F484655
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 885 | 257 | 882 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_100456778|Ga0070674_1004567782 |
| Length | 243 |
| Sequence | LNFIPPFILKITRHEVNFICCRFNMHKLSTMAWKVDWPEAIKPLLKKYKNQQHPLEYKNIYQLLVMVVLSAQSTDHIVNLIAPKLFESFPDMQSLATATPETLFPLIGKVRNFANKANWIMDIARQIKSDKNIPLTHDELTKLKGIGTKSANVILREAGKPAEGVIVDLHVVRVAPRLGIATGSDPKKIEKQIMEKLPKKQWDAGMAMSFLGREICRPKPLCEECLMRKVCWYYNTVVVKTRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 3 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 4 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 170 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 176 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 191 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 194 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 195 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 196 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 197 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 198 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 203 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 232 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 252 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 253 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 254 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 255 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 256 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 257 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0.11 |
| Isolates | 0.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.02 |
| Nodule | 0 |
| Rhizoplane | 0.34 |
| Rhizosphere | 95.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10005606 | 3300002459 | Bacteria | 2557 |
| 2 | JGI25154J39366_1007391 | 3300002738 | Bacteria | 1509 |
| 3 | rootH1_10004660 | 3300003316 | Bacteria | 1491 |
| 4 | rootH1_10037794 | 3300003316 | Bacteria | 8062 |
| 5 | rootH2_10000086 | 3300003320 | Bacteria | 48758 |
| 6 | rootH2_10016021 | 3300003320 | Bacteria | 13246 |
| 7 | rootH2_10038964 | 3300003320 | Bacteria | 4239 |
| 8 | rootH2_10062516 | 3300003320 | Bacteria | 1535 |
| 9 | rootH2_10063811 | 3300003320 | Bacteria | 2502 |
| 10 | rootL2_10072197 | 3300003322 | Bacteria | 2731 |
| 11 | rootH1_10013386 | 3300003316 | Bacteria | 3606 |
| 12 | rootH1_10013386 | 3300003323 | Bacteria | 42758 |
| 13 | Ga0055531_10000118 | 3300003794 | Bacteria | 88104 |
| 14 | Ga0065704_10088208 | 3300005289 | Bacteria | 2958 |
| 15 | Ga0065704_10123486 | 3300005289 | Bacteria | 1733 |
| 16 | Ga0065712_10008616 | 3300005290 | Unclassified | 2528 |
| 17 | Ga0065715_10193573 | 3300005293 | Bacteria | 1401 |
| 18 | Ga0065707_10271268 | 3300005295 | Bacteria | 1071 |
| 19 | Ga0070658_10034177 | 3300005327 | Bacteria | 4091 |
| 20 | Ga0070658_10047119 | 3300005327 | Bacteria | 3488 |
| 21 | Ga0070658_10055349 | 3300005327 | Bacteria | 3223 |
| 22 | Ga0070658_10265083 | 3300005327 | Bacteria | 1460 |
| 23 | Ga0070658_10270126 | 3300005327 | Bacteria | 1446 |
| 24 | Ga0070676_10010291 | 3300005328 | Bacteria | 5072 |
| 25 | Ga0070676_10666931 | 3300005328 | Unclassified | 756 |
| 26 | Ga0070683_100004806 | 3300005329 | Bacteria | 11185 |
| 27 | Ga0070683_100005679 | 3300005329 | Bacteria | 10416 |
| 28 | Ga0070683_100034348 | 3300005329 | Bacteria | 4632 |
| 29 | Ga0070683_100051414 | 3300005329 | Bacteria | 3816 |
| 30 | Ga0070683_100216563 | 3300005329 | Bacteria | 1819 |
| 31 | Ga0070690_100055055 | 3300005330 | Bacteria | 2547 |
| 32 | Ga0070690_100146378 | 3300005330 | Bacteria | 1608 |
| 33 | Ga0070670_100007982 | 3300005331 | Bacteria | 9003 |
| 34 | Ga0070670_100478408 | 3300005331 | Bacteria | 1106 |
| 35 | Ga0070670_100541123 | 3300005331 | Bacteria | 1038 |
| 36 | Ga0070677_10037752 | 3300005333 | Bacteria | 1886 |
| 37 | Ga0068869_100050141 | 3300005334 | Bacteria | 3025 |
| 38 | Ga0068869_100089932 | 3300005334 | Bacteria | 2306 |
| 39 | Ga0068869_100113631 | 3300005334 | Unclassified | 2063 |
| 40 | Ga0068869_100264094 | 3300005334 | Unclassified | 1379 |
| 41 | Ga0068869_100274630 | 3300005334 | Bacteria | 1353 |
| 42 | Ga0068869_100294029 | 3300005334 | Bacteria | 1309 |
| 43 | Ga0070666_10069419 | 3300005335 | Bacteria | 2396 |
| 44 | Ga0070666_10084019 | 3300005335 | Bacteria | 2178 |
| 45 | Ga0070666_10296083 | 3300005335 | Unclassified | 1152 |
| 46 | Ga0070666_10298154 | 3300005335 | Unclassified | 1148 |
| 47 | Ga0070680_100028967 | 3300005336 | Bacteria | 4445 |
| 48 | Ga0070680_100035203 | 3300005336 | Bacteria | 4041 |
| 49 | Ga0070680_100040658 | 3300005336 | Bacteria | 3766 |
| 50 | Ga0070680_100043701 | 3300005336 | Bacteria | 3639 |
| 51 | Ga0070680_100773307 | 3300005336 | Bacteria | 827 |
| 52 | Ga0070682_100036250 | 3300005337 | Bacteria | 3014 |
| 53 | Ga0070682_100039572 | 3300005337 | Bacteria | 2897 |
| 54 | Ga0068868_100032721 | 3300005338 | Bacteria | 4002 |
| 55 | Ga0068868_100051954 | 3300005338 | Bacteria | 3226 |
| 56 | Ga0068868_100065301 | 3300005338 | Unclassified | 2891 |
| 57 | Ga0068868_100146541 | 3300005338 | Bacteria | 1942 |
| 58 | Ga0068868_100164877 | 3300005338 | Bacteria | 1832 |
| 59 | Ga0068868_100371666 | 3300005338 | Unclassified | 1228 |
| 60 | Ga0070660_100004792 | 3300005339 | Bacteria | 9356 |
| 61 | Ga0070660_100015326 | 3300005339 | Bacteria | 5532 |
| 62 | Ga0070660_100038196 | 3300005339 | Bacteria | 3643 |
| 63 | Ga0070660_100043178 | 3300005339 | Bacteria | 3444 |
| 64 | Ga0070660_100050004 | 3300005339 | Bacteria | 3216 |
| 65 | Ga0070660_100083988 | 3300005339 | Bacteria | 2503 |
| 66 | Ga0070660_100207768 | 3300005339 | Bacteria | 1589 |
| 67 | Ga0070689_100006521 | 3300005340 | Bacteria | 8092 |
| 68 | Ga0070689_100011512 | 3300005340 | Bacteria | 6341 |
| 69 | Ga0070689_100100417 | 3300005340 | Bacteria | 2289 |
| 70 | Ga0070689_100172551 | 3300005340 | Bacteria | 1753 |
| 71 | Ga0070689_100448344 | 3300005340 | Bacteria | 1098 |
| 72 | Ga0070691_10104069 | 3300005341 | Unclassified | 1413 |
| 73 | Ga0070687_100018462 | 3300005343 | Unclassified | 3228 |
| 74 | Ga0070661_100002893 | 3300005344 | Bacteria | 11820 |
| 75 | Ga0070661_100003239 | 3300005344 | Bacteria | 11222 |
| 76 | Ga0070661_100111538 | 3300005344 | Bacteria | 2043 |
| 77 | Ga0070661_100207403 | 3300005344 | Unclassified | 1499 |
| 78 | Ga0070668_100089942 | 3300005347 | Bacteria | 2418 |
| 79 | Ga0070668_100233614 | 3300005347 | Bacteria | 1521 |
| 80 | Ga0070668_100458289 | 3300005347 | Bacteria | 1097 |
| 81 | Ga0070669_100037456 | 3300005353 | Bacteria | 3518 |
| 82 | Ga0070669_100044130 | 3300005353 | Bacteria | 3248 |
| 83 | Ga0070669_100570032 | 3300005353 | Bacteria | 946 |
| 84 | Ga0070675_100087279 | 3300005354 | Bacteria | 2609 |
| 85 | Ga0070675_100212696 | 3300005354 | Bacteria | 1681 |
| 86 | Ga0070675_100462515 | 3300005354 | Unclassified | 1139 |
| 87 | Ga0070671_100169381 | 3300005355 | Bacteria | 1847 |
| 88 | Ga0070671_100720492 | 3300005355 | Bacteria | 866 |
| 89 | Ga0070671_101098322 | 3300005355 | Bacteria | 698 |
| 90 | Ga0070674_100171840 | 3300005356 | Bacteria | 1653 |
| 91 | Ga0070674_100456778 | 3300005356 | Unclassified | 1055 |
| 92 | Ga0070673_100026043 | 3300005364 | Bacteria | 4314 |
| 93 | Ga0070673_100064191 | 3300005364 | Unclassified | 2924 |
| 94 | Ga0070673_100137787 | 3300005364 | Bacteria | 2056 |
| 95 | Ga0070673_100179835 | 3300005364 | Unclassified | 1810 |
| 96 | Ga0070673_100195719 | 3300005364 | Bacteria | 1739 |
| 97 | Ga0070673_100197411 | 3300005364 | Bacteria | 1731 |
| 98 | Ga0070673_100464888 | 3300005364 | Bacteria | 1140 |
| 99 | Ga0070688_100008347 | 3300005365 | Bacteria | 5620 |
| 100 | Ga0070688_100032273 | 3300005365 | Unclassified | 3156 |
| 101 | Ga0070688_100035869 | 3300005365 | Bacteria | 3014 |
| 102 | Ga0070688_100236818 | 3300005365 | Unclassified | 1294 |
| 103 | Ga0070688_100514073 | 3300005365 | Unclassified | 905 |
| 104 | Ga0070659_100023009 | 3300005366 | Bacteria | 4764 |
| 105 | Ga0070659_100038444 | 3300005366 | Bacteria | 3732 |
| 106 | Ga0070659_100066213 | 3300005366 | Bacteria | 2862 |
| 107 | Ga0070667_100022878 | 3300005367 | Bacteria | 5183 |
| 108 | Ga0070667_100091095 | 3300005367 | Unclassified | 2621 |
| 109 | Ga0070667_100108720 | 3300005367 | Bacteria | 2403 |
| 110 | Ga0070667_100170843 | 3300005367 | Bacteria | 1919 |
| 111 | Ga0070667_100195377 | 3300005367 | Bacteria | 1793 |
| 112 | Ga0070667_100308367 | 3300005367 | Bacteria | 1426 |
| 113 | Ga0070713_100901584 | 3300005436 | Bacteria | 850 |
| 114 | Ga0070700_100448778 | 3300005441 | Bacteria | 981 |
| 115 | Ga0070694_100097513 | 3300005444 | Bacteria | 2074 |
| 116 | Ga0070663_100025763 | 3300005455 | Bacteria | 3974 |
| 117 | Ga0070663_100049825 | 3300005455 | Bacteria | 2976 |
| 118 | Ga0070663_100258429 | 3300005455 | Bacteria | 1381 |
| 119 | Ga0070678_100007828 | 3300005456 | Bacteria | 6358 |
| 120 | Ga0070678_100020940 | 3300005456 | Bacteria | 4300 |
| 121 | Ga0070678_100386384 | 3300005456 | Bacteria | 1212 |
| 122 | Ga0070662_100004115 | 3300005457 | Bacteria | 9143 |
| 123 | Ga0070662_100027222 | 3300005457 | Bacteria | 3966 |
| 124 | Ga0070662_100055639 | 3300005457 | Bacteria | 2871 |
| 125 | Ga0070662_100072148 | 3300005457 | Bacteria | 2548 |
| 126 | Ga0070662_100171982 | 3300005457 | Bacteria | 1702 |
| 127 | Ga0070662_100207523 | 3300005457 | Bacteria | 1557 |
| 128 | Ga0070681_10046721 | 3300005458 | Bacteria | 4327 |
| 129 | Ga0070681_10056362 | 3300005458 | Bacteria | 3911 |
| 130 | Ga0070681_10058585 | 3300005458 | Bacteria | 3831 |
| 131 | Ga0070681_10445960 | 3300005458 | Bacteria | 1206 |
| 132 | Ga0070681_10815032 | 3300005458 | Bacteria | 851 |
| 133 | Ga0070681_10915985 | 3300005458 | Bacteria | 795 |
| 134 | Ga0068867_100033261 | 3300005459 | Bacteria | 3732 |
| 135 | Ga0068867_100081735 | 3300005459 | Unclassified | 2436 |
| 136 | Ga0068867_100147186 | 3300005459 | Bacteria | 1847 |
| 137 | Ga0068867_100199806 | 3300005459 | Bacteria | 1600 |
| 138 | Ga0068867_100212274 | 3300005459 | Bacteria | 1555 |
| 139 | Ga0068867_100277877 | 3300005459 | Bacteria | 1372 |
| 140 | Ga0068867_100317236 | 3300005459 | Bacteria | 1290 |
| 141 | Ga0068867_100366159 | 3300005459 | Unclassified | 1207 |
| 142 | Ga0070685_10007265 | 3300005466 | Bacteria | 5664 |
| 143 | Ga0070685_10023071 | 3300005466 | Bacteria | 3403 |
| 144 | Ga0070685_10033897 | 3300005466 | Unclassified | 2872 |
| 145 | Ga0070685_10551638 | 3300005466 | Unclassified | 823 |
| 146 | Ga0070698_100001998 | 3300005471 | Bacteria | 22644 |
| 147 | Ga0070698_100122946 | 3300005471 | Bacteria | 2554 |
| 148 | Ga0070679_100000065 | 3300005530 | Bacteria | 78829 |
| 149 | Ga0070679_100002258 | 3300005530 | Bacteria | 17402 |
| 150 | Ga0070679_100026049 | 3300005530 | Bacteria | 5740 |
| 151 | Ga0070679_100051387 | 3300005530 | Bacteria | 4105 |
| 152 | Ga0070679_100057506 | 3300005530 | Bacteria | 3876 |
| 153 | Ga0070679_100080308 | 3300005530 | Unclassified | 3250 |
| 154 | Ga0070679_100212593 | 3300005530 | Bacteria | 1897 |
| 155 | Ga0070679_100621805 | 3300005530 | Bacteria | 1023 |
| 156 | Ga0070679_100624764 | 3300005530 | Bacteria | 1020 |
| 157 | Ga0070684_100003838 | 3300005535 | Bacteria | 11361 |
| 158 | Ga0070684_100004617 | 3300005535 | Bacteria | 10501 |
| 159 | Ga0070684_100015813 | 3300005535 | Bacteria | 6157 |
| 160 | Ga0070684_100056042 | 3300005535 | Bacteria | 3438 |
| 161 | Ga0070684_100081513 | 3300005535 | Bacteria | 2863 |
| 162 | Ga0070697_101156271 | 3300005536 | Bacteria | 689 |
| 163 | Ga0068853_100008100 | 3300005539 | Bacteria | 8434 |
| 164 | Ga0068853_100014757 | 3300005539 | Bacteria | 6411 |
| 165 | Ga0068853_100016341 | 3300005539 | Bacteria | 6106 |
| 166 | Ga0068853_100052216 | 3300005539 | Bacteria | 3521 |
| 167 | Ga0068853_100053788 | 3300005539 | Bacteria | 3468 |
| 168 | Ga0068853_100227573 | 3300005539 | Bacteria | 1705 |
| 169 | Ga0068853_100278507 | 3300005539 | Bacteria | 1542 |
| 170 | Ga0070672_100047244 | 3300005543 | Unclassified | 3339 |
| 171 | Ga0070672_100049253 | 3300005543 | Bacteria | 3277 |
| 172 | Ga0070672_100058136 | 3300005543 | Bacteria | 3038 |
| 173 | Ga0070672_100335697 | 3300005543 | Bacteria | 1286 |
| 174 | Ga0070672_100592888 | 3300005543 | Unclassified | 965 |
| 175 | Ga0070686_100190493 | 3300005544 | Bacteria | 1463 |
| 176 | Ga0070686_100407527 | 3300005544 | Bacteria | 1036 |
| 177 | Ga0070693_100172521 | 3300005547 | Bacteria | 1386 |
| 178 | Ga0070693_100337185 | 3300005547 | Bacteria | 1028 |
| 179 | Ga0070665_100038063 | 3300005548 | Bacteria | 4835 |
| 180 | Ga0070665_100128940 | 3300005548 | Bacteria | 2532 |
| 181 | Ga0068855_100003936 | 3300005563 | Bacteria | 18131 |
| 182 | Ga0068855_100017595 | 3300005563 | Bacteria | 8594 |
| 183 | Ga0068855_100040646 | 3300005563 | Bacteria | 5519 |
| 184 | Ga0068855_100058177 | 3300005563 | Bacteria | 4528 |
| 185 | Ga0068855_100059775 | 3300005563 | Bacteria | 4459 |
| 186 | Ga0068855_100071606 | 3300005563 | Bacteria | 4031 |
| 187 | Ga0068855_100102170 | 3300005563 | Bacteria | 3300 |
| 188 | Ga0068855_100129917 | 3300005563 | Bacteria | 2877 |
| 189 | Ga0068855_100207033 | 3300005563 | Bacteria | 2206 |
| 190 | Ga0068855_100318902 | 3300005563 | Bacteria | 1718 |
| 191 | Ga0068855_100662720 | 3300005563 | Bacteria | 1120 |
| 192 | Ga0068855_100702609 | 3300005563 | Bacteria | 1082 |
| 193 | Ga0070664_100008799 | 3300005564 | Bacteria | 8179 |
| 194 | Ga0070664_100049998 | 3300005564 | Bacteria | 3536 |
| 195 | Ga0070664_100065607 | 3300005564 | Bacteria | 3098 |
| 196 | Ga0070664_100310167 | 3300005564 | Bacteria | 1427 |
| 197 | Ga0070664_100333241 | 3300005564 | Unclassified | 1377 |
| 198 | Ga0070664_100383122 | 3300005564 | Bacteria | 1284 |
| 199 | Ga0068857_100007481 | 3300005577 | Bacteria | 9402 |
| 200 | Ga0068857_100035569 | 3300005577 | Bacteria | 4411 |
| 201 | Ga0068857_100045885 | 3300005577 | Bacteria | 3878 |
| 202 | Ga0068857_100140525 | 3300005577 | Bacteria | 2182 |
| 203 | Ga0068857_100170536 | 3300005577 | Unclassified | 1978 |
| 204 | Ga0068857_100176284 | 3300005577 | Bacteria | 1945 |
| 205 | Ga0068857_100452784 | 3300005577 | Bacteria | 1200 |
| 206 | Ga0068857_100492779 | 3300005577 | Bacteria | 1149 |
| 207 | Ga0068854_100056669 | 3300005578 | Unclassified | 2825 |
| 208 | Ga0068854_100057944 | 3300005578 | Bacteria | 2795 |
| 209 | Ga0068854_100201925 | 3300005578 | Unclassified | 1563 |
| 210 | Ga0068854_100356570 | 3300005578 | Bacteria | 1199 |
| 211 | Ga0068854_100525611 | 3300005578 | Bacteria | 1000 |
| 212 | Ga0068854_100816972 | 3300005578 | Bacteria | 814 |
| 213 | Ga0068856_100018504 | 3300005614 | Bacteria | 6752 |
| 214 | Ga0068856_100024901 | 3300005614 | Bacteria | 5830 |
| 215 | Ga0068856_100046172 | 3300005614 | Bacteria | 4290 |
| 216 | Ga0068856_100073456 | 3300005614 | Bacteria | 3386 |
| 217 | Ga0068856_100157846 | 3300005614 | Unclassified | 2278 |
| 218 | Ga0068856_100157993 | 3300005614 | Bacteria | 2277 |
| 219 | Ga0068856_100290051 | 3300005614 | Bacteria | 1653 |
| 220 | Ga0068852_100001067 | 3300005616 | Bacteria | 18102 |
| 221 | Ga0068852_100002354 | 3300005616 | Bacteria | 13017 |
| 222 | Ga0068852_100140582 | 3300005616 | Bacteria | 2234 |
| 223 | Ga0068852_100189766 | 3300005616 | Unclassified | 1938 |
| 224 | Ga0068852_100404200 | 3300005616 | Bacteria | 1344 |
| 225 | Ga0068852_100421151 | 3300005616 | Unclassified | 1317 |
| 226 | Ga0068852_100534485 | 3300005616 | Bacteria | 1171 |
| 227 | Ga0068852_100586261 | 3300005616 | Bacteria | 1118 |
| 228 | Ga0068852_100749958 | 3300005616 | Unclassified | 988 |
| 229 | Ga0068859_100025982 | 3300005617 | Bacteria | 5875 |
| 230 | Ga0068859_100035397 | 3300005617 | Bacteria | 5010 |
| 231 | Ga0068859_100045776 | 3300005617 | Bacteria | 4395 |
| 232 | Ga0068859_100048901 | 3300005617 | Bacteria | 4247 |
| 233 | Ga0068859_100297349 | 3300005617 | Unclassified | 1707 |
| 234 | Ga0068859_100494484 | 3300005617 | Bacteria | 1318 |
| 235 | Ga0068859_100501650 | 3300005617 | Bacteria | 1309 |
| 236 | Ga0068864_100077069 | 3300005618 | Bacteria | 2915 |
| 237 | Ga0068864_100114675 | 3300005618 | Bacteria | 2403 |
| 238 | Ga0068864_100412039 | 3300005618 | Bacteria | 1286 |
| 239 | Ga0068864_100672912 | 3300005618 | Unclassified | 1009 |
| 240 | Ga0068864_100809383 | 3300005618 | Bacteria | 921 |
| 241 | Ga0068864_100971819 | 3300005618 | Unclassified | 841 |
| 242 | Ga0068866_10205242 | 3300005718 | Bacteria | 1180 |
| 243 | Ga0068861_100028443 | 3300005719 | Unclassified | 4078 |
| 244 | Ga0068861_100253851 | 3300005719 | Bacteria | 1502 |
| 245 | Ga0068861_100276803 | 3300005719 | Unclassified | 1443 |
| 246 | Ga0068851_10093855 | 3300005834 | Bacteria | 1584 |
| 247 | Ga0068851_10215517 | 3300005834 | Unclassified | 1077 |
| 248 | Ga0068851_10443656 | 3300005834 | Bacteria | 770 |
| 249 | Ga0068870_10170179 | 3300005840 | Bacteria | 1299 |
| 250 | Ga0068870_10362444 | 3300005840 | Unclassified | 933 |
| 251 | Ga0068863_100126403 | 3300005841 | Bacteria | 2439 |
| 252 | Ga0068863_100328903 | 3300005841 | Unclassified | 1486 |
| 253 | Ga0068863_100495893 | 3300005841 | Unclassified | 1202 |
| 254 | Ga0068858_100581653 | 3300005842 | Bacteria | 1085 |
| 255 | Ga0068858_101157795 | 3300005842 | Unclassified | 760 |
| 256 | Ga0068860_100025430 | 3300005843 | Bacteria | 5712 |
| 257 | Ga0068860_100035807 | 3300005843 | Unclassified | 4759 |
| 258 | Ga0068860_100038858 | 3300005843 | Bacteria | 4553 |
| 259 | Ga0068860_100045962 | 3300005843 | Bacteria | 4164 |
| 260 | Ga0068860_100169026 | 3300005843 | Bacteria | 2111 |
| 261 | Ga0068860_100220869 | 3300005843 | Bacteria | 1840 |
| 262 | Ga0068860_101066605 | 3300005843 | Bacteria | 827 |
| 263 | Ga0068862_100012633 | 3300005844 | Bacteria | 6990 |
| 264 | Ga0068862_100295962 | 3300005844 | Bacteria | 1488 |
| 265 | Ga0081539_10000714 | 3300005985 | Bacteria | 66625 |
| 266 | Ga0097621_100021395 | 3300006237 | Bacteria | 5002 |
| 267 | Ga0097621_100030624 | 3300006237 | Bacteria | 4261 |
| 268 | Ga0097621_100304357 | 3300006237 | Bacteria | 1409 |
| 269 | Ga0097621_100363102 | 3300006237 | Bacteria | 1290 |
| 270 | Ga0097621_100636901 | 3300006237 | Bacteria | 977 |
| 271 | Ga0097621_100822652 | 3300006237 | Bacteria | 861 |
| 272 | Ga0068871_100120751 | 3300006358 | Bacteria | 2213 |
| 273 | Ga0068871_100381121 | 3300006358 | Bacteria | 1253 |
| 274 | Ga0068871_100493079 | 3300006358 | Bacteria | 1103 |
| 275 | Ga0075428_100064824 | 3300006844 | Unclassified | 4001 |
| 276 | Ga0075428_100151035 | 3300006844 | Unclassified | 2523 |
| 277 | Ga0075430_100007274 | 3300006846 | Bacteria | 9345 |
| 278 | Ga0075433_10578825 | 3300006852 | Bacteria | 986 |
| 279 | Ga0075429_100091904 | 3300006880 | Bacteria | 2647 |
| 280 | Ga0068865_100028534 | 3300006881 | Unclassified | 3696 |
| 281 | Ga0068865_100058612 | 3300006881 | Bacteria | 2690 |
| 282 | Ga0068865_100135681 | 3300006881 | Bacteria | 1849 |
| 283 | Ga0097620_100025982 | 3300006931 | Bacteria | 5875 |
| 284 | Ga0097620_100035399 | 3300006931 | Bacteria | 5010 |
| 285 | Ga0097620_100045776 | 3300006931 | Bacteria | 4395 |
| 286 | Ga0097620_100048900 | 3300006931 | Bacteria | 4247 |
| 287 | Ga0097620_100297359 | 3300006931 | Unclassified | 1707 |
| 288 | Ga0097620_100494477 | 3300006931 | Bacteria | 1318 |
| 289 | Ga0097620_100501616 | 3300006931 | Bacteria | 1309 |
| 290 | Ga0097620_100896913 | 3300006931 | Bacteria | 971 |
| 291 | Ga0105240_10000383 | 3300009093 | Bacteria | 83057 |
| 292 | Ga0105240_10000905 | 3300009093 | Bacteria | 52980 |
| 293 | Ga0105240_10001825 | 3300009093 | Bacteria | 35720 |
| 294 | Ga0105240_10001869 | 3300009093 | Bacteria | 35028 |
| 295 | Ga0105240_10011676 | 3300009093 | Bacteria | 12208 |
| 296 | Ga0105240_10014537 | 3300009093 | Bacteria | 10745 |
| 297 | Ga0105240_10115290 | 3300009093 | Unclassified | 3244 |
| 298 | Ga0105240_10182366 | 3300009093 | Bacteria | 2476 |
| 299 | Ga0111539_10024746 | 3300009094 | Bacteria | 7363 |
| 300 | Ga0111539_10142694 | 3300009094 | Bacteria | 2803 |
| 301 | Ga0114129_10032540 | 3300009147 | Bacteria | 7370 |
| 302 | Ga0114129_10194413 | 3300009147 | Unclassified | 2752 |
| 303 | Ga0105243_10098133 | 3300009148 | Bacteria | 2426 |
| 304 | Ga0105241_10010223 | 3300009174 | Bacteria | 6893 |
| 305 | Ga0105241_10032233 | 3300009174 | Bacteria | 3928 |
| 306 | Ga0105241_10220114 | 3300009174 | Bacteria | 1595 |
| 307 | Ga0105242_10003021 | 3300009176 | Bacteria | 13152 |
| 308 | Ga0105242_10034122 | 3300009176 | Bacteria | 4079 |
| 309 | Ga0105242_10300452 | 3300009176 | Bacteria | 1465 |
| 310 | Ga0105242_10410330 | 3300009176 | Bacteria | 1266 |
| 311 | Ga0105242_10697448 | 3300009176 | Unclassified | 993 |
| 312 | Ga0105242_10777737 | 3300009176 | Bacteria | 945 |
| 313 | Ga0105248_10221882 | 3300009177 | Bacteria | 2128 |
| 314 | Ga0105237_10000305 | 3300009545 | Bacteria | 68102 |
| 315 | Ga0105237_10001224 | 3300009545 | Bacteria | 34200 |
| 316 | Ga0105237_10003156 | 3300009545 | Bacteria | 19825 |
| 317 | Ga0105237_10003946 | 3300009545 | Bacteria | 17369 |
| 318 | Ga0105237_10006238 | 3300009545 | Bacteria | 13276 |
| 319 | Ga0105237_10020409 | 3300009545 | Bacteria | 6831 |
| 320 | Ga0105237_10021612 | 3300009545 | Bacteria | 6615 |
| 321 | Ga0105237_10035034 | 3300009545 | Bacteria | 5080 |
| 322 | Ga0105237_10046496 | 3300009545 | Bacteria | 4365 |
| 323 | Ga0105238_10002413 | 3300009551 | Bacteria | 18744 |
| 324 | Ga0105238_10058560 | 3300009551 | Bacteria | 3860 |
| 325 | Ga0105238_10118144 | 3300009551 | Bacteria | 2632 |
| 326 | Ga0105249_10013169 | 3300009553 | Bacteria | 7297 |
| 327 | Ga0105249_10017757 | 3300009553 | Bacteria | 6319 |
| 328 | Ga0105249_10047364 | 3300009553 | Unclassified | 3917 |
| 329 | Ga0105249_10058553 | 3300009553 | Bacteria | 3531 |
| 330 | Ga0105249_10237511 | 3300009553 | Bacteria | 1800 |
| 331 | Ga0105249_10370143 | 3300009553 | Bacteria | 1456 |
| 332 | Ga0105249_10697993 | 3300009553 | Unclassified | 1075 |
| 333 | Ga0105249_10789389 | 3300009553 | Bacteria | 1013 |
| 334 | Ga0105249_11401850 | 3300009553 | Bacteria | 771 |
| 335 | Ga0105239_10000099 | 3300010375 | Bacteria | 120205 |
| 336 | Ga0105239_10000970 | 3300010375 | Bacteria | 40255 |
| 337 | Ga0105239_10003044 | 3300010375 | Bacteria | 20839 |
| 338 | Ga0105239_10009415 | 3300010375 | Bacteria | 11012 |
| 339 | Ga0105239_10070884 | 3300010375 | Bacteria | 3829 |
| 340 | Ga0105239_10119128 | 3300010375 | Bacteria | 2930 |
| 341 | Ga0105246_10227206 | 3300011119 | Bacteria | 1467 |
| 342 | Ga0105246_10464434 | 3300011119 | Bacteria | 1067 |
| 343 | Ga0157373_10003026 | 3300013100 | Bacteria | 12683 |
| 344 | Ga0157373_10016192 | 3300013100 | Bacteria | 5441 |
| 345 | Ga0157373_10032989 | 3300013100 | Bacteria | 3727 |
| 346 | Ga0157373_10047207 | 3300013100 | Unclassified | 3072 |
| 347 | Ga0157373_10059535 | 3300013100 | Bacteria | 2706 |
| 348 | Ga0157373_10063514 | 3300013100 | Bacteria | 2614 |
| 349 | Ga0157373_10089149 | 3300013100 | Bacteria | 2173 |
| 350 | Ga0157373_10106400 | 3300013100 | Bacteria | 1972 |
| 351 | Ga0157373_10111972 | 3300013100 | Bacteria | 1919 |
| 352 | Ga0157373_10126561 | 3300013100 | Bacteria | 1797 |
| 353 | Ga0157373_10487325 | 3300013100 | Bacteria | 890 |
| 354 | Ga0157371_10000322 | 3300013102 | Bacteria | 62104 |
| 355 | Ga0157371_10002933 | 3300013102 | Bacteria | 15909 |
| 356 | Ga0157371_10005313 | 3300013102 | Bacteria | 10902 |
| 357 | Ga0157371_10005951 | 3300013102 | Bacteria | 10181 |
| 358 | Ga0157371_10022566 | 3300013102 | Bacteria | 4608 |
| 359 | Ga0157371_10046908 | 3300013102 | Bacteria | 3071 |
| 360 | Ga0157371_10052508 | 3300013102 | Bacteria | 2895 |
| 361 | Ga0157371_10073653 | 3300013102 | Bacteria | 2419 |
| 362 | Ga0157371_10085960 | 3300013102 | Bacteria | 2228 |
| 363 | Ga0157371_10095147 | 3300013102 | Bacteria | 2111 |
| 364 | Ga0157371_10126011 | 3300013102 | Unclassified | 1821 |
| 365 | Ga0157371_10194410 | 3300013102 | Bacteria | 1453 |
| 366 | Ga0157371_10268800 | 3300013102 | Bacteria | 1230 |
| 367 | Ga0157371_10274289 | 3300013102 | Unclassified | 1217 |
| 368 | Ga0157371_10301071 | 3300013102 | Bacteria | 1161 |
| 369 | Ga0157370_10000651 | 3300013104 | Bacteria | 43302 |
| 370 | Ga0157370_10008098 | 3300013104 | Bacteria | 11377 |
| 371 | Ga0157370_10016368 | 3300013104 | Bacteria | 7507 |
| 372 | Ga0157370_10042948 | 3300013104 | Bacteria | 4353 |
| 373 | Ga0157370_10071434 | 3300013104 | Bacteria | 3274 |
| 374 | Ga0157370_10162581 | 3300013104 | Bacteria | 2077 |
| 375 | Ga0157370_10191287 | 3300013104 | Bacteria | 1899 |
| 376 | Ga0157370_10376078 | 3300013104 | Bacteria | 1309 |
| 377 | Ga0157370_10434293 | 3300013104 | Bacteria | 1207 |
| 378 | Ga0157370_10636622 | 3300013104 | Bacteria | 975 |
| 379 | Ga0157369_10014417 | 3300013105 | Bacteria | 8924 |
| 380 | Ga0157369_10015570 | 3300013105 | Bacteria | 8570 |
| 381 | Ga0157369_10030664 | 3300013105 | Bacteria | 5929 |
| 382 | Ga0157369_10035829 | 3300013105 | Bacteria | 5440 |
| 383 | Ga0157369_10042173 | 3300013105 | Bacteria | 4978 |
| 384 | Ga0157369_10100069 | 3300013105 | Bacteria | 3090 |
| 385 | Ga0157369_10157274 | 3300013105 | Bacteria | 2400 |
| 386 | Ga0157369_10183254 | 3300013105 | Bacteria | 2202 |
| 387 | Ga0157369_10297523 | 3300013105 | Bacteria | 1679 |
| 388 | Ga0157369_10372791 | 3300013105 | Bacteria | 1482 |
| 389 | Ga0157369_10392266 | 3300013105 | Unclassified | 1440 |
| 390 | Ga0157374_10000027 | 3300013296 | Bacteria | 233444 |
| 391 | Ga0157374_10003778 | 3300013296 | Bacteria | 12738 |
| 392 | Ga0157374_10021940 | 3300013296 | Bacteria | 5689 |
| 393 | Ga0157374_10092412 | 3300013296 | Bacteria | 2887 |
| 394 | Ga0157374_10108533 | 3300013296 | Bacteria | 2668 |
| 395 | Ga0157374_10192637 | 3300013296 | Bacteria | 1994 |
| 396 | Ga0157374_10213399 | 3300013296 | Bacteria | 1893 |
| 397 | Ga0157374_10299997 | 3300013296 | Bacteria | 1589 |
| 398 | Ga0157374_10301550 | 3300013296 | Unclassified | 1585 |
| 399 | Ga0157374_10401219 | 3300013296 | Bacteria | 1368 |
| 400 | Ga0157374_10860394 | 3300013296 | Bacteria | 924 |
| 401 | Ga0157374_10946476 | 3300013296 | Bacteria | 880 |
| 402 | Ga0157374_10974599 | 3300013296 | Bacteria | 867 |
| 403 | Ga0157374_11150853 | 3300013296 | Bacteria | 797 |
| 404 | Ga0157378_10048964 | 3300013297 | Bacteria | 3759 |
| 405 | Ga0157378_10049021 | 3300013297 | Bacteria | 3757 |
| 406 | Ga0157378_10095326 | 3300013297 | Unclassified | 2710 |
| 407 | Ga0157378_10351313 | 3300013297 | Bacteria | 1440 |
| 408 | Ga0157378_10355512 | 3300013297 | Bacteria | 1432 |
| 409 | Ga0157378_10546246 | 3300013297 | Unclassified | 1163 |
| 410 | Ga0157378_10679266 | 3300013297 | Bacteria | 1048 |
| 411 | Ga0157378_10854318 | 3300013297 | Bacteria | 939 |
| 412 | Ga0157378_11265446 | 3300013297 | Unclassified | 778 |
| 413 | Ga0163162_10011701 | 3300013306 | Bacteria | 8557 |
| 414 | Ga0163162_10056799 | 3300013306 | Bacteria | 3942 |
| 415 | Ga0163162_10060685 | 3300013306 | Bacteria | 3818 |
| 416 | Ga0163162_10063130 | 3300013306 | Bacteria | 3745 |
| 417 | Ga0163162_10089388 | 3300013306 | Bacteria | 3161 |
| 418 | Ga0163162_10093714 | 3300013306 | Bacteria | 3088 |
| 419 | Ga0163162_10124903 | 3300013306 | Unclassified | 2679 |
| 420 | Ga0163162_10147746 | 3300013306 | Unclassified | 2467 |
| 421 | Ga0163162_10286741 | 3300013306 | Bacteria | 1778 |
| 422 | Ga0163162_10338635 | 3300013306 | Bacteria | 1637 |
| 423 | Ga0163162_10408678 | 3300013306 | Bacteria | 1490 |
| 424 | Ga0163162_10442966 | 3300013306 | Bacteria | 1431 |
| 425 | Ga0163162_10498475 | 3300013306 | Bacteria | 1348 |
| 426 | Ga0163162_10543549 | 3300013306 | Unclassified | 1290 |
| 427 | Ga0163162_11009847 | 3300013306 | Bacteria | 941 |
| 428 | Ga0163162_11368167 | 3300013306 | Bacteria | 805 |
| 429 | Ga0157372_10001117 | 3300013307 | Bacteria | 29145 |
| 430 | Ga0157372_10005797 | 3300013307 | Bacteria | 13153 |
| 431 | Ga0157372_10018334 | 3300013307 | Bacteria | 7523 |
| 432 | Ga0157372_10026752 | 3300013307 | Bacteria | 6279 |
| 433 | Ga0157372_10123156 | 3300013307 | Bacteria | 2980 |
| 434 | Ga0157372_10151232 | 3300013307 | Bacteria | 2679 |
| 435 | Ga0157372_10193760 | 3300013307 | Unclassified | 2354 |
| 436 | Ga0157372_10226138 | 3300013307 | Unclassified | 2169 |
| 437 | Ga0157372_10230504 | 3300013307 | Bacteria | 2147 |
| 438 | Ga0157372_10310941 | 3300013307 | Bacteria | 1834 |
| 439 | Ga0157372_10452285 | 3300013307 | Bacteria | 1497 |
| 440 | Ga0157372_10653420 | 3300013307 | Bacteria | 1224 |
| 441 | Ga0157372_10696703 | 3300013307 | Bacteria | 1182 |
| 442 | Ga0157372_10782216 | 3300013307 | Bacteria | 1109 |
| 443 | Ga0157375_10013929 | 3300013308 | Bacteria | 7170 |
| 444 | Ga0157375_10036544 | 3300013308 | Bacteria | 4700 |
| 445 | Ga0157375_10067374 | 3300013308 | Bacteria | 3577 |
| 446 | Ga0157375_10187203 | 3300013308 | Bacteria | 2224 |
| 447 | Ga0157375_10194285 | 3300013308 | Bacteria | 2184 |
| 448 | Ga0157375_10294269 | 3300013308 | Unclassified | 1787 |
| 449 | Ga0157375_10477369 | 3300013308 | Bacteria | 1412 |
| 450 | Ga0157375_10546869 | 3300013308 | Bacteria | 1320 |
| 451 | Ga0157375_10563568 | 3300013308 | Bacteria | 1300 |
| 452 | Ga0157375_10733864 | 3300013308 | Bacteria | 1140 |
| 453 | Ga0163163_10000781 | 3300014325 | Bacteria | 26993 |
| 454 | Ga0163163_10064762 | 3300014325 | Bacteria | 3627 |
| 455 | Ga0163163_10597338 | 3300014325 | Bacteria | 1167 |
| 456 | Ga0163163_10669931 | 3300014325 | Bacteria | 1101 |
| 457 | Ga0157380_10050034 | 3300014326 | Unclassified | 3299 |
| 458 | Ga0157380_10095165 | 3300014326 | Unclassified | 2467 |
| 459 | Ga0157380_10320471 | 3300014326 | Bacteria | 1437 |
| 460 | Ga0157380_10386905 | 3300014326 | Unclassified | 1322 |
| 461 | Ga0157377_10004114 | 3300014745 | Bacteria | 6646 |
| 462 | Ga0157377_10016681 | 3300014745 | Unclassified | 3782 |
| 463 | Ga0157377_10018364 | 3300014745 | Bacteria | 3633 |
| 464 | Ga0157377_10031949 | 3300014745 | Bacteria | 2864 |
| 465 | Ga0157377_10036746 | 3300014745 | Bacteria | 2696 |
| 466 | Ga0157377_10207953 | 3300014745 | Unclassified | 1246 |
| 467 | Ga0157377_10593357 | 3300014745 | Bacteria | 789 |
| 468 | Ga0157379_10054403 | 3300014968 | Bacteria | 3576 |
| 469 | Ga0157379_10151053 | 3300014968 | Unclassified | 2095 |
| 470 | Ga0157379_10450116 | 3300014968 | Bacteria | 1189 |
| 471 | Ga0157379_10556274 | 3300014968 | Bacteria | 1068 |
| 472 | Ga0157376_10000368 | 3300014969 | Bacteria | 29611 |
| 473 | Ga0157376_10070002 | 3300014969 | Bacteria | 2976 |
| 474 | Ga0157376_10111589 | 3300014969 | Bacteria | 2408 |
| 475 | Ga0157376_10197524 | 3300014969 | Bacteria | 1849 |
| 476 | Ga0157376_10207254 | 3300014969 | Bacteria | 1808 |
| 477 | Ga0157376_10450134 | 3300014969 | Bacteria | 1256 |
| 478 | Ga0157376_10779739 | 3300014969 | Bacteria | 967 |
| 479 | Ga0157376_10902375 | 3300014969 | Bacteria | 902 |
| 480 | Ga0157376_11079453 | 3300014969 | Bacteria | 828 |
| 481 | Ga0163161_10030948 | 3300017792 | Bacteria | 3810 |
| 482 | Ga0163161_10364283 | 3300017792 | Bacteria | 1152 |
| 483 | Ga0163161_10395678 | 3300017792 | Bacteria | 1107 |
| 484 | Ga0163161_10647683 | 3300017792 | Unclassified | 875 |
| 485 | Ga0213876_10058848 | 3300021384 | Bacteria | 2028 |
| 486 | Ga0209646_1001061 | 3300025246 | Bacteria | 8248 |
| 487 | Ga0207426_1000189 | 3300025302 | Bacteria | 153457 |
| 488 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 489 | Ga0207697_10021308 | 3300025315 | Bacteria | 2653 |
| 490 | Ga0207697_10086287 | 3300025315 | Unclassified | 1327 |
| 491 | Ga0207697_10113767 | 3300025315 | Bacteria | 1160 |
| 492 | Ga0207642_10039985 | 3300025899 | Unclassified | 2043 |
| 493 | Ga0207688_10006914 | 3300025901 | Bacteria | 6176 |
| 494 | Ga0207688_10380827 | 3300025901 | Unclassified | 873 |
| 495 | Ga0207680_10014089 | 3300025903 | Bacteria | 4125 |
| 496 | Ga0207680_10043792 | 3300025903 | Bacteria | 2628 |
| 497 | Ga0207647_10004913 | 3300025904 | Bacteria | 9865 |
| 498 | Ga0207647_10069595 | 3300025904 | Bacteria | 2127 |
| 499 | Ga0207647_10188660 | 3300025904 | Bacteria | 1195 |
| 500 | Ga0207647_10261247 | 3300025904 | Bacteria | 991 |
| 501 | Ga0207645_10000307 | 3300025907 | Bacteria | 41105 |
| 502 | Ga0207645_10012698 | 3300025907 | Bacteria | 5711 |
| 503 | Ga0207645_10112800 | 3300025907 | Bacteria | 1761 |
| 504 | Ga0207643_10017411 | 3300025908 | Bacteria | 3929 |
| 505 | Ga0207705_10011305 | 3300025909 | Bacteria | 6467 |
| 506 | Ga0207705_10025055 | 3300025909 | Bacteria | 4259 |
| 507 | Ga0207705_10033049 | 3300025909 | Bacteria | 3697 |
| 508 | Ga0207705_10056453 | 3300025909 | Bacteria | 2831 |
| 509 | Ga0207705_10214283 | 3300025909 | Bacteria | 1461 |
| 510 | Ga0207654_10005944 | 3300025911 | Bacteria | 6143 |
| 511 | Ga0207707_10009918 | 3300025912 | Bacteria | 8258 |
| 512 | Ga0207707_10153898 | 3300025912 | Bacteria | 2010 |
| 513 | Ga0207707_10275044 | 3300025912 | Bacteria | 1459 |
| 514 | Ga0207695_10000209 | 3300025913 | Bacteria | 157802 |
| 515 | Ga0207695_10000300 | 3300025913 | Bacteria | 122104 |
| 516 | Ga0207695_10000483 | 3300025913 | Bacteria | 85395 |
| 517 | Ga0207695_10005507 | 3300025913 | Bacteria | 16761 |
| 518 | Ga0207695_10007075 | 3300025913 | Bacteria | 14381 |
| 519 | Ga0207695_10018867 | 3300025913 | Bacteria | 7959 |
| 520 | Ga0207695_10184568 | 3300025913 | Bacteria | 2005 |
| 521 | Ga0207695_10348617 | 3300025913 | Unclassified | 1368 |
| 522 | Ga0207671_10002537 | 3300025914 | Bacteria | 19435 |
| 523 | Ga0207671_10011167 | 3300025914 | Bacteria | 7334 |
| 524 | Ga0207671_10012297 | 3300025914 | Bacteria | 6891 |
| 525 | Ga0207671_10068447 | 3300025914 | Unclassified | 2645 |
| 526 | Ga0207671_10179893 | 3300025914 | Bacteria | 1645 |
| 527 | Ga0207660_10028421 | 3300025917 | Bacteria | 3825 |
| 528 | Ga0207660_10043520 | 3300025917 | Bacteria | 3156 |
| 529 | Ga0207660_10103074 | 3300025917 | Bacteria | 2134 |
| 530 | Ga0207660_10112411 | 3300025917 | Bacteria | 2051 |
| 531 | Ga0207660_10145831 | 3300025917 | Bacteria | 1814 |
| 532 | Ga0207660_10245987 | 3300025917 | Bacteria | 1410 |
| 533 | Ga0207662_10045192 | 3300025918 | Plasmid | 2603 |
| 534 | Ga0207657_10004767 | 3300025919 | Bacteria | 14306 |
| 535 | Ga0207657_10006381 | 3300025919 | Bacteria | 12245 |
| 536 | Ga0207657_10032094 | 3300025919 | Bacteria | 4749 |
| 537 | Ga0207657_10033705 | 3300025919 | Bacteria | 4614 |
| 538 | Ga0207657_10034417 | 3300025919 | Bacteria | 4556 |
| 539 | Ga0207657_10054131 | 3300025919 | Bacteria | 3472 |
| 540 | Ga0207657_10077336 | 3300025919 | Bacteria | 2805 |
| 541 | Ga0207657_10127034 | 3300025919 | Unclassified | 2093 |
| 542 | Ga0207657_10250495 | 3300025919 | Unclassified | 1412 |
| 543 | Ga0207649_10003179 | 3300025920 | Bacteria | 9005 |
| 544 | Ga0207649_10009537 | 3300025920 | Bacteria | 5314 |
| 545 | Ga0207649_10078523 | 3300025920 | Bacteria | 2130 |
| 546 | Ga0207649_10736484 | 3300025920 | Bacteria | 766 |
| 547 | Ga0207652_10000013 | 3300025921 | Bacteria | 222247 |
| 548 | Ga0207652_10000055 | 3300025921 | Bacteria | 115420 |
| 549 | Ga0207652_10000327 | 3300025921 | Bacteria | 49170 |
| 550 | Ga0207652_10005333 | 3300025921 | Bacteria | 10424 |
| 551 | Ga0207652_10049054 | 3300025921 | Bacteria | 3612 |
| 552 | Ga0207652_10056510 | 3300025921 | Unclassified | 3378 |
| 553 | Ga0207652_10096447 | 3300025921 | Bacteria | 2605 |
| 554 | Ga0207652_10096776 | 3300025921 | Bacteria | 2601 |
| 555 | Ga0207652_10289767 | 3300025921 | Bacteria | 1477 |
| 556 | Ga0207652_10449164 | 3300025921 | Bacteria | 1162 |
| 557 | Ga0207652_10484192 | 3300025921 | Unclassified | 1114 |
| 558 | Ga0207681_10028570 | 3300025923 | Bacteria | 3613 |
| 559 | Ga0207681_10100784 | 3300025923 | Bacteria | 2082 |
| 560 | Ga0207681_10754485 | 3300025923 | Unclassified | 811 |
| 561 | Ga0207681_10948709 | 3300025923 | Unclassified | 721 |
| 562 | Ga0207694_10236795 | 3300025924 | Bacteria | 1491 |
| 563 | Ga0207694_10411104 | 3300025924 | Bacteria | 1126 |
| 564 | Ga0207650_10053528 | 3300025925 | Bacteria | 2992 |
| 565 | Ga0207650_10338292 | 3300025925 | Unclassified | 1236 |
| 566 | Ga0207659_10047282 | 3300025926 | Bacteria | 3043 |
| 567 | Ga0207659_10082309 | 3300025926 | Bacteria | 2383 |
| 568 | Ga0207659_10087184 | 3300025926 | Bacteria | 2323 |
| 569 | Ga0207659_10238393 | 3300025926 | Bacteria | 1470 |
| 570 | Ga0207659_10370692 | 3300025926 | Bacteria | 1192 |
| 571 | Ga0207659_10449192 | 3300025926 | Bacteria | 1085 |
| 572 | Ga0207659_10520986 | 3300025926 | Bacteria | 1008 |
| 573 | Ga0207644_10089622 | 3300025931 | Bacteria | 2290 |
| 574 | Ga0207644_10161227 | 3300025931 | Bacteria | 1743 |
| 575 | Ga0207690_10058402 | 3300025932 | Bacteria | 2609 |
| 576 | Ga0207690_10087131 | 3300025932 | Unclassified | 2196 |
| 577 | Ga0207690_10100285 | 3300025932 | Bacteria | 2066 |
| 578 | Ga0207706_10026330 | 3300025933 | Bacteria | 5206 |
| 579 | Ga0207706_10036390 | 3300025933 | Bacteria | 4372 |
| 580 | Ga0207706_10105265 | 3300025933 | Bacteria | 2482 |
| 581 | Ga0207706_10286075 | 3300025933 | Unclassified | 1437 |
| 582 | Ga0207706_10309322 | 3300025933 | Bacteria | 1376 |
| 583 | Ga0207686_10000884 | 3300025934 | Bacteria | 18109 |
| 584 | Ga0207686_10056406 | 3300025934 | Bacteria | 2469 |
| 585 | Ga0207686_10112072 | 3300025934 | Bacteria | 1842 |
| 586 | Ga0207686_10255834 | 3300025934 | Bacteria | 1282 |
| 587 | Ga0207670_10026860 | 3300025936 | Bacteria | 3634 |
| 588 | Ga0207670_10029226 | 3300025936 | Bacteria | 3509 |
| 589 | Ga0207670_10060545 | 3300025936 | Bacteria | 2580 |
| 590 | Ga0207670_10105561 | 3300025936 | Unclassified | 2019 |
| 591 | Ga0207670_10260006 | 3300025936 | Bacteria | 1345 |
| 592 | Ga0207669_10067489 | 3300025937 | Bacteria | 2229 |
| 593 | Ga0207704_10027351 | 3300025938 | Unclassified | 3145 |
| 594 | Ga0207704_10111592 | 3300025938 | Bacteria | 1850 |
| 595 | Ga0207704_10139308 | 3300025938 | Bacteria | 1694 |
| 596 | Ga0207704_10586710 | 3300025938 | Bacteria | 910 |
| 597 | Ga0207691_10005556 | 3300025940 | Bacteria | 12180 |
| 598 | Ga0207691_10012090 | 3300025940 | Bacteria | 8278 |
| 599 | Ga0207691_10019398 | 3300025940 | Bacteria | 6435 |
| 600 | Ga0207691_10019465 | 3300025940 | Bacteria | 6422 |
| 601 | Ga0207691_10399476 | 3300025940 | Bacteria | 1172 |
| 602 | Ga0207691_10782327 | 3300025940 | Bacteria | 802 |
| 603 | Ga0207689_10001757 | 3300025942 | Bacteria | 20439 |
| 604 | Ga0207689_10010694 | 3300025942 | Bacteria | 7894 |
| 605 | Ga0207689_10035195 | 3300025942 | Bacteria | 4160 |
| 606 | Ga0207689_10036311 | 3300025942 | Bacteria | 4092 |
| 607 | Ga0207689_10069897 | 3300025942 | Bacteria | 2885 |
| 608 | Ga0207689_10075838 | 3300025942 | Unclassified | 2764 |
| 609 | Ga0207689_10146892 | 3300025942 | Bacteria | 1943 |
| 610 | Ga0207689_10184929 | 3300025942 | Unclassified | 1719 |
| 611 | Ga0207689_10286108 | 3300025942 | Bacteria | 1365 |
| 612 | Ga0207661_10002725 | 3300025944 | Bacteria | 12163 |
| 613 | Ga0207661_10095918 | 3300025944 | Bacteria | 2481 |
| 614 | Ga0207679_10000611 | 3300025945 | Bacteria | 23793 |
| 615 | Ga0207679_10076548 | 3300025945 | Bacteria | 2543 |
| 616 | Ga0207679_10281138 | 3300025945 | Bacteria | 1427 |
| 617 | Ga0207679_10772856 | 3300025945 | Bacteria | 875 |
| 618 | Ga0207667_10002405 | 3300025949 | Bacteria | 23429 |
| 619 | Ga0207667_10003410 | 3300025949 | Bacteria | 19621 |
| 620 | Ga0207667_10010537 | 3300025949 | Bacteria | 10800 |
| 621 | Ga0207667_10076885 | 3300025949 | Bacteria | 3463 |
| 622 | Ga0207667_10084648 | 3300025949 | Bacteria | 3283 |
| 623 | Ga0207667_10109234 | 3300025949 | Bacteria | 2852 |
| 624 | Ga0207667_10137089 | 3300025949 | Bacteria | 2520 |
| 625 | Ga0207667_10202598 | 3300025949 | Bacteria | 2035 |
| 626 | Ga0207667_10225049 | 3300025949 | Bacteria | 1922 |
| 627 | Ga0207667_10298385 | 3300025949 | Bacteria | 1646 |
| 628 | Ga0207667_10378758 | 3300025949 | Unclassified | 1442 |
| 629 | Ga0207667_10484811 | 3300025949 | Bacteria | 1255 |
| 630 | Ga0207667_10818356 | 3300025949 | Bacteria | 927 |
| 631 | Ga0207651_10040387 | 3300025960 | Bacteria | 3086 |
| 632 | Ga0207651_10061582 | 3300025960 | Bacteria | 2611 |
| 633 | Ga0207651_10100504 | 3300025960 | Bacteria | 2144 |
| 634 | Ga0207651_10128569 | 3300025960 | Bacteria | 1935 |
| 635 | Ga0207651_10333897 | 3300025960 | Unclassified | 1271 |
| 636 | Ga0207651_10640476 | 3300025960 | Unclassified | 932 |
| 637 | Ga0207712_10002170 | 3300025961 | Bacteria | 12828 |
| 638 | Ga0207712_10003149 | 3300025961 | Bacteria | 10523 |
| 639 | Ga0207712_10038438 | 3300025961 | Bacteria | 3273 |
| 640 | Ga0207712_10057941 | 3300025961 | Bacteria | 2735 |
| 641 | Ga0207712_10068500 | 3300025961 | Bacteria | 2543 |
| 642 | Ga0207668_10064508 | 3300025972 | Bacteria | 2589 |
| 643 | Ga0207668_10531062 | 3300025972 | Bacteria | 1016 |
| 644 | Ga0207668_10812858 | 3300025972 | Bacteria | 828 |
| 645 | Ga0207640_10056728 | 3300025981 | Unclassified | 2573 |
| 646 | Ga0207640_10070650 | 3300025981 | Bacteria | 2349 |
| 647 | Ga0207640_10143843 | 3300025981 | Bacteria | 1742 |
| 648 | Ga0207640_10159744 | 3300025981 | Unclassified | 1666 |
| 649 | Ga0207640_10207810 | 3300025981 | Unclassified | 1489 |
| 650 | Ga0207640_10508330 | 3300025981 | Bacteria | 1005 |
| 651 | Ga0207640_10652598 | 3300025981 | Bacteria | 897 |
| 652 | Ga0207640_10699250 | 3300025981 | Bacteria | 869 |
| 653 | Ga0207658_10235320 | 3300025986 | Bacteria | 1548 |
| 654 | Ga0207658_10278294 | 3300025986 | Bacteria | 1433 |
| 655 | Ga0207658_10492251 | 3300025986 | Bacteria | 1091 |
| 656 | Ga0207658_10638123 | 3300025986 | Unclassified | 959 |
| 657 | Ga0207677_10034595 | 3300026023 | Bacteria | 3273 |
| 658 | Ga0207677_10041695 | 3300026023 | Bacteria | 3038 |
| 659 | Ga0207677_10065555 | 3300026023 | Bacteria | 2534 |
| 660 | Ga0207677_10081127 | 3300026023 | Bacteria | 2326 |
| 661 | Ga0207677_10197317 | 3300026023 | Unclassified | 1597 |
| 662 | Ga0207677_10247001 | 3300026023 | Unclassified | 1447 |
| 663 | Ga0207639_10011601 | 3300026041 | Bacteria | 6123 |
| 664 | Ga0207639_10093825 | 3300026041 | Bacteria | 2408 |
| 665 | Ga0207639_10100248 | 3300026041 | Bacteria | 2339 |
| 666 | Ga0207639_10278125 | 3300026041 | Bacteria | 1471 |
| 667 | Ga0207639_10304730 | 3300026041 | Bacteria | 1409 |
| 668 | Ga0207639_11017861 | 3300026041 | Bacteria | 776 |
| 669 | Ga0207678_10057112 | 3300026067 | Bacteria | 3359 |
| 670 | Ga0207678_10059260 | 3300026067 | Bacteria | 3294 |
| 671 | Ga0207678_10101165 | 3300026067 | Unclassified | 2462 |
| 672 | Ga0207678_10257067 | 3300026067 | Unclassified | 1496 |
| 673 | Ga0207678_10454352 | 3300026067 | Bacteria | 1114 |
| 674 | Ga0207708_10446038 | 3300026075 | Bacteria | 1077 |
| 675 | Ga0207702_10022070 | 3300026078 | Bacteria | 5274 |
| 676 | Ga0207702_10095210 | 3300026078 | Bacteria | 2616 |
| 677 | Ga0207702_10135069 | 3300026078 | Unclassified | 2224 |
| 678 | Ga0207702_10238026 | 3300026078 | Bacteria | 1704 |
| 679 | Ga0207641_10001235 | 3300026088 | Bacteria | 25590 |
| 680 | Ga0207641_10035180 | 3300026088 | Bacteria | 4171 |
| 681 | Ga0207641_10361189 | 3300026088 | Bacteria | 1386 |
| 682 | Ga0207641_10395674 | 3300026088 | Bacteria | 1326 |
| 683 | Ga0207641_10861750 | 3300026088 | Unclassified | 898 |
| 684 | Ga0207648_10001972 | 3300026089 | Bacteria | 22390 |
| 685 | Ga0207648_10099643 | 3300026089 | Bacteria | 2545 |
| 686 | Ga0207648_10107946 | 3300026089 | Unclassified | 2443 |
| 687 | Ga0207648_10282105 | 3300026089 | Bacteria | 1485 |
| 688 | Ga0207648_10353461 | 3300026089 | Unclassified | 1325 |
| 689 | Ga0207648_10438726 | 3300026089 | Bacteria | 1187 |
| 690 | Ga0207648_10544182 | 3300026089 | Bacteria | 1066 |
| 691 | Ga0207676_10060852 | 3300026095 | Bacteria | 2988 |
| 692 | Ga0207676_10064360 | 3300026095 | Bacteria | 2916 |
| 693 | Ga0207676_10114867 | 3300026095 | Bacteria | 2259 |
| 694 | Ga0207676_10263928 | 3300026095 | Bacteria | 1556 |
| 695 | Ga0207676_10277661 | 3300026095 | Unclassified | 1520 |
| 696 | Ga0207676_10604538 | 3300026095 | Unclassified | 1054 |
| 697 | Ga0207676_10641767 | 3300026095 | Unclassified | 1024 |
| 698 | Ga0207674_10002454 | 3300026116 | Bacteria | 23401 |
| 699 | Ga0207674_10004889 | 3300026116 | Bacteria | 16037 |
| 700 | Ga0207674_10007799 | 3300026116 | Bacteria | 12451 |
| 701 | Ga0207674_10041435 | 3300026116 | Bacteria | 4763 |
| 702 | Ga0207674_10056401 | 3300026116 | Bacteria | 3990 |
| 703 | Ga0207674_10059130 | 3300026116 | Bacteria | 3880 |
| 704 | Ga0207674_10175510 | 3300026116 | Bacteria | 2095 |
| 705 | Ga0207674_10439504 | 3300026116 | Bacteria | 1261 |
| 706 | Ga0207675_100004652 | 3300026118 | Bacteria | 13217 |
| 707 | Ga0207675_100077458 | 3300026118 | Bacteria | 3115 |
| 708 | Ga0207683_10003643 | 3300026121 | Bacteria | 13402 |
| 709 | Ga0207683_10268077 | 3300026121 | Bacteria | 1560 |
| 710 | Ga0207683_10446589 | 3300026121 | Bacteria | 1192 |
| 711 | Ga0207698_10003337 | 3300026142 | Bacteria | 9659 |
| 712 | Ga0207698_10004845 | 3300026142 | Bacteria | 8243 |
| 713 | Ga0207698_10075259 | 3300026142 | Unclassified | 2697 |
| 714 | Ga0207698_10309951 | 3300026142 | Bacteria | 1473 |
| 715 | Ga0207698_10357958 | 3300026142 | Bacteria | 1381 |
| 716 | Ga0207698_10368573 | 3300026142 | Bacteria | 1362 |
| 717 | Ga0207698_10421392 | 3300026142 | Unclassified | 1281 |
| 718 | Ga0268266_10543577 | 3300028379 | Bacteria | 1112 |
| 719 | Ga0268265_10114602 | 3300028380 | Bacteria | 2208 |
| 720 | Ga0268265_10145454 | 3300028380 | Bacteria | 1991 |
| 721 | Ga0268265_10413193 | 3300028380 | Bacteria | 1251 |
| 722 | Ga0268265_10621433 | 3300028380 | Bacteria | 1035 |
| 723 | Ga0268264_10010600 | 3300028381 | Bacteria | 7617 |
| 724 | Ga0268264_10079567 | 3300028381 | Bacteria | 2797 |
| 725 | Ga0268264_10133007 | 3300028381 | Bacteria | 2208 |
| 726 | Ga0265318_10132870 | 3300028577 | Unclassified | 915 |
| 727 | Ga0307517_10008092 | 3300028786 | Bacteria | 15151 |
| 728 | Ga0265329_10049512 | 3300031242 | Unclassified | 1339 |
| 729 | Ga0265327_10000107 | 3300031251 | Bacteria | 183770 |
| 730 | Ga0265327_10123244 | 3300031251 | Unclassified | 1226 |
| 731 | Ga0307513_10624292 | 3300031456 | Unclassified | 786 |
| 732 | Ga0307509_10206093 | 3300031507 | Bacteria | 1797 |
| 733 | Ga0307509_10359178 | 3300031507 | Bacteria | 1177 |
| 734 | Ga0265314_10015531 | 3300031711 | Bacteria | 6041 |
| 735 | Ga0307510_10007513 | 3300033180 | Bacteria | 12980 |
| 736 | Ga0373934_0109733 | 3300035086 | Bacteria | 1118 |
| 737 | Ga0373943_0135060 | 3300035170 | Bacteria | 1324 |
| 738 | Ga0373924_0051757 | 3300035410 | Bacteria | 1704 |
| 739 | Ga0373924_0318108 | 3300035410 | Bacteria | 692 |
| 740 | Ga0373935_0138940 | 3300035692 | Bacteria | 1639 |
| 741 | Ga0373935_0283596 | 3300035692 | Bacteria | 1167 |
| 742 | Ga0373937_0010916 | 3300036401 | Bacteria | 7953 |
| 743 | Ga0265778_032959 | 3300036457 | Unclassified | 674 |
| 744 | Ga0373925_0667824 | 3300037068 | Unclassified | 857 |
| 745 | Ga0395899_0001555 | 3300037312 | Bacteria | 19348 |
| 746 | Ga0395899_0016403 | 3300037312 | Bacteria | 5646 |
| 747 | Ga0395899_0024144 | 3300037312 | Bacteria | 4599 |
| 748 | Ga0395899_0030887 | 3300037312 | Bacteria | 4027 |
| 749 | Ga0395899_0115442 | 3300037312 | Bacteria | 1927 |
| 750 | Ga0395899_0175527 | 3300037312 | Bacteria | 1507 |
| 751 | Ga0395899_0323287 | 3300037312 | Bacteria | 1038 |
| 752 | Ga0395900_0001378 | 3300037418 | Bacteria | 29221 |
| 753 | Ga0395900_0002745 | 3300037418 | Bacteria | 19224 |
| 754 | Ga0395900_0022520 | 3300037418 | Bacteria | 6445 |
| 755 | Ga0395900_0022676 | 3300037418 | Bacteria | 6425 |
| 756 | Ga0395900_0079906 | 3300037418 | Bacteria | 3360 |
| 757 | Ga0395900_0289337 | 3300037418 | Bacteria | 1627 |
| 758 | Ga0395900_0290859 | 3300037418 | Bacteria | 1622 |
| 759 | Ga0395900_0797672 | 3300037418 | Bacteria | 872 |
| 760 | Ga0395898_0001155 | 3300037466 | Bacteria | 40306 |
| 761 | Ga0395898_0001910 | 3300037466 | Bacteria | 26545 |
| 762 | Ga0395898_0012127 | 3300037466 | Bacteria | 8919 |
| 763 | Ga0395898_0040370 | 3300037466 | Bacteria | 4615 |
| 764 | Ga0395898_0071303 | 3300037466 | Bacteria | 3357 |
| 765 | Ga0395898_0128544 | 3300037466 | Bacteria | 2427 |
| 766 | Ga0395898_0176571 | 3300037466 | Bacteria | 2041 |
| 767 | Ga0395898_1016531 | 3300037466 | Bacteria | 764 |
| 768 | Ga0395905_0145290 | 3300037471 | Bacteria | 2232 |
| 769 | Ga0395905_0194926 | 3300037471 | Unclassified | 1899 |
| 770 | Ga0395905_0320555 | 3300037471 | Bacteria | 1439 |
| 771 | Ga0395905_0576887 | 3300037471 | Bacteria | 1026 |
| 772 | Ga0395901_0001357 | 3300038443 | Bacteria | 25621 |
| 773 | Ga0395901_0009161 | 3300038443 | Bacteria | 10027 |
| 774 | Ga0395901_0058290 | 3300038443 | Bacteria | 4017 |
| 775 | Ga0395901_0146694 | 3300038443 | Bacteria | 2480 |
| 776 | Ga0395901_0683874 | 3300038443 | Bacteria | 1025 |
| 777 | Ga0436365_0106092 | 3300039437 | Bacteria | 1026 |
| 778 | Ga0436365_0391663 | 3300039437 | Bacteria | 4253 |
| 779 | Ga0451793_0102715 | 3300041452 | Unclassified | 1591 |
| 780 | Ga0451849_1184600 | 3300041505 | Bacteria | 1608 |
| 781 | Ga0439442_008493 | 3300042002 | Bacteria | 2074 |
| 782 | Ga0439449_0040363 | 3300042007 | Bacteria | 1735 |
| 783 | Ga0439434_0028813 | 3300042435 | Bacteria | 1683 |
| 784 | Ga0439435_0088725 | 3300042436 | Bacteria | 937 |
| 785 | Ga0451577_0101308 | 3300042876 | Bacteria | 2573 |
| 786 | Ga0466969_0000030 | 3300044656 | Bacteria | 90368 |
| 787 | Ga0466969_0237531 | 3300044656 | Unclassified | 827 |
| 788 | Ga0466972_0047886 | 3300044658 | Bacteria | 2066 |
| 789 | Ga0466972_0230362 | 3300044658 | Bacteria | 867 |
| 790 | Ga0453683_0483855 | 3300044673 | Bacteria | 802 |
| 791 | Ga0466966_0000293 | 3300044684 | Bacteria | 32754 |
| 792 | Ga0466961_0018147 | 3300044693 | Bacteria | 4525 |
| 793 | Ga0466961_0215382 | 3300044693 | Unclassified | 1185 |
| 794 | Ga0453684_0002051 | 3300044712 | Bacteria | 51267 |
| 795 | Ga0466971_0036594 | 3300044719 | Bacteria | 2201 |
| 796 | Ga0466968_0053808 | 3300044735 | Bacteria | 1725 |
| 797 | Ga0466970_0007416 | 3300044765 | Bacteria | 5495 |
| 798 | Ga0466957_0219891 | 3300044842 | Bacteria | 1254 |
| 799 | Ga0466959_0000021 | 3300045049 | Bacteria | 132387 |
| 800 | Ga0466959_0000330 | 3300045049 | Bacteria | 27908 |
| 801 | Ga0451576_0000002 | 3300045051 | Bacteria | 1670975 |
| 802 | Ga0451576_0007316 | 3300045051 | Bacteria | 13256 |
| 803 | Ga0451576_0013939 | 3300045051 | Bacteria | 8973 |
| 804 | Ga0466958_0120752 | 3300045836 | Bacteria | 1640 |
| 805 | Ga0495603_0273756 | 3300046455 | Bacteria | 971 |
| 806 | Ga0495629_0088441 | 3300046459 | Bacteria | 2161 |
| 807 | Ga0495653_0088056 | 3300046463 | Bacteria | 2279 |
| 808 | Ga0495594_0215178 | 3300046499 | Unclassified | 1096 |
| 809 | Ga0495606_0004295 | 3300046507 | Bacteria | 14349 |
| 810 | Ga0495618_0008041 | 3300046514 | Bacteria | 6385 |
| 811 | Ga0495628_0032939 | 3300046516 | Bacteria | 4179 |
| 812 | Ga0495630_0008579 | 3300046517 | Bacteria | 7333 |
| 813 | Ga0495643_0085426 | 3300046522 | Bacteria | 1636 |
| 814 | Ga0495640_0533669 | 3300046533 | Bacteria | 712 |
| 815 | Ga0495587_0056600 | 3300046536 | Bacteria | 2307 |
| 816 | Ga0495645_0325772 | 3300046543 | Bacteria | 996 |
| 817 | Ga0495611_0018419 | 3300046648 | Bacteria | 2994 |
| 818 | Ga0495625_0215316 | 3300046660 | Bacteria | 1261 |
| 819 | Ga0495613_0115296 | 3300046689 | Bacteria | 1934 |
| 820 | Ga0495600_0588901 | 3300046809 | Unclassified | 677 |
| 821 | Ga0495604_0195883 | 3300047317 | Bacteria | 1405 |
| 822 | Ga0495672_0029236 | 3300047320 | Unclassified | 3474 |
| 823 | Ga0495684_0089414 | 3300047471 | Unclassified | 2333 |
| 824 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 825 | Ga0495686_0028548 | 3300047472 | Bacteria | 3633 |
| 826 | Ga0496110_0045077 | 3300048913 | Bacteria | 3853 |
| 827 | Ga0496114_0581616 | 3300048917 | Bacteria | 988 |
| 828 | Ga0496126_0285154 | 3300048929 | Bacteria | 1367 |
| 829 | Ga0501032_0020959 | 3300049569 | Bacteria | 4548 |
| 830 | Ga0501032_0148057 | 3300049569 | Unclassified | 1545 |
| 831 | Ga0501033_0080023 | 3300049570 | Bacteria | 2398 |
| 832 | Ga0501033_0101937 | 3300049570 | Bacteria | 2094 |
| 833 | Ga0501033_0454569 | 3300049570 | Bacteria | 889 |
| 834 | Ga0501034_0010577 | 3300049571 | Bacteria | 9602 |
| 835 | Ga0501034_0014037 | 3300049571 | Bacteria | 8249 |
| 836 | Ga0501034_0033351 | 3300049571 | Bacteria | 5225 |
| 837 | Ga0501034_0057606 | 3300049571 | Bacteria | 3906 |
| 838 | Ga0501034_0275762 | 3300049571 | Bacteria | 1622 |
| 839 | Ga0501034_0277269 | 3300049571 | Bacteria | 1616 |
| 840 | Ga0501034_0474125 | 3300049571 | Bacteria | 1167 |
| 841 | Ga0501034_0492683 | 3300049571 | Bacteria | 1140 |
| 842 | Ga0501036_0139162 | 3300049572 | Bacteria | 2049 |
| 843 | Ga0501036_0232289 | 3300049572 | Unclassified | 1547 |
| 844 | Ga0501036_0703330 | 3300049572 | Bacteria | 835 |
| 845 | Ga0501037_0069618 | 3300049573 | Bacteria | 2561 |
| 846 | Ga0501037_0143409 | 3300049573 | Bacteria | 1709 |
| 847 | Ga0501037_0332009 | 3300049573 | Bacteria | 1051 |
| 848 | Ga0501038_0047026 | 3300049574 | Bacteria | 3739 |
| 849 | Ga0501038_0673318 | 3300049574 | Unclassified | 777 |
| 850 | Ga0501039_0051374 | 3300049575 | Bacteria | 3190 |
| 851 | Ga0501043_0070025 | 3300049579 | Bacteria | 2755 |
| 852 | Ga0501043_0092913 | 3300049579 | Bacteria | 2372 |
| 853 | Ga0501047_0005749 | 3300049581 | Bacteria | 11673 |
| 854 | Ga0501047_0151868 | 3300049581 | Bacteria | 2191 |
| 855 | Ga0501048_0570906 | 3300049582 | Unclassified | 812 |
| 856 | Ga0501070_0036061 | 3300049586 | Bacteria | 4130 |
| 857 | Ga0501083_0152270 | 3300049744 | Bacteria | 1514 |
| 858 | Ga0501035_0011447 | 3300049822 | Bacteria | 8225 |
| 859 | Ga0501035_0016607 | 3300049822 | Bacteria | 6786 |
| 860 | Ga0501035_0027352 | 3300049822 | Bacteria | 5214 |
| 861 | Ga0501035_0072836 | 3300049822 | Bacteria | 3040 |
| 862 | Ga0501044_0004005 | 3300049823 | Bacteria | 16506 |
| 863 | Ga0501044_0088067 | 3300049823 | Unclassified | 3135 |
| 864 | Ga0501044_0116862 | 3300049823 | Bacteria | 2672 |
| 865 | Ga0501044_0216318 | 3300049823 | Bacteria | 1868 |
| 866 | Ga0501044_0407282 | 3300049823 | Bacteria | 1272 |
| 867 | nmdc:mga05p37_100274_c1 | 3300050507 | Bacteria | 3566 |
| 868 | nmdc:mga09592_87369_c1 | 3300050508 | Bacteria | 2662 |
| 869 | nmdc:mga0qj67_32779_c1 | 3300050509 | Bacteria | 4053 |
| 870 | nmdc:mga06r32_297747_c1 | 3300050510 | Bacteria | 1599 |
| 871 | nmdc:mga06r32_54656_c1 | 3300050510 | Bacteria | 3829 |
| 872 | nmdc:mga08y16_124052_c1 | 3300050511 | Bacteria | 2687 |
| 873 | nmdc:mga08y16_505095_c1 | 3300050511 | Unclassified | 1228 |
| 874 | nmdc:mga08y16_596562_c1 | 3300050511 | Bacteria | 1114 |
| 875 | Ga0500578_0000358 | 3300053086 | Bacteria | 56123 |
| 876 | Ga0500658_0126968 | 3300053134 | Unclassified | 1135 |
| 877 | Ga0500616_0051611 | 3300053153 | Bacteria | 2166 |
| 878 | Ga0500622_0065988 | 3300053156 | Bacteria | 1838 |
| 879 | Ga0500637_0310340 | 3300053178 | Bacteria | 856 |
| 880 | Ga0500587_035492 | 3300053739 | Bacteria | 699 |
| 881 | Ga0466962_0008032 | 3300061719 | Bacteria | 5060 |
| 882 | Ga0466962_0199363 | 3300061719 | Bacteria | 978 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053739 | Ga0500587_035492 | Ga0500587_035492_145_669 | 173 |
| 2 | 3300013307 | Ga0157372_10310941 | Ga0157372_103109411 | 195 |
| 3 | 3300036457 | Ga0265778_032959 | Ga0265778_032959_50_637 | 195 |
| 4 | 3300044693 | Ga0466961_0215382 | Ga0466961_0215382_559_1173 | 197 |
| 5 | 3300005444 | Ga0070694_100097513 | Ga0070694_1000975132 | 198 |
| 6 | 3300005840 | Ga0068870_10170179 | Ga0068870_101701792 | 198 |
| 7 | 3300025908 | Ga0207643_10017411 | Ga0207643_100174112 | 198 |
| 8 | 3300025914 | Ga0207671_10011167 | Ga0207671_100111673 | 198 |
| 9 | 3300025936 | Ga0207670_10029226 | Ga0207670_100292261 | 198 |
| 10 | 3300005334 | Ga0068869_100274630 | Ga0068869_1002746302 | 199 |
| 11 | 3300005843 | Ga0068860_100035807 | Ga0068860_1000358073 | 199 |
| 12 | 3300009147 | Ga0114129_10032540 | Ga0114129_100325406 | 199 |
| 13 | 3300025942 | Ga0207689_10286108 | Ga0207689_102861082 | 199 |
| 14 | 3300025986 | Ga0207658_10278294 | Ga0207658_102782942 | 199 |
| 15 | 3300005543 | Ga0070672_100335697 | Ga0070672_1003356972 | 200 |
| 16 | 3300009094 | Ga0111539_10142694 | Ga0111539_101426942 | 200 |
| 17 | 3300025913 | Ga0207695_10348617 | Ga0207695_103486173 | 200 |
| 18 | 3300025926 | Ga0207659_10520986 | Ga0207659_105209861 | 200 |
| 19 | 3300025949 | Ga0207667_10137089 | Ga0207667_101370893 | 200 |
| 20 | 3300039437 | Ga0436365_0106092 | Ga0436365_0106092_124_753 | 200 |
| 21 | 3300050511 | nmdc:mga08y16_505095_c1 | nmdc:mga08y16_505095_c1_506_1144 | 200 |
| 22 | 3300005289 | Ga0065704_10123486 | Ga0065704_101234862 | 202 |
| 23 | 3300005459 | Ga0068867_100199806 | Ga0068867_1001998062 | 202 |
| 24 | 3300006844 | Ga0075428_100151035 | Ga0075428_1001510352 | 202 |
| 25 | 3300006846 | Ga0075430_100007274 | Ga0075430_1000072745 | 202 |
| 26 | 3300009147 | Ga0114129_10194413 | Ga0114129_101944133 | 202 |
| 27 | 3300041452 | Ga0451793_0102715 | Ga0451793_0102715_916_1560 | 202 |
| 28 | 3300049570 | Ga0501033_0454569 | Ga0501033_0454569_119_802 | 202 |
| 29 | 3300049571 | Ga0501034_0014037 | Ga0501034_0014037_281_964 | 202 |
| 30 | 3300049573 | Ga0501037_0143409 | Ga0501037_0143409_812_1495 | 202 |
| 31 | 3300049822 | Ga0501035_0016607 | Ga0501035_0016607_2680_3363 | 202 |
| 32 | 3300049823 | Ga0501044_0088067 | Ga0501044_0088067_47_730 | 202 |
| 33 | 3300050509 | nmdc:mga0qj67_32779_c1 | nmdc:mga0qj67_32779_c1_1503_2189 | 202 |
| 34 | 3300050510 | nmdc:mga06r32_54656_c1 | nmdc:mga06r32_54656_c1_1568_2254 | 202 |
| 35 | 3300009551 | Ga0105238_10058560 | Ga0105238_100585603 | 205 |
| 36 | iso_pu_bacteria | 2840677318 | 2840679354 | 205 |
| 37 | iso_pu_bacteria | 2896085136 | 2896087165 | 205 |
| 38 | 3300025302 | Ga0207426_1000189 | Ga0207426_100018912 | 206 |
| 39 | 3300005335 | Ga0070666_10296083 | Ga0070666_102960831 | 207 |
| 40 | 3300005355 | Ga0070671_101098322 | Ga0070671_1010983221 | 207 |
| 41 | 3300005535 | Ga0070684_100081513 | Ga0070684_1000815133 | 207 |
| 42 | 3300005834 | Ga0068851_10443656 | Ga0068851_104436561 | 207 |
| 43 | 3300005841 | Ga0068863_100495893 | Ga0068863_1004958932 | 207 |
| 44 | 3300009093 | Ga0105240_10001825 | Ga0105240_100018255 | 207 |
| 45 | 3300009176 | Ga0105242_10410330 | Ga0105242_104103302 | 207 |
| 46 | 3300009553 | Ga0105249_11401850 | Ga0105249_114018501 | 207 |
| 47 | 3300013104 | Ga0157370_10636622 | Ga0157370_106366221 | 207 |
| 48 | 3300013296 | Ga0157374_10299997 | Ga0157374_102999971 | 207 |
| 49 | 3300013297 | Ga0157378_10048964 | Ga0157378_100489642 | 207 |
| 50 | 3300013306 | Ga0163162_10147746 | Ga0163162_101477462 | 207 |
| 51 | 3300013306 | Ga0163162_10498475 | Ga0163162_104984754 | 207 |
| 52 | 3300013306 | Ga0163162_11009847 | Ga0163162_110098472 | 207 |
| 53 | 3300014325 | Ga0163163_10064762 | Ga0163163_100647622 | 207 |
| 54 | 3300017792 | Ga0163161_10030948 | Ga0163161_100309482 | 207 |
| 55 | 3300025913 | Ga0207695_10000209 | Ga0207695_1000020974 | 207 |
| 56 | 3300026088 | Ga0207641_10861750 | Ga0207641_108617501 | 207 |
| 57 | 3300031251 | Ga0265327_10000107 | Ga0265327_1000010792 | 207 |
| 58 | 3300033180 | Ga0307510_10007513 | Ga0307510_100075135 | 207 |
| 59 | 3300035692 | Ga0373935_0283596 | Ga0373935_0283596_181_807 | 207 |
| 60 | 3300048917 | Ga0496114_0581616 | Ga0496114_0581616_142_765 | 207 |
| 61 | 3300002738 | JGI25154J39366_1007391 | JGI25154J39366_10073912 | 208 |
| 62 | 3300003316 | rootH1_10004660 | rootH1_100046602 | 208 |
| 63 | 3300003320 | rootH2_10062516 | rootH2_100625161 | 208 |
| 64 | 3300003794 | Ga0055531_10000118 | Ga0055531_1000011847 | 208 |
| 65 | 3300005290 | Ga0065712_10008616 | Ga0065712_100086162 | 208 |
| 66 | 3300005334 | Ga0068869_100294029 | Ga0068869_1002940292 | 208 |
| 67 | 3300005336 | Ga0070680_100773307 | Ga0070680_1007733071 | 208 |
| 68 | 3300005339 | Ga0070660_100004792 | Ga0070660_1000047925 | 208 |
| 69 | 3300005339 | Ga0070660_100038196 | Ga0070660_1000381962 | 208 |
| 70 | 3300005339 | Ga0070660_100043178 | Ga0070660_1000431782 | 208 |
| 71 | 3300005339 | Ga0070660_100083988 | Ga0070660_1000839883 | 208 |
| 72 | 3300005340 | Ga0070689_100172551 | Ga0070689_1001725512 | 208 |
| 73 | 3300005340 | Ga0070689_100448344 | Ga0070689_1004483441 | 208 |
| 74 | 3300005354 | Ga0070675_100212696 | Ga0070675_1002126962 | 208 |
| 75 | 3300005356 | Ga0070674_100171840 | Ga0070674_1001718402 | 208 |
| 76 | 3300005364 | Ga0070673_100195719 | Ga0070673_1001957192 | 208 |
| 77 | 3300005364 | Ga0070673_100197411 | Ga0070673_1001974112 | 208 |
| 78 | 3300005365 | Ga0070688_100032273 | Ga0070688_1000322732 | 208 |
| 79 | 3300005365 | Ga0070688_100236818 | Ga0070688_1002368182 | 208 |
| 80 | 3300005366 | Ga0070659_100038444 | Ga0070659_1000384441 | 208 |
| 81 | 3300005367 | Ga0070667_100170843 | Ga0070667_1001708432 | 208 |
| 82 | 3300005367 | Ga0070667_100195377 | Ga0070667_1001953772 | 208 |
| 83 | 3300005367 | Ga0070667_100308367 | Ga0070667_1003083672 | 208 |
| 84 | 3300005457 | Ga0070662_100055639 | Ga0070662_1000556393 | 208 |
| 85 | 3300005466 | Ga0070685_10007265 | Ga0070685_100072653 | 208 |
| 86 | 3300005466 | Ga0070685_10033897 | Ga0070685_100338974 | 208 |
| 87 | 3300005471 | Ga0070698_100001998 | Ga0070698_1000019986 | 208 |
| 88 | 3300005471 | Ga0070698_100122946 | Ga0070698_1001229461 | 208 |
| 89 | 3300005530 | Ga0070679_100026049 | Ga0070679_1000260494 | 208 |
| 90 | 3300005530 | Ga0070679_100624764 | Ga0070679_1006247642 | 208 |
| 91 | 3300005539 | Ga0068853_100053788 | Ga0068853_1000537883 | 208 |
| 92 | 3300005543 | Ga0070672_100047244 | Ga0070672_1000472443 | 208 |
| 93 | 3300005563 | Ga0068855_100017595 | Ga0068855_10001759510 | 208 |
| 94 | 3300005563 | Ga0068855_100058177 | Ga0068855_1000581777 | 208 |
| 95 | 3300005563 | Ga0068855_100702609 | Ga0068855_1007026092 | 208 |
| 96 | 3300005564 | Ga0070664_100049998 | Ga0070664_1000499981 | 208 |
| 97 | 3300005564 | Ga0070664_100383122 | Ga0070664_1003831223 | 208 |
| 98 | 3300005577 | Ga0068857_100045885 | Ga0068857_1000458855 | 208 |
| 99 | 3300005578 | Ga0068854_100816972 | Ga0068854_1008169721 | 208 |
| 100 | 3300005614 | Ga0068856_100018504 | Ga0068856_1000185045 | 208 |
| 101 | 3300005614 | Ga0068856_100073456 | Ga0068856_1000734564 | 208 |
| 102 | 3300005616 | Ga0068852_100534485 | Ga0068852_1005344852 | 208 |
| 103 | 3300005617 | Ga0068859_100297349 | Ga0068859_1002973492 | 208 |
| 104 | 3300005617 | Ga0068859_100501650 | Ga0068859_1005016502 | 208 |
| 105 | 3300005618 | Ga0068864_100114675 | Ga0068864_1001146752 | 208 |
| 106 | 3300005618 | Ga0068864_100412039 | Ga0068864_1004120392 | 208 |
| 107 | 3300005618 | Ga0068864_100971819 | Ga0068864_1009718191 | 208 |
| 108 | 3300005718 | Ga0068866_10205242 | Ga0068866_102052422 | 208 |
| 109 | 3300005719 | Ga0068861_100253851 | Ga0068861_1002538512 | 208 |
| 110 | 3300005840 | Ga0068870_10362444 | Ga0068870_103624442 | 208 |
| 111 | 3300005841 | Ga0068863_100126403 | Ga0068863_1001264033 | 208 |
| 112 | 3300005843 | Ga0068860_100045962 | Ga0068860_1000459622 | 208 |
| 113 | 3300005843 | Ga0068860_100169026 | Ga0068860_1001690262 | 208 |
| 114 | 3300005843 | Ga0068860_101066605 | Ga0068860_1010666051 | 208 |
| 115 | 3300006237 | Ga0097621_100021395 | Ga0097621_1000213955 | 208 |
| 116 | 3300006237 | Ga0097621_100304357 | Ga0097621_1003043572 | 208 |
| 117 | 3300006237 | Ga0097621_100822652 | Ga0097621_1008226522 | 208 |
| 118 | 3300006852 | Ga0075433_10578825 | Ga0075433_105788252 | 208 |
| 119 | 3300006931 | Ga0097620_100297359 | Ga0097620_1002973592 | 208 |
| 120 | 3300006931 | Ga0097620_100501616 | Ga0097620_1005016162 | 208 |
| 121 | 3300009093 | Ga0105240_10000905 | Ga0105240_1000090540 | 208 |
| 122 | 3300009093 | Ga0105240_10182366 | Ga0105240_101823662 | 208 |
| 123 | 3300009148 | Ga0105243_10098133 | Ga0105243_100981331 | 208 |
| 124 | 3300009174 | Ga0105241_10032233 | Ga0105241_100322332 | 208 |
| 125 | 3300009176 | Ga0105242_10003021 | Ga0105242_100030214 | 208 |
| 126 | 3300009177 | Ga0105248_10221882 | Ga0105248_102218822 | 208 |
| 127 | 3300009545 | Ga0105237_10000305 | Ga0105237_1000030528 | 208 |
| 128 | 3300009545 | Ga0105237_10020409 | Ga0105237_1002040912 | 208 |
| 129 | 3300009545 | Ga0105237_10046496 | Ga0105237_100464964 | 208 |
| 130 | 3300009551 | Ga0105238_10118144 | Ga0105238_101181442 | 208 |
| 131 | 3300009553 | Ga0105249_10013169 | Ga0105249_100131692 | 208 |
| 132 | 3300009553 | Ga0105249_10058553 | Ga0105249_100585535 | 208 |
| 133 | 3300009553 | Ga0105249_10237511 | Ga0105249_102375111 | 208 |
| 134 | 3300009553 | Ga0105249_10789389 | Ga0105249_107893891 | 208 |
| 135 | 3300010375 | Ga0105239_10000099 | Ga0105239_1000009935 | 208 |
| 136 | 3300013100 | Ga0157373_10111972 | Ga0157373_101119721 | 208 |
| 137 | 3300013102 | Ga0157371_10000322 | Ga0157371_1000032241 | 208 |
| 138 | 3300013102 | Ga0157371_10002933 | Ga0157371_100029331 | 208 |
| 139 | 3300013102 | Ga0157371_10005313 | Ga0157371_100053133 | 208 |
| 140 | 3300013102 | Ga0157371_10085960 | Ga0157371_100859602 | 208 |
| 141 | 3300013102 | Ga0157371_10126011 | Ga0157371_101260112 | 208 |
| 142 | 3300013102 | Ga0157371_10194410 | Ga0157371_101944102 | 208 |
| 143 | 3300013104 | Ga0157370_10071434 | Ga0157370_100714343 | 208 |
| 144 | 3300013104 | Ga0157370_10162581 | Ga0157370_101625812 | 208 |
| 145 | 3300013104 | Ga0157370_10191287 | Ga0157370_101912873 | 208 |
| 146 | 3300013105 | Ga0157369_10015570 | Ga0157369_100155703 | 208 |
| 147 | 3300013105 | Ga0157369_10100069 | Ga0157369_101000693 | 208 |
| 148 | 3300013296 | Ga0157374_10000027 | Ga0157374_10000027179 | 208 |
| 149 | 3300013296 | Ga0157374_10108533 | Ga0157374_101085335 | 208 |
| 150 | 3300013296 | Ga0157374_10213399 | Ga0157374_102133992 | 208 |
| 151 | 3300013297 | Ga0157378_10049021 | Ga0157378_100490213 | 208 |
| 152 | 3300013306 | Ga0163162_10093714 | Ga0163162_100937142 | 208 |
| 153 | 3300013306 | Ga0163162_10124903 | Ga0163162_101249034 | 208 |
| 154 | 3300013306 | Ga0163162_10286741 | Ga0163162_102867412 | 208 |
| 155 | 3300013306 | Ga0163162_10338635 | Ga0163162_103386352 | 208 |
| 156 | 3300013306 | Ga0163162_10543549 | Ga0163162_105435492 | 208 |
| 157 | 3300013307 | Ga0157372_10230504 | Ga0157372_102305042 | 208 |
| 158 | 3300013307 | Ga0157372_10452285 | Ga0157372_104522854 | 208 |
| 159 | 3300013307 | Ga0157372_10696703 | Ga0157372_106967031 | 208 |
| 160 | 3300013307 | Ga0157372_10782216 | Ga0157372_107822162 | 208 |
| 161 | 3300013308 | Ga0157375_10294269 | Ga0157375_102942692 | 208 |
| 162 | 3300013308 | Ga0157375_10477369 | Ga0157375_104773691 | 208 |
| 163 | 3300013308 | Ga0157375_10563568 | Ga0157375_105635682 | 208 |
| 164 | 3300014325 | Ga0163163_10597338 | Ga0163163_105973381 | 208 |
| 165 | 3300014326 | Ga0157380_10386905 | Ga0157380_103869052 | 208 |
| 166 | 3300014745 | Ga0157377_10016681 | Ga0157377_100166812 | 208 |
| 167 | 3300014745 | Ga0157377_10207953 | Ga0157377_102079531 | 208 |
| 168 | 3300014968 | Ga0157379_10054403 | Ga0157379_100544032 | 208 |
| 169 | 3300014968 | Ga0157379_10556274 | Ga0157379_105562742 | 208 |
| 170 | 3300014969 | Ga0157376_10000368 | Ga0157376_1000036819 | 208 |
| 171 | 3300014969 | Ga0157376_10197524 | Ga0157376_101975241 | 208 |
| 172 | 3300014969 | Ga0157376_10207254 | Ga0157376_102072542 | 208 |
| 173 | 3300017792 | Ga0163161_10395678 | Ga0163161_103956782 | 208 |
| 174 | 3300025246 | Ga0209646_1001061 | Ga0209646_10010612 | 208 |
| 175 | 3300025304 | Ga0209257_1000007 | Ga0209257_1000007144 | 208 |
| 176 | 3300025904 | Ga0207647_10261247 | Ga0207647_102612471 | 208 |
| 177 | 3300025907 | Ga0207645_10112800 | Ga0207645_101128001 | 208 |
| 178 | 3300025909 | Ga0207705_10033049 | Ga0207705_100330493 | 208 |
| 179 | 3300025911 | Ga0207654_10005944 | Ga0207654_100059449 | 208 |
| 180 | 3300025913 | Ga0207695_10007075 | Ga0207695_100070759 | 208 |
| 181 | 3300025913 | Ga0207695_10184568 | Ga0207695_101845682 | 208 |
| 182 | 3300025914 | Ga0207671_10012297 | Ga0207671_100122973 | 208 |
| 183 | 3300025914 | Ga0207671_10179893 | Ga0207671_101798932 | 208 |
| 184 | 3300025917 | Ga0207660_10043520 | Ga0207660_100435202 | 208 |
| 185 | 3300025917 | Ga0207660_10103074 | Ga0207660_101030741 | 208 |
| 186 | 3300025919 | Ga0207657_10006381 | Ga0207657_100063813 | 208 |
| 187 | 3300025919 | Ga0207657_10032094 | Ga0207657_100320943 | 208 |
| 188 | 3300025919 | Ga0207657_10054131 | Ga0207657_100541312 | 208 |
| 189 | 3300025919 | Ga0207657_10077336 | Ga0207657_100773364 | 208 |
| 190 | 3300025921 | Ga0207652_10000327 | Ga0207652_1000032734 | 208 |
| 191 | 3300025921 | Ga0207652_10096776 | Ga0207652_100967761 | 208 |
| 192 | 3300025921 | Ga0207652_10449164 | Ga0207652_104491641 | 208 |
| 193 | 3300025921 | Ga0207652_10484192 | Ga0207652_104841922 | 208 |
| 194 | 3300025923 | Ga0207681_10754485 | Ga0207681_107544851 | 208 |
| 195 | 3300025924 | Ga0207694_10236795 | Ga0207694_102367951 | 208 |
| 196 | 3300025925 | Ga0207650_10338292 | Ga0207650_103382922 | 208 |
| 197 | 3300025932 | Ga0207690_10058402 | Ga0207690_100584023 | 208 |
| 198 | 3300025934 | Ga0207686_10000884 | Ga0207686_100008848 | 208 |
| 199 | 3300025934 | Ga0207686_10112072 | Ga0207686_101120722 | 208 |
| 200 | 3300025934 | Ga0207686_10255834 | Ga0207686_102558342 | 208 |
| 201 | 3300025936 | Ga0207670_10060545 | Ga0207670_100605453 | 208 |
| 202 | 3300025940 | Ga0207691_10019398 | Ga0207691_100193982 | 208 |
| 203 | 3300025942 | Ga0207689_10035195 | Ga0207689_100351953 | 208 |
| 204 | 3300025942 | Ga0207689_10036311 | Ga0207689_100363112 | 208 |
| 205 | 3300025949 | Ga0207667_10202598 | Ga0207667_102025982 | 208 |
| 206 | 3300025949 | Ga0207667_10484811 | Ga0207667_104848113 | 208 |
| 207 | 3300025949 | Ga0207667_10818356 | Ga0207667_108183562 | 208 |
| 208 | 3300025960 | Ga0207651_10040387 | Ga0207651_100403872 | 208 |
| 209 | 3300025961 | Ga0207712_10002170 | Ga0207712_100021704 | 208 |
| 210 | 3300025961 | Ga0207712_10057941 | Ga0207712_100579412 | 208 |
| 211 | 3300025961 | Ga0207712_10068500 | Ga0207712_100685003 | 208 |
| 212 | 3300025972 | Ga0207668_10064508 | Ga0207668_100645083 | 208 |
| 213 | 3300025981 | Ga0207640_10143843 | Ga0207640_101438432 | 208 |
| 214 | 3300025986 | Ga0207658_10492251 | Ga0207658_104922512 | 208 |
| 215 | 3300025986 | Ga0207658_10638123 | Ga0207658_106381231 | 208 |
| 216 | 3300026041 | Ga0207639_10100248 | Ga0207639_101002482 | 208 |
| 217 | 3300026067 | Ga0207678_10059260 | Ga0207678_100592603 | 208 |
| 218 | 3300026067 | Ga0207678_10454352 | Ga0207678_104543522 | 208 |
| 219 | 3300026078 | Ga0207702_10238026 | Ga0207702_102380262 | 208 |
| 220 | 3300026088 | Ga0207641_10001235 | Ga0207641_1000123525 | 208 |
| 221 | 3300026088 | Ga0207641_10035180 | Ga0207641_100351803 | 208 |
| 222 | 3300026088 | Ga0207641_10361189 | Ga0207641_103611891 | 208 |
| 223 | 3300026089 | Ga0207648_10099643 | Ga0207648_100996432 | 208 |
| 224 | 3300026089 | Ga0207648_10438726 | Ga0207648_104387262 | 208 |
| 225 | 3300026095 | Ga0207676_10263928 | Ga0207676_102639281 | 208 |
| 226 | 3300026095 | Ga0207676_10641767 | Ga0207676_106417671 | 208 |
| 227 | 3300026116 | Ga0207674_10059130 | Ga0207674_100591304 | 208 |
| 228 | 3300026116 | Ga0207674_10439504 | Ga0207674_104395041 | 208 |
| 229 | 3300026142 | Ga0207698_10368573 | Ga0207698_103685732 | 208 |
| 230 | 3300028380 | Ga0268265_10413193 | Ga0268265_104131932 | 208 |
| 231 | 3300028381 | Ga0268264_10133007 | Ga0268264_101330072 | 208 |
| 232 | 3300028786 | Ga0307517_10008092 | Ga0307517_1000809214 | 208 |
| 233 | 3300031507 | Ga0307509_10206093 | Ga0307509_102060932 | 208 |
| 234 | 3300035410 | Ga0373924_0318108 | Ga0373924_0318108_24_650 | 208 |
| 235 | 3300037312 | Ga0395899_0001555 | Ga0395899_0001555_17297_17926 | 208 |
| 236 | 3300037312 | Ga0395899_0030887 | Ga0395899_0030887_2885_3514 | 208 |
| 237 | 3300037312 | Ga0395899_0115442 | Ga0395899_0115442_329_958 | 208 |
| 238 | 3300037418 | Ga0395900_0002745 | Ga0395900_0002745_17586_18215 | 208 |
| 239 | 3300037418 | Ga0395900_0022520 | Ga0395900_0022520_2669_3298 | 208 |
| 240 | 3300037418 | Ga0395900_0797672 | Ga0395900_0797672_128_757 | 208 |
| 241 | 3300037466 | Ga0395898_0001910 | Ga0395898_0001910_7529_8158 | 208 |
| 242 | 3300037466 | Ga0395898_0012127 | Ga0395898_0012127_1409_2038 | 208 |
| 243 | 3300037466 | Ga0395898_0040370 | Ga0395898_0040370_2581_3210 | 208 |
| 244 | 3300037466 | Ga0395898_1016531 | Ga0395898_1016531_113_742 | 208 |
| 245 | 3300037471 | Ga0395905_0576887 | Ga0395905_0576887_365_994 | 208 |
| 246 | 3300038443 | Ga0395901_0001357 | Ga0395901_0001357_11300_11929 | 208 |
| 247 | 3300038443 | Ga0395901_0146694 | Ga0395901_0146694_1581_2210 | 208 |
| 248 | 3300042436 | Ga0439435_0088725 | Ga0439435_0088725_127_753 | 208 |
| 249 | 3300042876 | Ga0451577_0101308 | Ga0451577_0101308_937_1578 | 208 |
| 250 | 3300044656 | Ga0466969_0237531 | Ga0466969_0237531_145_774 | 208 |
| 251 | 3300044658 | Ga0466972_0047886 | Ga0466972_0047886_1289_1927 | 208 |
| 252 | 3300044673 | Ga0453683_0483855 | Ga0453683_0483855_42_671 | 208 |
| 253 | 3300044693 | Ga0466961_0018147 | Ga0466961_0018147_3647_4276 | 208 |
| 254 | 3300044712 | Ga0453684_0002051 | Ga0453684_0002051_39600_40241 | 208 |
| 255 | 3300044719 | Ga0466971_0036594 | Ga0466971_0036594_377_1006 | 208 |
| 256 | 3300044842 | Ga0466957_0219891 | Ga0466957_0219891_441_1070 | 208 |
| 257 | 3300045049 | Ga0466959_0000330 | Ga0466959_0000330_1755_2384 | 208 |
| 258 | 3300045051 | Ga0451576_0007316 | Ga0451576_0007316_9852_10481 | 208 |
| 259 | 3300045051 | Ga0451576_0013939 | Ga0451576_0013939_284_925 | 208 |
| 260 | 3300045836 | Ga0466958_0120752 | Ga0466958_0120752_997_1626 | 208 |
| 261 | 3300046455 | Ga0495603_0273756 | Ga0495603_0273756_303_932 | 208 |
| 262 | 3300046499 | Ga0495594_0215178 | Ga0495594_0215178_202_831 | 208 |
| 263 | 3300046660 | Ga0495625_0215316 | Ga0495625_0215316_184_825 | 208 |
| 264 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_563050_563679 | 208 |
| 265 | 3300049571 | Ga0501034_0275762 | Ga0501034_0275762_339_965 | 208 |
| 266 | 3300050511 | nmdc:mga08y16_124052_c1 | nmdc:mga08y16_124052_c1_710_1354 | 208 |
| 267 | 3300053153 | Ga0500616_0051611 | Ga0500616_0051611_203_829 | 208 |
| 268 | 3300061719 | Ga0466962_0008032 | Ga0466962_0008032_1739_2368 | 208 |
| 269 | 3300061719 | Ga0466962_0199363 | Ga0466962_0199363_225_869 | 208 |
| 270 | iso_pu_bacteria | 2738541278 | 2738727275 | 208 |
| 271 | 3300003320 | rootH2_10000086 | rootH2_1000008626 | 209 |
| 272 | 3300003320 | rootH2_10038964 | rootH2_100389642 | 209 |
| 273 | 3300003320 | rootH2_10063811 | rootH2_100638111 | 209 |
| 274 | 3300005328 | Ga0070676_10010291 | Ga0070676_100102912 | 209 |
| 275 | 3300005330 | Ga0070690_100055055 | Ga0070690_1000550552 | 209 |
| 276 | 3300005333 | Ga0070677_10037752 | Ga0070677_100377522 | 209 |
| 277 | 3300005334 | Ga0068869_100089932 | Ga0068869_1000899322 | 209 |
| 278 | 3300005334 | Ga0068869_100113631 | Ga0068869_1001136312 | 209 |
| 279 | 3300005335 | Ga0070666_10069419 | Ga0070666_100694192 | 209 |
| 280 | 3300005335 | Ga0070666_10298154 | Ga0070666_102981541 | 209 |
| 281 | 3300005338 | Ga0068868_100032721 | Ga0068868_1000327213 | 209 |
| 282 | 3300005338 | Ga0068868_100051954 | Ga0068868_1000519543 | 209 |
| 283 | 3300005338 | Ga0068868_100164877 | Ga0068868_1001648772 | 209 |
| 284 | 3300005340 | Ga0070689_100011512 | Ga0070689_1000115125 | 209 |
| 285 | 3300005347 | Ga0070668_100089942 | Ga0070668_1000899422 | 209 |
| 286 | 3300005347 | Ga0070668_100458289 | Ga0070668_1004582891 | 209 |
| 287 | 3300005353 | Ga0070669_100037456 | Ga0070669_1000374561 | 209 |
| 288 | 3300005353 | Ga0070669_100570032 | Ga0070669_1005700321 | 209 |
| 289 | 3300005354 | Ga0070675_100087279 | Ga0070675_1000872792 | 209 |
| 290 | 3300005354 | Ga0070675_100462515 | Ga0070675_1004625151 | 209 |
| 291 | 3300005355 | Ga0070671_100720492 | Ga0070671_1007204922 | 209 |
| 292 | 3300005364 | Ga0070673_100026043 | Ga0070673_1000260433 | 209 |
| 293 | 3300005364 | Ga0070673_100137787 | Ga0070673_1001377872 | 209 |
| 294 | 3300005365 | Ga0070688_100035869 | Ga0070688_1000358691 | 209 |
| 295 | 3300005365 | Ga0070688_100514073 | Ga0070688_1005140732 | 209 |
| 296 | 3300005367 | Ga0070667_100022878 | Ga0070667_1000228782 | 209 |
| 297 | 3300005367 | Ga0070667_100091095 | Ga0070667_1000910952 | 209 |
| 298 | 3300005367 | Ga0070667_100108720 | Ga0070667_1001087203 | 209 |
| 299 | 3300005456 | Ga0070678_100020940 | Ga0070678_1000209404 | 209 |
| 300 | 3300005457 | Ga0070662_100072148 | Ga0070662_1000721483 | 209 |
| 301 | 3300005457 | Ga0070662_100207523 | Ga0070662_1002075233 | 209 |
| 302 | 3300005459 | Ga0068867_100033261 | Ga0068867_1000332612 | 209 |
| 303 | 3300005459 | Ga0068867_100147186 | Ga0068867_1001471862 | 209 |
| 304 | 3300005459 | Ga0068867_100317236 | Ga0068867_1003172362 | 209 |
| 305 | 3300005466 | Ga0070685_10023071 | Ga0070685_100230711 | 209 |
| 306 | 3300005466 | Ga0070685_10551638 | Ga0070685_105516381 | 209 |
| 307 | 3300005535 | Ga0070684_100056042 | Ga0070684_1000560423 | 209 |
| 308 | 3300005539 | Ga0068853_100227573 | Ga0068853_1002275732 | 209 |
| 309 | 3300005543 | Ga0070672_100049253 | Ga0070672_1000492533 | 209 |
| 310 | 3300005544 | Ga0070686_100407527 | Ga0070686_1004075271 | 209 |
| 311 | 3300005547 | Ga0070693_100337185 | Ga0070693_1003371851 | 209 |
| 312 | 3300005548 | Ga0070665_100038063 | Ga0070665_1000380633 | 209 |
| 313 | 3300005548 | Ga0070665_100128940 | Ga0070665_1001289402 | 209 |
| 314 | 3300005564 | Ga0070664_100310167 | Ga0070664_1003101673 | 209 |
| 315 | 3300005564 | Ga0070664_100333241 | Ga0070664_1003332412 | 209 |
| 316 | 3300005578 | Ga0068854_100057944 | Ga0068854_1000579441 | 209 |
| 317 | 3300005614 | Ga0068856_100157993 | Ga0068856_1001579932 | 209 |
| 318 | 3300005617 | Ga0068859_100025982 | Ga0068859_1000259823 | 209 |
| 319 | 3300005617 | Ga0068859_100048901 | Ga0068859_1000489014 | 209 |
| 320 | 3300005617 | Ga0068859_100494484 | Ga0068859_1004944841 | 209 |
| 321 | 3300005842 | Ga0068858_100581653 | Ga0068858_1005816532 | 209 |
| 322 | 3300005842 | Ga0068858_101157795 | Ga0068858_1011577951 | 209 |
| 323 | 3300005843 | Ga0068860_100038858 | Ga0068860_1000388585 | 209 |
| 324 | 3300005844 | Ga0068862_100295962 | Ga0068862_1002959622 | 209 |
| 325 | 3300006237 | Ga0097621_100030624 | Ga0097621_1000306244 | 209 |
| 326 | 3300006237 | Ga0097621_100363102 | Ga0097621_1003631022 | 209 |
| 327 | 3300006358 | Ga0068871_100120751 | Ga0068871_1001207512 | 209 |
| 328 | 3300006881 | Ga0068865_100028534 | Ga0068865_1000285344 | 209 |
| 329 | 3300006881 | Ga0068865_100058612 | Ga0068865_1000586122 | 209 |
| 330 | 3300006881 | Ga0068865_100135681 | Ga0068865_1001356811 | 209 |
| 331 | 3300006931 | Ga0097620_100025982 | Ga0097620_1000259823 | 209 |
| 332 | 3300006931 | Ga0097620_100048900 | Ga0097620_1000489004 | 209 |
| 333 | 3300006931 | Ga0097620_100494477 | Ga0097620_1004944771 | 209 |
| 334 | 3300009093 | Ga0105240_10001869 | Ga0105240_100018694 | 209 |
| 335 | 3300009176 | Ga0105242_10034122 | Ga0105242_100341222 | 209 |
| 336 | 3300009176 | Ga0105242_10300452 | Ga0105242_103004522 | 209 |
| 337 | 3300009176 | Ga0105242_10697448 | Ga0105242_106974482 | 209 |
| 338 | 3300009545 | Ga0105237_10001224 | Ga0105237_1000122423 | 209 |
| 339 | 3300009545 | Ga0105237_10006238 | Ga0105237_100062382 | 209 |
| 340 | 3300009545 | Ga0105237_10021612 | Ga0105237_100216124 | 209 |
| 341 | 3300009553 | Ga0105249_10370143 | Ga0105249_103701432 | 209 |
| 342 | 3300010375 | Ga0105239_10000970 | Ga0105239_1000097017 | 209 |
| 343 | 3300011119 | Ga0105246_10464434 | Ga0105246_104644342 | 209 |
| 344 | 3300013102 | Ga0157371_10052508 | Ga0157371_100525081 | 209 |
| 345 | 3300013296 | Ga0157374_10092412 | Ga0157374_100924123 | 209 |
| 346 | 3300013296 | Ga0157374_10301550 | Ga0157374_103015501 | 209 |
| 347 | 3300013296 | Ga0157374_10401219 | Ga0157374_104012191 | 209 |
| 348 | 3300013296 | Ga0157374_10974599 | Ga0157374_109745992 | 209 |
| 349 | 3300013296 | Ga0157374_11150853 | Ga0157374_111508531 | 209 |
| 350 | 3300013297 | Ga0157378_10351313 | Ga0157378_103513132 | 209 |
| 351 | 3300013297 | Ga0157378_10546246 | Ga0157378_105462462 | 209 |
| 352 | 3300013297 | Ga0157378_10679266 | Ga0157378_106792662 | 209 |
| 353 | 3300013306 | Ga0163162_10011701 | Ga0163162_100117016 | 209 |
| 354 | 3300013306 | Ga0163162_10063130 | Ga0163162_100631303 | 209 |
| 355 | 3300013306 | Ga0163162_10089388 | Ga0163162_100893883 | 209 |
| 356 | 3300013306 | Ga0163162_10408678 | Ga0163162_104086782 | 209 |
| 357 | 3300013306 | Ga0163162_10442966 | Ga0163162_104429663 | 209 |
| 358 | 3300013306 | Ga0163162_11368167 | Ga0163162_113681671 | 209 |
| 359 | 3300013308 | Ga0157375_10036544 | Ga0157375_100365442 | 209 |
| 360 | 3300013308 | Ga0157375_10067374 | Ga0157375_100673743 | 209 |
| 361 | 3300013308 | Ga0157375_10187203 | Ga0157375_101872032 | 209 |
| 362 | 3300013308 | Ga0157375_10194285 | Ga0157375_101942853 | 209 |
| 363 | 3300014325 | Ga0163163_10669931 | Ga0163163_106699312 | 209 |
| 364 | 3300014326 | Ga0157380_10095165 | Ga0157380_100951652 | 209 |
| 365 | 3300014745 | Ga0157377_10031949 | Ga0157377_100319492 | 209 |
| 366 | 3300014745 | Ga0157377_10593357 | Ga0157377_105933571 | 209 |
| 367 | 3300014968 | Ga0157379_10151053 | Ga0157379_101510532 | 209 |
| 368 | 3300014969 | Ga0157376_10070002 | Ga0157376_100700023 | 209 |
| 369 | 3300014969 | Ga0157376_10902375 | Ga0157376_109023751 | 209 |
| 370 | 3300014969 | Ga0157376_11079453 | Ga0157376_110794531 | 209 |
| 371 | 3300021384 | Ga0213876_10058848 | Ga0213876_100588483 | 209 |
| 372 | 3300025315 | Ga0207697_10021308 | Ga0207697_100213083 | 209 |
| 373 | 3300025899 | Ga0207642_10039985 | Ga0207642_100399852 | 209 |
| 374 | 3300025901 | Ga0207688_10006914 | Ga0207688_100069146 | 209 |
| 375 | 3300025903 | Ga0207680_10014089 | Ga0207680_100140892 | 209 |
| 376 | 3300025903 | Ga0207680_10043792 | Ga0207680_100437921 | 209 |
| 377 | 3300025907 | Ga0207645_10000307 | Ga0207645_1000030737 | 209 |
| 378 | 3300025907 | Ga0207645_10012698 | Ga0207645_100126983 | 209 |
| 379 | 3300025923 | Ga0207681_10100784 | Ga0207681_101007841 | 209 |
| 380 | 3300025926 | Ga0207659_10082309 | Ga0207659_100823092 | 209 |
| 381 | 3300025926 | Ga0207659_10087184 | Ga0207659_100871842 | 209 |
| 382 | 3300025926 | Ga0207659_10370692 | Ga0207659_103706921 | 209 |
| 383 | 3300025926 | Ga0207659_10449192 | Ga0207659_104491921 | 209 |
| 384 | 3300025932 | Ga0207690_10087131 | Ga0207690_100871312 | 209 |
| 385 | 3300025933 | Ga0207706_10036390 | Ga0207706_100363903 | 209 |
| 386 | 3300025933 | Ga0207706_10105265 | Ga0207706_101052653 | 209 |
| 387 | 3300025933 | Ga0207706_10286075 | Ga0207706_102860752 | 209 |
| 388 | 3300025934 | Ga0207686_10056406 | Ga0207686_100564063 | 209 |
| 389 | 3300025936 | Ga0207670_10105561 | Ga0207670_101055612 | 209 |
| 390 | 3300025937 | Ga0207669_10067489 | Ga0207669_100674892 | 209 |
| 391 | 3300025938 | Ga0207704_10027351 | Ga0207704_100273513 | 209 |
| 392 | 3300025938 | Ga0207704_10111592 | Ga0207704_101115922 | 209 |
| 393 | 3300025938 | Ga0207704_10139308 | Ga0207704_101393082 | 209 |
| 394 | 3300025938 | Ga0207704_10586710 | Ga0207704_105867101 | 209 |
| 395 | 3300025940 | Ga0207691_10019465 | Ga0207691_100194652 | 209 |
| 396 | 3300025942 | Ga0207689_10001757 | Ga0207689_1000175713 | 209 |
| 397 | 3300025942 | Ga0207689_10010694 | Ga0207689_100106946 | 209 |
| 398 | 3300025942 | Ga0207689_10184929 | Ga0207689_101849291 | 209 |
| 399 | 3300025960 | Ga0207651_10061582 | Ga0207651_100615822 | 209 |
| 400 | 3300025960 | Ga0207651_10100504 | Ga0207651_101005042 | 209 |
| 401 | 3300025960 | Ga0207651_10640476 | Ga0207651_106404761 | 209 |
| 402 | 3300025972 | Ga0207668_10812858 | Ga0207668_108128581 | 209 |
| 403 | 3300025981 | Ga0207640_10070650 | Ga0207640_100706502 | 209 |
| 404 | 3300025986 | Ga0207658_10235320 | Ga0207658_102353202 | 209 |
| 405 | 3300026023 | Ga0207677_10034595 | Ga0207677_100345952 | 209 |
| 406 | 3300026023 | Ga0207677_10065555 | Ga0207677_100655553 | 209 |
| 407 | 3300026023 | Ga0207677_10197317 | Ga0207677_101973171 | 209 |
| 408 | 3300026041 | Ga0207639_10093825 | Ga0207639_100938252 | 209 |
| 409 | 3300026041 | Ga0207639_11017861 | Ga0207639_110178611 | 209 |
| 410 | 3300026078 | Ga0207702_10095210 | Ga0207702_100952102 | 209 |
| 411 | 3300026089 | Ga0207648_10001972 | Ga0207648_100019727 | 209 |
| 412 | 3300026089 | Ga0207648_10282105 | Ga0207648_102821052 | 209 |
| 413 | 3300026095 | Ga0207676_10277661 | Ga0207676_102776612 | 209 |
| 414 | 3300026121 | Ga0207683_10003643 | Ga0207683_100036436 | 209 |
| 415 | 3300026121 | Ga0207683_10446589 | Ga0207683_104465891 | 209 |
| 416 | 3300028379 | Ga0268266_10543577 | Ga0268266_105435771 | 209 |
| 417 | 3300028380 | Ga0268265_10114602 | Ga0268265_101146022 | 209 |
| 418 | 3300028380 | Ga0268265_10621433 | Ga0268265_106214332 | 209 |
| 419 | 3300028381 | Ga0268264_10010600 | Ga0268264_100106005 | 209 |
| 420 | 3300028381 | Ga0268264_10079567 | Ga0268264_100795672 | 209 |
| 421 | 3300028577 | Ga0265318_10132870 | Ga0265318_101328701 | 209 |
| 422 | 3300031242 | Ga0265329_10049512 | Ga0265329_100495122 | 209 |
| 423 | 3300031711 | Ga0265314_10015531 | Ga0265314_100155313 | 209 |
| 424 | 3300035086 | Ga0373934_0109733 | Ga0373934_0109733_127_756 | 209 |
| 425 | 3300035410 | Ga0373924_0051757 | Ga0373924_0051757_454_1083 | 209 |
| 426 | 3300036401 | Ga0373937_0010916 | Ga0373937_0010916_3028_3657 | 209 |
| 427 | 3300037068 | Ga0373925_0667824 | Ga0373925_0667824_33_662 | 209 |
| 428 | 3300039437 | Ga0436365_0391663 | Ga0436365_0391663_1096_1731 | 209 |
| 429 | 3300046459 | Ga0495629_0088441 | Ga0495629_0088441_1110_1739 | 209 |
| 430 | 3300046463 | Ga0495653_0088056 | Ga0495653_0088056_1365_1994 | 209 |
| 431 | 3300046507 | Ga0495606_0004295 | Ga0495606_0004295_5837_6487 | 209 |
| 432 | 3300046514 | Ga0495618_0008041 | Ga0495618_0008041_1884_2513 | 209 |
| 433 | 3300046516 | Ga0495628_0032939 | Ga0495628_0032939_1894_2523 | 209 |
| 434 | 3300046517 | Ga0495630_0008579 | Ga0495630_0008579_248_877 | 209 |
| 435 | 3300046533 | Ga0495640_0533669 | Ga0495640_0533669_42_671 | 209 |
| 436 | 3300046536 | Ga0495587_0056600 | Ga0495587_0056600_782_1411 | 209 |
| 437 | 3300046543 | Ga0495645_0325772 | Ga0495645_0325772_12_641 | 209 |
| 438 | 3300046689 | Ga0495613_0115296 | Ga0495613_0115296_173_802 | 209 |
| 439 | 3300046809 | Ga0495600_0588901 | Ga0495600_0588901_11_640 | 209 |
| 440 | 3300047317 | Ga0495604_0195883 | Ga0495604_0195883_284_913 | 209 |
| 441 | 3300047471 | Ga0495684_0089414 | Ga0495684_0089414_211_840 | 209 |
| 442 | 3300049569 | Ga0501032_0020959 | Ga0501032_0020959_101_733 | 209 |
| 443 | 3300049570 | Ga0501033_0080023 | Ga0501033_0080023_113_745 | 209 |
| 444 | 3300049571 | Ga0501034_0057606 | Ga0501034_0057606_88_720 | 209 |
| 445 | 3300049572 | Ga0501036_0232289 | Ga0501036_0232289_70_702 | 209 |
| 446 | 3300049573 | Ga0501037_0069618 | Ga0501037_0069618_334_966 | 209 |
| 447 | 3300049574 | Ga0501038_0047026 | Ga0501038_0047026_83_715 | 209 |
| 448 | 3300049575 | Ga0501039_0051374 | Ga0501039_0051374_293_925 | 209 |
| 449 | 3300049579 | Ga0501043_0070025 | Ga0501043_0070025_627_1259 | 209 |
| 450 | 3300049581 | Ga0501047_0151868 | Ga0501047_0151868_1449_2081 | 209 |
| 451 | 3300049582 | Ga0501048_0570906 | Ga0501048_0570906_47_679 | 209 |
| 452 | 3300049822 | Ga0501035_0011447 | Ga0501035_0011447_6987_7619 | 209 |
| 453 | 3300049823 | Ga0501044_0004005 | Ga0501044_0004005_11431_12063 | 209 |
| 454 | iso_pu_bacteria | 2919683626 | 2919688326 | 209 |
| 455 | 3300005293 | Ga0065715_10193573 | Ga0065715_101935732 | 210 |
| 456 | 3300005295 | Ga0065707_10271268 | Ga0065707_102712681 | 210 |
| 457 | 3300005327 | Ga0070658_10265083 | Ga0070658_102650832 | 210 |
| 458 | 3300005329 | Ga0070683_100216563 | Ga0070683_1002165633 | 210 |
| 459 | 3300005330 | Ga0070690_100146378 | Ga0070690_1001463782 | 210 |
| 460 | 3300005331 | Ga0070670_100541123 | Ga0070670_1005411232 | 210 |
| 461 | 3300005335 | Ga0070666_10084019 | Ga0070666_100840193 | 210 |
| 462 | 3300005336 | Ga0070680_100040658 | Ga0070680_1000406585 | 210 |
| 463 | 3300005337 | Ga0070682_100036250 | Ga0070682_1000362501 | 210 |
| 464 | 3300005338 | Ga0068868_100146541 | Ga0068868_1001465412 | 210 |
| 465 | 3300005339 | Ga0070660_100015326 | Ga0070660_1000153263 | 210 |
| 466 | 3300005344 | Ga0070661_100111538 | Ga0070661_1001115382 | 210 |
| 467 | 3300005344 | Ga0070661_100207403 | Ga0070661_1002074033 | 210 |
| 468 | 3300005353 | Ga0070669_100044130 | Ga0070669_1000441301 | 210 |
| 469 | 3300005355 | Ga0070671_100169381 | Ga0070671_1001693811 | 210 |
| 470 | 3300005364 | Ga0070673_100464888 | Ga0070673_1004648881 | 210 |
| 471 | 3300005366 | Ga0070659_100066213 | Ga0070659_1000662133 | 210 |
| 472 | 3300005436 | Ga0070713_100901584 | Ga0070713_1009015841 | 210 |
| 473 | 3300005456 | Ga0070678_100386384 | Ga0070678_1003863842 | 210 |
| 474 | 3300005457 | Ga0070662_100171982 | Ga0070662_1001719821 | 210 |
| 475 | 3300005458 | Ga0070681_10815032 | Ga0070681_108150322 | 210 |
| 476 | 3300005459 | Ga0068867_100081735 | Ga0068867_1000817355 | 210 |
| 477 | 3300005459 | Ga0068867_100212274 | Ga0068867_1002122743 | 210 |
| 478 | 3300005530 | Ga0070679_100002258 | Ga0070679_10000225813 | 210 |
| 479 | 3300005530 | Ga0070679_100057506 | Ga0070679_1000575064 | 210 |
| 480 | 3300005530 | Ga0070679_100621805 | Ga0070679_1006218052 | 210 |
| 481 | 3300005535 | Ga0070684_100015813 | Ga0070684_1000158134 | 210 |
| 482 | 3300005539 | Ga0068853_100052216 | Ga0068853_1000522164 | 210 |
| 483 | 3300005547 | Ga0070693_100172521 | Ga0070693_1001725212 | 210 |
| 484 | 3300005563 | Ga0068855_100059775 | Ga0068855_1000597752 | 210 |
| 485 | 3300005563 | Ga0068855_100129917 | Ga0068855_1001299175 | 210 |
| 486 | 3300005563 | Ga0068855_100318902 | Ga0068855_1003189023 | 210 |
| 487 | 3300005564 | Ga0070664_100065607 | Ga0070664_1000656074 | 210 |
| 488 | 3300005577 | Ga0068857_100176284 | Ga0068857_1001762842 | 210 |
| 489 | 3300005577 | Ga0068857_100492779 | Ga0068857_1004927792 | 210 |
| 490 | 3300005578 | Ga0068854_100201925 | Ga0068854_1002019252 | 210 |
| 491 | 3300005578 | Ga0068854_100356570 | Ga0068854_1003565703 | 210 |
| 492 | 3300005614 | Ga0068856_100046172 | Ga0068856_1000461721 | 210 |
| 493 | 3300005614 | Ga0068856_100290051 | Ga0068856_1002900512 | 210 |
| 494 | 3300005616 | Ga0068852_100001067 | Ga0068852_1000010673 | 210 |
| 495 | 3300005616 | Ga0068852_100140582 | Ga0068852_1001405821 | 210 |
| 496 | 3300005616 | Ga0068852_100189766 | Ga0068852_1001897662 | 210 |
| 497 | 3300005616 | Ga0068852_100586261 | Ga0068852_1005862612 | 210 |
| 498 | 3300005618 | Ga0068864_100809383 | Ga0068864_1008093832 | 210 |
| 499 | 3300005719 | Ga0068861_100028443 | Ga0068861_1000284432 | 210 |
| 500 | 3300005834 | Ga0068851_10093855 | Ga0068851_100938552 | 210 |
| 501 | 3300005843 | Ga0068860_100220869 | Ga0068860_1002208692 | 210 |
| 502 | 3300005985 | Ga0081539_10000714 | Ga0081539_1000071480 | 210 |
| 503 | 3300006237 | Ga0097621_100636901 | Ga0097621_1006369011 | 210 |
| 504 | 3300006358 | Ga0068871_100381121 | Ga0068871_1003811212 | 210 |
| 505 | 3300006358 | Ga0068871_100493079 | Ga0068871_1004930791 | 210 |
| 506 | 3300009093 | Ga0105240_10115290 | Ga0105240_101152901 | 210 |
| 507 | 3300009545 | Ga0105237_10035034 | Ga0105237_100350344 | 210 |
| 508 | 3300009551 | Ga0105238_10002413 | Ga0105238_100024138 | 210 |
| 509 | 3300009553 | Ga0105249_10047364 | Ga0105249_100473642 | 210 |
| 510 | 3300013100 | Ga0157373_10003026 | Ga0157373_1000302611 | 210 |
| 511 | 3300013100 | Ga0157373_10059535 | Ga0157373_100595353 | 210 |
| 512 | 3300013100 | Ga0157373_10106400 | Ga0157373_101064002 | 210 |
| 513 | 3300013100 | Ga0157373_10487325 | Ga0157373_104873252 | 210 |
| 514 | 3300013102 | Ga0157371_10005951 | Ga0157371_100059515 | 210 |
| 515 | 3300013102 | Ga0157371_10095147 | Ga0157371_100951472 | 210 |
| 516 | 3300013102 | Ga0157371_10268800 | Ga0157371_102688002 | 210 |
| 517 | 3300013102 | Ga0157371_10301071 | Ga0157371_103010711 | 210 |
| 518 | 3300013104 | Ga0157370_10000651 | Ga0157370_100006513 | 210 |
| 519 | 3300013104 | Ga0157370_10008098 | Ga0157370_100080989 | 210 |
| 520 | 3300013104 | Ga0157370_10016368 | Ga0157370_100163683 | 210 |
| 521 | 3300013104 | Ga0157370_10376078 | Ga0157370_103760782 | 210 |
| 522 | 3300013104 | Ga0157370_10434293 | Ga0157370_104342932 | 210 |
| 523 | 3300013105 | Ga0157369_10035829 | Ga0157369_100358292 | 210 |
| 524 | 3300013105 | Ga0157369_10157274 | Ga0157369_101572743 | 210 |
| 525 | 3300013105 | Ga0157369_10183254 | Ga0157369_101832542 | 210 |
| 526 | 3300013105 | Ga0157369_10372791 | Ga0157369_103727912 | 210 |
| 527 | 3300013296 | Ga0157374_10021940 | Ga0157374_100219404 | 210 |
| 528 | 3300013296 | Ga0157374_10192637 | Ga0157374_101926372 | 210 |
| 529 | 3300013296 | Ga0157374_10946476 | Ga0157374_109464761 | 210 |
| 530 | 3300013297 | Ga0157378_10854318 | Ga0157378_108543182 | 210 |
| 531 | 3300013297 | Ga0157378_11265446 | Ga0157378_112654461 | 210 |
| 532 | 3300013306 | Ga0163162_10060685 | Ga0163162_100606852 | 210 |
| 533 | 3300013307 | Ga0157372_10001117 | Ga0157372_1000111713 | 210 |
| 534 | 3300013307 | Ga0157372_10005797 | Ga0157372_100057977 | 210 |
| 535 | 3300013307 | Ga0157372_10026752 | Ga0157372_100267523 | 210 |
| 536 | 3300013307 | Ga0157372_10226138 | Ga0157372_102261382 | 210 |
| 537 | 3300013307 | Ga0157372_10653420 | Ga0157372_106534202 | 210 |
| 538 | 3300014968 | Ga0157379_10450116 | Ga0157379_104501161 | 210 |
| 539 | 3300014969 | Ga0157376_10450134 | Ga0157376_104501342 | 210 |
| 540 | 3300017792 | Ga0163161_10364283 | Ga0163161_103642831 | 210 |
| 541 | 3300025315 | Ga0207697_10113767 | Ga0207697_101137671 | 210 |
| 542 | 3300025904 | Ga0207647_10004913 | Ga0207647_100049137 | 210 |
| 543 | 3300025904 | Ga0207647_10188660 | Ga0207647_101886602 | 210 |
| 544 | 3300025909 | Ga0207705_10056453 | Ga0207705_100564531 | 210 |
| 545 | 3300025917 | Ga0207660_10028421 | Ga0207660_100284215 | 210 |
| 546 | 3300025919 | Ga0207657_10004767 | Ga0207657_1000476710 | 210 |
| 547 | 3300025919 | Ga0207657_10127034 | Ga0207657_101270344 | 210 |
| 548 | 3300025920 | Ga0207649_10078523 | Ga0207649_100785231 | 210 |
| 549 | 3300025920 | Ga0207649_10736484 | Ga0207649_107364841 | 210 |
| 550 | 3300025921 | Ga0207652_10096447 | Ga0207652_100964473 | 210 |
| 551 | 3300025921 | Ga0207652_10289767 | Ga0207652_102897673 | 210 |
| 552 | 3300025924 | Ga0207694_10411104 | Ga0207694_104111042 | 210 |
| 553 | 3300025926 | Ga0207659_10047282 | Ga0207659_100472823 | 210 |
| 554 | 3300025931 | Ga0207644_10089622 | Ga0207644_100896221 | 210 |
| 555 | 3300025931 | Ga0207644_10161227 | Ga0207644_101612272 | 210 |
| 556 | 3300025932 | Ga0207690_10100285 | Ga0207690_101002852 | 210 |
| 557 | 3300025933 | Ga0207706_10026330 | Ga0207706_100263306 | 210 |
| 558 | 3300025940 | Ga0207691_10782327 | Ga0207691_107823271 | 210 |
| 559 | 3300025945 | Ga0207679_10281138 | Ga0207679_102811382 | 210 |
| 560 | 3300025945 | Ga0207679_10772856 | Ga0207679_107728561 | 210 |
| 561 | 3300025949 | Ga0207667_10002405 | Ga0207667_1000240521 | 210 |
| 562 | 3300025949 | Ga0207667_10225049 | Ga0207667_102250493 | 210 |
| 563 | 3300025949 | Ga0207667_10298385 | Ga0207667_102983852 | 210 |
| 564 | 3300025949 | Ga0207667_10378758 | Ga0207667_103787581 | 210 |
| 565 | 3300025960 | Ga0207651_10128569 | Ga0207651_101285691 | 210 |
| 566 | 3300025961 | Ga0207712_10038438 | Ga0207712_100384382 | 210 |
| 567 | 3300025981 | Ga0207640_10207810 | Ga0207640_102078103 | 210 |
| 568 | 3300026023 | Ga0207677_10081127 | Ga0207677_100811272 | 210 |
| 569 | 3300026041 | Ga0207639_10304730 | Ga0207639_103047302 | 210 |
| 570 | 3300026075 | Ga0207708_10446038 | Ga0207708_104460381 | 210 |
| 571 | 3300026089 | Ga0207648_10107946 | Ga0207648_101079465 | 210 |
| 572 | 3300026089 | Ga0207648_10544182 | Ga0207648_105441822 | 210 |
| 573 | 3300026116 | Ga0207674_10004889 | Ga0207674_100048897 | 210 |
| 574 | 3300026116 | Ga0207674_10007799 | Ga0207674_100077993 | 210 |
| 575 | 3300026116 | Ga0207674_10175510 | Ga0207674_101755104 | 210 |
| 576 | 3300026121 | Ga0207683_10268077 | Ga0207683_102680772 | 210 |
| 577 | 3300026142 | Ga0207698_10003337 | Ga0207698_100033375 | 210 |
| 578 | 3300026142 | Ga0207698_10075259 | Ga0207698_100752592 | 210 |
| 579 | 3300026142 | Ga0207698_10357958 | Ga0207698_103579581 | 210 |
| 580 | 3300031251 | Ga0265327_10123244 | Ga0265327_101232442 | 210 |
| 581 | 3300035692 | Ga0373935_0138940 | Ga0373935_0138940_457_1122 | 210 |
| 582 | 3300037312 | Ga0395899_0323287 | Ga0395899_0323287_341_976 | 210 |
| 583 | 3300037418 | Ga0395900_0290859 | Ga0395900_0290859_453_1088 | 210 |
| 584 | 3300037466 | Ga0395898_0176571 | Ga0395898_0176571_35_670 | 210 |
| 585 | 3300037471 | Ga0395905_0194926 | Ga0395905_0194926_967_1602 | 210 |
| 586 | 3300044735 | Ga0466968_0053808 | Ga0466968_0053808_754_1503 | 210 |
| 587 | 3300044765 | Ga0466970_0007416 | Ga0466970_0007416_3865_4614 | 210 |
| 588 | 3300047472 | Ga0495686_0028548 | Ga0495686_0028548_446_1096 | 210 |
| 589 | 3300049571 | Ga0501034_0277269 | Ga0501034_0277269_435_1139 | 210 |
| 590 | 3300049571 | Ga0501034_0474125 | Ga0501034_0474125_24_665 | 210 |
| 591 | 3300049571 | Ga0501034_0492683 | Ga0501034_0492683_245_880 | 210 |
| 592 | 3300049572 | Ga0501036_0703330 | Ga0501036_0703330_171_806 | 210 |
| 593 | 3300049573 | Ga0501037_0332009 | Ga0501037_0332009_310_951 | 210 |
| 594 | 3300049579 | Ga0501043_0092913 | Ga0501043_0092913_598_1233 | 210 |
| 595 | 3300049744 | Ga0501083_0152270 | Ga0501083_0152270_689_1333 | 210 |
| 596 | 3300049823 | Ga0501044_0407282 | Ga0501044_0407282_356_991 | 210 |
| 597 | 3300050511 | nmdc:mga08y16_596562_c1 | nmdc:mga08y16_596562_c1_209_847 | 210 |
| 598 | 3300003316 | rootH1_10037794 | rootH1_100377942 | 211 |
| 599 | 3300003320 | rootH2_10016021 | rootH2_100160217 | 211 |
| 600 | 3300003322 | rootL2_10072197 | rootL2_100721972 | 211 |
| 601 | 3300003323 | rootH1_10013386 | rootH1_1001338639 | 211 |
| 602 | 3300005289 | Ga0065704_10088208 | Ga0065704_100882082 | 211 |
| 603 | 3300005327 | Ga0070658_10034177 | Ga0070658_100341772 | 211 |
| 604 | 3300005327 | Ga0070658_10047119 | Ga0070658_100471195 | 211 |
| 605 | 3300005327 | Ga0070658_10055349 | Ga0070658_100553492 | 211 |
| 606 | 3300005327 | Ga0070658_10270126 | Ga0070658_102701262 | 211 |
| 607 | 3300005328 | Ga0070676_10666931 | Ga0070676_106669311 | 211 |
| 608 | 3300005329 | Ga0070683_100004806 | Ga0070683_1000048069 | 211 |
| 609 | 3300005329 | Ga0070683_100005679 | Ga0070683_1000056794 | 211 |
| 610 | 3300005329 | Ga0070683_100034348 | Ga0070683_1000343482 | 211 |
| 611 | 3300005329 | Ga0070683_100051414 | Ga0070683_1000514142 | 211 |
| 612 | 3300005331 | Ga0070670_100478408 | Ga0070670_1004784081 | 211 |
| 613 | 3300005334 | Ga0068869_100050141 | Ga0068869_1000501413 | 211 |
| 614 | 3300005334 | Ga0068869_100264094 | Ga0068869_1002640942 | 211 |
| 615 | 3300005336 | Ga0070680_100028967 | Ga0070680_1000289675 | 211 |
| 616 | 3300005336 | Ga0070680_100035203 | Ga0070680_1000352034 | 211 |
| 617 | 3300005336 | Ga0070680_100043701 | Ga0070680_1000437013 | 211 |
| 618 | 3300005337 | Ga0070682_100039572 | Ga0070682_1000395723 | 211 |
| 619 | 3300005338 | Ga0068868_100065301 | Ga0068868_1000653013 | 211 |
| 620 | 3300005338 | Ga0068868_100371666 | Ga0068868_1003716662 | 211 |
| 621 | 3300005339 | Ga0070660_100050004 | Ga0070660_1000500042 | 211 |
| 622 | 3300005339 | Ga0070660_100207768 | Ga0070660_1002077682 | 211 |
| 623 | 3300005340 | Ga0070689_100006521 | Ga0070689_1000065214 | 211 |
| 624 | 3300005340 | Ga0070689_100100417 | Ga0070689_1001004172 | 211 |
| 625 | 3300005341 | Ga0070691_10104069 | Ga0070691_101040692 | 211 |
| 626 | 3300005343 | Ga0070687_100018462 | Ga0070687_1000184621 | 211 |
| 627 | 3300005344 | Ga0070661_100002893 | Ga0070661_1000028935 | 211 |
| 628 | 3300005344 | Ga0070661_100003239 | Ga0070661_1000032399 | 211 |
| 629 | 3300005347 | Ga0070668_100233614 | Ga0070668_1002336142 | 211 |
| 630 | 3300005356 | Ga0070674_100456778 | Ga0070674_1004567782 | 211 |
| 631 | 3300005364 | Ga0070673_100064191 | Ga0070673_1000641913 | 211 |
| 632 | 3300005364 | Ga0070673_100179835 | Ga0070673_1001798353 | 211 |
| 633 | 3300005365 | Ga0070688_100008347 | Ga0070688_1000083472 | 211 |
| 634 | 3300005366 | Ga0070659_100023009 | Ga0070659_1000230094 | 211 |
| 635 | 3300005441 | Ga0070700_100448778 | Ga0070700_1004487781 | 211 |
| 636 | 3300005455 | Ga0070663_100025763 | Ga0070663_1000257634 | 211 |
| 637 | 3300005455 | Ga0070663_100049825 | Ga0070663_1000498251 | 211 |
| 638 | 3300005455 | Ga0070663_100258429 | Ga0070663_1002584292 | 211 |
| 639 | 3300005456 | Ga0070678_100007828 | Ga0070678_1000078282 | 211 |
| 640 | 3300005457 | Ga0070662_100004115 | Ga0070662_1000041155 | 211 |
| 641 | 3300005457 | Ga0070662_100027222 | Ga0070662_1000272223 | 211 |
| 642 | 3300005458 | Ga0070681_10046721 | Ga0070681_100467213 | 211 |
| 643 | 3300005458 | Ga0070681_10056362 | Ga0070681_100563622 | 211 |
| 644 | 3300005458 | Ga0070681_10058585 | Ga0070681_100585853 | 211 |
| 645 | 3300005458 | Ga0070681_10445960 | Ga0070681_104459601 | 211 |
| 646 | 3300005458 | Ga0070681_10915985 | Ga0070681_109159851 | 211 |
| 647 | 3300005459 | Ga0068867_100277877 | Ga0068867_1002778771 | 211 |
| 648 | 3300005459 | Ga0068867_100366159 | Ga0068867_1003661591 | 211 |
| 649 | 3300005530 | Ga0070679_100000065 | Ga0070679_1000000658 | 211 |
| 650 | 3300005530 | Ga0070679_100051387 | Ga0070679_1000513874 | 211 |
| 651 | 3300005530 | Ga0070679_100080308 | Ga0070679_1000803082 | 211 |
| 652 | 3300005530 | Ga0070679_100212593 | Ga0070679_1002125932 | 211 |
| 653 | 3300005535 | Ga0070684_100003838 | Ga0070684_10000383810 | 211 |
| 654 | 3300005535 | Ga0070684_100004617 | Ga0070684_1000046179 | 211 |
| 655 | 3300005536 | Ga0070697_101156271 | Ga0070697_1011562711 | 211 |
| 656 | 3300005539 | Ga0068853_100008100 | Ga0068853_1000081005 | 211 |
| 657 | 3300005539 | Ga0068853_100014757 | Ga0068853_1000147573 | 211 |
| 658 | 3300005539 | Ga0068853_100016341 | Ga0068853_1000163416 | 211 |
| 659 | 3300005539 | Ga0068853_100278507 | Ga0068853_1002785071 | 211 |
| 660 | 3300005543 | Ga0070672_100058136 | Ga0070672_1000581362 | 211 |
| 661 | 3300005543 | Ga0070672_100592888 | Ga0070672_1005928881 | 211 |
| 662 | 3300005544 | Ga0070686_100190493 | Ga0070686_1001904931 | 211 |
| 663 | 3300005563 | Ga0068855_100003936 | Ga0068855_10000393613 | 211 |
| 664 | 3300005563 | Ga0068855_100040646 | Ga0068855_1000406465 | 211 |
| 665 | 3300005563 | Ga0068855_100071606 | Ga0068855_1000716064 | 211 |
| 666 | 3300005563 | Ga0068855_100102170 | Ga0068855_1001021704 | 211 |
| 667 | 3300005563 | Ga0068855_100207033 | Ga0068855_1002070332 | 211 |
| 668 | 3300005563 | Ga0068855_100662720 | Ga0068855_1006627201 | 211 |
| 669 | 3300005564 | Ga0070664_100008799 | Ga0070664_1000087995 | 211 |
| 670 | 3300005577 | Ga0068857_100007481 | Ga0068857_1000074814 | 211 |
| 671 | 3300005577 | Ga0068857_100035569 | Ga0068857_1000355694 | 211 |
| 672 | 3300005577 | Ga0068857_100140525 | Ga0068857_1001405252 | 211 |
| 673 | 3300005577 | Ga0068857_100170536 | Ga0068857_1001705363 | 211 |
| 674 | 3300005577 | Ga0068857_100452784 | Ga0068857_1004527842 | 211 |
| 675 | 3300005578 | Ga0068854_100056669 | Ga0068854_1000566692 | 211 |
| 676 | 3300005578 | Ga0068854_100525611 | Ga0068854_1005256112 | 211 |
| 677 | 3300005614 | Ga0068856_100024901 | Ga0068856_1000249012 | 211 |
| 678 | 3300005614 | Ga0068856_100157846 | Ga0068856_1001578462 | 211 |
| 679 | 3300005616 | Ga0068852_100002354 | Ga0068852_10000235411 | 211 |
| 680 | 3300005616 | Ga0068852_100404200 | Ga0068852_1004042002 | 211 |
| 681 | 3300005616 | Ga0068852_100421151 | Ga0068852_1004211511 | 211 |
| 682 | 3300005616 | Ga0068852_100749958 | Ga0068852_1007499582 | 211 |
| 683 | 3300005617 | Ga0068859_100035397 | Ga0068859_1000353971 | 211 |
| 684 | 3300005617 | Ga0068859_100045776 | Ga0068859_1000457763 | 211 |
| 685 | 3300005618 | Ga0068864_100077069 | Ga0068864_1000770691 | 211 |
| 686 | 3300005618 | Ga0068864_100672912 | Ga0068864_1006729121 | 211 |
| 687 | 3300005834 | Ga0068851_10215517 | Ga0068851_102155171 | 211 |
| 688 | 3300005841 | Ga0068863_100328903 | Ga0068863_1003289031 | 211 |
| 689 | 3300005843 | Ga0068860_100025430 | Ga0068860_1000254302 | 211 |
| 690 | 3300005844 | Ga0068862_100012633 | Ga0068862_1000126332 | 211 |
| 691 | 3300006844 | Ga0075428_100064824 | Ga0075428_1000648243 | 211 |
| 692 | 3300006931 | Ga0097620_100035399 | Ga0097620_1000353991 | 211 |
| 693 | 3300006931 | Ga0097620_100045776 | Ga0097620_1000457763 | 211 |
| 694 | 3300006931 | Ga0097620_100896913 | Ga0097620_1008969131 | 211 |
| 695 | 3300009093 | Ga0105240_10000383 | Ga0105240_100003834 | 211 |
| 696 | 3300009093 | Ga0105240_10011676 | Ga0105240_1001167616 | 211 |
| 697 | 3300009093 | Ga0105240_10014537 | Ga0105240_1001453710 | 211 |
| 698 | 3300009094 | Ga0111539_10024746 | Ga0111539_100247465 | 211 |
| 699 | 3300009174 | Ga0105241_10010223 | Ga0105241_100102236 | 211 |
| 700 | 3300009174 | Ga0105241_10220114 | Ga0105241_102201142 | 211 |
| 701 | 3300009176 | Ga0105242_10777737 | Ga0105242_107777371 | 211 |
| 702 | 3300009545 | Ga0105237_10003156 | Ga0105237_1000315618 | 211 |
| 703 | 3300009545 | Ga0105237_10003946 | Ga0105237_100039469 | 211 |
| 704 | 3300009553 | Ga0105249_10697993 | Ga0105249_106979932 | 211 |
| 705 | 3300010375 | Ga0105239_10003044 | Ga0105239_100030448 | 211 |
| 706 | 3300010375 | Ga0105239_10009415 | Ga0105239_1000941510 | 211 |
| 707 | 3300010375 | Ga0105239_10070884 | Ga0105239_100708842 | 211 |
| 708 | 3300010375 | Ga0105239_10119128 | Ga0105239_101191283 | 211 |
| 709 | 3300011119 | Ga0105246_10227206 | Ga0105246_102272061 | 211 |
| 710 | 3300013100 | Ga0157373_10016192 | Ga0157373_100161923 | 211 |
| 711 | 3300013100 | Ga0157373_10032989 | Ga0157373_100329893 | 211 |
| 712 | 3300013100 | Ga0157373_10047207 | Ga0157373_100472072 | 211 |
| 713 | 3300013100 | Ga0157373_10063514 | Ga0157373_100635142 | 211 |
| 714 | 3300013100 | Ga0157373_10089149 | Ga0157373_100891492 | 211 |
| 715 | 3300013100 | Ga0157373_10126561 | Ga0157373_101265612 | 211 |
| 716 | 3300013102 | Ga0157371_10022566 | Ga0157371_100225663 | 211 |
| 717 | 3300013102 | Ga0157371_10046908 | Ga0157371_100469083 | 211 |
| 718 | 3300013102 | Ga0157371_10073653 | Ga0157371_100736532 | 211 |
| 719 | 3300013102 | Ga0157371_10274289 | Ga0157371_102742892 | 211 |
| 720 | 3300013104 | Ga0157370_10042948 | Ga0157370_100429482 | 211 |
| 721 | 3300013105 | Ga0157369_10014417 | Ga0157369_100144175 | 211 |
| 722 | 3300013105 | Ga0157369_10030664 | Ga0157369_100306646 | 211 |
| 723 | 3300013105 | Ga0157369_10042173 | Ga0157369_100421735 | 211 |
| 724 | 3300013105 | Ga0157369_10297523 | Ga0157369_102975231 | 211 |
| 725 | 3300013105 | Ga0157369_10392266 | Ga0157369_103922662 | 211 |
| 726 | 3300013296 | Ga0157374_10003778 | Ga0157374_100037789 | 211 |
| 727 | 3300013296 | Ga0157374_10860394 | Ga0157374_108603941 | 211 |
| 728 | 3300013297 | Ga0157378_10095326 | Ga0157378_100953262 | 211 |
| 729 | 3300013297 | Ga0157378_10355512 | Ga0157378_103555122 | 211 |
| 730 | 3300013306 | Ga0163162_10056799 | Ga0163162_100567993 | 211 |
| 731 | 3300013307 | Ga0157372_10018334 | Ga0157372_100183347 | 211 |
| 732 | 3300013307 | Ga0157372_10123156 | Ga0157372_101231564 | 211 |
| 733 | 3300013307 | Ga0157372_10151232 | Ga0157372_101512322 | 211 |
| 734 | 3300013307 | Ga0157372_10193760 | Ga0157372_101937603 | 211 |
| 735 | 3300013308 | Ga0157375_10013929 | Ga0157375_100139295 | 211 |
| 736 | 3300013308 | Ga0157375_10546869 | Ga0157375_105468691 | 211 |
| 737 | 3300013308 | Ga0157375_10733864 | Ga0157375_107338642 | 211 |
| 738 | 3300014325 | Ga0163163_10000781 | Ga0163163_1000078125 | 211 |
| 739 | 3300014326 | Ga0157380_10050034 | Ga0157380_100500342 | 211 |
| 740 | 3300014326 | Ga0157380_10320471 | Ga0157380_103204712 | 211 |
| 741 | 3300014745 | Ga0157377_10004114 | Ga0157377_100041142 | 211 |
| 742 | 3300014745 | Ga0157377_10018364 | Ga0157377_100183642 | 211 |
| 743 | 3300014745 | Ga0157377_10036746 | Ga0157377_100367461 | 211 |
| 744 | 3300014969 | Ga0157376_10111589 | Ga0157376_101115892 | 211 |
| 745 | 3300014969 | Ga0157376_10779739 | Ga0157376_107797391 | 211 |
| 746 | 3300017792 | Ga0163161_10647683 | Ga0163161_106476832 | 211 |
| 747 | 3300025315 | Ga0207697_10086287 | Ga0207697_100862871 | 211 |
| 748 | 3300025901 | Ga0207688_10380827 | Ga0207688_103808272 | 211 |
| 749 | 3300025904 | Ga0207647_10069595 | Ga0207647_100695951 | 211 |
| 750 | 3300025909 | Ga0207705_10011305 | Ga0207705_100113053 | 211 |
| 751 | 3300025909 | Ga0207705_10025055 | Ga0207705_100250552 | 211 |
| 752 | 3300025909 | Ga0207705_10214283 | Ga0207705_102142831 | 211 |
| 753 | 3300025912 | Ga0207707_10009918 | Ga0207707_100099184 | 211 |
| 754 | 3300025912 | Ga0207707_10153898 | Ga0207707_101538983 | 211 |
| 755 | 3300025912 | Ga0207707_10275044 | Ga0207707_102750442 | 211 |
| 756 | 3300025913 | Ga0207695_10000300 | Ga0207695_1000030069 | 211 |
| 757 | 3300025913 | Ga0207695_10000483 | Ga0207695_1000048320 | 211 |
| 758 | 3300025913 | Ga0207695_10005507 | Ga0207695_100055073 | 211 |
| 759 | 3300025913 | Ga0207695_10018867 | Ga0207695_100188671 | 211 |
| 760 | 3300025914 | Ga0207671_10002537 | Ga0207671_100025375 | 211 |
| 761 | 3300025914 | Ga0207671_10068447 | Ga0207671_100684472 | 211 |
| 762 | 3300025917 | Ga0207660_10112411 | Ga0207660_101124111 | 211 |
| 763 | 3300025917 | Ga0207660_10145831 | Ga0207660_101458312 | 211 |
| 764 | 3300025917 | Ga0207660_10245987 | Ga0207660_102459872 | 211 |
| 765 | 3300025918 | Ga0207662_10045192 | Ga0207662_100451921 | 211 |
| 766 | 3300025919 | Ga0207657_10033705 | Ga0207657_100337053 | 211 |
| 767 | 3300025919 | Ga0207657_10034417 | Ga0207657_100344172 | 211 |
| 768 | 3300025919 | Ga0207657_10250495 | Ga0207657_102504952 | 211 |
| 769 | 3300025920 | Ga0207649_10003179 | Ga0207649_100031793 | 211 |
| 770 | 3300025920 | Ga0207649_10009537 | Ga0207649_100095372 | 211 |
| 771 | 3300025921 | Ga0207652_10000013 | Ga0207652_1000001375 | 211 |
| 772 | 3300025921 | Ga0207652_10000055 | Ga0207652_1000005532 | 211 |
| 773 | 3300025921 | Ga0207652_10005333 | Ga0207652_100053336 | 211 |
| 774 | 3300025921 | Ga0207652_10049054 | Ga0207652_100490544 | 211 |
| 775 | 3300025921 | Ga0207652_10056510 | Ga0207652_100565105 | 211 |
| 776 | 3300025923 | Ga0207681_10028570 | Ga0207681_100285702 | 211 |
| 777 | 3300025923 | Ga0207681_10948709 | Ga0207681_109487091 | 211 |
| 778 | 3300025926 | Ga0207659_10238393 | Ga0207659_102383931 | 211 |
| 779 | 3300025933 | Ga0207706_10309322 | Ga0207706_103093222 | 211 |
| 780 | 3300025936 | Ga0207670_10026860 | Ga0207670_100268601 | 211 |
| 781 | 3300025936 | Ga0207670_10260006 | Ga0207670_102600062 | 211 |
| 782 | 3300025940 | Ga0207691_10005556 | Ga0207691_100055569 | 211 |
| 783 | 3300025940 | Ga0207691_10012090 | Ga0207691_1001209010 | 211 |
| 784 | 3300025940 | Ga0207691_10399476 | Ga0207691_103994762 | 211 |
| 785 | 3300025942 | Ga0207689_10069897 | Ga0207689_100698971 | 211 |
| 786 | 3300025942 | Ga0207689_10075838 | Ga0207689_100758383 | 211 |
| 787 | 3300025942 | Ga0207689_10146892 | Ga0207689_101468922 | 211 |
| 788 | 3300025944 | Ga0207661_10002725 | Ga0207661_100027255 | 211 |
| 789 | 3300025944 | Ga0207661_10095918 | Ga0207661_100959183 | 211 |
| 790 | 3300025945 | Ga0207679_10000611 | Ga0207679_1000061125 | 211 |
| 791 | 3300025945 | Ga0207679_10076548 | Ga0207679_100765481 | 211 |
| 792 | 3300025949 | Ga0207667_10003410 | Ga0207667_1000341013 | 211 |
| 793 | 3300025949 | Ga0207667_10010537 | Ga0207667_100105375 | 211 |
| 794 | 3300025949 | Ga0207667_10076885 | Ga0207667_100768853 | 211 |
| 795 | 3300025949 | Ga0207667_10084648 | Ga0207667_100846484 | 211 |
| 796 | 3300025949 | Ga0207667_10109234 | Ga0207667_101092343 | 211 |
| 797 | 3300025960 | Ga0207651_10333897 | Ga0207651_103338972 | 211 |
| 798 | 3300025972 | Ga0207668_10531062 | Ga0207668_105310621 | 211 |
| 799 | 3300025981 | Ga0207640_10056728 | Ga0207640_100567284 | 211 |
| 800 | 3300025981 | Ga0207640_10159744 | Ga0207640_101597441 | 211 |
| 801 | 3300025981 | Ga0207640_10508330 | Ga0207640_105083302 | 211 |
| 802 | 3300025981 | Ga0207640_10652598 | Ga0207640_106525981 | 211 |
| 803 | 3300025981 | Ga0207640_10699250 | Ga0207640_106992501 | 211 |
| 804 | 3300026023 | Ga0207677_10041695 | Ga0207677_100416951 | 211 |
| 805 | 3300026023 | Ga0207677_10247001 | Ga0207677_102470012 | 211 |
| 806 | 3300026041 | Ga0207639_10011601 | Ga0207639_100116012 | 211 |
| 807 | 3300026041 | Ga0207639_10278125 | Ga0207639_102781252 | 211 |
| 808 | 3300026067 | Ga0207678_10057112 | Ga0207678_100571124 | 211 |
| 809 | 3300026067 | Ga0207678_10101165 | Ga0207678_101011651 | 211 |
| 810 | 3300026067 | Ga0207678_10257067 | Ga0207678_102570672 | 211 |
| 811 | 3300026078 | Ga0207702_10022070 | Ga0207702_100220702 | 211 |
| 812 | 3300026078 | Ga0207702_10135069 | Ga0207702_101350692 | 211 |
| 813 | 3300026088 | Ga0207641_10395674 | Ga0207641_103956741 | 211 |
| 814 | 3300026089 | Ga0207648_10353461 | Ga0207648_103534611 | 211 |
| 815 | 3300026095 | Ga0207676_10060852 | Ga0207676_100608523 | 211 |
| 816 | 3300026095 | Ga0207676_10064360 | Ga0207676_100643602 | 211 |
| 817 | 3300026095 | Ga0207676_10114867 | Ga0207676_101148674 | 211 |
| 818 | 3300026095 | Ga0207676_10604538 | Ga0207676_106045381 | 211 |
| 819 | 3300026116 | Ga0207674_10002454 | Ga0207674_1000245414 | 211 |
| 820 | 3300026116 | Ga0207674_10041435 | Ga0207674_100414355 | 211 |
| 821 | 3300026116 | Ga0207674_10056401 | Ga0207674_100564013 | 211 |
| 822 | 3300026118 | Ga0207675_100004652 | Ga0207675_1000046522 | 211 |
| 823 | 3300026142 | Ga0207698_10004845 | Ga0207698_100048458 | 211 |
| 824 | 3300026142 | Ga0207698_10309951 | Ga0207698_103099511 | 211 |
| 825 | 3300026142 | Ga0207698_10421392 | Ga0207698_104213921 | 211 |
| 826 | 3300028380 | Ga0268265_10145454 | Ga0268265_101454542 | 211 |
| 827 | 3300031456 | Ga0307513_10624292 | Ga0307513_106242921 | 211 |
| 828 | 3300031507 | Ga0307509_10359178 | Ga0307509_103591782 | 211 |
| 829 | 3300035170 | Ga0373943_0135060 | Ga0373943_0135060_51_692 | 211 |
| 830 | 3300037312 | Ga0395899_0016403 | Ga0395899_0016403_579_1220 | 211 |
| 831 | 3300037312 | Ga0395899_0024144 | Ga0395899_0024144_2817_3461 | 211 |
| 832 | 3300037312 | Ga0395899_0175527 | Ga0395899_0175527_686_1324 | 211 |
| 833 | 3300037418 | Ga0395900_0001378 | Ga0395900_0001378_6957_7598 | 211 |
| 834 | 3300037418 | Ga0395900_0022676 | Ga0395900_0022676_3094_3738 | 211 |
| 835 | 3300037418 | Ga0395900_0079906 | Ga0395900_0079906_1655_2296 | 211 |
| 836 | 3300037418 | Ga0395900_0289337 | Ga0395900_0289337_340_978 | 211 |
| 837 | 3300037466 | Ga0395898_0001155 | Ga0395898_0001155_33013_33654 | 211 |
| 838 | 3300037466 | Ga0395898_0071303 | Ga0395898_0071303_1575_2219 | 211 |
| 839 | 3300037466 | Ga0395898_0128544 | Ga0395898_0128544_706_1344 | 211 |
| 840 | 3300037471 | Ga0395905_0145290 | Ga0395905_0145290_1259_1903 | 211 |
| 841 | 3300037471 | Ga0395905_0320555 | Ga0395905_0320555_539_1177 | 211 |
| 842 | 3300038443 | Ga0395901_0009161 | Ga0395901_0009161_5648_6289 | 211 |
| 843 | 3300038443 | Ga0395901_0058290 | Ga0395901_0058290_2619_3257 | 211 |
| 844 | 3300038443 | Ga0395901_0683874 | Ga0395901_0683874_165_809 | 211 |
| 845 | 3300041505 | Ga0451849_1184600 | Ga0451849_1184600_380_1021 | 211 |
| 846 | 3300042002 | Ga0439442_008493 | Ga0439442_008493_863_1498 | 211 |
| 847 | 3300042007 | Ga0439449_0040363 | Ga0439449_0040363_768_1403 | 211 |
| 848 | 3300042435 | Ga0439434_0028813 | Ga0439434_0028813_581_1216 | 211 |
| 849 | 3300044656 | Ga0466969_0000030 | Ga0466969_0000030_56020_56679 | 211 |
| 850 | 3300044658 | Ga0466972_0230362 | Ga0466972_0230362_109_771 | 211 |
| 851 | 3300044684 | Ga0466966_0000293 | Ga0466966_0000293_23419_24078 | 211 |
| 852 | 3300045049 | Ga0466959_0000021 | Ga0466959_0000021_44251_44910 | 211 |
| 853 | 3300045051 | Ga0451576_0000002 | Ga0451576_0000002_141554_142342 | 211 |
| 854 | 3300046522 | Ga0495643_0085426 | Ga0495643_0085426_211_846 | 211 |
| 855 | 3300046648 | Ga0495611_0018419 | Ga0495611_0018419_1973_2671 | 211 |
| 856 | 3300047320 | Ga0495672_0029236 | Ga0495672_0029236_447_1088 | 211 |
| 857 | 3300048913 | Ga0496110_0045077 | Ga0496110_0045077_2458_3099 | 211 |
| 858 | 3300048929 | Ga0496126_0285154 | Ga0496126_0285154_70_786 | 211 |
| 859 | 3300049569 | Ga0501032_0148057 | Ga0501032_0148057_273_908 | 211 |
| 860 | 3300049570 | Ga0501033_0101937 | Ga0501033_0101937_1118_1792 | 211 |
| 861 | 3300049571 | Ga0501034_0010577 | Ga0501034_0010577_3466_4101 | 211 |
| 862 | 3300049571 | Ga0501034_0033351 | Ga0501034_0033351_3047_3721 | 211 |
| 863 | 3300049572 | Ga0501036_0139162 | Ga0501036_0139162_628_1263 | 211 |
| 864 | 3300049574 | Ga0501038_0673318 | Ga0501038_0673318_85_720 | 211 |
| 865 | 3300049581 | Ga0501047_0005749 | Ga0501047_0005749_6424_7059 | 211 |
| 866 | 3300049586 | Ga0501070_0036061 | Ga0501070_0036061_973_1647 | 211 |
| 867 | 3300049822 | Ga0501035_0027352 | Ga0501035_0027352_3275_3910 | 211 |
| 868 | 3300049822 | Ga0501035_0072836 | Ga0501035_0072836_1012_1686 | 211 |
| 869 | 3300049823 | Ga0501044_0116862 | Ga0501044_0116862_757_1392 | 211 |
| 870 | 3300049823 | Ga0501044_0216318 | Ga0501044_0216318_1109_1774 | 211 |
| 871 | 3300050507 | nmdc:mga05p37_100274_c1 | nmdc:mga05p37_100274_c1_1963_2628 | 211 |
| 872 | 3300053086 | Ga0500578_0000358 | Ga0500578_0000358_32415_33080 | 211 |
| 873 | 3300053134 | Ga0500658_0126968 | Ga0500658_0126968_286_951 | 211 |
| 874 | 3300053156 | Ga0500622_0065988 | Ga0500622_0065988_358_1023 | 211 |
| 875 | 3300053178 | Ga0500637_0310340 | Ga0500637_0310340_73_738 | 211 |
| 876 | 3300002459 | JGI24751J29686_10005606 | JGI24751J29686_100056062 | 212 |
| 877 | 3300005331 | Ga0070670_100007982 | Ga0070670_1000079825 | 212 |
| 878 | 3300005719 | Ga0068861_100276803 | Ga0068861_1002768031 | 212 |
| 879 | 3300006880 | Ga0075429_100091904 | Ga0075429_1000919043 | 212 |
| 880 | 3300009553 | Ga0105249_10017757 | Ga0105249_100177573 | 212 |
| 881 | 3300025925 | Ga0207650_10053528 | Ga0207650_100535283 | 212 |
| 882 | 3300025961 | Ga0207712_10003149 | Ga0207712_100031492 | 212 |
| 883 | 3300026118 | Ga0207675_100077458 | Ga0207675_1000774583 | 212 |
| 884 | 3300050508 | nmdc:mga09592_87369_c1 | nmdc:mga09592_87369_c1_362_1072 | 212 |
| 885 | 3300050510 | nmdc:mga06r32_297747_c1 | nmdc:mga06r32_297747_c1_500_1210 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ofe-assembly1.cif.gz_A | structural basis for thymine glycosylase activity on t:o6-methylg mismatch by methyl-cpg binding domain protein 4: implications for roles of arg468 in mismatch recognition and catalysis | 0.8962 | 30 | 123 |
| 2abk-assembly1.cif.gz_A | refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom | 0.8865 | 4 | 202 |
| 4ea4-assembly1.cif.gz_A | structure of the glycosylase domain of mbd4 bound to 5hmu-containing dna | 0.8816 | 30 | 127 |
| 1ngn-assembly1.cif.gz_A | mismatch repair in methylated dna. structure of the mismatch-specific thymine glycosylase domain of methyl-cpg-binding protein mbd4 | 0.8687 | 30 | 123 |
| 1orp-assembly1.cif.gz_A | structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex | 0.8599 | 9 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AB83_21_132_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9435 | 22 | 128 | 1.10.340.30 |
| af_P9WQ11_33_143_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9336 | 23 | 129 | 1.10.340.30 |
| af_Q9SIC4_169_271_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9289 | 30 | 125 | 1.10.340.30 |
| af_O35980_108_217_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.922 | 30 | 126 | 1.10.340.30 |
| af_Q58030_26_127_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9217 | 31 | 128 | 1.10.340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A3UBQ3-F1-model_v4 | deleted | 0.9885 | 4 | 205 |
|
| AF-A0A2S1SIS3-F1-model_v4 | DNA lyase | 0.9857 | 4 | 205 |
GO:0006285
GO:0016829 GO:0019104 GO:0046872 GO:0051539 |
| AF-A0A2S0RGK4-F1-model_v4 | DNA lyase | 0.9844 | 6 | 206 |
GO:0003677
GO:0006285 GO:0016829 GO:0019104 GO:0046872 GO:0051539 |
| AF-A0A317IPN2-F1-model_v4 | DNA lyase | 0.9825 | 1 | 210 |
GO:0006285
GO:0016829 GO:0019104 GO:0046872 GO:0051539 |
| AF-A0A3D4TY37-F1-model_v4 | DNA lyase | 0.9822 | 4 | 204 |
GO:0003677
GO:0006285 GO:0016829 GO:0019104 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar