F484655

General Info

Members Datasets Scaffolds Average Seq Length
885 257 882 213

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100456778|Ga0070674_1004567782
Length 243
Sequence LNFIPPFILKITRHEVNFICCRFNMHKLSTMAWKVDWPEAIKPLLKKYKNQQHPLEYKNIYQLLVMVVLSAQSTDHIVNLIAPKLFESFPDMQSLATATPETLFPLIGKVRNFANKANWIMDIARQIKSDKNIPLTHDELTKLKGIGTKSANVILREAGKPAEGVIVDLHVVRVAPRLGIATGSDPKKIEKQIMEKLPKKQWDAGMAMSFLGREICRPKPLCEECLMRKVCWYYNTVVVKTRK

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
3 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
4 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
191 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
252 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
256 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.11
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 0.34
Rhizosphere 95.82
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10005606 3300002459 Bacteria 2557
2 JGI25154J39366_1007391 3300002738 Bacteria 1509
3 rootH1_10004660 3300003316 Bacteria 1491
4 rootH1_10037794 3300003316 Bacteria 8062
5 rootH2_10000086 3300003320 Bacteria 48758
6 rootH2_10016021 3300003320 Bacteria 13246
7 rootH2_10038964 3300003320 Bacteria 4239
8 rootH2_10062516 3300003320 Bacteria 1535
9 rootH2_10063811 3300003320 Bacteria 2502
10 rootL2_10072197 3300003322 Bacteria 2731
11 rootH1_10013386 3300003316 Bacteria 3606
12 rootH1_10013386 3300003323 Bacteria 42758
13 Ga0055531_10000118 3300003794 Bacteria 88104
14 Ga0065704_10088208 3300005289 Bacteria 2958
15 Ga0065704_10123486 3300005289 Bacteria 1733
16 Ga0065712_10008616 3300005290 Unclassified 2528
17 Ga0065715_10193573 3300005293 Bacteria 1401
18 Ga0065707_10271268 3300005295 Bacteria 1071
19 Ga0070658_10034177 3300005327 Bacteria 4091
20 Ga0070658_10047119 3300005327 Bacteria 3488
21 Ga0070658_10055349 3300005327 Bacteria 3223
22 Ga0070658_10265083 3300005327 Bacteria 1460
23 Ga0070658_10270126 3300005327 Bacteria 1446
24 Ga0070676_10010291 3300005328 Bacteria 5072
25 Ga0070676_10666931 3300005328 Unclassified 756
26 Ga0070683_100004806 3300005329 Bacteria 11185
27 Ga0070683_100005679 3300005329 Bacteria 10416
28 Ga0070683_100034348 3300005329 Bacteria 4632
29 Ga0070683_100051414 3300005329 Bacteria 3816
30 Ga0070683_100216563 3300005329 Bacteria 1819
31 Ga0070690_100055055 3300005330 Bacteria 2547
32 Ga0070690_100146378 3300005330 Bacteria 1608
33 Ga0070670_100007982 3300005331 Bacteria 9003
34 Ga0070670_100478408 3300005331 Bacteria 1106
35 Ga0070670_100541123 3300005331 Bacteria 1038
36 Ga0070677_10037752 3300005333 Bacteria 1886
37 Ga0068869_100050141 3300005334 Bacteria 3025
38 Ga0068869_100089932 3300005334 Bacteria 2306
39 Ga0068869_100113631 3300005334 Unclassified 2063
40 Ga0068869_100264094 3300005334 Unclassified 1379
41 Ga0068869_100274630 3300005334 Bacteria 1353
42 Ga0068869_100294029 3300005334 Bacteria 1309
43 Ga0070666_10069419 3300005335 Bacteria 2396
44 Ga0070666_10084019 3300005335 Bacteria 2178
45 Ga0070666_10296083 3300005335 Unclassified 1152
46 Ga0070666_10298154 3300005335 Unclassified 1148
47 Ga0070680_100028967 3300005336 Bacteria 4445
48 Ga0070680_100035203 3300005336 Bacteria 4041
49 Ga0070680_100040658 3300005336 Bacteria 3766
50 Ga0070680_100043701 3300005336 Bacteria 3639
51 Ga0070680_100773307 3300005336 Bacteria 827
52 Ga0070682_100036250 3300005337 Bacteria 3014
53 Ga0070682_100039572 3300005337 Bacteria 2897
54 Ga0068868_100032721 3300005338 Bacteria 4002
55 Ga0068868_100051954 3300005338 Bacteria 3226
56 Ga0068868_100065301 3300005338 Unclassified 2891
57 Ga0068868_100146541 3300005338 Bacteria 1942
58 Ga0068868_100164877 3300005338 Bacteria 1832
59 Ga0068868_100371666 3300005338 Unclassified 1228
60 Ga0070660_100004792 3300005339 Bacteria 9356
61 Ga0070660_100015326 3300005339 Bacteria 5532
62 Ga0070660_100038196 3300005339 Bacteria 3643
63 Ga0070660_100043178 3300005339 Bacteria 3444
64 Ga0070660_100050004 3300005339 Bacteria 3216
65 Ga0070660_100083988 3300005339 Bacteria 2503
66 Ga0070660_100207768 3300005339 Bacteria 1589
67 Ga0070689_100006521 3300005340 Bacteria 8092
68 Ga0070689_100011512 3300005340 Bacteria 6341
69 Ga0070689_100100417 3300005340 Bacteria 2289
70 Ga0070689_100172551 3300005340 Bacteria 1753
71 Ga0070689_100448344 3300005340 Bacteria 1098
72 Ga0070691_10104069 3300005341 Unclassified 1413
73 Ga0070687_100018462 3300005343 Unclassified 3228
74 Ga0070661_100002893 3300005344 Bacteria 11820
75 Ga0070661_100003239 3300005344 Bacteria 11222
76 Ga0070661_100111538 3300005344 Bacteria 2043
77 Ga0070661_100207403 3300005344 Unclassified 1499
78 Ga0070668_100089942 3300005347 Bacteria 2418
79 Ga0070668_100233614 3300005347 Bacteria 1521
80 Ga0070668_100458289 3300005347 Bacteria 1097
81 Ga0070669_100037456 3300005353 Bacteria 3518
82 Ga0070669_100044130 3300005353 Bacteria 3248
83 Ga0070669_100570032 3300005353 Bacteria 946
84 Ga0070675_100087279 3300005354 Bacteria 2609
85 Ga0070675_100212696 3300005354 Bacteria 1681
86 Ga0070675_100462515 3300005354 Unclassified 1139
87 Ga0070671_100169381 3300005355 Bacteria 1847
88 Ga0070671_100720492 3300005355 Bacteria 866
89 Ga0070671_101098322 3300005355 Bacteria 698
90 Ga0070674_100171840 3300005356 Bacteria 1653
91 Ga0070674_100456778 3300005356 Unclassified 1055
92 Ga0070673_100026043 3300005364 Bacteria 4314
93 Ga0070673_100064191 3300005364 Unclassified 2924
94 Ga0070673_100137787 3300005364 Bacteria 2056
95 Ga0070673_100179835 3300005364 Unclassified 1810
96 Ga0070673_100195719 3300005364 Bacteria 1739
97 Ga0070673_100197411 3300005364 Bacteria 1731
98 Ga0070673_100464888 3300005364 Bacteria 1140
99 Ga0070688_100008347 3300005365 Bacteria 5620
100 Ga0070688_100032273 3300005365 Unclassified 3156
101 Ga0070688_100035869 3300005365 Bacteria 3014
102 Ga0070688_100236818 3300005365 Unclassified 1294
103 Ga0070688_100514073 3300005365 Unclassified 905
104 Ga0070659_100023009 3300005366 Bacteria 4764
105 Ga0070659_100038444 3300005366 Bacteria 3732
106 Ga0070659_100066213 3300005366 Bacteria 2862
107 Ga0070667_100022878 3300005367 Bacteria 5183
108 Ga0070667_100091095 3300005367 Unclassified 2621
109 Ga0070667_100108720 3300005367 Bacteria 2403
110 Ga0070667_100170843 3300005367 Bacteria 1919
111 Ga0070667_100195377 3300005367 Bacteria 1793
112 Ga0070667_100308367 3300005367 Bacteria 1426
113 Ga0070713_100901584 3300005436 Bacteria 850
114 Ga0070700_100448778 3300005441 Bacteria 981
115 Ga0070694_100097513 3300005444 Bacteria 2074
116 Ga0070663_100025763 3300005455 Bacteria 3974
117 Ga0070663_100049825 3300005455 Bacteria 2976
118 Ga0070663_100258429 3300005455 Bacteria 1381
119 Ga0070678_100007828 3300005456 Bacteria 6358
120 Ga0070678_100020940 3300005456 Bacteria 4300
121 Ga0070678_100386384 3300005456 Bacteria 1212
122 Ga0070662_100004115 3300005457 Bacteria 9143
123 Ga0070662_100027222 3300005457 Bacteria 3966
124 Ga0070662_100055639 3300005457 Bacteria 2871
125 Ga0070662_100072148 3300005457 Bacteria 2548
126 Ga0070662_100171982 3300005457 Bacteria 1702
127 Ga0070662_100207523 3300005457 Bacteria 1557
128 Ga0070681_10046721 3300005458 Bacteria 4327
129 Ga0070681_10056362 3300005458 Bacteria 3911
130 Ga0070681_10058585 3300005458 Bacteria 3831
131 Ga0070681_10445960 3300005458 Bacteria 1206
132 Ga0070681_10815032 3300005458 Bacteria 851
133 Ga0070681_10915985 3300005458 Bacteria 795
134 Ga0068867_100033261 3300005459 Bacteria 3732
135 Ga0068867_100081735 3300005459 Unclassified 2436
136 Ga0068867_100147186 3300005459 Bacteria 1847
137 Ga0068867_100199806 3300005459 Bacteria 1600
138 Ga0068867_100212274 3300005459 Bacteria 1555
139 Ga0068867_100277877 3300005459 Bacteria 1372
140 Ga0068867_100317236 3300005459 Bacteria 1290
141 Ga0068867_100366159 3300005459 Unclassified 1207
142 Ga0070685_10007265 3300005466 Bacteria 5664
143 Ga0070685_10023071 3300005466 Bacteria 3403
144 Ga0070685_10033897 3300005466 Unclassified 2872
145 Ga0070685_10551638 3300005466 Unclassified 823
146 Ga0070698_100001998 3300005471 Bacteria 22644
147 Ga0070698_100122946 3300005471 Bacteria 2554
148 Ga0070679_100000065 3300005530 Bacteria 78829
149 Ga0070679_100002258 3300005530 Bacteria 17402
150 Ga0070679_100026049 3300005530 Bacteria 5740
151 Ga0070679_100051387 3300005530 Bacteria 4105
152 Ga0070679_100057506 3300005530 Bacteria 3876
153 Ga0070679_100080308 3300005530 Unclassified 3250
154 Ga0070679_100212593 3300005530 Bacteria 1897
155 Ga0070679_100621805 3300005530 Bacteria 1023
156 Ga0070679_100624764 3300005530 Bacteria 1020
157 Ga0070684_100003838 3300005535 Bacteria 11361
158 Ga0070684_100004617 3300005535 Bacteria 10501
159 Ga0070684_100015813 3300005535 Bacteria 6157
160 Ga0070684_100056042 3300005535 Bacteria 3438
161 Ga0070684_100081513 3300005535 Bacteria 2863
162 Ga0070697_101156271 3300005536 Bacteria 689
163 Ga0068853_100008100 3300005539 Bacteria 8434
164 Ga0068853_100014757 3300005539 Bacteria 6411
165 Ga0068853_100016341 3300005539 Bacteria 6106
166 Ga0068853_100052216 3300005539 Bacteria 3521
167 Ga0068853_100053788 3300005539 Bacteria 3468
168 Ga0068853_100227573 3300005539 Bacteria 1705
169 Ga0068853_100278507 3300005539 Bacteria 1542
170 Ga0070672_100047244 3300005543 Unclassified 3339
171 Ga0070672_100049253 3300005543 Bacteria 3277
172 Ga0070672_100058136 3300005543 Bacteria 3038
173 Ga0070672_100335697 3300005543 Bacteria 1286
174 Ga0070672_100592888 3300005543 Unclassified 965
175 Ga0070686_100190493 3300005544 Bacteria 1463
176 Ga0070686_100407527 3300005544 Bacteria 1036
177 Ga0070693_100172521 3300005547 Bacteria 1386
178 Ga0070693_100337185 3300005547 Bacteria 1028
179 Ga0070665_100038063 3300005548 Bacteria 4835
180 Ga0070665_100128940 3300005548 Bacteria 2532
181 Ga0068855_100003936 3300005563 Bacteria 18131
182 Ga0068855_100017595 3300005563 Bacteria 8594
183 Ga0068855_100040646 3300005563 Bacteria 5519
184 Ga0068855_100058177 3300005563 Bacteria 4528
185 Ga0068855_100059775 3300005563 Bacteria 4459
186 Ga0068855_100071606 3300005563 Bacteria 4031
187 Ga0068855_100102170 3300005563 Bacteria 3300
188 Ga0068855_100129917 3300005563 Bacteria 2877
189 Ga0068855_100207033 3300005563 Bacteria 2206
190 Ga0068855_100318902 3300005563 Bacteria 1718
191 Ga0068855_100662720 3300005563 Bacteria 1120
192 Ga0068855_100702609 3300005563 Bacteria 1082
193 Ga0070664_100008799 3300005564 Bacteria 8179
194 Ga0070664_100049998 3300005564 Bacteria 3536
195 Ga0070664_100065607 3300005564 Bacteria 3098
196 Ga0070664_100310167 3300005564 Bacteria 1427
197 Ga0070664_100333241 3300005564 Unclassified 1377
198 Ga0070664_100383122 3300005564 Bacteria 1284
199 Ga0068857_100007481 3300005577 Bacteria 9402
200 Ga0068857_100035569 3300005577 Bacteria 4411
201 Ga0068857_100045885 3300005577 Bacteria 3878
202 Ga0068857_100140525 3300005577 Bacteria 2182
203 Ga0068857_100170536 3300005577 Unclassified 1978
204 Ga0068857_100176284 3300005577 Bacteria 1945
205 Ga0068857_100452784 3300005577 Bacteria 1200
206 Ga0068857_100492779 3300005577 Bacteria 1149
207 Ga0068854_100056669 3300005578 Unclassified 2825
208 Ga0068854_100057944 3300005578 Bacteria 2795
209 Ga0068854_100201925 3300005578 Unclassified 1563
210 Ga0068854_100356570 3300005578 Bacteria 1199
211 Ga0068854_100525611 3300005578 Bacteria 1000
212 Ga0068854_100816972 3300005578 Bacteria 814
213 Ga0068856_100018504 3300005614 Bacteria 6752
214 Ga0068856_100024901 3300005614 Bacteria 5830
215 Ga0068856_100046172 3300005614 Bacteria 4290
216 Ga0068856_100073456 3300005614 Bacteria 3386
217 Ga0068856_100157846 3300005614 Unclassified 2278
218 Ga0068856_100157993 3300005614 Bacteria 2277
219 Ga0068856_100290051 3300005614 Bacteria 1653
220 Ga0068852_100001067 3300005616 Bacteria 18102
221 Ga0068852_100002354 3300005616 Bacteria 13017
222 Ga0068852_100140582 3300005616 Bacteria 2234
223 Ga0068852_100189766 3300005616 Unclassified 1938
224 Ga0068852_100404200 3300005616 Bacteria 1344
225 Ga0068852_100421151 3300005616 Unclassified 1317
226 Ga0068852_100534485 3300005616 Bacteria 1171
227 Ga0068852_100586261 3300005616 Bacteria 1118
228 Ga0068852_100749958 3300005616 Unclassified 988
229 Ga0068859_100025982 3300005617 Bacteria 5875
230 Ga0068859_100035397 3300005617 Bacteria 5010
231 Ga0068859_100045776 3300005617 Bacteria 4395
232 Ga0068859_100048901 3300005617 Bacteria 4247
233 Ga0068859_100297349 3300005617 Unclassified 1707
234 Ga0068859_100494484 3300005617 Bacteria 1318
235 Ga0068859_100501650 3300005617 Bacteria 1309
236 Ga0068864_100077069 3300005618 Bacteria 2915
237 Ga0068864_100114675 3300005618 Bacteria 2403
238 Ga0068864_100412039 3300005618 Bacteria 1286
239 Ga0068864_100672912 3300005618 Unclassified 1009
240 Ga0068864_100809383 3300005618 Bacteria 921
241 Ga0068864_100971819 3300005618 Unclassified 841
242 Ga0068866_10205242 3300005718 Bacteria 1180
243 Ga0068861_100028443 3300005719 Unclassified 4078
244 Ga0068861_100253851 3300005719 Bacteria 1502
245 Ga0068861_100276803 3300005719 Unclassified 1443
246 Ga0068851_10093855 3300005834 Bacteria 1584
247 Ga0068851_10215517 3300005834 Unclassified 1077
248 Ga0068851_10443656 3300005834 Bacteria 770
249 Ga0068870_10170179 3300005840 Bacteria 1299
250 Ga0068870_10362444 3300005840 Unclassified 933
251 Ga0068863_100126403 3300005841 Bacteria 2439
252 Ga0068863_100328903 3300005841 Unclassified 1486
253 Ga0068863_100495893 3300005841 Unclassified 1202
254 Ga0068858_100581653 3300005842 Bacteria 1085
255 Ga0068858_101157795 3300005842 Unclassified 760
256 Ga0068860_100025430 3300005843 Bacteria 5712
257 Ga0068860_100035807 3300005843 Unclassified 4759
258 Ga0068860_100038858 3300005843 Bacteria 4553
259 Ga0068860_100045962 3300005843 Bacteria 4164
260 Ga0068860_100169026 3300005843 Bacteria 2111
261 Ga0068860_100220869 3300005843 Bacteria 1840
262 Ga0068860_101066605 3300005843 Bacteria 827
263 Ga0068862_100012633 3300005844 Bacteria 6990
264 Ga0068862_100295962 3300005844 Bacteria 1488
265 Ga0081539_10000714 3300005985 Bacteria 66625
266 Ga0097621_100021395 3300006237 Bacteria 5002
267 Ga0097621_100030624 3300006237 Bacteria 4261
268 Ga0097621_100304357 3300006237 Bacteria 1409
269 Ga0097621_100363102 3300006237 Bacteria 1290
270 Ga0097621_100636901 3300006237 Bacteria 977
271 Ga0097621_100822652 3300006237 Bacteria 861
272 Ga0068871_100120751 3300006358 Bacteria 2213
273 Ga0068871_100381121 3300006358 Bacteria 1253
274 Ga0068871_100493079 3300006358 Bacteria 1103
275 Ga0075428_100064824 3300006844 Unclassified 4001
276 Ga0075428_100151035 3300006844 Unclassified 2523
277 Ga0075430_100007274 3300006846 Bacteria 9345
278 Ga0075433_10578825 3300006852 Bacteria 986
279 Ga0075429_100091904 3300006880 Bacteria 2647
280 Ga0068865_100028534 3300006881 Unclassified 3696
281 Ga0068865_100058612 3300006881 Bacteria 2690
282 Ga0068865_100135681 3300006881 Bacteria 1849
283 Ga0097620_100025982 3300006931 Bacteria 5875
284 Ga0097620_100035399 3300006931 Bacteria 5010
285 Ga0097620_100045776 3300006931 Bacteria 4395
286 Ga0097620_100048900 3300006931 Bacteria 4247
287 Ga0097620_100297359 3300006931 Unclassified 1707
288 Ga0097620_100494477 3300006931 Bacteria 1318
289 Ga0097620_100501616 3300006931 Bacteria 1309
290 Ga0097620_100896913 3300006931 Bacteria 971
291 Ga0105240_10000383 3300009093 Bacteria 83057
292 Ga0105240_10000905 3300009093 Bacteria 52980
293 Ga0105240_10001825 3300009093 Bacteria 35720
294 Ga0105240_10001869 3300009093 Bacteria 35028
295 Ga0105240_10011676 3300009093 Bacteria 12208
296 Ga0105240_10014537 3300009093 Bacteria 10745
297 Ga0105240_10115290 3300009093 Unclassified 3244
298 Ga0105240_10182366 3300009093 Bacteria 2476
299 Ga0111539_10024746 3300009094 Bacteria 7363
300 Ga0111539_10142694 3300009094 Bacteria 2803
301 Ga0114129_10032540 3300009147 Bacteria 7370
302 Ga0114129_10194413 3300009147 Unclassified 2752
303 Ga0105243_10098133 3300009148 Bacteria 2426
304 Ga0105241_10010223 3300009174 Bacteria 6893
305 Ga0105241_10032233 3300009174 Bacteria 3928
306 Ga0105241_10220114 3300009174 Bacteria 1595
307 Ga0105242_10003021 3300009176 Bacteria 13152
308 Ga0105242_10034122 3300009176 Bacteria 4079
309 Ga0105242_10300452 3300009176 Bacteria 1465
310 Ga0105242_10410330 3300009176 Bacteria 1266
311 Ga0105242_10697448 3300009176 Unclassified 993
312 Ga0105242_10777737 3300009176 Bacteria 945
313 Ga0105248_10221882 3300009177 Bacteria 2128
314 Ga0105237_10000305 3300009545 Bacteria 68102
315 Ga0105237_10001224 3300009545 Bacteria 34200
316 Ga0105237_10003156 3300009545 Bacteria 19825
317 Ga0105237_10003946 3300009545 Bacteria 17369
318 Ga0105237_10006238 3300009545 Bacteria 13276
319 Ga0105237_10020409 3300009545 Bacteria 6831
320 Ga0105237_10021612 3300009545 Bacteria 6615
321 Ga0105237_10035034 3300009545 Bacteria 5080
322 Ga0105237_10046496 3300009545 Bacteria 4365
323 Ga0105238_10002413 3300009551 Bacteria 18744
324 Ga0105238_10058560 3300009551 Bacteria 3860
325 Ga0105238_10118144 3300009551 Bacteria 2632
326 Ga0105249_10013169 3300009553 Bacteria 7297
327 Ga0105249_10017757 3300009553 Bacteria 6319
328 Ga0105249_10047364 3300009553 Unclassified 3917
329 Ga0105249_10058553 3300009553 Bacteria 3531
330 Ga0105249_10237511 3300009553 Bacteria 1800
331 Ga0105249_10370143 3300009553 Bacteria 1456
332 Ga0105249_10697993 3300009553 Unclassified 1075
333 Ga0105249_10789389 3300009553 Bacteria 1013
334 Ga0105249_11401850 3300009553 Bacteria 771
335 Ga0105239_10000099 3300010375 Bacteria 120205
336 Ga0105239_10000970 3300010375 Bacteria 40255
337 Ga0105239_10003044 3300010375 Bacteria 20839
338 Ga0105239_10009415 3300010375 Bacteria 11012
339 Ga0105239_10070884 3300010375 Bacteria 3829
340 Ga0105239_10119128 3300010375 Bacteria 2930
341 Ga0105246_10227206 3300011119 Bacteria 1467
342 Ga0105246_10464434 3300011119 Bacteria 1067
343 Ga0157373_10003026 3300013100 Bacteria 12683
344 Ga0157373_10016192 3300013100 Bacteria 5441
345 Ga0157373_10032989 3300013100 Bacteria 3727
346 Ga0157373_10047207 3300013100 Unclassified 3072
347 Ga0157373_10059535 3300013100 Bacteria 2706
348 Ga0157373_10063514 3300013100 Bacteria 2614
349 Ga0157373_10089149 3300013100 Bacteria 2173
350 Ga0157373_10106400 3300013100 Bacteria 1972
351 Ga0157373_10111972 3300013100 Bacteria 1919
352 Ga0157373_10126561 3300013100 Bacteria 1797
353 Ga0157373_10487325 3300013100 Bacteria 890
354 Ga0157371_10000322 3300013102 Bacteria 62104
355 Ga0157371_10002933 3300013102 Bacteria 15909
356 Ga0157371_10005313 3300013102 Bacteria 10902
357 Ga0157371_10005951 3300013102 Bacteria 10181
358 Ga0157371_10022566 3300013102 Bacteria 4608
359 Ga0157371_10046908 3300013102 Bacteria 3071
360 Ga0157371_10052508 3300013102 Bacteria 2895
361 Ga0157371_10073653 3300013102 Bacteria 2419
362 Ga0157371_10085960 3300013102 Bacteria 2228
363 Ga0157371_10095147 3300013102 Bacteria 2111
364 Ga0157371_10126011 3300013102 Unclassified 1821
365 Ga0157371_10194410 3300013102 Bacteria 1453
366 Ga0157371_10268800 3300013102 Bacteria 1230
367 Ga0157371_10274289 3300013102 Unclassified 1217
368 Ga0157371_10301071 3300013102 Bacteria 1161
369 Ga0157370_10000651 3300013104 Bacteria 43302
370 Ga0157370_10008098 3300013104 Bacteria 11377
371 Ga0157370_10016368 3300013104 Bacteria 7507
372 Ga0157370_10042948 3300013104 Bacteria 4353
373 Ga0157370_10071434 3300013104 Bacteria 3274
374 Ga0157370_10162581 3300013104 Bacteria 2077
375 Ga0157370_10191287 3300013104 Bacteria 1899
376 Ga0157370_10376078 3300013104 Bacteria 1309
377 Ga0157370_10434293 3300013104 Bacteria 1207
378 Ga0157370_10636622 3300013104 Bacteria 975
379 Ga0157369_10014417 3300013105 Bacteria 8924
380 Ga0157369_10015570 3300013105 Bacteria 8570
381 Ga0157369_10030664 3300013105 Bacteria 5929
382 Ga0157369_10035829 3300013105 Bacteria 5440
383 Ga0157369_10042173 3300013105 Bacteria 4978
384 Ga0157369_10100069 3300013105 Bacteria 3090
385 Ga0157369_10157274 3300013105 Bacteria 2400
386 Ga0157369_10183254 3300013105 Bacteria 2202
387 Ga0157369_10297523 3300013105 Bacteria 1679
388 Ga0157369_10372791 3300013105 Bacteria 1482
389 Ga0157369_10392266 3300013105 Unclassified 1440
390 Ga0157374_10000027 3300013296 Bacteria 233444
391 Ga0157374_10003778 3300013296 Bacteria 12738
392 Ga0157374_10021940 3300013296 Bacteria 5689
393 Ga0157374_10092412 3300013296 Bacteria 2887
394 Ga0157374_10108533 3300013296 Bacteria 2668
395 Ga0157374_10192637 3300013296 Bacteria 1994
396 Ga0157374_10213399 3300013296 Bacteria 1893
397 Ga0157374_10299997 3300013296 Bacteria 1589
398 Ga0157374_10301550 3300013296 Unclassified 1585
399 Ga0157374_10401219 3300013296 Bacteria 1368
400 Ga0157374_10860394 3300013296 Bacteria 924
401 Ga0157374_10946476 3300013296 Bacteria 880
402 Ga0157374_10974599 3300013296 Bacteria 867
403 Ga0157374_11150853 3300013296 Bacteria 797
404 Ga0157378_10048964 3300013297 Bacteria 3759
405 Ga0157378_10049021 3300013297 Bacteria 3757
406 Ga0157378_10095326 3300013297 Unclassified 2710
407 Ga0157378_10351313 3300013297 Bacteria 1440
408 Ga0157378_10355512 3300013297 Bacteria 1432
409 Ga0157378_10546246 3300013297 Unclassified 1163
410 Ga0157378_10679266 3300013297 Bacteria 1048
411 Ga0157378_10854318 3300013297 Bacteria 939
412 Ga0157378_11265446 3300013297 Unclassified 778
413 Ga0163162_10011701 3300013306 Bacteria 8557
414 Ga0163162_10056799 3300013306 Bacteria 3942
415 Ga0163162_10060685 3300013306 Bacteria 3818
416 Ga0163162_10063130 3300013306 Bacteria 3745
417 Ga0163162_10089388 3300013306 Bacteria 3161
418 Ga0163162_10093714 3300013306 Bacteria 3088
419 Ga0163162_10124903 3300013306 Unclassified 2679
420 Ga0163162_10147746 3300013306 Unclassified 2467
421 Ga0163162_10286741 3300013306 Bacteria 1778
422 Ga0163162_10338635 3300013306 Bacteria 1637
423 Ga0163162_10408678 3300013306 Bacteria 1490
424 Ga0163162_10442966 3300013306 Bacteria 1431
425 Ga0163162_10498475 3300013306 Bacteria 1348
426 Ga0163162_10543549 3300013306 Unclassified 1290
427 Ga0163162_11009847 3300013306 Bacteria 941
428 Ga0163162_11368167 3300013306 Bacteria 805
429 Ga0157372_10001117 3300013307 Bacteria 29145
430 Ga0157372_10005797 3300013307 Bacteria 13153
431 Ga0157372_10018334 3300013307 Bacteria 7523
432 Ga0157372_10026752 3300013307 Bacteria 6279
433 Ga0157372_10123156 3300013307 Bacteria 2980
434 Ga0157372_10151232 3300013307 Bacteria 2679
435 Ga0157372_10193760 3300013307 Unclassified 2354
436 Ga0157372_10226138 3300013307 Unclassified 2169
437 Ga0157372_10230504 3300013307 Bacteria 2147
438 Ga0157372_10310941 3300013307 Bacteria 1834
439 Ga0157372_10452285 3300013307 Bacteria 1497
440 Ga0157372_10653420 3300013307 Bacteria 1224
441 Ga0157372_10696703 3300013307 Bacteria 1182
442 Ga0157372_10782216 3300013307 Bacteria 1109
443 Ga0157375_10013929 3300013308 Bacteria 7170
444 Ga0157375_10036544 3300013308 Bacteria 4700
445 Ga0157375_10067374 3300013308 Bacteria 3577
446 Ga0157375_10187203 3300013308 Bacteria 2224
447 Ga0157375_10194285 3300013308 Bacteria 2184
448 Ga0157375_10294269 3300013308 Unclassified 1787
449 Ga0157375_10477369 3300013308 Bacteria 1412
450 Ga0157375_10546869 3300013308 Bacteria 1320
451 Ga0157375_10563568 3300013308 Bacteria 1300
452 Ga0157375_10733864 3300013308 Bacteria 1140
453 Ga0163163_10000781 3300014325 Bacteria 26993
454 Ga0163163_10064762 3300014325 Bacteria 3627
455 Ga0163163_10597338 3300014325 Bacteria 1167
456 Ga0163163_10669931 3300014325 Bacteria 1101
457 Ga0157380_10050034 3300014326 Unclassified 3299
458 Ga0157380_10095165 3300014326 Unclassified 2467
459 Ga0157380_10320471 3300014326 Bacteria 1437
460 Ga0157380_10386905 3300014326 Unclassified 1322
461 Ga0157377_10004114 3300014745 Bacteria 6646
462 Ga0157377_10016681 3300014745 Unclassified 3782
463 Ga0157377_10018364 3300014745 Bacteria 3633
464 Ga0157377_10031949 3300014745 Bacteria 2864
465 Ga0157377_10036746 3300014745 Bacteria 2696
466 Ga0157377_10207953 3300014745 Unclassified 1246
467 Ga0157377_10593357 3300014745 Bacteria 789
468 Ga0157379_10054403 3300014968 Bacteria 3576
469 Ga0157379_10151053 3300014968 Unclassified 2095
470 Ga0157379_10450116 3300014968 Bacteria 1189
471 Ga0157379_10556274 3300014968 Bacteria 1068
472 Ga0157376_10000368 3300014969 Bacteria 29611
473 Ga0157376_10070002 3300014969 Bacteria 2976
474 Ga0157376_10111589 3300014969 Bacteria 2408
475 Ga0157376_10197524 3300014969 Bacteria 1849
476 Ga0157376_10207254 3300014969 Bacteria 1808
477 Ga0157376_10450134 3300014969 Bacteria 1256
478 Ga0157376_10779739 3300014969 Bacteria 967
479 Ga0157376_10902375 3300014969 Bacteria 902
480 Ga0157376_11079453 3300014969 Bacteria 828
481 Ga0163161_10030948 3300017792 Bacteria 3810
482 Ga0163161_10364283 3300017792 Bacteria 1152
483 Ga0163161_10395678 3300017792 Bacteria 1107
484 Ga0163161_10647683 3300017792 Unclassified 875
485 Ga0213876_10058848 3300021384 Bacteria 2028
486 Ga0209646_1001061 3300025246 Bacteria 8248
487 Ga0207426_1000189 3300025302 Bacteria 153457
488 Ga0209257_1000007 3300025304 Bacteria 1564415
489 Ga0207697_10021308 3300025315 Bacteria 2653
490 Ga0207697_10086287 3300025315 Unclassified 1327
491 Ga0207697_10113767 3300025315 Bacteria 1160
492 Ga0207642_10039985 3300025899 Unclassified 2043
493 Ga0207688_10006914 3300025901 Bacteria 6176
494 Ga0207688_10380827 3300025901 Unclassified 873
495 Ga0207680_10014089 3300025903 Bacteria 4125
496 Ga0207680_10043792 3300025903 Bacteria 2628
497 Ga0207647_10004913 3300025904 Bacteria 9865
498 Ga0207647_10069595 3300025904 Bacteria 2127
499 Ga0207647_10188660 3300025904 Bacteria 1195
500 Ga0207647_10261247 3300025904 Bacteria 991
501 Ga0207645_10000307 3300025907 Bacteria 41105
502 Ga0207645_10012698 3300025907 Bacteria 5711
503 Ga0207645_10112800 3300025907 Bacteria 1761
504 Ga0207643_10017411 3300025908 Bacteria 3929
505 Ga0207705_10011305 3300025909 Bacteria 6467
506 Ga0207705_10025055 3300025909 Bacteria 4259
507 Ga0207705_10033049 3300025909 Bacteria 3697
508 Ga0207705_10056453 3300025909 Bacteria 2831
509 Ga0207705_10214283 3300025909 Bacteria 1461
510 Ga0207654_10005944 3300025911 Bacteria 6143
511 Ga0207707_10009918 3300025912 Bacteria 8258
512 Ga0207707_10153898 3300025912 Bacteria 2010
513 Ga0207707_10275044 3300025912 Bacteria 1459
514 Ga0207695_10000209 3300025913 Bacteria 157802
515 Ga0207695_10000300 3300025913 Bacteria 122104
516 Ga0207695_10000483 3300025913 Bacteria 85395
517 Ga0207695_10005507 3300025913 Bacteria 16761
518 Ga0207695_10007075 3300025913 Bacteria 14381
519 Ga0207695_10018867 3300025913 Bacteria 7959
520 Ga0207695_10184568 3300025913 Bacteria 2005
521 Ga0207695_10348617 3300025913 Unclassified 1368
522 Ga0207671_10002537 3300025914 Bacteria 19435
523 Ga0207671_10011167 3300025914 Bacteria 7334
524 Ga0207671_10012297 3300025914 Bacteria 6891
525 Ga0207671_10068447 3300025914 Unclassified 2645
526 Ga0207671_10179893 3300025914 Bacteria 1645
527 Ga0207660_10028421 3300025917 Bacteria 3825
528 Ga0207660_10043520 3300025917 Bacteria 3156
529 Ga0207660_10103074 3300025917 Bacteria 2134
530 Ga0207660_10112411 3300025917 Bacteria 2051
531 Ga0207660_10145831 3300025917 Bacteria 1814
532 Ga0207660_10245987 3300025917 Bacteria 1410
533 Ga0207662_10045192 3300025918 Plasmid 2603
534 Ga0207657_10004767 3300025919 Bacteria 14306
535 Ga0207657_10006381 3300025919 Bacteria 12245
536 Ga0207657_10032094 3300025919 Bacteria 4749
537 Ga0207657_10033705 3300025919 Bacteria 4614
538 Ga0207657_10034417 3300025919 Bacteria 4556
539 Ga0207657_10054131 3300025919 Bacteria 3472
540 Ga0207657_10077336 3300025919 Bacteria 2805
541 Ga0207657_10127034 3300025919 Unclassified 2093
542 Ga0207657_10250495 3300025919 Unclassified 1412
543 Ga0207649_10003179 3300025920 Bacteria 9005
544 Ga0207649_10009537 3300025920 Bacteria 5314
545 Ga0207649_10078523 3300025920 Bacteria 2130
546 Ga0207649_10736484 3300025920 Bacteria 766
547 Ga0207652_10000013 3300025921 Bacteria 222247
548 Ga0207652_10000055 3300025921 Bacteria 115420
549 Ga0207652_10000327 3300025921 Bacteria 49170
550 Ga0207652_10005333 3300025921 Bacteria 10424
551 Ga0207652_10049054 3300025921 Bacteria 3612
552 Ga0207652_10056510 3300025921 Unclassified 3378
553 Ga0207652_10096447 3300025921 Bacteria 2605
554 Ga0207652_10096776 3300025921 Bacteria 2601
555 Ga0207652_10289767 3300025921 Bacteria 1477
556 Ga0207652_10449164 3300025921 Bacteria 1162
557 Ga0207652_10484192 3300025921 Unclassified 1114
558 Ga0207681_10028570 3300025923 Bacteria 3613
559 Ga0207681_10100784 3300025923 Bacteria 2082
560 Ga0207681_10754485 3300025923 Unclassified 811
561 Ga0207681_10948709 3300025923 Unclassified 721
562 Ga0207694_10236795 3300025924 Bacteria 1491
563 Ga0207694_10411104 3300025924 Bacteria 1126
564 Ga0207650_10053528 3300025925 Bacteria 2992
565 Ga0207650_10338292 3300025925 Unclassified 1236
566 Ga0207659_10047282 3300025926 Bacteria 3043
567 Ga0207659_10082309 3300025926 Bacteria 2383
568 Ga0207659_10087184 3300025926 Bacteria 2323
569 Ga0207659_10238393 3300025926 Bacteria 1470
570 Ga0207659_10370692 3300025926 Bacteria 1192
571 Ga0207659_10449192 3300025926 Bacteria 1085
572 Ga0207659_10520986 3300025926 Bacteria 1008
573 Ga0207644_10089622 3300025931 Bacteria 2290
574 Ga0207644_10161227 3300025931 Bacteria 1743
575 Ga0207690_10058402 3300025932 Bacteria 2609
576 Ga0207690_10087131 3300025932 Unclassified 2196
577 Ga0207690_10100285 3300025932 Bacteria 2066
578 Ga0207706_10026330 3300025933 Bacteria 5206
579 Ga0207706_10036390 3300025933 Bacteria 4372
580 Ga0207706_10105265 3300025933 Bacteria 2482
581 Ga0207706_10286075 3300025933 Unclassified 1437
582 Ga0207706_10309322 3300025933 Bacteria 1376
583 Ga0207686_10000884 3300025934 Bacteria 18109
584 Ga0207686_10056406 3300025934 Bacteria 2469
585 Ga0207686_10112072 3300025934 Bacteria 1842
586 Ga0207686_10255834 3300025934 Bacteria 1282
587 Ga0207670_10026860 3300025936 Bacteria 3634
588 Ga0207670_10029226 3300025936 Bacteria 3509
589 Ga0207670_10060545 3300025936 Bacteria 2580
590 Ga0207670_10105561 3300025936 Unclassified 2019
591 Ga0207670_10260006 3300025936 Bacteria 1345
592 Ga0207669_10067489 3300025937 Bacteria 2229
593 Ga0207704_10027351 3300025938 Unclassified 3145
594 Ga0207704_10111592 3300025938 Bacteria 1850
595 Ga0207704_10139308 3300025938 Bacteria 1694
596 Ga0207704_10586710 3300025938 Bacteria 910
597 Ga0207691_10005556 3300025940 Bacteria 12180
598 Ga0207691_10012090 3300025940 Bacteria 8278
599 Ga0207691_10019398 3300025940 Bacteria 6435
600 Ga0207691_10019465 3300025940 Bacteria 6422
601 Ga0207691_10399476 3300025940 Bacteria 1172
602 Ga0207691_10782327 3300025940 Bacteria 802
603 Ga0207689_10001757 3300025942 Bacteria 20439
604 Ga0207689_10010694 3300025942 Bacteria 7894
605 Ga0207689_10035195 3300025942 Bacteria 4160
606 Ga0207689_10036311 3300025942 Bacteria 4092
607 Ga0207689_10069897 3300025942 Bacteria 2885
608 Ga0207689_10075838 3300025942 Unclassified 2764
609 Ga0207689_10146892 3300025942 Bacteria 1943
610 Ga0207689_10184929 3300025942 Unclassified 1719
611 Ga0207689_10286108 3300025942 Bacteria 1365
612 Ga0207661_10002725 3300025944 Bacteria 12163
613 Ga0207661_10095918 3300025944 Bacteria 2481
614 Ga0207679_10000611 3300025945 Bacteria 23793
615 Ga0207679_10076548 3300025945 Bacteria 2543
616 Ga0207679_10281138 3300025945 Bacteria 1427
617 Ga0207679_10772856 3300025945 Bacteria 875
618 Ga0207667_10002405 3300025949 Bacteria 23429
619 Ga0207667_10003410 3300025949 Bacteria 19621
620 Ga0207667_10010537 3300025949 Bacteria 10800
621 Ga0207667_10076885 3300025949 Bacteria 3463
622 Ga0207667_10084648 3300025949 Bacteria 3283
623 Ga0207667_10109234 3300025949 Bacteria 2852
624 Ga0207667_10137089 3300025949 Bacteria 2520
625 Ga0207667_10202598 3300025949 Bacteria 2035
626 Ga0207667_10225049 3300025949 Bacteria 1922
627 Ga0207667_10298385 3300025949 Bacteria 1646
628 Ga0207667_10378758 3300025949 Unclassified 1442
629 Ga0207667_10484811 3300025949 Bacteria 1255
630 Ga0207667_10818356 3300025949 Bacteria 927
631 Ga0207651_10040387 3300025960 Bacteria 3086
632 Ga0207651_10061582 3300025960 Bacteria 2611
633 Ga0207651_10100504 3300025960 Bacteria 2144
634 Ga0207651_10128569 3300025960 Bacteria 1935
635 Ga0207651_10333897 3300025960 Unclassified 1271
636 Ga0207651_10640476 3300025960 Unclassified 932
637 Ga0207712_10002170 3300025961 Bacteria 12828
638 Ga0207712_10003149 3300025961 Bacteria 10523
639 Ga0207712_10038438 3300025961 Bacteria 3273
640 Ga0207712_10057941 3300025961 Bacteria 2735
641 Ga0207712_10068500 3300025961 Bacteria 2543
642 Ga0207668_10064508 3300025972 Bacteria 2589
643 Ga0207668_10531062 3300025972 Bacteria 1016
644 Ga0207668_10812858 3300025972 Bacteria 828
645 Ga0207640_10056728 3300025981 Unclassified 2573
646 Ga0207640_10070650 3300025981 Bacteria 2349
647 Ga0207640_10143843 3300025981 Bacteria 1742
648 Ga0207640_10159744 3300025981 Unclassified 1666
649 Ga0207640_10207810 3300025981 Unclassified 1489
650 Ga0207640_10508330 3300025981 Bacteria 1005
651 Ga0207640_10652598 3300025981 Bacteria 897
652 Ga0207640_10699250 3300025981 Bacteria 869
653 Ga0207658_10235320 3300025986 Bacteria 1548
654 Ga0207658_10278294 3300025986 Bacteria 1433
655 Ga0207658_10492251 3300025986 Bacteria 1091
656 Ga0207658_10638123 3300025986 Unclassified 959
657 Ga0207677_10034595 3300026023 Bacteria 3273
658 Ga0207677_10041695 3300026023 Bacteria 3038
659 Ga0207677_10065555 3300026023 Bacteria 2534
660 Ga0207677_10081127 3300026023 Bacteria 2326
661 Ga0207677_10197317 3300026023 Unclassified 1597
662 Ga0207677_10247001 3300026023 Unclassified 1447
663 Ga0207639_10011601 3300026041 Bacteria 6123
664 Ga0207639_10093825 3300026041 Bacteria 2408
665 Ga0207639_10100248 3300026041 Bacteria 2339
666 Ga0207639_10278125 3300026041 Bacteria 1471
667 Ga0207639_10304730 3300026041 Bacteria 1409
668 Ga0207639_11017861 3300026041 Bacteria 776
669 Ga0207678_10057112 3300026067 Bacteria 3359
670 Ga0207678_10059260 3300026067 Bacteria 3294
671 Ga0207678_10101165 3300026067 Unclassified 2462
672 Ga0207678_10257067 3300026067 Unclassified 1496
673 Ga0207678_10454352 3300026067 Bacteria 1114
674 Ga0207708_10446038 3300026075 Bacteria 1077
675 Ga0207702_10022070 3300026078 Bacteria 5274
676 Ga0207702_10095210 3300026078 Bacteria 2616
677 Ga0207702_10135069 3300026078 Unclassified 2224
678 Ga0207702_10238026 3300026078 Bacteria 1704
679 Ga0207641_10001235 3300026088 Bacteria 25590
680 Ga0207641_10035180 3300026088 Bacteria 4171
681 Ga0207641_10361189 3300026088 Bacteria 1386
682 Ga0207641_10395674 3300026088 Bacteria 1326
683 Ga0207641_10861750 3300026088 Unclassified 898
684 Ga0207648_10001972 3300026089 Bacteria 22390
685 Ga0207648_10099643 3300026089 Bacteria 2545
686 Ga0207648_10107946 3300026089 Unclassified 2443
687 Ga0207648_10282105 3300026089 Bacteria 1485
688 Ga0207648_10353461 3300026089 Unclassified 1325
689 Ga0207648_10438726 3300026089 Bacteria 1187
690 Ga0207648_10544182 3300026089 Bacteria 1066
691 Ga0207676_10060852 3300026095 Bacteria 2988
692 Ga0207676_10064360 3300026095 Bacteria 2916
693 Ga0207676_10114867 3300026095 Bacteria 2259
694 Ga0207676_10263928 3300026095 Bacteria 1556
695 Ga0207676_10277661 3300026095 Unclassified 1520
696 Ga0207676_10604538 3300026095 Unclassified 1054
697 Ga0207676_10641767 3300026095 Unclassified 1024
698 Ga0207674_10002454 3300026116 Bacteria 23401
699 Ga0207674_10004889 3300026116 Bacteria 16037
700 Ga0207674_10007799 3300026116 Bacteria 12451
701 Ga0207674_10041435 3300026116 Bacteria 4763
702 Ga0207674_10056401 3300026116 Bacteria 3990
703 Ga0207674_10059130 3300026116 Bacteria 3880
704 Ga0207674_10175510 3300026116 Bacteria 2095
705 Ga0207674_10439504 3300026116 Bacteria 1261
706 Ga0207675_100004652 3300026118 Bacteria 13217
707 Ga0207675_100077458 3300026118 Bacteria 3115
708 Ga0207683_10003643 3300026121 Bacteria 13402
709 Ga0207683_10268077 3300026121 Bacteria 1560
710 Ga0207683_10446589 3300026121 Bacteria 1192
711 Ga0207698_10003337 3300026142 Bacteria 9659
712 Ga0207698_10004845 3300026142 Bacteria 8243
713 Ga0207698_10075259 3300026142 Unclassified 2697
714 Ga0207698_10309951 3300026142 Bacteria 1473
715 Ga0207698_10357958 3300026142 Bacteria 1381
716 Ga0207698_10368573 3300026142 Bacteria 1362
717 Ga0207698_10421392 3300026142 Unclassified 1281
718 Ga0268266_10543577 3300028379 Bacteria 1112
719 Ga0268265_10114602 3300028380 Bacteria 2208
720 Ga0268265_10145454 3300028380 Bacteria 1991
721 Ga0268265_10413193 3300028380 Bacteria 1251
722 Ga0268265_10621433 3300028380 Bacteria 1035
723 Ga0268264_10010600 3300028381 Bacteria 7617
724 Ga0268264_10079567 3300028381 Bacteria 2797
725 Ga0268264_10133007 3300028381 Bacteria 2208
726 Ga0265318_10132870 3300028577 Unclassified 915
727 Ga0307517_10008092 3300028786 Bacteria 15151
728 Ga0265329_10049512 3300031242 Unclassified 1339
729 Ga0265327_10000107 3300031251 Bacteria 183770
730 Ga0265327_10123244 3300031251 Unclassified 1226
731 Ga0307513_10624292 3300031456 Unclassified 786
732 Ga0307509_10206093 3300031507 Bacteria 1797
733 Ga0307509_10359178 3300031507 Bacteria 1177
734 Ga0265314_10015531 3300031711 Bacteria 6041
735 Ga0307510_10007513 3300033180 Bacteria 12980
736 Ga0373934_0109733 3300035086 Bacteria 1118
737 Ga0373943_0135060 3300035170 Bacteria 1324
738 Ga0373924_0051757 3300035410 Bacteria 1704
739 Ga0373924_0318108 3300035410 Bacteria 692
740 Ga0373935_0138940 3300035692 Bacteria 1639
741 Ga0373935_0283596 3300035692 Bacteria 1167
742 Ga0373937_0010916 3300036401 Bacteria 7953
743 Ga0265778_032959 3300036457 Unclassified 674
744 Ga0373925_0667824 3300037068 Unclassified 857
745 Ga0395899_0001555 3300037312 Bacteria 19348
746 Ga0395899_0016403 3300037312 Bacteria 5646
747 Ga0395899_0024144 3300037312 Bacteria 4599
748 Ga0395899_0030887 3300037312 Bacteria 4027
749 Ga0395899_0115442 3300037312 Bacteria 1927
750 Ga0395899_0175527 3300037312 Bacteria 1507
751 Ga0395899_0323287 3300037312 Bacteria 1038
752 Ga0395900_0001378 3300037418 Bacteria 29221
753 Ga0395900_0002745 3300037418 Bacteria 19224
754 Ga0395900_0022520 3300037418 Bacteria 6445
755 Ga0395900_0022676 3300037418 Bacteria 6425
756 Ga0395900_0079906 3300037418 Bacteria 3360
757 Ga0395900_0289337 3300037418 Bacteria 1627
758 Ga0395900_0290859 3300037418 Bacteria 1622
759 Ga0395900_0797672 3300037418 Bacteria 872
760 Ga0395898_0001155 3300037466 Bacteria 40306
761 Ga0395898_0001910 3300037466 Bacteria 26545
762 Ga0395898_0012127 3300037466 Bacteria 8919
763 Ga0395898_0040370 3300037466 Bacteria 4615
764 Ga0395898_0071303 3300037466 Bacteria 3357
765 Ga0395898_0128544 3300037466 Bacteria 2427
766 Ga0395898_0176571 3300037466 Bacteria 2041
767 Ga0395898_1016531 3300037466 Bacteria 764
768 Ga0395905_0145290 3300037471 Bacteria 2232
769 Ga0395905_0194926 3300037471 Unclassified 1899
770 Ga0395905_0320555 3300037471 Bacteria 1439
771 Ga0395905_0576887 3300037471 Bacteria 1026
772 Ga0395901_0001357 3300038443 Bacteria 25621
773 Ga0395901_0009161 3300038443 Bacteria 10027
774 Ga0395901_0058290 3300038443 Bacteria 4017
775 Ga0395901_0146694 3300038443 Bacteria 2480
776 Ga0395901_0683874 3300038443 Bacteria 1025
777 Ga0436365_0106092 3300039437 Bacteria 1026
778 Ga0436365_0391663 3300039437 Bacteria 4253
779 Ga0451793_0102715 3300041452 Unclassified 1591
780 Ga0451849_1184600 3300041505 Bacteria 1608
781 Ga0439442_008493 3300042002 Bacteria 2074
782 Ga0439449_0040363 3300042007 Bacteria 1735
783 Ga0439434_0028813 3300042435 Bacteria 1683
784 Ga0439435_0088725 3300042436 Bacteria 937
785 Ga0451577_0101308 3300042876 Bacteria 2573
786 Ga0466969_0000030 3300044656 Bacteria 90368
787 Ga0466969_0237531 3300044656 Unclassified 827
788 Ga0466972_0047886 3300044658 Bacteria 2066
789 Ga0466972_0230362 3300044658 Bacteria 867
790 Ga0453683_0483855 3300044673 Bacteria 802
791 Ga0466966_0000293 3300044684 Bacteria 32754
792 Ga0466961_0018147 3300044693 Bacteria 4525
793 Ga0466961_0215382 3300044693 Unclassified 1185
794 Ga0453684_0002051 3300044712 Bacteria 51267
795 Ga0466971_0036594 3300044719 Bacteria 2201
796 Ga0466968_0053808 3300044735 Bacteria 1725
797 Ga0466970_0007416 3300044765 Bacteria 5495
798 Ga0466957_0219891 3300044842 Bacteria 1254
799 Ga0466959_0000021 3300045049 Bacteria 132387
800 Ga0466959_0000330 3300045049 Bacteria 27908
801 Ga0451576_0000002 3300045051 Bacteria 1670975
802 Ga0451576_0007316 3300045051 Bacteria 13256
803 Ga0451576_0013939 3300045051 Bacteria 8973
804 Ga0466958_0120752 3300045836 Bacteria 1640
805 Ga0495603_0273756 3300046455 Bacteria 971
806 Ga0495629_0088441 3300046459 Bacteria 2161
807 Ga0495653_0088056 3300046463 Bacteria 2279
808 Ga0495594_0215178 3300046499 Unclassified 1096
809 Ga0495606_0004295 3300046507 Bacteria 14349
810 Ga0495618_0008041 3300046514 Bacteria 6385
811 Ga0495628_0032939 3300046516 Bacteria 4179
812 Ga0495630_0008579 3300046517 Bacteria 7333
813 Ga0495643_0085426 3300046522 Bacteria 1636
814 Ga0495640_0533669 3300046533 Bacteria 712
815 Ga0495587_0056600 3300046536 Bacteria 2307
816 Ga0495645_0325772 3300046543 Bacteria 996
817 Ga0495611_0018419 3300046648 Bacteria 2994
818 Ga0495625_0215316 3300046660 Bacteria 1261
819 Ga0495613_0115296 3300046689 Bacteria 1934
820 Ga0495600_0588901 3300046809 Unclassified 677
821 Ga0495604_0195883 3300047317 Bacteria 1405
822 Ga0495672_0029236 3300047320 Unclassified 3474
823 Ga0495684_0089414 3300047471 Unclassified 2333
824 Ga0495686_0000010 3300047472 Bacteria 573229
825 Ga0495686_0028548 3300047472 Bacteria 3633
826 Ga0496110_0045077 3300048913 Bacteria 3853
827 Ga0496114_0581616 3300048917 Bacteria 988
828 Ga0496126_0285154 3300048929 Bacteria 1367
829 Ga0501032_0020959 3300049569 Bacteria 4548
830 Ga0501032_0148057 3300049569 Unclassified 1545
831 Ga0501033_0080023 3300049570 Bacteria 2398
832 Ga0501033_0101937 3300049570 Bacteria 2094
833 Ga0501033_0454569 3300049570 Bacteria 889
834 Ga0501034_0010577 3300049571 Bacteria 9602
835 Ga0501034_0014037 3300049571 Bacteria 8249
836 Ga0501034_0033351 3300049571 Bacteria 5225
837 Ga0501034_0057606 3300049571 Bacteria 3906
838 Ga0501034_0275762 3300049571 Bacteria 1622
839 Ga0501034_0277269 3300049571 Bacteria 1616
840 Ga0501034_0474125 3300049571 Bacteria 1167
841 Ga0501034_0492683 3300049571 Bacteria 1140
842 Ga0501036_0139162 3300049572 Bacteria 2049
843 Ga0501036_0232289 3300049572 Unclassified 1547
844 Ga0501036_0703330 3300049572 Bacteria 835
845 Ga0501037_0069618 3300049573 Bacteria 2561
846 Ga0501037_0143409 3300049573 Bacteria 1709
847 Ga0501037_0332009 3300049573 Bacteria 1051
848 Ga0501038_0047026 3300049574 Bacteria 3739
849 Ga0501038_0673318 3300049574 Unclassified 777
850 Ga0501039_0051374 3300049575 Bacteria 3190
851 Ga0501043_0070025 3300049579 Bacteria 2755
852 Ga0501043_0092913 3300049579 Bacteria 2372
853 Ga0501047_0005749 3300049581 Bacteria 11673
854 Ga0501047_0151868 3300049581 Bacteria 2191
855 Ga0501048_0570906 3300049582 Unclassified 812
856 Ga0501070_0036061 3300049586 Bacteria 4130
857 Ga0501083_0152270 3300049744 Bacteria 1514
858 Ga0501035_0011447 3300049822 Bacteria 8225
859 Ga0501035_0016607 3300049822 Bacteria 6786
860 Ga0501035_0027352 3300049822 Bacteria 5214
861 Ga0501035_0072836 3300049822 Bacteria 3040
862 Ga0501044_0004005 3300049823 Bacteria 16506
863 Ga0501044_0088067 3300049823 Unclassified 3135
864 Ga0501044_0116862 3300049823 Bacteria 2672
865 Ga0501044_0216318 3300049823 Bacteria 1868
866 Ga0501044_0407282 3300049823 Bacteria 1272
867 nmdc:mga05p37_100274_c1 3300050507 Bacteria 3566
868 nmdc:mga09592_87369_c1 3300050508 Bacteria 2662
869 nmdc:mga0qj67_32779_c1 3300050509 Bacteria 4053
870 nmdc:mga06r32_297747_c1 3300050510 Bacteria 1599
871 nmdc:mga06r32_54656_c1 3300050510 Bacteria 3829
872 nmdc:mga08y16_124052_c1 3300050511 Bacteria 2687
873 nmdc:mga08y16_505095_c1 3300050511 Unclassified 1228
874 nmdc:mga08y16_596562_c1 3300050511 Bacteria 1114
875 Ga0500578_0000358 3300053086 Bacteria 56123
876 Ga0500658_0126968 3300053134 Unclassified 1135
877 Ga0500616_0051611 3300053153 Bacteria 2166
878 Ga0500622_0065988 3300053156 Bacteria 1838
879 Ga0500637_0310340 3300053178 Bacteria 856
880 Ga0500587_035492 3300053739 Bacteria 699
881 Ga0466962_0008032 3300061719 Bacteria 5060
882 Ga0466962_0199363 3300061719 Bacteria 978

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053739 Ga0500587_035492 Ga0500587_035492_145_669 173
2 3300013307 Ga0157372_10310941 Ga0157372_103109411 195
3 3300036457 Ga0265778_032959 Ga0265778_032959_50_637 195
4 3300044693 Ga0466961_0215382 Ga0466961_0215382_559_1173 197
5 3300005444 Ga0070694_100097513 Ga0070694_1000975132 198
6 3300005840 Ga0068870_10170179 Ga0068870_101701792 198
7 3300025908 Ga0207643_10017411 Ga0207643_100174112 198
8 3300025914 Ga0207671_10011167 Ga0207671_100111673 198
9 3300025936 Ga0207670_10029226 Ga0207670_100292261 198
10 3300005334 Ga0068869_100274630 Ga0068869_1002746302 199
11 3300005843 Ga0068860_100035807 Ga0068860_1000358073 199
12 3300009147 Ga0114129_10032540 Ga0114129_100325406 199
13 3300025942 Ga0207689_10286108 Ga0207689_102861082 199
14 3300025986 Ga0207658_10278294 Ga0207658_102782942 199
15 3300005543 Ga0070672_100335697 Ga0070672_1003356972 200
16 3300009094 Ga0111539_10142694 Ga0111539_101426942 200
17 3300025913 Ga0207695_10348617 Ga0207695_103486173 200
18 3300025926 Ga0207659_10520986 Ga0207659_105209861 200
19 3300025949 Ga0207667_10137089 Ga0207667_101370893 200
20 3300039437 Ga0436365_0106092 Ga0436365_0106092_124_753 200
21 3300050511 nmdc:mga08y16_505095_c1 nmdc:mga08y16_505095_c1_506_1144 200
22 3300005289 Ga0065704_10123486 Ga0065704_101234862 202
23 3300005459 Ga0068867_100199806 Ga0068867_1001998062 202
24 3300006844 Ga0075428_100151035 Ga0075428_1001510352 202
25 3300006846 Ga0075430_100007274 Ga0075430_1000072745 202
26 3300009147 Ga0114129_10194413 Ga0114129_101944133 202
27 3300041452 Ga0451793_0102715 Ga0451793_0102715_916_1560 202
28 3300049570 Ga0501033_0454569 Ga0501033_0454569_119_802 202
29 3300049571 Ga0501034_0014037 Ga0501034_0014037_281_964 202
30 3300049573 Ga0501037_0143409 Ga0501037_0143409_812_1495 202
31 3300049822 Ga0501035_0016607 Ga0501035_0016607_2680_3363 202
32 3300049823 Ga0501044_0088067 Ga0501044_0088067_47_730 202
33 3300050509 nmdc:mga0qj67_32779_c1 nmdc:mga0qj67_32779_c1_1503_2189 202
34 3300050510 nmdc:mga06r32_54656_c1 nmdc:mga06r32_54656_c1_1568_2254 202
35 3300009551 Ga0105238_10058560 Ga0105238_100585603 205
36 iso_pu_bacteria 2840677318 2840679354 205
37 iso_pu_bacteria 2896085136 2896087165 205
38 3300025302 Ga0207426_1000189 Ga0207426_100018912 206
39 3300005335 Ga0070666_10296083 Ga0070666_102960831 207
40 3300005355 Ga0070671_101098322 Ga0070671_1010983221 207
41 3300005535 Ga0070684_100081513 Ga0070684_1000815133 207
42 3300005834 Ga0068851_10443656 Ga0068851_104436561 207
43 3300005841 Ga0068863_100495893 Ga0068863_1004958932 207
44 3300009093 Ga0105240_10001825 Ga0105240_100018255 207
45 3300009176 Ga0105242_10410330 Ga0105242_104103302 207
46 3300009553 Ga0105249_11401850 Ga0105249_114018501 207
47 3300013104 Ga0157370_10636622 Ga0157370_106366221 207
48 3300013296 Ga0157374_10299997 Ga0157374_102999971 207
49 3300013297 Ga0157378_10048964 Ga0157378_100489642 207
50 3300013306 Ga0163162_10147746 Ga0163162_101477462 207
51 3300013306 Ga0163162_10498475 Ga0163162_104984754 207
52 3300013306 Ga0163162_11009847 Ga0163162_110098472 207
53 3300014325 Ga0163163_10064762 Ga0163163_100647622 207
54 3300017792 Ga0163161_10030948 Ga0163161_100309482 207
55 3300025913 Ga0207695_10000209 Ga0207695_1000020974 207
56 3300026088 Ga0207641_10861750 Ga0207641_108617501 207
57 3300031251 Ga0265327_10000107 Ga0265327_1000010792 207
58 3300033180 Ga0307510_10007513 Ga0307510_100075135 207
59 3300035692 Ga0373935_0283596 Ga0373935_0283596_181_807 207
60 3300048917 Ga0496114_0581616 Ga0496114_0581616_142_765 207
61 3300002738 JGI25154J39366_1007391 JGI25154J39366_10073912 208
62 3300003316 rootH1_10004660 rootH1_100046602 208
63 3300003320 rootH2_10062516 rootH2_100625161 208
64 3300003794 Ga0055531_10000118 Ga0055531_1000011847 208
65 3300005290 Ga0065712_10008616 Ga0065712_100086162 208
66 3300005334 Ga0068869_100294029 Ga0068869_1002940292 208
67 3300005336 Ga0070680_100773307 Ga0070680_1007733071 208
68 3300005339 Ga0070660_100004792 Ga0070660_1000047925 208
69 3300005339 Ga0070660_100038196 Ga0070660_1000381962 208
70 3300005339 Ga0070660_100043178 Ga0070660_1000431782 208
71 3300005339 Ga0070660_100083988 Ga0070660_1000839883 208
72 3300005340 Ga0070689_100172551 Ga0070689_1001725512 208
73 3300005340 Ga0070689_100448344 Ga0070689_1004483441 208
74 3300005354 Ga0070675_100212696 Ga0070675_1002126962 208
75 3300005356 Ga0070674_100171840 Ga0070674_1001718402 208
76 3300005364 Ga0070673_100195719 Ga0070673_1001957192 208
77 3300005364 Ga0070673_100197411 Ga0070673_1001974112 208
78 3300005365 Ga0070688_100032273 Ga0070688_1000322732 208
79 3300005365 Ga0070688_100236818 Ga0070688_1002368182 208
80 3300005366 Ga0070659_100038444 Ga0070659_1000384441 208
81 3300005367 Ga0070667_100170843 Ga0070667_1001708432 208
82 3300005367 Ga0070667_100195377 Ga0070667_1001953772 208
83 3300005367 Ga0070667_100308367 Ga0070667_1003083672 208
84 3300005457 Ga0070662_100055639 Ga0070662_1000556393 208
85 3300005466 Ga0070685_10007265 Ga0070685_100072653 208
86 3300005466 Ga0070685_10033897 Ga0070685_100338974 208
87 3300005471 Ga0070698_100001998 Ga0070698_1000019986 208
88 3300005471 Ga0070698_100122946 Ga0070698_1001229461 208
89 3300005530 Ga0070679_100026049 Ga0070679_1000260494 208
90 3300005530 Ga0070679_100624764 Ga0070679_1006247642 208
91 3300005539 Ga0068853_100053788 Ga0068853_1000537883 208
92 3300005543 Ga0070672_100047244 Ga0070672_1000472443 208
93 3300005563 Ga0068855_100017595 Ga0068855_10001759510 208
94 3300005563 Ga0068855_100058177 Ga0068855_1000581777 208
95 3300005563 Ga0068855_100702609 Ga0068855_1007026092 208
96 3300005564 Ga0070664_100049998 Ga0070664_1000499981 208
97 3300005564 Ga0070664_100383122 Ga0070664_1003831223 208
98 3300005577 Ga0068857_100045885 Ga0068857_1000458855 208
99 3300005578 Ga0068854_100816972 Ga0068854_1008169721 208
100 3300005614 Ga0068856_100018504 Ga0068856_1000185045 208
101 3300005614 Ga0068856_100073456 Ga0068856_1000734564 208
102 3300005616 Ga0068852_100534485 Ga0068852_1005344852 208
103 3300005617 Ga0068859_100297349 Ga0068859_1002973492 208
104 3300005617 Ga0068859_100501650 Ga0068859_1005016502 208
105 3300005618 Ga0068864_100114675 Ga0068864_1001146752 208
106 3300005618 Ga0068864_100412039 Ga0068864_1004120392 208
107 3300005618 Ga0068864_100971819 Ga0068864_1009718191 208
108 3300005718 Ga0068866_10205242 Ga0068866_102052422 208
109 3300005719 Ga0068861_100253851 Ga0068861_1002538512 208
110 3300005840 Ga0068870_10362444 Ga0068870_103624442 208
111 3300005841 Ga0068863_100126403 Ga0068863_1001264033 208
112 3300005843 Ga0068860_100045962 Ga0068860_1000459622 208
113 3300005843 Ga0068860_100169026 Ga0068860_1001690262 208
114 3300005843 Ga0068860_101066605 Ga0068860_1010666051 208
115 3300006237 Ga0097621_100021395 Ga0097621_1000213955 208
116 3300006237 Ga0097621_100304357 Ga0097621_1003043572 208
117 3300006237 Ga0097621_100822652 Ga0097621_1008226522 208
118 3300006852 Ga0075433_10578825 Ga0075433_105788252 208
119 3300006931 Ga0097620_100297359 Ga0097620_1002973592 208
120 3300006931 Ga0097620_100501616 Ga0097620_1005016162 208
121 3300009093 Ga0105240_10000905 Ga0105240_1000090540 208
122 3300009093 Ga0105240_10182366 Ga0105240_101823662 208
123 3300009148 Ga0105243_10098133 Ga0105243_100981331 208
124 3300009174 Ga0105241_10032233 Ga0105241_100322332 208
125 3300009176 Ga0105242_10003021 Ga0105242_100030214 208
126 3300009177 Ga0105248_10221882 Ga0105248_102218822 208
127 3300009545 Ga0105237_10000305 Ga0105237_1000030528 208
128 3300009545 Ga0105237_10020409 Ga0105237_1002040912 208
129 3300009545 Ga0105237_10046496 Ga0105237_100464964 208
130 3300009551 Ga0105238_10118144 Ga0105238_101181442 208
131 3300009553 Ga0105249_10013169 Ga0105249_100131692 208
132 3300009553 Ga0105249_10058553 Ga0105249_100585535 208
133 3300009553 Ga0105249_10237511 Ga0105249_102375111 208
134 3300009553 Ga0105249_10789389 Ga0105249_107893891 208
135 3300010375 Ga0105239_10000099 Ga0105239_1000009935 208
136 3300013100 Ga0157373_10111972 Ga0157373_101119721 208
137 3300013102 Ga0157371_10000322 Ga0157371_1000032241 208
138 3300013102 Ga0157371_10002933 Ga0157371_100029331 208
139 3300013102 Ga0157371_10005313 Ga0157371_100053133 208
140 3300013102 Ga0157371_10085960 Ga0157371_100859602 208
141 3300013102 Ga0157371_10126011 Ga0157371_101260112 208
142 3300013102 Ga0157371_10194410 Ga0157371_101944102 208
143 3300013104 Ga0157370_10071434 Ga0157370_100714343 208
144 3300013104 Ga0157370_10162581 Ga0157370_101625812 208
145 3300013104 Ga0157370_10191287 Ga0157370_101912873 208
146 3300013105 Ga0157369_10015570 Ga0157369_100155703 208
147 3300013105 Ga0157369_10100069 Ga0157369_101000693 208
148 3300013296 Ga0157374_10000027 Ga0157374_10000027179 208
149 3300013296 Ga0157374_10108533 Ga0157374_101085335 208
150 3300013296 Ga0157374_10213399 Ga0157374_102133992 208
151 3300013297 Ga0157378_10049021 Ga0157378_100490213 208
152 3300013306 Ga0163162_10093714 Ga0163162_100937142 208
153 3300013306 Ga0163162_10124903 Ga0163162_101249034 208
154 3300013306 Ga0163162_10286741 Ga0163162_102867412 208
155 3300013306 Ga0163162_10338635 Ga0163162_103386352 208
156 3300013306 Ga0163162_10543549 Ga0163162_105435492 208
157 3300013307 Ga0157372_10230504 Ga0157372_102305042 208
158 3300013307 Ga0157372_10452285 Ga0157372_104522854 208
159 3300013307 Ga0157372_10696703 Ga0157372_106967031 208
160 3300013307 Ga0157372_10782216 Ga0157372_107822162 208
161 3300013308 Ga0157375_10294269 Ga0157375_102942692 208
162 3300013308 Ga0157375_10477369 Ga0157375_104773691 208
163 3300013308 Ga0157375_10563568 Ga0157375_105635682 208
164 3300014325 Ga0163163_10597338 Ga0163163_105973381 208
165 3300014326 Ga0157380_10386905 Ga0157380_103869052 208
166 3300014745 Ga0157377_10016681 Ga0157377_100166812 208
167 3300014745 Ga0157377_10207953 Ga0157377_102079531 208
168 3300014968 Ga0157379_10054403 Ga0157379_100544032 208
169 3300014968 Ga0157379_10556274 Ga0157379_105562742 208
170 3300014969 Ga0157376_10000368 Ga0157376_1000036819 208
171 3300014969 Ga0157376_10197524 Ga0157376_101975241 208
172 3300014969 Ga0157376_10207254 Ga0157376_102072542 208
173 3300017792 Ga0163161_10395678 Ga0163161_103956782 208
174 3300025246 Ga0209646_1001061 Ga0209646_10010612 208
175 3300025304 Ga0209257_1000007 Ga0209257_1000007144 208
176 3300025904 Ga0207647_10261247 Ga0207647_102612471 208
177 3300025907 Ga0207645_10112800 Ga0207645_101128001 208
178 3300025909 Ga0207705_10033049 Ga0207705_100330493 208
179 3300025911 Ga0207654_10005944 Ga0207654_100059449 208
180 3300025913 Ga0207695_10007075 Ga0207695_100070759 208
181 3300025913 Ga0207695_10184568 Ga0207695_101845682 208
182 3300025914 Ga0207671_10012297 Ga0207671_100122973 208
183 3300025914 Ga0207671_10179893 Ga0207671_101798932 208
184 3300025917 Ga0207660_10043520 Ga0207660_100435202 208
185 3300025917 Ga0207660_10103074 Ga0207660_101030741 208
186 3300025919 Ga0207657_10006381 Ga0207657_100063813 208
187 3300025919 Ga0207657_10032094 Ga0207657_100320943 208
188 3300025919 Ga0207657_10054131 Ga0207657_100541312 208
189 3300025919 Ga0207657_10077336 Ga0207657_100773364 208
190 3300025921 Ga0207652_10000327 Ga0207652_1000032734 208
191 3300025921 Ga0207652_10096776 Ga0207652_100967761 208
192 3300025921 Ga0207652_10449164 Ga0207652_104491641 208
193 3300025921 Ga0207652_10484192 Ga0207652_104841922 208
194 3300025923 Ga0207681_10754485 Ga0207681_107544851 208
195 3300025924 Ga0207694_10236795 Ga0207694_102367951 208
196 3300025925 Ga0207650_10338292 Ga0207650_103382922 208
197 3300025932 Ga0207690_10058402 Ga0207690_100584023 208
198 3300025934 Ga0207686_10000884 Ga0207686_100008848 208
199 3300025934 Ga0207686_10112072 Ga0207686_101120722 208
200 3300025934 Ga0207686_10255834 Ga0207686_102558342 208
201 3300025936 Ga0207670_10060545 Ga0207670_100605453 208
202 3300025940 Ga0207691_10019398 Ga0207691_100193982 208
203 3300025942 Ga0207689_10035195 Ga0207689_100351953 208
204 3300025942 Ga0207689_10036311 Ga0207689_100363112 208
205 3300025949 Ga0207667_10202598 Ga0207667_102025982 208
206 3300025949 Ga0207667_10484811 Ga0207667_104848113 208
207 3300025949 Ga0207667_10818356 Ga0207667_108183562 208
208 3300025960 Ga0207651_10040387 Ga0207651_100403872 208
209 3300025961 Ga0207712_10002170 Ga0207712_100021704 208
210 3300025961 Ga0207712_10057941 Ga0207712_100579412 208
211 3300025961 Ga0207712_10068500 Ga0207712_100685003 208
212 3300025972 Ga0207668_10064508 Ga0207668_100645083 208
213 3300025981 Ga0207640_10143843 Ga0207640_101438432 208
214 3300025986 Ga0207658_10492251 Ga0207658_104922512 208
215 3300025986 Ga0207658_10638123 Ga0207658_106381231 208
216 3300026041 Ga0207639_10100248 Ga0207639_101002482 208
217 3300026067 Ga0207678_10059260 Ga0207678_100592603 208
218 3300026067 Ga0207678_10454352 Ga0207678_104543522 208
219 3300026078 Ga0207702_10238026 Ga0207702_102380262 208
220 3300026088 Ga0207641_10001235 Ga0207641_1000123525 208
221 3300026088 Ga0207641_10035180 Ga0207641_100351803 208
222 3300026088 Ga0207641_10361189 Ga0207641_103611891 208
223 3300026089 Ga0207648_10099643 Ga0207648_100996432 208
224 3300026089 Ga0207648_10438726 Ga0207648_104387262 208
225 3300026095 Ga0207676_10263928 Ga0207676_102639281 208
226 3300026095 Ga0207676_10641767 Ga0207676_106417671 208
227 3300026116 Ga0207674_10059130 Ga0207674_100591304 208
228 3300026116 Ga0207674_10439504 Ga0207674_104395041 208
229 3300026142 Ga0207698_10368573 Ga0207698_103685732 208
230 3300028380 Ga0268265_10413193 Ga0268265_104131932 208
231 3300028381 Ga0268264_10133007 Ga0268264_101330072 208
232 3300028786 Ga0307517_10008092 Ga0307517_1000809214 208
233 3300031507 Ga0307509_10206093 Ga0307509_102060932 208
234 3300035410 Ga0373924_0318108 Ga0373924_0318108_24_650 208
235 3300037312 Ga0395899_0001555 Ga0395899_0001555_17297_17926 208
236 3300037312 Ga0395899_0030887 Ga0395899_0030887_2885_3514 208
237 3300037312 Ga0395899_0115442 Ga0395899_0115442_329_958 208
238 3300037418 Ga0395900_0002745 Ga0395900_0002745_17586_18215 208
239 3300037418 Ga0395900_0022520 Ga0395900_0022520_2669_3298 208
240 3300037418 Ga0395900_0797672 Ga0395900_0797672_128_757 208
241 3300037466 Ga0395898_0001910 Ga0395898_0001910_7529_8158 208
242 3300037466 Ga0395898_0012127 Ga0395898_0012127_1409_2038 208
243 3300037466 Ga0395898_0040370 Ga0395898_0040370_2581_3210 208
244 3300037466 Ga0395898_1016531 Ga0395898_1016531_113_742 208
245 3300037471 Ga0395905_0576887 Ga0395905_0576887_365_994 208
246 3300038443 Ga0395901_0001357 Ga0395901_0001357_11300_11929 208
247 3300038443 Ga0395901_0146694 Ga0395901_0146694_1581_2210 208
248 3300042436 Ga0439435_0088725 Ga0439435_0088725_127_753 208
249 3300042876 Ga0451577_0101308 Ga0451577_0101308_937_1578 208
250 3300044656 Ga0466969_0237531 Ga0466969_0237531_145_774 208
251 3300044658 Ga0466972_0047886 Ga0466972_0047886_1289_1927 208
252 3300044673 Ga0453683_0483855 Ga0453683_0483855_42_671 208
253 3300044693 Ga0466961_0018147 Ga0466961_0018147_3647_4276 208
254 3300044712 Ga0453684_0002051 Ga0453684_0002051_39600_40241 208
255 3300044719 Ga0466971_0036594 Ga0466971_0036594_377_1006 208
256 3300044842 Ga0466957_0219891 Ga0466957_0219891_441_1070 208
257 3300045049 Ga0466959_0000330 Ga0466959_0000330_1755_2384 208
258 3300045051 Ga0451576_0007316 Ga0451576_0007316_9852_10481 208
259 3300045051 Ga0451576_0013939 Ga0451576_0013939_284_925 208
260 3300045836 Ga0466958_0120752 Ga0466958_0120752_997_1626 208
261 3300046455 Ga0495603_0273756 Ga0495603_0273756_303_932 208
262 3300046499 Ga0495594_0215178 Ga0495594_0215178_202_831 208
263 3300046660 Ga0495625_0215316 Ga0495625_0215316_184_825 208
264 3300047472 Ga0495686_0000010 Ga0495686_0000010_563050_563679 208
265 3300049571 Ga0501034_0275762 Ga0501034_0275762_339_965 208
266 3300050511 nmdc:mga08y16_124052_c1 nmdc:mga08y16_124052_c1_710_1354 208
267 3300053153 Ga0500616_0051611 Ga0500616_0051611_203_829 208
268 3300061719 Ga0466962_0008032 Ga0466962_0008032_1739_2368 208
269 3300061719 Ga0466962_0199363 Ga0466962_0199363_225_869 208
270 iso_pu_bacteria 2738541278 2738727275 208
271 3300003320 rootH2_10000086 rootH2_1000008626 209
272 3300003320 rootH2_10038964 rootH2_100389642 209
273 3300003320 rootH2_10063811 rootH2_100638111 209
274 3300005328 Ga0070676_10010291 Ga0070676_100102912 209
275 3300005330 Ga0070690_100055055 Ga0070690_1000550552 209
276 3300005333 Ga0070677_10037752 Ga0070677_100377522 209
277 3300005334 Ga0068869_100089932 Ga0068869_1000899322 209
278 3300005334 Ga0068869_100113631 Ga0068869_1001136312 209
279 3300005335 Ga0070666_10069419 Ga0070666_100694192 209
280 3300005335 Ga0070666_10298154 Ga0070666_102981541 209
281 3300005338 Ga0068868_100032721 Ga0068868_1000327213 209
282 3300005338 Ga0068868_100051954 Ga0068868_1000519543 209
283 3300005338 Ga0068868_100164877 Ga0068868_1001648772 209
284 3300005340 Ga0070689_100011512 Ga0070689_1000115125 209
285 3300005347 Ga0070668_100089942 Ga0070668_1000899422 209
286 3300005347 Ga0070668_100458289 Ga0070668_1004582891 209
287 3300005353 Ga0070669_100037456 Ga0070669_1000374561 209
288 3300005353 Ga0070669_100570032 Ga0070669_1005700321 209
289 3300005354 Ga0070675_100087279 Ga0070675_1000872792 209
290 3300005354 Ga0070675_100462515 Ga0070675_1004625151 209
291 3300005355 Ga0070671_100720492 Ga0070671_1007204922 209
292 3300005364 Ga0070673_100026043 Ga0070673_1000260433 209
293 3300005364 Ga0070673_100137787 Ga0070673_1001377872 209
294 3300005365 Ga0070688_100035869 Ga0070688_1000358691 209
295 3300005365 Ga0070688_100514073 Ga0070688_1005140732 209
296 3300005367 Ga0070667_100022878 Ga0070667_1000228782 209
297 3300005367 Ga0070667_100091095 Ga0070667_1000910952 209
298 3300005367 Ga0070667_100108720 Ga0070667_1001087203 209
299 3300005456 Ga0070678_100020940 Ga0070678_1000209404 209
300 3300005457 Ga0070662_100072148 Ga0070662_1000721483 209
301 3300005457 Ga0070662_100207523 Ga0070662_1002075233 209
302 3300005459 Ga0068867_100033261 Ga0068867_1000332612 209
303 3300005459 Ga0068867_100147186 Ga0068867_1001471862 209
304 3300005459 Ga0068867_100317236 Ga0068867_1003172362 209
305 3300005466 Ga0070685_10023071 Ga0070685_100230711 209
306 3300005466 Ga0070685_10551638 Ga0070685_105516381 209
307 3300005535 Ga0070684_100056042 Ga0070684_1000560423 209
308 3300005539 Ga0068853_100227573 Ga0068853_1002275732 209
309 3300005543 Ga0070672_100049253 Ga0070672_1000492533 209
310 3300005544 Ga0070686_100407527 Ga0070686_1004075271 209
311 3300005547 Ga0070693_100337185 Ga0070693_1003371851 209
312 3300005548 Ga0070665_100038063 Ga0070665_1000380633 209
313 3300005548 Ga0070665_100128940 Ga0070665_1001289402 209
314 3300005564 Ga0070664_100310167 Ga0070664_1003101673 209
315 3300005564 Ga0070664_100333241 Ga0070664_1003332412 209
316 3300005578 Ga0068854_100057944 Ga0068854_1000579441 209
317 3300005614 Ga0068856_100157993 Ga0068856_1001579932 209
318 3300005617 Ga0068859_100025982 Ga0068859_1000259823 209
319 3300005617 Ga0068859_100048901 Ga0068859_1000489014 209
320 3300005617 Ga0068859_100494484 Ga0068859_1004944841 209
321 3300005842 Ga0068858_100581653 Ga0068858_1005816532 209
322 3300005842 Ga0068858_101157795 Ga0068858_1011577951 209
323 3300005843 Ga0068860_100038858 Ga0068860_1000388585 209
324 3300005844 Ga0068862_100295962 Ga0068862_1002959622 209
325 3300006237 Ga0097621_100030624 Ga0097621_1000306244 209
326 3300006237 Ga0097621_100363102 Ga0097621_1003631022 209
327 3300006358 Ga0068871_100120751 Ga0068871_1001207512 209
328 3300006881 Ga0068865_100028534 Ga0068865_1000285344 209
329 3300006881 Ga0068865_100058612 Ga0068865_1000586122 209
330 3300006881 Ga0068865_100135681 Ga0068865_1001356811 209
331 3300006931 Ga0097620_100025982 Ga0097620_1000259823 209
332 3300006931 Ga0097620_100048900 Ga0097620_1000489004 209
333 3300006931 Ga0097620_100494477 Ga0097620_1004944771 209
334 3300009093 Ga0105240_10001869 Ga0105240_100018694 209
335 3300009176 Ga0105242_10034122 Ga0105242_100341222 209
336 3300009176 Ga0105242_10300452 Ga0105242_103004522 209
337 3300009176 Ga0105242_10697448 Ga0105242_106974482 209
338 3300009545 Ga0105237_10001224 Ga0105237_1000122423 209
339 3300009545 Ga0105237_10006238 Ga0105237_100062382 209
340 3300009545 Ga0105237_10021612 Ga0105237_100216124 209
341 3300009553 Ga0105249_10370143 Ga0105249_103701432 209
342 3300010375 Ga0105239_10000970 Ga0105239_1000097017 209
343 3300011119 Ga0105246_10464434 Ga0105246_104644342 209
344 3300013102 Ga0157371_10052508 Ga0157371_100525081 209
345 3300013296 Ga0157374_10092412 Ga0157374_100924123 209
346 3300013296 Ga0157374_10301550 Ga0157374_103015501 209
347 3300013296 Ga0157374_10401219 Ga0157374_104012191 209
348 3300013296 Ga0157374_10974599 Ga0157374_109745992 209
349 3300013296 Ga0157374_11150853 Ga0157374_111508531 209
350 3300013297 Ga0157378_10351313 Ga0157378_103513132 209
351 3300013297 Ga0157378_10546246 Ga0157378_105462462 209
352 3300013297 Ga0157378_10679266 Ga0157378_106792662 209
353 3300013306 Ga0163162_10011701 Ga0163162_100117016 209
354 3300013306 Ga0163162_10063130 Ga0163162_100631303 209
355 3300013306 Ga0163162_10089388 Ga0163162_100893883 209
356 3300013306 Ga0163162_10408678 Ga0163162_104086782 209
357 3300013306 Ga0163162_10442966 Ga0163162_104429663 209
358 3300013306 Ga0163162_11368167 Ga0163162_113681671 209
359 3300013308 Ga0157375_10036544 Ga0157375_100365442 209
360 3300013308 Ga0157375_10067374 Ga0157375_100673743 209
361 3300013308 Ga0157375_10187203 Ga0157375_101872032 209
362 3300013308 Ga0157375_10194285 Ga0157375_101942853 209
363 3300014325 Ga0163163_10669931 Ga0163163_106699312 209
364 3300014326 Ga0157380_10095165 Ga0157380_100951652 209
365 3300014745 Ga0157377_10031949 Ga0157377_100319492 209
366 3300014745 Ga0157377_10593357 Ga0157377_105933571 209
367 3300014968 Ga0157379_10151053 Ga0157379_101510532 209
368 3300014969 Ga0157376_10070002 Ga0157376_100700023 209
369 3300014969 Ga0157376_10902375 Ga0157376_109023751 209
370 3300014969 Ga0157376_11079453 Ga0157376_110794531 209
371 3300021384 Ga0213876_10058848 Ga0213876_100588483 209
372 3300025315 Ga0207697_10021308 Ga0207697_100213083 209
373 3300025899 Ga0207642_10039985 Ga0207642_100399852 209
374 3300025901 Ga0207688_10006914 Ga0207688_100069146 209
375 3300025903 Ga0207680_10014089 Ga0207680_100140892 209
376 3300025903 Ga0207680_10043792 Ga0207680_100437921 209
377 3300025907 Ga0207645_10000307 Ga0207645_1000030737 209
378 3300025907 Ga0207645_10012698 Ga0207645_100126983 209
379 3300025923 Ga0207681_10100784 Ga0207681_101007841 209
380 3300025926 Ga0207659_10082309 Ga0207659_100823092 209
381 3300025926 Ga0207659_10087184 Ga0207659_100871842 209
382 3300025926 Ga0207659_10370692 Ga0207659_103706921 209
383 3300025926 Ga0207659_10449192 Ga0207659_104491921 209
384 3300025932 Ga0207690_10087131 Ga0207690_100871312 209
385 3300025933 Ga0207706_10036390 Ga0207706_100363903 209
386 3300025933 Ga0207706_10105265 Ga0207706_101052653 209
387 3300025933 Ga0207706_10286075 Ga0207706_102860752 209
388 3300025934 Ga0207686_10056406 Ga0207686_100564063 209
389 3300025936 Ga0207670_10105561 Ga0207670_101055612 209
390 3300025937 Ga0207669_10067489 Ga0207669_100674892 209
391 3300025938 Ga0207704_10027351 Ga0207704_100273513 209
392 3300025938 Ga0207704_10111592 Ga0207704_101115922 209
393 3300025938 Ga0207704_10139308 Ga0207704_101393082 209
394 3300025938 Ga0207704_10586710 Ga0207704_105867101 209
395 3300025940 Ga0207691_10019465 Ga0207691_100194652 209
396 3300025942 Ga0207689_10001757 Ga0207689_1000175713 209
397 3300025942 Ga0207689_10010694 Ga0207689_100106946 209
398 3300025942 Ga0207689_10184929 Ga0207689_101849291 209
399 3300025960 Ga0207651_10061582 Ga0207651_100615822 209
400 3300025960 Ga0207651_10100504 Ga0207651_101005042 209
401 3300025960 Ga0207651_10640476 Ga0207651_106404761 209
402 3300025972 Ga0207668_10812858 Ga0207668_108128581 209
403 3300025981 Ga0207640_10070650 Ga0207640_100706502 209
404 3300025986 Ga0207658_10235320 Ga0207658_102353202 209
405 3300026023 Ga0207677_10034595 Ga0207677_100345952 209
406 3300026023 Ga0207677_10065555 Ga0207677_100655553 209
407 3300026023 Ga0207677_10197317 Ga0207677_101973171 209
408 3300026041 Ga0207639_10093825 Ga0207639_100938252 209
409 3300026041 Ga0207639_11017861 Ga0207639_110178611 209
410 3300026078 Ga0207702_10095210 Ga0207702_100952102 209
411 3300026089 Ga0207648_10001972 Ga0207648_100019727 209
412 3300026089 Ga0207648_10282105 Ga0207648_102821052 209
413 3300026095 Ga0207676_10277661 Ga0207676_102776612 209
414 3300026121 Ga0207683_10003643 Ga0207683_100036436 209
415 3300026121 Ga0207683_10446589 Ga0207683_104465891 209
416 3300028379 Ga0268266_10543577 Ga0268266_105435771 209
417 3300028380 Ga0268265_10114602 Ga0268265_101146022 209
418 3300028380 Ga0268265_10621433 Ga0268265_106214332 209
419 3300028381 Ga0268264_10010600 Ga0268264_100106005 209
420 3300028381 Ga0268264_10079567 Ga0268264_100795672 209
421 3300028577 Ga0265318_10132870 Ga0265318_101328701 209
422 3300031242 Ga0265329_10049512 Ga0265329_100495122 209
423 3300031711 Ga0265314_10015531 Ga0265314_100155313 209
424 3300035086 Ga0373934_0109733 Ga0373934_0109733_127_756 209
425 3300035410 Ga0373924_0051757 Ga0373924_0051757_454_1083 209
426 3300036401 Ga0373937_0010916 Ga0373937_0010916_3028_3657 209
427 3300037068 Ga0373925_0667824 Ga0373925_0667824_33_662 209
428 3300039437 Ga0436365_0391663 Ga0436365_0391663_1096_1731 209
429 3300046459 Ga0495629_0088441 Ga0495629_0088441_1110_1739 209
430 3300046463 Ga0495653_0088056 Ga0495653_0088056_1365_1994 209
431 3300046507 Ga0495606_0004295 Ga0495606_0004295_5837_6487 209
432 3300046514 Ga0495618_0008041 Ga0495618_0008041_1884_2513 209
433 3300046516 Ga0495628_0032939 Ga0495628_0032939_1894_2523 209
434 3300046517 Ga0495630_0008579 Ga0495630_0008579_248_877 209
435 3300046533 Ga0495640_0533669 Ga0495640_0533669_42_671 209
436 3300046536 Ga0495587_0056600 Ga0495587_0056600_782_1411 209
437 3300046543 Ga0495645_0325772 Ga0495645_0325772_12_641 209
438 3300046689 Ga0495613_0115296 Ga0495613_0115296_173_802 209
439 3300046809 Ga0495600_0588901 Ga0495600_0588901_11_640 209
440 3300047317 Ga0495604_0195883 Ga0495604_0195883_284_913 209
441 3300047471 Ga0495684_0089414 Ga0495684_0089414_211_840 209
442 3300049569 Ga0501032_0020959 Ga0501032_0020959_101_733 209
443 3300049570 Ga0501033_0080023 Ga0501033_0080023_113_745 209
444 3300049571 Ga0501034_0057606 Ga0501034_0057606_88_720 209
445 3300049572 Ga0501036_0232289 Ga0501036_0232289_70_702 209
446 3300049573 Ga0501037_0069618 Ga0501037_0069618_334_966 209
447 3300049574 Ga0501038_0047026 Ga0501038_0047026_83_715 209
448 3300049575 Ga0501039_0051374 Ga0501039_0051374_293_925 209
449 3300049579 Ga0501043_0070025 Ga0501043_0070025_627_1259 209
450 3300049581 Ga0501047_0151868 Ga0501047_0151868_1449_2081 209
451 3300049582 Ga0501048_0570906 Ga0501048_0570906_47_679 209
452 3300049822 Ga0501035_0011447 Ga0501035_0011447_6987_7619 209
453 3300049823 Ga0501044_0004005 Ga0501044_0004005_11431_12063 209
454 iso_pu_bacteria 2919683626 2919688326 209
455 3300005293 Ga0065715_10193573 Ga0065715_101935732 210
456 3300005295 Ga0065707_10271268 Ga0065707_102712681 210
457 3300005327 Ga0070658_10265083 Ga0070658_102650832 210
458 3300005329 Ga0070683_100216563 Ga0070683_1002165633 210
459 3300005330 Ga0070690_100146378 Ga0070690_1001463782 210
460 3300005331 Ga0070670_100541123 Ga0070670_1005411232 210
461 3300005335 Ga0070666_10084019 Ga0070666_100840193 210
462 3300005336 Ga0070680_100040658 Ga0070680_1000406585 210
463 3300005337 Ga0070682_100036250 Ga0070682_1000362501 210
464 3300005338 Ga0068868_100146541 Ga0068868_1001465412 210
465 3300005339 Ga0070660_100015326 Ga0070660_1000153263 210
466 3300005344 Ga0070661_100111538 Ga0070661_1001115382 210
467 3300005344 Ga0070661_100207403 Ga0070661_1002074033 210
468 3300005353 Ga0070669_100044130 Ga0070669_1000441301 210
469 3300005355 Ga0070671_100169381 Ga0070671_1001693811 210
470 3300005364 Ga0070673_100464888 Ga0070673_1004648881 210
471 3300005366 Ga0070659_100066213 Ga0070659_1000662133 210
472 3300005436 Ga0070713_100901584 Ga0070713_1009015841 210
473 3300005456 Ga0070678_100386384 Ga0070678_1003863842 210
474 3300005457 Ga0070662_100171982 Ga0070662_1001719821 210
475 3300005458 Ga0070681_10815032 Ga0070681_108150322 210
476 3300005459 Ga0068867_100081735 Ga0068867_1000817355 210
477 3300005459 Ga0068867_100212274 Ga0068867_1002122743 210
478 3300005530 Ga0070679_100002258 Ga0070679_10000225813 210
479 3300005530 Ga0070679_100057506 Ga0070679_1000575064 210
480 3300005530 Ga0070679_100621805 Ga0070679_1006218052 210
481 3300005535 Ga0070684_100015813 Ga0070684_1000158134 210
482 3300005539 Ga0068853_100052216 Ga0068853_1000522164 210
483 3300005547 Ga0070693_100172521 Ga0070693_1001725212 210
484 3300005563 Ga0068855_100059775 Ga0068855_1000597752 210
485 3300005563 Ga0068855_100129917 Ga0068855_1001299175 210
486 3300005563 Ga0068855_100318902 Ga0068855_1003189023 210
487 3300005564 Ga0070664_100065607 Ga0070664_1000656074 210
488 3300005577 Ga0068857_100176284 Ga0068857_1001762842 210
489 3300005577 Ga0068857_100492779 Ga0068857_1004927792 210
490 3300005578 Ga0068854_100201925 Ga0068854_1002019252 210
491 3300005578 Ga0068854_100356570 Ga0068854_1003565703 210
492 3300005614 Ga0068856_100046172 Ga0068856_1000461721 210
493 3300005614 Ga0068856_100290051 Ga0068856_1002900512 210
494 3300005616 Ga0068852_100001067 Ga0068852_1000010673 210
495 3300005616 Ga0068852_100140582 Ga0068852_1001405821 210
496 3300005616 Ga0068852_100189766 Ga0068852_1001897662 210
497 3300005616 Ga0068852_100586261 Ga0068852_1005862612 210
498 3300005618 Ga0068864_100809383 Ga0068864_1008093832 210
499 3300005719 Ga0068861_100028443 Ga0068861_1000284432 210
500 3300005834 Ga0068851_10093855 Ga0068851_100938552 210
501 3300005843 Ga0068860_100220869 Ga0068860_1002208692 210
502 3300005985 Ga0081539_10000714 Ga0081539_1000071480 210
503 3300006237 Ga0097621_100636901 Ga0097621_1006369011 210
504 3300006358 Ga0068871_100381121 Ga0068871_1003811212 210
505 3300006358 Ga0068871_100493079 Ga0068871_1004930791 210
506 3300009093 Ga0105240_10115290 Ga0105240_101152901 210
507 3300009545 Ga0105237_10035034 Ga0105237_100350344 210
508 3300009551 Ga0105238_10002413 Ga0105238_100024138 210
509 3300009553 Ga0105249_10047364 Ga0105249_100473642 210
510 3300013100 Ga0157373_10003026 Ga0157373_1000302611 210
511 3300013100 Ga0157373_10059535 Ga0157373_100595353 210
512 3300013100 Ga0157373_10106400 Ga0157373_101064002 210
513 3300013100 Ga0157373_10487325 Ga0157373_104873252 210
514 3300013102 Ga0157371_10005951 Ga0157371_100059515 210
515 3300013102 Ga0157371_10095147 Ga0157371_100951472 210
516 3300013102 Ga0157371_10268800 Ga0157371_102688002 210
517 3300013102 Ga0157371_10301071 Ga0157371_103010711 210
518 3300013104 Ga0157370_10000651 Ga0157370_100006513 210
519 3300013104 Ga0157370_10008098 Ga0157370_100080989 210
520 3300013104 Ga0157370_10016368 Ga0157370_100163683 210
521 3300013104 Ga0157370_10376078 Ga0157370_103760782 210
522 3300013104 Ga0157370_10434293 Ga0157370_104342932 210
523 3300013105 Ga0157369_10035829 Ga0157369_100358292 210
524 3300013105 Ga0157369_10157274 Ga0157369_101572743 210
525 3300013105 Ga0157369_10183254 Ga0157369_101832542 210
526 3300013105 Ga0157369_10372791 Ga0157369_103727912 210
527 3300013296 Ga0157374_10021940 Ga0157374_100219404 210
528 3300013296 Ga0157374_10192637 Ga0157374_101926372 210
529 3300013296 Ga0157374_10946476 Ga0157374_109464761 210
530 3300013297 Ga0157378_10854318 Ga0157378_108543182 210
531 3300013297 Ga0157378_11265446 Ga0157378_112654461 210
532 3300013306 Ga0163162_10060685 Ga0163162_100606852 210
533 3300013307 Ga0157372_10001117 Ga0157372_1000111713 210
534 3300013307 Ga0157372_10005797 Ga0157372_100057977 210
535 3300013307 Ga0157372_10026752 Ga0157372_100267523 210
536 3300013307 Ga0157372_10226138 Ga0157372_102261382 210
537 3300013307 Ga0157372_10653420 Ga0157372_106534202 210
538 3300014968 Ga0157379_10450116 Ga0157379_104501161 210
539 3300014969 Ga0157376_10450134 Ga0157376_104501342 210
540 3300017792 Ga0163161_10364283 Ga0163161_103642831 210
541 3300025315 Ga0207697_10113767 Ga0207697_101137671 210
542 3300025904 Ga0207647_10004913 Ga0207647_100049137 210
543 3300025904 Ga0207647_10188660 Ga0207647_101886602 210
544 3300025909 Ga0207705_10056453 Ga0207705_100564531 210
545 3300025917 Ga0207660_10028421 Ga0207660_100284215 210
546 3300025919 Ga0207657_10004767 Ga0207657_1000476710 210
547 3300025919 Ga0207657_10127034 Ga0207657_101270344 210
548 3300025920 Ga0207649_10078523 Ga0207649_100785231 210
549 3300025920 Ga0207649_10736484 Ga0207649_107364841 210
550 3300025921 Ga0207652_10096447 Ga0207652_100964473 210
551 3300025921 Ga0207652_10289767 Ga0207652_102897673 210
552 3300025924 Ga0207694_10411104 Ga0207694_104111042 210
553 3300025926 Ga0207659_10047282 Ga0207659_100472823 210
554 3300025931 Ga0207644_10089622 Ga0207644_100896221 210
555 3300025931 Ga0207644_10161227 Ga0207644_101612272 210
556 3300025932 Ga0207690_10100285 Ga0207690_101002852 210
557 3300025933 Ga0207706_10026330 Ga0207706_100263306 210
558 3300025940 Ga0207691_10782327 Ga0207691_107823271 210
559 3300025945 Ga0207679_10281138 Ga0207679_102811382 210
560 3300025945 Ga0207679_10772856 Ga0207679_107728561 210
561 3300025949 Ga0207667_10002405 Ga0207667_1000240521 210
562 3300025949 Ga0207667_10225049 Ga0207667_102250493 210
563 3300025949 Ga0207667_10298385 Ga0207667_102983852 210
564 3300025949 Ga0207667_10378758 Ga0207667_103787581 210
565 3300025960 Ga0207651_10128569 Ga0207651_101285691 210
566 3300025961 Ga0207712_10038438 Ga0207712_100384382 210
567 3300025981 Ga0207640_10207810 Ga0207640_102078103 210
568 3300026023 Ga0207677_10081127 Ga0207677_100811272 210
569 3300026041 Ga0207639_10304730 Ga0207639_103047302 210
570 3300026075 Ga0207708_10446038 Ga0207708_104460381 210
571 3300026089 Ga0207648_10107946 Ga0207648_101079465 210
572 3300026089 Ga0207648_10544182 Ga0207648_105441822 210
573 3300026116 Ga0207674_10004889 Ga0207674_100048897 210
574 3300026116 Ga0207674_10007799 Ga0207674_100077993 210
575 3300026116 Ga0207674_10175510 Ga0207674_101755104 210
576 3300026121 Ga0207683_10268077 Ga0207683_102680772 210
577 3300026142 Ga0207698_10003337 Ga0207698_100033375 210
578 3300026142 Ga0207698_10075259 Ga0207698_100752592 210
579 3300026142 Ga0207698_10357958 Ga0207698_103579581 210
580 3300031251 Ga0265327_10123244 Ga0265327_101232442 210
581 3300035692 Ga0373935_0138940 Ga0373935_0138940_457_1122 210
582 3300037312 Ga0395899_0323287 Ga0395899_0323287_341_976 210
583 3300037418 Ga0395900_0290859 Ga0395900_0290859_453_1088 210
584 3300037466 Ga0395898_0176571 Ga0395898_0176571_35_670 210
585 3300037471 Ga0395905_0194926 Ga0395905_0194926_967_1602 210
586 3300044735 Ga0466968_0053808 Ga0466968_0053808_754_1503 210
587 3300044765 Ga0466970_0007416 Ga0466970_0007416_3865_4614 210
588 3300047472 Ga0495686_0028548 Ga0495686_0028548_446_1096 210
589 3300049571 Ga0501034_0277269 Ga0501034_0277269_435_1139 210
590 3300049571 Ga0501034_0474125 Ga0501034_0474125_24_665 210
591 3300049571 Ga0501034_0492683 Ga0501034_0492683_245_880 210
592 3300049572 Ga0501036_0703330 Ga0501036_0703330_171_806 210
593 3300049573 Ga0501037_0332009 Ga0501037_0332009_310_951 210
594 3300049579 Ga0501043_0092913 Ga0501043_0092913_598_1233 210
595 3300049744 Ga0501083_0152270 Ga0501083_0152270_689_1333 210
596 3300049823 Ga0501044_0407282 Ga0501044_0407282_356_991 210
597 3300050511 nmdc:mga08y16_596562_c1 nmdc:mga08y16_596562_c1_209_847 210
598 3300003316 rootH1_10037794 rootH1_100377942 211
599 3300003320 rootH2_10016021 rootH2_100160217 211
600 3300003322 rootL2_10072197 rootL2_100721972 211
601 3300003323 rootH1_10013386 rootH1_1001338639 211
602 3300005289 Ga0065704_10088208 Ga0065704_100882082 211
603 3300005327 Ga0070658_10034177 Ga0070658_100341772 211
604 3300005327 Ga0070658_10047119 Ga0070658_100471195 211
605 3300005327 Ga0070658_10055349 Ga0070658_100553492 211
606 3300005327 Ga0070658_10270126 Ga0070658_102701262 211
607 3300005328 Ga0070676_10666931 Ga0070676_106669311 211
608 3300005329 Ga0070683_100004806 Ga0070683_1000048069 211
609 3300005329 Ga0070683_100005679 Ga0070683_1000056794 211
610 3300005329 Ga0070683_100034348 Ga0070683_1000343482 211
611 3300005329 Ga0070683_100051414 Ga0070683_1000514142 211
612 3300005331 Ga0070670_100478408 Ga0070670_1004784081 211
613 3300005334 Ga0068869_100050141 Ga0068869_1000501413 211
614 3300005334 Ga0068869_100264094 Ga0068869_1002640942 211
615 3300005336 Ga0070680_100028967 Ga0070680_1000289675 211
616 3300005336 Ga0070680_100035203 Ga0070680_1000352034 211
617 3300005336 Ga0070680_100043701 Ga0070680_1000437013 211
618 3300005337 Ga0070682_100039572 Ga0070682_1000395723 211
619 3300005338 Ga0068868_100065301 Ga0068868_1000653013 211
620 3300005338 Ga0068868_100371666 Ga0068868_1003716662 211
621 3300005339 Ga0070660_100050004 Ga0070660_1000500042 211
622 3300005339 Ga0070660_100207768 Ga0070660_1002077682 211
623 3300005340 Ga0070689_100006521 Ga0070689_1000065214 211
624 3300005340 Ga0070689_100100417 Ga0070689_1001004172 211
625 3300005341 Ga0070691_10104069 Ga0070691_101040692 211
626 3300005343 Ga0070687_100018462 Ga0070687_1000184621 211
627 3300005344 Ga0070661_100002893 Ga0070661_1000028935 211
628 3300005344 Ga0070661_100003239 Ga0070661_1000032399 211
629 3300005347 Ga0070668_100233614 Ga0070668_1002336142 211
630 3300005356 Ga0070674_100456778 Ga0070674_1004567782 211
631 3300005364 Ga0070673_100064191 Ga0070673_1000641913 211
632 3300005364 Ga0070673_100179835 Ga0070673_1001798353 211
633 3300005365 Ga0070688_100008347 Ga0070688_1000083472 211
634 3300005366 Ga0070659_100023009 Ga0070659_1000230094 211
635 3300005441 Ga0070700_100448778 Ga0070700_1004487781 211
636 3300005455 Ga0070663_100025763 Ga0070663_1000257634 211
637 3300005455 Ga0070663_100049825 Ga0070663_1000498251 211
638 3300005455 Ga0070663_100258429 Ga0070663_1002584292 211
639 3300005456 Ga0070678_100007828 Ga0070678_1000078282 211
640 3300005457 Ga0070662_100004115 Ga0070662_1000041155 211
641 3300005457 Ga0070662_100027222 Ga0070662_1000272223 211
642 3300005458 Ga0070681_10046721 Ga0070681_100467213 211
643 3300005458 Ga0070681_10056362 Ga0070681_100563622 211
644 3300005458 Ga0070681_10058585 Ga0070681_100585853 211
645 3300005458 Ga0070681_10445960 Ga0070681_104459601 211
646 3300005458 Ga0070681_10915985 Ga0070681_109159851 211
647 3300005459 Ga0068867_100277877 Ga0068867_1002778771 211
648 3300005459 Ga0068867_100366159 Ga0068867_1003661591 211
649 3300005530 Ga0070679_100000065 Ga0070679_1000000658 211
650 3300005530 Ga0070679_100051387 Ga0070679_1000513874 211
651 3300005530 Ga0070679_100080308 Ga0070679_1000803082 211
652 3300005530 Ga0070679_100212593 Ga0070679_1002125932 211
653 3300005535 Ga0070684_100003838 Ga0070684_10000383810 211
654 3300005535 Ga0070684_100004617 Ga0070684_1000046179 211
655 3300005536 Ga0070697_101156271 Ga0070697_1011562711 211
656 3300005539 Ga0068853_100008100 Ga0068853_1000081005 211
657 3300005539 Ga0068853_100014757 Ga0068853_1000147573 211
658 3300005539 Ga0068853_100016341 Ga0068853_1000163416 211
659 3300005539 Ga0068853_100278507 Ga0068853_1002785071 211
660 3300005543 Ga0070672_100058136 Ga0070672_1000581362 211
661 3300005543 Ga0070672_100592888 Ga0070672_1005928881 211
662 3300005544 Ga0070686_100190493 Ga0070686_1001904931 211
663 3300005563 Ga0068855_100003936 Ga0068855_10000393613 211
664 3300005563 Ga0068855_100040646 Ga0068855_1000406465 211
665 3300005563 Ga0068855_100071606 Ga0068855_1000716064 211
666 3300005563 Ga0068855_100102170 Ga0068855_1001021704 211
667 3300005563 Ga0068855_100207033 Ga0068855_1002070332 211
668 3300005563 Ga0068855_100662720 Ga0068855_1006627201 211
669 3300005564 Ga0070664_100008799 Ga0070664_1000087995 211
670 3300005577 Ga0068857_100007481 Ga0068857_1000074814 211
671 3300005577 Ga0068857_100035569 Ga0068857_1000355694 211
672 3300005577 Ga0068857_100140525 Ga0068857_1001405252 211
673 3300005577 Ga0068857_100170536 Ga0068857_1001705363 211
674 3300005577 Ga0068857_100452784 Ga0068857_1004527842 211
675 3300005578 Ga0068854_100056669 Ga0068854_1000566692 211
676 3300005578 Ga0068854_100525611 Ga0068854_1005256112 211
677 3300005614 Ga0068856_100024901 Ga0068856_1000249012 211
678 3300005614 Ga0068856_100157846 Ga0068856_1001578462 211
679 3300005616 Ga0068852_100002354 Ga0068852_10000235411 211
680 3300005616 Ga0068852_100404200 Ga0068852_1004042002 211
681 3300005616 Ga0068852_100421151 Ga0068852_1004211511 211
682 3300005616 Ga0068852_100749958 Ga0068852_1007499582 211
683 3300005617 Ga0068859_100035397 Ga0068859_1000353971 211
684 3300005617 Ga0068859_100045776 Ga0068859_1000457763 211
685 3300005618 Ga0068864_100077069 Ga0068864_1000770691 211
686 3300005618 Ga0068864_100672912 Ga0068864_1006729121 211
687 3300005834 Ga0068851_10215517 Ga0068851_102155171 211
688 3300005841 Ga0068863_100328903 Ga0068863_1003289031 211
689 3300005843 Ga0068860_100025430 Ga0068860_1000254302 211
690 3300005844 Ga0068862_100012633 Ga0068862_1000126332 211
691 3300006844 Ga0075428_100064824 Ga0075428_1000648243 211
692 3300006931 Ga0097620_100035399 Ga0097620_1000353991 211
693 3300006931 Ga0097620_100045776 Ga0097620_1000457763 211
694 3300006931 Ga0097620_100896913 Ga0097620_1008969131 211
695 3300009093 Ga0105240_10000383 Ga0105240_100003834 211
696 3300009093 Ga0105240_10011676 Ga0105240_1001167616 211
697 3300009093 Ga0105240_10014537 Ga0105240_1001453710 211
698 3300009094 Ga0111539_10024746 Ga0111539_100247465 211
699 3300009174 Ga0105241_10010223 Ga0105241_100102236 211
700 3300009174 Ga0105241_10220114 Ga0105241_102201142 211
701 3300009176 Ga0105242_10777737 Ga0105242_107777371 211
702 3300009545 Ga0105237_10003156 Ga0105237_1000315618 211
703 3300009545 Ga0105237_10003946 Ga0105237_100039469 211
704 3300009553 Ga0105249_10697993 Ga0105249_106979932 211
705 3300010375 Ga0105239_10003044 Ga0105239_100030448 211
706 3300010375 Ga0105239_10009415 Ga0105239_1000941510 211
707 3300010375 Ga0105239_10070884 Ga0105239_100708842 211
708 3300010375 Ga0105239_10119128 Ga0105239_101191283 211
709 3300011119 Ga0105246_10227206 Ga0105246_102272061 211
710 3300013100 Ga0157373_10016192 Ga0157373_100161923 211
711 3300013100 Ga0157373_10032989 Ga0157373_100329893 211
712 3300013100 Ga0157373_10047207 Ga0157373_100472072 211
713 3300013100 Ga0157373_10063514 Ga0157373_100635142 211
714 3300013100 Ga0157373_10089149 Ga0157373_100891492 211
715 3300013100 Ga0157373_10126561 Ga0157373_101265612 211
716 3300013102 Ga0157371_10022566 Ga0157371_100225663 211
717 3300013102 Ga0157371_10046908 Ga0157371_100469083 211
718 3300013102 Ga0157371_10073653 Ga0157371_100736532 211
719 3300013102 Ga0157371_10274289 Ga0157371_102742892 211
720 3300013104 Ga0157370_10042948 Ga0157370_100429482 211
721 3300013105 Ga0157369_10014417 Ga0157369_100144175 211
722 3300013105 Ga0157369_10030664 Ga0157369_100306646 211
723 3300013105 Ga0157369_10042173 Ga0157369_100421735 211
724 3300013105 Ga0157369_10297523 Ga0157369_102975231 211
725 3300013105 Ga0157369_10392266 Ga0157369_103922662 211
726 3300013296 Ga0157374_10003778 Ga0157374_100037789 211
727 3300013296 Ga0157374_10860394 Ga0157374_108603941 211
728 3300013297 Ga0157378_10095326 Ga0157378_100953262 211
729 3300013297 Ga0157378_10355512 Ga0157378_103555122 211
730 3300013306 Ga0163162_10056799 Ga0163162_100567993 211
731 3300013307 Ga0157372_10018334 Ga0157372_100183347 211
732 3300013307 Ga0157372_10123156 Ga0157372_101231564 211
733 3300013307 Ga0157372_10151232 Ga0157372_101512322 211
734 3300013307 Ga0157372_10193760 Ga0157372_101937603 211
735 3300013308 Ga0157375_10013929 Ga0157375_100139295 211
736 3300013308 Ga0157375_10546869 Ga0157375_105468691 211
737 3300013308 Ga0157375_10733864 Ga0157375_107338642 211
738 3300014325 Ga0163163_10000781 Ga0163163_1000078125 211
739 3300014326 Ga0157380_10050034 Ga0157380_100500342 211
740 3300014326 Ga0157380_10320471 Ga0157380_103204712 211
741 3300014745 Ga0157377_10004114 Ga0157377_100041142 211
742 3300014745 Ga0157377_10018364 Ga0157377_100183642 211
743 3300014745 Ga0157377_10036746 Ga0157377_100367461 211
744 3300014969 Ga0157376_10111589 Ga0157376_101115892 211
745 3300014969 Ga0157376_10779739 Ga0157376_107797391 211
746 3300017792 Ga0163161_10647683 Ga0163161_106476832 211
747 3300025315 Ga0207697_10086287 Ga0207697_100862871 211
748 3300025901 Ga0207688_10380827 Ga0207688_103808272 211
749 3300025904 Ga0207647_10069595 Ga0207647_100695951 211
750 3300025909 Ga0207705_10011305 Ga0207705_100113053 211
751 3300025909 Ga0207705_10025055 Ga0207705_100250552 211
752 3300025909 Ga0207705_10214283 Ga0207705_102142831 211
753 3300025912 Ga0207707_10009918 Ga0207707_100099184 211
754 3300025912 Ga0207707_10153898 Ga0207707_101538983 211
755 3300025912 Ga0207707_10275044 Ga0207707_102750442 211
756 3300025913 Ga0207695_10000300 Ga0207695_1000030069 211
757 3300025913 Ga0207695_10000483 Ga0207695_1000048320 211
758 3300025913 Ga0207695_10005507 Ga0207695_100055073 211
759 3300025913 Ga0207695_10018867 Ga0207695_100188671 211
760 3300025914 Ga0207671_10002537 Ga0207671_100025375 211
761 3300025914 Ga0207671_10068447 Ga0207671_100684472 211
762 3300025917 Ga0207660_10112411 Ga0207660_101124111 211
763 3300025917 Ga0207660_10145831 Ga0207660_101458312 211
764 3300025917 Ga0207660_10245987 Ga0207660_102459872 211
765 3300025918 Ga0207662_10045192 Ga0207662_100451921 211
766 3300025919 Ga0207657_10033705 Ga0207657_100337053 211
767 3300025919 Ga0207657_10034417 Ga0207657_100344172 211
768 3300025919 Ga0207657_10250495 Ga0207657_102504952 211
769 3300025920 Ga0207649_10003179 Ga0207649_100031793 211
770 3300025920 Ga0207649_10009537 Ga0207649_100095372 211
771 3300025921 Ga0207652_10000013 Ga0207652_1000001375 211
772 3300025921 Ga0207652_10000055 Ga0207652_1000005532 211
773 3300025921 Ga0207652_10005333 Ga0207652_100053336 211
774 3300025921 Ga0207652_10049054 Ga0207652_100490544 211
775 3300025921 Ga0207652_10056510 Ga0207652_100565105 211
776 3300025923 Ga0207681_10028570 Ga0207681_100285702 211
777 3300025923 Ga0207681_10948709 Ga0207681_109487091 211
778 3300025926 Ga0207659_10238393 Ga0207659_102383931 211
779 3300025933 Ga0207706_10309322 Ga0207706_103093222 211
780 3300025936 Ga0207670_10026860 Ga0207670_100268601 211
781 3300025936 Ga0207670_10260006 Ga0207670_102600062 211
782 3300025940 Ga0207691_10005556 Ga0207691_100055569 211
783 3300025940 Ga0207691_10012090 Ga0207691_1001209010 211
784 3300025940 Ga0207691_10399476 Ga0207691_103994762 211
785 3300025942 Ga0207689_10069897 Ga0207689_100698971 211
786 3300025942 Ga0207689_10075838 Ga0207689_100758383 211
787 3300025942 Ga0207689_10146892 Ga0207689_101468922 211
788 3300025944 Ga0207661_10002725 Ga0207661_100027255 211
789 3300025944 Ga0207661_10095918 Ga0207661_100959183 211
790 3300025945 Ga0207679_10000611 Ga0207679_1000061125 211
791 3300025945 Ga0207679_10076548 Ga0207679_100765481 211
792 3300025949 Ga0207667_10003410 Ga0207667_1000341013 211
793 3300025949 Ga0207667_10010537 Ga0207667_100105375 211
794 3300025949 Ga0207667_10076885 Ga0207667_100768853 211
795 3300025949 Ga0207667_10084648 Ga0207667_100846484 211
796 3300025949 Ga0207667_10109234 Ga0207667_101092343 211
797 3300025960 Ga0207651_10333897 Ga0207651_103338972 211
798 3300025972 Ga0207668_10531062 Ga0207668_105310621 211
799 3300025981 Ga0207640_10056728 Ga0207640_100567284 211
800 3300025981 Ga0207640_10159744 Ga0207640_101597441 211
801 3300025981 Ga0207640_10508330 Ga0207640_105083302 211
802 3300025981 Ga0207640_10652598 Ga0207640_106525981 211
803 3300025981 Ga0207640_10699250 Ga0207640_106992501 211
804 3300026023 Ga0207677_10041695 Ga0207677_100416951 211
805 3300026023 Ga0207677_10247001 Ga0207677_102470012 211
806 3300026041 Ga0207639_10011601 Ga0207639_100116012 211
807 3300026041 Ga0207639_10278125 Ga0207639_102781252 211
808 3300026067 Ga0207678_10057112 Ga0207678_100571124 211
809 3300026067 Ga0207678_10101165 Ga0207678_101011651 211
810 3300026067 Ga0207678_10257067 Ga0207678_102570672 211
811 3300026078 Ga0207702_10022070 Ga0207702_100220702 211
812 3300026078 Ga0207702_10135069 Ga0207702_101350692 211
813 3300026088 Ga0207641_10395674 Ga0207641_103956741 211
814 3300026089 Ga0207648_10353461 Ga0207648_103534611 211
815 3300026095 Ga0207676_10060852 Ga0207676_100608523 211
816 3300026095 Ga0207676_10064360 Ga0207676_100643602 211
817 3300026095 Ga0207676_10114867 Ga0207676_101148674 211
818 3300026095 Ga0207676_10604538 Ga0207676_106045381 211
819 3300026116 Ga0207674_10002454 Ga0207674_1000245414 211
820 3300026116 Ga0207674_10041435 Ga0207674_100414355 211
821 3300026116 Ga0207674_10056401 Ga0207674_100564013 211
822 3300026118 Ga0207675_100004652 Ga0207675_1000046522 211
823 3300026142 Ga0207698_10004845 Ga0207698_100048458 211
824 3300026142 Ga0207698_10309951 Ga0207698_103099511 211
825 3300026142 Ga0207698_10421392 Ga0207698_104213921 211
826 3300028380 Ga0268265_10145454 Ga0268265_101454542 211
827 3300031456 Ga0307513_10624292 Ga0307513_106242921 211
828 3300031507 Ga0307509_10359178 Ga0307509_103591782 211
829 3300035170 Ga0373943_0135060 Ga0373943_0135060_51_692 211
830 3300037312 Ga0395899_0016403 Ga0395899_0016403_579_1220 211
831 3300037312 Ga0395899_0024144 Ga0395899_0024144_2817_3461 211
832 3300037312 Ga0395899_0175527 Ga0395899_0175527_686_1324 211
833 3300037418 Ga0395900_0001378 Ga0395900_0001378_6957_7598 211
834 3300037418 Ga0395900_0022676 Ga0395900_0022676_3094_3738 211
835 3300037418 Ga0395900_0079906 Ga0395900_0079906_1655_2296 211
836 3300037418 Ga0395900_0289337 Ga0395900_0289337_340_978 211
837 3300037466 Ga0395898_0001155 Ga0395898_0001155_33013_33654 211
838 3300037466 Ga0395898_0071303 Ga0395898_0071303_1575_2219 211
839 3300037466 Ga0395898_0128544 Ga0395898_0128544_706_1344 211
840 3300037471 Ga0395905_0145290 Ga0395905_0145290_1259_1903 211
841 3300037471 Ga0395905_0320555 Ga0395905_0320555_539_1177 211
842 3300038443 Ga0395901_0009161 Ga0395901_0009161_5648_6289 211
843 3300038443 Ga0395901_0058290 Ga0395901_0058290_2619_3257 211
844 3300038443 Ga0395901_0683874 Ga0395901_0683874_165_809 211
845 3300041505 Ga0451849_1184600 Ga0451849_1184600_380_1021 211
846 3300042002 Ga0439442_008493 Ga0439442_008493_863_1498 211
847 3300042007 Ga0439449_0040363 Ga0439449_0040363_768_1403 211
848 3300042435 Ga0439434_0028813 Ga0439434_0028813_581_1216 211
849 3300044656 Ga0466969_0000030 Ga0466969_0000030_56020_56679 211
850 3300044658 Ga0466972_0230362 Ga0466972_0230362_109_771 211
851 3300044684 Ga0466966_0000293 Ga0466966_0000293_23419_24078 211
852 3300045049 Ga0466959_0000021 Ga0466959_0000021_44251_44910 211
853 3300045051 Ga0451576_0000002 Ga0451576_0000002_141554_142342 211
854 3300046522 Ga0495643_0085426 Ga0495643_0085426_211_846 211
855 3300046648 Ga0495611_0018419 Ga0495611_0018419_1973_2671 211
856 3300047320 Ga0495672_0029236 Ga0495672_0029236_447_1088 211
857 3300048913 Ga0496110_0045077 Ga0496110_0045077_2458_3099 211
858 3300048929 Ga0496126_0285154 Ga0496126_0285154_70_786 211
859 3300049569 Ga0501032_0148057 Ga0501032_0148057_273_908 211
860 3300049570 Ga0501033_0101937 Ga0501033_0101937_1118_1792 211
861 3300049571 Ga0501034_0010577 Ga0501034_0010577_3466_4101 211
862 3300049571 Ga0501034_0033351 Ga0501034_0033351_3047_3721 211
863 3300049572 Ga0501036_0139162 Ga0501036_0139162_628_1263 211
864 3300049574 Ga0501038_0673318 Ga0501038_0673318_85_720 211
865 3300049581 Ga0501047_0005749 Ga0501047_0005749_6424_7059 211
866 3300049586 Ga0501070_0036061 Ga0501070_0036061_973_1647 211
867 3300049822 Ga0501035_0027352 Ga0501035_0027352_3275_3910 211
868 3300049822 Ga0501035_0072836 Ga0501035_0072836_1012_1686 211
869 3300049823 Ga0501044_0116862 Ga0501044_0116862_757_1392 211
870 3300049823 Ga0501044_0216318 Ga0501044_0216318_1109_1774 211
871 3300050507 nmdc:mga05p37_100274_c1 nmdc:mga05p37_100274_c1_1963_2628 211
872 3300053086 Ga0500578_0000358 Ga0500578_0000358_32415_33080 211
873 3300053134 Ga0500658_0126968 Ga0500658_0126968_286_951 211
874 3300053156 Ga0500622_0065988 Ga0500622_0065988_358_1023 211
875 3300053178 Ga0500637_0310340 Ga0500637_0310340_73_738 211
876 3300002459 JGI24751J29686_10005606 JGI24751J29686_100056062 212
877 3300005331 Ga0070670_100007982 Ga0070670_1000079825 212
878 3300005719 Ga0068861_100276803 Ga0068861_1002768031 212
879 3300006880 Ga0075429_100091904 Ga0075429_1000919043 212
880 3300009553 Ga0105249_10017757 Ga0105249_100177573 212
881 3300025925 Ga0207650_10053528 Ga0207650_100535283 212
882 3300025961 Ga0207712_10003149 Ga0207712_100031492 212
883 3300026118 Ga0207675_100077458 Ga0207675_1000774583 212
884 3300050508 nmdc:mga09592_87369_c1 nmdc:mga09592_87369_c1_362_1072 212
885 3300050510 nmdc:mga06r32_297747_c1 nmdc:mga06r32_297747_c1_500_1210 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

65

199

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ofe-assembly1.cif.gz_A structural basis for thymine glycosylase activity on t:o6-methylg mismatch by methyl-cpg binding domain protein 4: implications for roles of arg468 in mismatch recognition and catalysis 0.8962 30 123
2abk-assembly1.cif.gz_A refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom 0.8865 4 202
4ea4-assembly1.cif.gz_A structure of the glycosylase domain of mbd4 bound to 5hmu-containing dna 0.8816 30 127
1ngn-assembly1.cif.gz_A mismatch repair in methylated dna. structure of the mismatch-specific thymine glycosylase domain of methyl-cpg-binding protein mbd4 0.8687 30 123
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.8599 9 207
ID Description Score Start End Superfamily
af_P0AB83_21_132_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9435 22 128 1.10.340.30
af_P9WQ11_33_143_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9336 23 129 1.10.340.30
af_Q9SIC4_169_271_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9289 30 125 1.10.340.30
af_O35980_108_217_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.922 30 126 1.10.340.30
af_Q58030_26_127_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9217 31 128 1.10.340.30

Feature Viewer

pLDDT pTM Quality
95.01 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map