Ga0451789_1056321_10_507 165
512 3300041453 Ga0451797_1251711 Ga0451797_1251711_1066_1563 165
513 3300041458 Ga0451798_0683035 Ga0451798_0683035_19_516 165
514 3300041459 Ga0451800_0107967 Ga0451800_0107967_413_910 165
515 3300041486 Ga0451807_2057839 Ga0451807_2057839_272_769 165
516 3300041491 Ga0451833_0550258 Ga0451833_0550258_813_1319 165
517 3300041492 Ga0451835_0600583 Ga0451835_0600583_365_862 165
518 3300041494 Ga0451837_0587038 Ga0451837_0587038_918_1415 165
519 3300041494 Ga0451837_1281686 Ga0451837_1281686_77_574 165
520 3300041496 Ga0451839_0025619 Ga0451839_0025619_2132_2629 165
521 3300041496 Ga0451839_0628215 Ga0451839_0628215_686_1183 165
522 3300041498 Ga0451841_0405338 Ga0451841_0405338_4907_5413 165
523 3300041498 Ga0451841_1009422 Ga0451841_1009422_352_849 165
524 3300041501 Ga0451845_0431176 Ga0451845_0431176_473_970 165
525 3300041507 Ga0451851_0424964 Ga0451851_0424964_135_632 165
526 3300041509 Ga0451843_1721569 Ga0451843_1721569_21_518 165
527 3300041511 Ga0451855_1727606 Ga0451855_1727606_404_910 165
528 3300041512 Ga0451853_0323784 Ga0451853_0323784_1209_1706 165
529 3300041512 Ga0451853_1968180 Ga0451853_1968180_10568_11074 165
530 3300041512 Ga0451853_3792942 Ga0451853_3792942_616_1113 165
531 3300042007 Ga0439449_0012315 Ga0439449_0012315_874_1371 165
532 3300042007 Ga0439449_0026917 Ga0439449_0026917_987_1484 165
533 3300042146 Ga0450907_045408 Ga0450907_045408_115_612 165
534 3300044901 Ga0466960_0601899 Ga0466960_0601899_48_551 165
535 3300046471 Ga0495650_0113508 Ga0495650_0113508_204_701 165
536 3300046474 Ga0495605_0020349 Ga0495605_0020349_139_636 165
537 3300046492 Ga0495585_0039713 Ga0495585_0039713_1999_2496 165
538 3300046492 Ga0495585_0057492 Ga0495585_0057492_533_1033 165
539 3300046500 Ga0495596_0139635 Ga0495596_0139635_102_599 165
540 3300046501 Ga0495607_0025542 Ga0495607_0025542_1465_1962 165
541 3300046501 Ga0495607_0048648 Ga0495607_0048648_156_653 165
542 3300046506 Ga0495583_0154658 Ga0495583_0154658_331_828 165
543 3300046507 Ga0495606_0011287 Ga0495606_0011287_4042_4539 165
544 3300046507 Ga0495606_0129703 Ga0495606_0129703_210_710 165
545 3300046512 Ga0495610_0025221 Ga0495610_0025221_1206_1703 165
546 3300046513 Ga0495616_0087061 Ga0495616_0087061_23_520 165
547 3300046515 Ga0495620_0035539 Ga0495620_0035539_1518_2015 165
548 3300046515 Ga0495620_0147015 Ga0495620_0147015_39_539 165
549 3300046518 Ga0495631_0043216 Ga0495631_0043216_55_552 165
550 3300046518 Ga0495631_0049327 Ga0495631_0049327_1152_1649 165
551 3300046522 Ga0495643_0014336 Ga0495643_0014336_3573_4073 165
552 3300046522 Ga0495643_0024665 Ga0495643_0024665_2216_2722 165
553 3300046522 Ga0495643_0100749 Ga0495643_0100749_859_1356 165
554 3300046524 Ga0495648_0029734 Ga0495648_0029734_1961_2458 165
555 3300046525 Ga0495663_0288166 Ga0495663_0288166_62_559 165
556 3300046530 Ga0495654_0264875 Ga0495654_0264875_68_565 165
557 3300046542 Ga0495597_0018032 Ga0495597_0018032_2030_2527 165
558 3300046557 Ga0495622_0106514 Ga0495622_0106514_317_817 165
559 3300046558 Ga0495633_0015168 Ga0495633_0015168_998_1495 165
560 3300046558 Ga0495633_0271283 Ga0495633_0271283_106_606 165
561 3300046615 Ga0495656_0134244 Ga0495656_0134244_629_1126 165
562 3300046616 Ga0495668_0080434 Ga0495668_0080434_204_701 165
563 3300046616 Ga0495668_0384992 Ga0495668_0384992_140_637 165
564 3300046660 Ga0495625_0056504 Ga0495625_0056504_111_608 165
565 3300046675 Ga0495657_0200709 Ga0495657_0200709_101_601 165
566 3300046691 Ga0495670_0134412 Ga0495670_0134412_331_831 165
567 3300046694 Ga0495649_0110431 Ga0495649_0110431_747_1244 165
568 3300046694 Ga0495649_0168037 Ga0495649_0168037_224_724 165
569 3300046809 Ga0495600_0011202 Ga0495600_0011202_4926_5426 165
570 3300046810 Ga0495660_0019703 Ga0495660_0019703_347_844 165
571 3300047317 Ga0495604_0147039 Ga0495604_0147039_915_1415 165
572 3300047470 Ga0495681_0157129 Ga0495681_0157129_296_793 165
573 3300048090 Ga0495615_0008064 Ga0495615_0008064_100_597 165
574 3300048909 Ga0496106_0000945 Ga0496106_0000945_3236_3736 165
575 3300048919 Ga0496116_0001077 Ga0496116_0001077_24782_25294 165
576 3300048919 Ga0496116_0051077 Ga0496116_0051077_1670_2170 165
577 3300048919 Ga0496116_0095514 Ga0496116_0095514_47_559 165
578 3300048919 Ga0496116_0133730 Ga0496116_0133730_602_1111 165
579 3300048920 Ga0496117_0292447 Ga0496117_0292447_242_751 165
580 3300048921 Ga0496118_0023971 Ga0496118_0023971_1906_2415 165
581 3300048922 Ga0496119_0021140 Ga0496119_0021140_126_635 165
582 3300048922 Ga0496119_0201185 Ga0496119_0201185_285_788 165
583 3300048924 Ga0496121_0000115 Ga0496121_0000115_136790_137290 165
584 3300048924 Ga0496121_0018935 Ga0496121_0018935_1957_2466 165
585 3300048924 Ga0496121_0063940 Ga0496121_0063940_1980_2480 165
586 3300048924 Ga0496121_0543955 Ga0496121_0543955_25_528 165
587 3300048925 Ga0496122_0109780 Ga0496122_0109780_990_1493 165
588 3300048925 Ga0496122_0117214 Ga0496122_0117214_870_1373 165
589 3300048925 Ga0496122_0168951 Ga0496122_0168951_669_1178 165
590 3300048926 Ga0496123_0073891 Ga0496123_0073891_262_765 165
591 3300048926 Ga0496123_0124758 Ga0496123_0124758_407_916 165
592 3300048927 Ga0496124_0000153 Ga0496124_0000153_12619_13131 165
593 3300048927 Ga0496124_0135368 Ga0496124_0135368_344_844 165
594 3300048927 Ga0496124_0347901 Ga0496124_0347901_62_565 165
595 3300048928 Ga0496125_0000143 Ga0496125_0000143_114242_114745 165
596 3300048928 Ga0496125_0065345 Ga0496125_0065345_1426_1926 165
597 3300048928 Ga0496125_0145292 Ga0496125_0145292_530_1039 165
598 3300048929 Ga0496126_0013497 Ga0496126_0013497_7288_7791 165
599 3300048929 Ga0496126_0140640 Ga0496126_0140640_371_874 165
600 3300049744 Ga0501083_0064095 Ga0501083_0064095_605_1105 165
601 3300050490 nmdc:mga03n38_75815_c1 nmdc:mga03n38_75815_c1_714_1211 165
602 3300050491 nmdc:mga00v17_49_c1 nmdc:mga00v17_49_c1_24895_25395 165
603 3300050493 nmdc:mga0k408_92006_c1 nmdc:mga0k408_92006_c1_332_829 165
604 3300050496 nmdc:mga07m45_103081_c1 nmdc:mga07m45_103081_c1_1120_1620 165
605 3300050516 nmdc:mga0sz30_25180_c1 nmdc:mga0sz30_25180_c1_1395_1895 165
606 3300053083 Ga0495655_0104889 Ga0495655_0104889_187_684 165
607 3300053093 Ga0500651_0271762 Ga0500651_0271762_44_541 165
608 3300053108 Ga0500562_115993 Ga0500562_115993_183_689 165
609 3300053109 Ga0500569_232252 Ga0500569_232252_22_519 165
610 3300053129 Ga0500628_025103 Ga0500628_025103_631_1128 165
611 3300053134 Ga0500658_0000176 Ga0500658_0000176_3081_3578 165
612 3300053134 Ga0500658_0026039 Ga0500658_0026039_1004_1504 165
613 3300053139 Ga0500568_0101591 Ga0500568_0101591_540_1040 165
614 3300053151 Ga0500604_0002311 Ga0500604_0002311_707_1207 165
615 3300053153 Ga0500616_0028823 Ga0500616_0028823_1239_1736 165
616 3300053154 Ga0500619_137637 Ga0500619_137637_109_609 165
617 3300053177 Ga0500636_0291763 Ga0500636_0291763_112_612 165
618 3300059508 Ga0587088_006754 Ga0587088_006754_106_606 165
619 3300059508 Ga0587088_026121 Ga0587088_026121_302_799 165
620 3300059643 Ga0587072_021968 Ga0587072_021968_346_849 165
621 3300002705 JGI25156J39149_1000008 JGI25156J39149_100000896 166
622 3300002737 JGI25162J39368_1000071 JGI25162J39368_100007141 166
623 3300002738 JGI25154J39366_1000050 JGI25154J39366_100005029 166
624 3300002739 JGI25158J39367_1000023 JGI25158J39367_100002331 166
625 3300002741 JGI25157J39369_1000028 JGI25157J39369_100002897 166
626 3300002773 JGI25152J39213_1000941 JGI25152J39213_10009418 166
627 3300002773 JGI25152J39213_1002378 JGI25152J39213_100237810 166
628 3300002773 JGI25152J39213_1007246 JGI25152J39213_10072462 166
629 3300002987 JGI25159J45721_1001401 JGI25159J45721_100140114 166
630 3300002987 JGI25159J45721_1002493 JGI25159J45721_10024936 166
631 3300003187 JGI25151J46595_10000905 JGI25151J46595_1000090512 166
632 3300003187 JGI25151J46595_10001095 JGI25151J46595_1000109510 166
633 3300003187 JGI25151J46595_10020496 JGI25151J46595_100204964 166
634 3300003187 JGI25151J46595_10080247 JGI25151J46595_100802471 166
635 3300003214 JGI25165J46597_1000134 JGI25165J46597_100013441 166
636 3300003215 JGI25153J46596_10004228 JGI25153J46596_100042283 166
637 3300003322 rootL2_10115729 rootL2_101157292 166
638 3300003322 rootL2_10126102 rootL2_101261029 166
639 3300003323 rootH1_10125649 rootH1_101256495 166
640 3300003354 JGI25160J50197_1001898 JGI25160J50197_100189814 166
641 3300003354 JGI25160J50197_1012703 JGI25160J50197_10127033 166
642 3300003374 JGI25161J50226_1000189 JGI25161J50226_100018931 166
643 3300003374 JGI25161J50226_1000989 JGI25161J50226_100098914 166
644 3300003771 Ga0055526_1003386 Ga0055526_10033864 166
645 3300003771 Ga0055526_1005991 Ga0055526_10059917 166
646 3300003771 Ga0055526_1014903 Ga0055526_10149031 166
647 3300003775 Ga0055524_1000366 Ga0055524_100036645 166
648 3300003775 Ga0055524_1001261 Ga0055524_100126117 166
649 3300003775 Ga0055524_1001709 Ga0055524_10017097 166
650 3300003775 Ga0055524_1005153 Ga0055524_10051533 166
651 3300003790 Ga0055528_1000096 Ga0055528_10000965 166
652 3300003790 Ga0055528_1000210 Ga0055528_100021019 166
653 3300003790 Ga0055528_1000411 Ga0055528_10004111 166
654 3300003790 Ga0055528_1001638 Ga0055528_100163814 166
655 3300003790 Ga0055528_1002634 Ga0055528_10026343 166
656 3300003792 Ga0055540_1002032 Ga0055540_10020323 166
657 3300003792 Ga0055540_1059022 Ga0055540_10590221 166
658 3300003794 Ga0055531_10037448 Ga0055531_100374482 166
659 3300004625 Ga0055543_1000105 Ga0055543_100010546 166
660 3300004625 Ga0055543_1001314 Ga0055543_10013144 166
661 3300005262 Ga0065165_1003820 Ga0065165_10038204 166
662 3300005262 Ga0065165_1004657 Ga0065165_10046577 166
663 3300005289 Ga0065704_10203769 Ga0065704_102037692 166
664 3300005337 Ga0070682_100260992 Ga0070682_1002609922 166
665 3300005355 Ga0070671_100054542 Ga0070671_1000545424 166
666 3300005367 Ga0070667_100219993 Ga0070667_1002199932 166
667 3300005455 Ga0070663_100528262 Ga0070663_1005282622 166
668 3300005543 Ga0070672_101726736 Ga0070672_1017267361 166
669 3300005548 Ga0070665_100268933 Ga0070665_1002689333 166
670 3300005548 Ga0070665_100597702 Ga0070665_1005977022 166
671 3300005616 Ga0068852_100564953 Ga0068852_1005649532 166
672 3300006051 Ga0075364_10004254 Ga0075364_100042544 166
673 3300006051 Ga0075364_10114867 Ga0075364_101148673 166
674 3300006178 Ga0075367_10120259 Ga0075367_101202592 166
675 3300006353 Ga0075370_10012042 Ga0075370_100120427 166
676 3300006353 Ga0075370_10301998 Ga0075370_103019982 166
677 3300009011 Ga0105251_10006612 Ga0105251_100066122 166
678 3300009036 Ga0105244_10113224 Ga0105244_101132241 166
679 3300009036 Ga0105244_10169406 Ga0105244_101694061 166
680 3300009092 Ga0105250_10026217 Ga0105250_100262171 166
681 3300009177 Ga0105248_10389598 Ga0105248_103895982 166
682 3300009551 Ga0105238_10451829 Ga0105238_104518291 166
683 3300009551 Ga0105238_10598912 Ga0105238_105989121 166
684 3300011119 Ga0105246_10348417 Ga0105246_103484171 166
685 3300013104 Ga0157370_10168969 Ga0157370_101689692 166
686 3300013104 Ga0157370_11130196 Ga0157370_111301962 166
687 3300013297 Ga0157378_12256563 Ga0157378_122565631 166
688 3300013307 Ga0157372_10858533 Ga0157372_108585332 166
689 3300013307 Ga0157372_10879084 Ga0157372_108790841 166
690 3300025206 Ga0209435_100020 Ga0209435_10002093 166
691 3300025208 Ga0209436_100022 Ga0209436_10002230 166
692 3300025230 Ga0209563_101593 Ga0209563_1015935 166
693 3300025233 Ga0209437_100191 Ga0209437_10019173 166
694 3300025246 Ga0209646_1000070 Ga0209646_100007093 166
695 3300025250 Ga0209026_1000057 Ga0209026_1000057129 166
696 3300025256 Ga0209759_1000047 Ga0209759_1000047129 166
697 3300025258 Ga0209129_1000045 Ga0209129_1000045256 166
698 3300025258 Ga0209129_1000045 Ga0209129_100004570 166
699 3300025258 Ga0209129_1000684 Ga0209129_100068415 166
700 3300025258 Ga0209129_1000833 Ga0209129_10008335 166
701 3300025261 Ga0209233_1000200 Ga0209233_100020073 166
702 3300025263 Ga0209565_1026833 Ga0209565_10268332 166
703 3300025273 Ga0209673_1000252 Ga0209673_100025236 166
704 3300025273 Ga0209673_1000416 Ga0209673_100041644 166
705 3300025273 Ga0209673_1000688 Ga0209673_100068825 166
706 3300025273 Ga0209673_1001777 Ga0209673_10017777 166
707 3300025284 Ga0209130_1000002 Ga0209130_1000002513 166
708 3300025284 Ga0209130_1000651 Ga0209130_100065148 166
709 3300025292 Ga0209676_1009389 Ga0209676_10093891 166
710 3300025292 Ga0209676_1032166 Ga0209676_10321662 166
711 3300025294 Ga0209025_1000148 Ga0209025_100014852 166
712 3300025294 Ga0209025_1000376 Ga0209025_100037681 166
713 3300025294 Ga0209025_1000653 Ga0209025_100065371 166
714 3300025294 Ga0209025_1001202 Ga0209025_100120221 166
715 3300025294 Ga0209025_1006314 Ga0209025_10063147 166
716 3300025294 Ga0209025_1006941 Ga0209025_10069414 166
717 3300025295 Ga0209564_1000262 Ga0209564_10002628 166
718 3300025295 Ga0209564_1002329 Ga0209564_10023299 166
719 3300025295 Ga0209564_1011171 Ga0209564_10111712 166
720 3300025297 Ga0209758_1000786 Ga0209758_10007865 166
721 3300025299 Ga0209256_1000463 Ga0209256_100046343 166
722 3300025299 Ga0209256_1001363 Ga0209256_100136321 166
723 3300025299 Ga0209256_1001590 Ga0209256_100159015 166
724 3300025299 Ga0209256_1001700 Ga0209256_100170016 166
725 3300025302 Ga0207426_1000013 Ga0207426_1000013513 166
726 3300025302 Ga0207426_1000856 Ga0207426_10008564 166
727 3300025302 Ga0207426_1001095 Ga0207426_100109510 166
728 3300025303 Ga0209051_1001053 Ga0209051_100105317 166
729 3300025303 Ga0209051_1026193 Ga0209051_10261932 166
730 3300025304 Ga0209257_1002138 Ga0209257_100213813 166
731 3300025304 Ga0209257_1010503 Ga0209257_10105035 166
732 3300025304 Ga0209257_1025048 Ga0209257_10250481 166
733 3300025304 Ga0209257_1045796 Ga0209257_10457962 166
734 3300025728 Ga0207655_1108665 Ga0207655_11086652 166
735 3300025923 Ga0207681_10194364 Ga0207681_101943642 166
736 3300025931 Ga0207644_10095151 Ga0207644_100951512 166
737 3300025940 Ga0207691_11454331 Ga0207691_114543311 166
738 3300025941 Ga0207711_10417641 Ga0207711_104176412 166
739 3300025986 Ga0207658_10204444 Ga0207658_102044442 166
740 3300026067 Ga0207678_10122345 Ga0207678_101223453 166
741 3300028379 Ga0268266_10413884 Ga0268266_104138841 166
742 3300028379 Ga0268266_10480573 Ga0268266_104805731 166
743 3300028794 Ga0307515_10001651 Ga0307515_1000165124 166
744 3300031911 Ga0307412_10006600 Ga0307412_100066006 166
745 3300031911 Ga0307412_10016775 Ga0307412_100167752 166
746 3300041413 Ga0439465_0020102 Ga0439465_0020102_721_1221 166
747 3300041443 Ga0451789_1219991 Ga0451789_1219991_138_647 166
748 3300041491 Ga0451833_0041652 Ga0451833_0041652_380_880 166
749 3300041498 Ga0451841_1189662 Ga0451841_1189662_843_1343 166
750 3300041501 Ga0451845_0246094 Ga0451845_0246094_4775_5275 166
751 3300041503 Ga0451847_0306313 Ga0451847_0306313_269_769 166
752 3300041509 Ga0451843_0278965 Ga0451843_0278965_380_880 166
753 3300041509 Ga0451843_1003149 Ga0451843_1003149_351_851 166
754 3300041511 Ga0451855_1081656 Ga0451855_1081656_818_1318 166
755 3300041512 Ga0451853_0415950 Ga0451853_0415950_319_819 166
756 3300042007 Ga0439449_0046608 Ga0439449_0046608_850_1350 166
757 3300046452 Ga0495617_082978 Ga0495617_082978_248_748 166
758 3300046457 Ga0495590_0063074 Ga0495590_0063074_147_647 166
759 3300046460 Ga0495638_0065667 Ga0495638_0065667_685_1188 166
760 3300046460 Ga0495638_0078423 Ga0495638_0078423_1171_1671 166
761 3300046501 Ga0495607_0002062 Ga0495607_0002062_15066_15572 166
762 3300046507 Ga0495606_0005017 Ga0495606_0005017_7460_7960 166
763 3300046507 Ga0495606_0012421 Ga0495606_0012421_1671_2192 166
764 3300046507 Ga0495606_0013330 Ga0495606_0013330_1225_1740 166
765 3300046507 Ga0495606_0015452 Ga0495606_0015452_5218_5727 166
766 3300046512 Ga0495610_0002757 Ga0495610_0002757_3946_4485 166
767 3300046512 Ga0495610_0007425 Ga0495610_0007425_5045_5545 166
768 3300046512 Ga0495610_0365207 Ga0495610_0365207_10_516 166
769 3300046515 Ga0495620_0009675 Ga0495620_0009675_2389_2889 166
770 3300046518 Ga0495631_0073289 Ga0495631_0073289_359_859 166
771 3300046519 Ga0495632_0001480 Ga0495632_0001480_18408_18908 166
772 3300046519 Ga0495632_0001547 Ga0495632_0001547_14482_14982 166
773 3300046519 Ga0495632_0041838 Ga0495632_0041838_581_1120 166
774 3300046522 Ga0495643_0002657 Ga0495643_0002657_9926_10426 166
775 3300046522 Ga0495643_0046685 Ga0495643_0046685_67_606 166
776 3300046522 Ga0495643_0118155 Ga0495643_0118155_208_714 166
777 3300046524 Ga0495648_0148472 Ga0495648_0148472_105_605 166
778 3300046530 Ga0495654_0238317 Ga0495654_0238317_32_532 166
779 3300046542 Ga0495597_0006785 Ga0495597_0006785_2073_2573 166
780 3300046558 Ga0495633_0307191 Ga0495633_0307191_179_679 166
781 3300046616 Ga0495668_0322933 Ga0495668_0322933_37_537 166
782 3300046660 Ga0495625_0057176 Ga0495625_0057176_50_550 166
783 3300046692 Ga0495671_0228113 Ga0495671_0228113_369_869 166
784 3300046694 Ga0495649_0000467 Ga0495649_0000467_3832_4332 166
785 3300046694 Ga0495649_0067349 Ga0495649_0067349_211_711 166
786 3300046810 Ga0495660_0010022 Ga0495660_0010022_2184_2684 166
787 3300047318 Ga0495636_0070094 Ga0495636_0070094_793_1293 166
788 3300047443 Ga0495687_028474 Ga0495687_028474_655_1155 166
789 3300047470 Ga0495681_0042119 Ga0495681_0042119_1341_1841 166
790 3300047472 Ga0495686_0013818 Ga0495686_0013818_1769_2269 166
791 3300047472 Ga0495686_0014146 Ga0495686_0014146_3772_4311 166
792 3300048091 Ga0495626_0011516 Ga0495626_0011516_1426_1926 166
793 3300048904 Ga0496101_0549376 Ga0496101_0549376_255_758 166
794 3300048905 Ga0496102_0048473 Ga0496102_0048473_240_740 166
795 3300048907 Ga0496104_0045738 Ga0496104_0045738_1304_1804 166
796 3300048908 Ga0496105_0069820 Ga0496105_0069820_1313_1813 166
797 3300048909 Ga0496106_0000858 Ga0496106_0000858_19786_20286 166
798 3300048909 Ga0496106_0009110 Ga0496106_0009110_1699_2199 166
799 3300048909 Ga0496106_0010954 Ga0496106_0010954_3152_3655 166
800 3300048910 Ga0496107_0042252 Ga0496107_0042252_25_528 166
801 3300048910 Ga0496107_0235603 Ga0496107_0235603_390_890 166
802 3300048911 Ga0496108_0097075 Ga0496108_0097075_1290_1790 166
803 3300048913 Ga0496110_0020326 Ga0496110_0020326_4490_4990 166
804 3300048914 Ga0496111_0027349 Ga0496111_0027349_1174_1674 166
805 3300048916 Ga0496113_0077476 Ga0496113_0077476_957_1457 166
806 3300048917 Ga0496114_0459256 Ga0496114_0459256_550_1050 166
807 3300048919 Ga0496116_0016851 Ga0496116_0016851_1412_1915 166
808 3300048919 Ga0496116_0041493 Ga0496116_0041493_173_673 166
809 3300048919 Ga0496116_0063331 Ga0496116_0063331_339_920 166
810 3300048920 Ga0496117_0004366 Ga0496117_0004366_164_670 166
811 3300048920 Ga0496117_0007375 Ga0496117_0007375_5233_5739 166
812 3300048920 Ga0496117_0044019 Ga0496117_0044019_361_864 166
813 3300048921 Ga0496118_0008953 Ga0496118_0008953_1938_2438 166
814 3300048921 Ga0496118_0121563 Ga0496118_0121563_620_1126 166
815 3300048921 Ga0496118_0147100 Ga0496118_0147100_405_911 166
816 3300048921 Ga0496118_0150028 Ga0496118_0150028_631_1134 166
817 3300048921 Ga0496118_0266879 Ga0496118_0266879_14_517 166
818 3300048921 Ga0496118_0304238 Ga0496118_0304238_340_846 166
819 3300048922 Ga0496119_0014757 Ga0496119_0014757_1092_1592 166
820 3300048922 Ga0496119_0043761 Ga0496119_0043761_2260_2760 166
821 3300048922 Ga0496119_0115853 Ga0496119_0115853_899_1402 166
822 3300048922 Ga0496119_0297491 Ga0496119_0297491_217_717 166
823 3300048922 Ga0496119_0479265 Ga0496119_0479265_37_543 166
824 3300048923 Ga0496120_0010917 Ga0496120_0010917_3356_3856 166
825 3300048923 Ga0496120_0180638 Ga0496120_0180638_54_560 166
826 3300048924 Ga0496121_0006670 Ga0496121_0006670_1844_2347 166
827 3300048924 Ga0496121_0026828 Ga0496121_0026828_533_1033 166
828 3300048924 Ga0496121_0037053 Ga0496121_0037053_2610_3110 166
829 3300048924 Ga0496121_0041293 Ga0496121_0041293_1699_2214 166
830 3300048924 Ga0496121_0050309 Ga0496121_0050309_540_1058 166
831 3300048924 Ga0496121_0077099 Ga0496121_0077099_1007_1522 166
832 3300048924 Ga0496121_0189264 Ga0496121_0189264_209_712 166
833 3300048924 Ga0496121_0196383 Ga0496121_0196383_294_797 166
834 3300048924 Ga0496121_0572098 Ga0496121_0572098_27_533 166
835 3300048924 Ga0496121_0707281 Ga0496121_0707281_15_515 166
836 3300048925 Ga0496122_0000032 Ga0496122_0000032_268512_269018 166
837 3300048925 Ga0496122_0009735 Ga0496122_0009735_909_1409 166
838 3300048925 Ga0496122_0012567 Ga0496122_0012567_5875_6378 166
839 3300048925 Ga0496122_0111808 Ga0496122_0111808_1127_1627 166
840 3300048926 Ga0496123_0000094 Ga0496123_0000094_155148_155654 166
841 3300048927 Ga0496124_0000072 Ga0496124_0000072_32844_33344 166
842 3300048927 Ga0496124_0001217 Ga0496124_0001217_38247_38753 166
843 3300048927 Ga0496124_0001539 Ga0496124_0001539_20700_21200 166
844 3300048927 Ga0496124_0002519 Ga0496124_0002519_20644_21150 166
845 3300048927 Ga0496124_0010326 Ga0496124_0010326_6334_6849 166
846 3300048927 Ga0496124_0025519 Ga0496124_0025519_3122_3625 166
847 3300048927 Ga0496124_0038139 Ga0496124_0038139_754_1257 166
848 3300048927 Ga0496124_0079846 Ga0496124_0079846_1479_1979 166
849 3300048927 Ga0496124_0354453 Ga0496124_0354453_491_997 166
850 3300048927 Ga0496124_0477014 Ga0496124_0477014_160_660 166
851 3300048928 Ga0496125_0000631 Ga0496125_0000631_52915_53421 166
852 3300048928 Ga0496125_0019293 Ga0496125_0019293_4818_5318 166
853 3300048928 Ga0496125_0143194 Ga0496125_0143194_997_1503 166
854 3300048928 Ga0496125_0302556 Ga0496125_0302556_453_953 166
855 3300048929 Ga0496126_0002532 Ga0496126_0002532_9223_9726 166
856 3300048929 Ga0496126_0020488 Ga0496126_0020488_5132_5638 166
857 3300048929 Ga0496126_0105512 Ga0496126_0105512_1115_1615 166
858 3300048929 Ga0496126_0413865 Ga0496126_0413865_489_992 166
859 3300049459 Ga0495678_028477 Ga0495678_028477_556_1095 166
860 3300049459 Ga0495678_105170 Ga0495678_105170_131_631 166
861 3300049569 Ga0501032_0053495 Ga0501032_0053495_1728_2231 166
862 3300049570 Ga0501033_0004453 Ga0501033_0004453_7341_7844 166
863 3300049571 Ga0501034_1308673 Ga0501034_1308673_47_553 166
864 3300049822 Ga0501035_0001499 Ga0501035_0001499_22615_23118 166
865 3300050491 nmdc:mga00v17_3391_c1 nmdc:mga00v17_3391_c1_1378_1878 166
866 3300050496 nmdc:mga07m45_348054_c1 nmdc:mga07m45_348054_c1_273_773 166
867 3300050496 nmdc:mga07m45_573835_c1 nmdc:mga07m45_573835_c1_28_528 166
868 3300053086 Ga0500578_0042114 Ga0500578_0042114_1808_2308 166
869 3300053093 Ga0500651_0153193 Ga0500651_0153193_65_565 166
870 3300053109 Ga0500569_000621 Ga0500569_000621_708_1208 166
871 3300053118 Ga0500594_0005004 Ga0500594_0005004_625_1125 166
872 3300053134 Ga0500658_0013451 Ga0500658_0013451_665_1165 166
873 3300053139 Ga0500568_0000517 Ga0500568_0000517_18097_18597 166
874 3300053139 Ga0500568_0001042 Ga0500568_0001042_17228_17728 166
875 3300053139 Ga0500568_0051956 Ga0500568_0051956_1042_1545 166
876 3300053151 Ga0500604_0008630 Ga0500604_0008630_677_1177 166
877 3300053151 Ga0500604_0014673 Ga0500604_0014673_806_1306 166
878 3300053153 Ga0500616_0030590 Ga0500616_0030590_1556_2056 166
879 3300053155 Ga0500620_044088 Ga0500620_044088_336_836 166
880 3300053156 Ga0500622_0000064 Ga0500622_0000064_85285_85785 166
881 3300053158 Ga0500627_0162813 Ga0500627_0162813_201_701 166
882 3300053160 Ga0500633_0004763 Ga0500633_0004763_476_976 166
883 3300053160 Ga0500633_0010298 Ga0500633_0010298_1243_1743 166
884 3300059505 Ga0587083_0111149 Ga0587083_0111149_94_603 166
885 iso_pu_bacteria 2874123672 2874127239 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05974

DUF892

Domain of unknown function (DUF892)

35

191

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tmv-assembly1.cif.gz_B crystal structure of a putative structural protein from klebsiella pneumoniae 0.9608 3 154
4eru-assembly1.cif.gz_B crystal structure of putative cytoplasmic protein, ycif bacterial stress response protein from salmonella enterica 0.9607 3 157
2gyq-assembly1.cif.gz_B ycfi, a putative structural protein from rhodopseudomonas palustris. 0.9606 2 151
2gs4-assembly1.cif.gz_A the crystal structure of the e.coli stress protein ycif. 0.9536 4 159
1f4m-assembly2.cif.gz_D p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9449 103 151
ID Description Score Start End Superfamily
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9747 5 151 1.20.1260.10
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9606 2 151 1.20.1260.10
1f4mF00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9473 103 151 1.10.287.230
1f4mD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9449 103 151 1.10.287.230
1f4mA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9417 103 151 1.10.287.230
ID Description Score Start End GO Terms
AF-A0A1Q3W731-F1-model_v4 Uncharacterized protein 0.9968 19 155
AF-A0A090MKY1-F1-model_v4 Uncharacterized protein 0.9945 15 165
AF-A0A7W8Y6X7-F1-model_v4 deleted 0.9925 3 147
AF-A0A4Q3A2D6-F1-model_v4 Ferritin-like domain-containing protein 0.9902 7 159
AF-A0A7W1YVG0-F1-model_v4 Ferritin-like domain-containing protein 0.9882 7 152

Feature Viewer

pLDDT pTM Quality
94.5 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map