F484666

General Info

Members Datasets Scaffolds Average Seq Length
885 274 1770 261

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10634495|Ga0207661_106344951
Length 248
Sequence MLLAIDAGNTNMVFALVDGGEIKTRWRIATDPRRTADEYAVWLHQLLELEGYSRSDVDAVIIGTVVPRALHNLEVLASKYFHVEPAIAGQGKAGWPVAFEVDEPQNVGADRALNAIAAHAKYPGNLVIIDFGTATTFDLISPAGAYTGGIIAPGINLSLDALVNATAKLPRIAIEAPEDTSVIGRTTQSQMLIGIYWGYIAMIEGLVERMRRQIEGPETVIATGGLAVLFDRHTDAFDAIEPDLTIQG

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
187 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
194 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
195 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
196 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
216 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
236 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
237 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
238 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
243 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
244 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
245 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
246 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
247 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
248 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
249 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
252 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
253 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
254 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
255 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
263 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
264 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
265 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
268 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
269 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
270 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
271 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.45
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 2.15
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10634495 3300025944 Bacteria 981
2 LJQas_1003377 3300000549 Bacteria 2146
3 JGI24736J21556_1000077 3300001904 Bacteria 16125
4 JGI24741J21665_1021826 3300001915 Bacteria 997
5 JGI24752J21851_1000389 3300001976 Bacteria 6069
6 JGI24740J21852_10003210 3300001979 Bacteria 7214
7 JGI24740J21852_10026087 3300001979 Bacteria 1961
8 JGI24740J21852_10035963 3300001979 Bacteria 1543
9 JGI24740J21852_10041232 3300001979 Bacteria 1393
10 JGI24739J22299_10004715 3300001989 Bacteria 5205
11 JGI24739J22299_10008406 3300001989 Bacteria 3855
12 JGI24739J22299_10009302 3300001989 Bacteria 3666
13 JGI24739J22299_10016397 3300001989 Bacteria 2681
14 JGI24737J22298_10001496 3300001990 Bacteria 8328
15 JGI24737J22298_10001667 3300001990 Bacteria 7919
16 JGI24737J22298_10004394 3300001990 Bacteria 4918
17 JGI24737J22298_10017161 3300001990 Bacteria 2334
18 JGI24743J22301_10029124 3300001991 Bacteria 1083
19 JGI24735J21928_10001163 3300002067 Bacteria 9410
20 JGI24735J21928_10003714 3300002067 Bacteria 5178
21 JGI24735J21928_10028440 3300002067 Bacteria 1669
22 JGI24735J21928_10048845 3300002067 Bacteria 1224
23 JGI24750J21931_1001279 3300002070 Bacteria 3165
24 JGI24748J21848_1000077 3300002074 Bacteria 32892
25 JGI24738J21930_10001136 3300002075 Bacteria 7526
26 JGI24738J21930_10002781 3300002075 Bacteria 4495
27 JGI24738J21930_10003298 3300002075 Bacteria 4101
28 JGI24749J21850_1000601 3300002076 Bacteria 5229
29 JGI24034J26672_10000019 3300002239 Bacteria 125073
30 JGI24742J22300_10001732 3300002244 Bacteria 3475
31 JGI24751J29686_10009521 3300002459 Bacteria 1999
32 JGI24751J29686_10030205 3300002459 Bacteria 1124
33 Ga0065707_10000608 3300005295 Bacteria 19207
34 Ga0070658_10002385 3300005327 Bacteria 15782
35 Ga0070658_10002556 3300005327 Bacteria 15170
36 Ga0070658_10008804 3300005327 Bacteria 8112
37 Ga0070658_10017679 3300005327 Bacteria 5704
38 Ga0070658_10047313 3300005327 Bacteria 3481
39 Ga0070658_10052144 3300005327 Bacteria 3317
40 Ga0070658_10290969 3300005327 Bacteria 1392
41 Ga0070658_10540270 3300005327 Bacteria 1008
42 Ga0070676_10002365 3300005328 Bacteria 9658
43 Ga0070676_10024716 3300005328 Bacteria 3388
44 Ga0070676_10159258 3300005328 Bacteria 1451
45 Ga0070683_100002173 3300005329 Bacteria 15508
46 Ga0070683_100029236 3300005329 Bacteria 4987
47 Ga0070683_100194342 3300005329 Bacteria 1927
48 Ga0070683_100746509 3300005329 Bacteria 938
49 Ga0070690_100000041 3300005330 Bacteria 59073
50 Ga0070670_100001367 3300005331 Bacteria 19549
51 Ga0070670_100006295 3300005331 Bacteria 10051
52 Ga0070670_100014459 3300005331 Bacteria 6776
53 Ga0070670_100059821 3300005331 Bacteria 3270
54 Ga0070670_100088968 3300005331 Bacteria 2654
55 Ga0070670_100329854 3300005331 Bacteria 1338
56 Ga0068869_100325415 3300005334 Bacteria 1247
57 Ga0070666_10000002 3300005335 Bacteria 478684
58 Ga0070666_10000033 3300005335 Bacteria 121625
59 Ga0070666_10000346 3300005335 Bacteria 29073
60 Ga0070666_10005001 3300005335 Bacteria 8109
61 Ga0070666_10234884 3300005335 Bacteria 1295
62 Ga0070680_100001372 3300005336 Bacteria 17619
63 Ga0070680_100003752 3300005336 Bacteria 11351
64 Ga0070680_100005783 3300005336 Bacteria 9386
65 Ga0070680_100035900 3300005336 Bacteria 4003
66 Ga0070680_100073706 3300005336 Bacteria 2808
67 Ga0070682_100143077 3300005337 Bacteria 1632
68 Ga0070682_100324096 3300005337 Bacteria 1139
69 Ga0068868_100740220 3300005338 Bacteria 882
70 Ga0070660_100000350 3300005339 Bacteria 30817
71 Ga0070660_100023254 3300005339 Bacteria 4591
72 Ga0070660_100063122 3300005339 Bacteria 2879
73 Ga0070660_100070259 3300005339 Bacteria 2732
74 Ga0070660_100246332 3300005339 Bacteria 1456
75 Ga0070660_100251594 3300005339 Bacteria 1441
76 Ga0070660_100336621 3300005339 Bacteria 1241
77 Ga0070660_100567372 3300005339 Bacteria 947
78 Ga0070689_100007577 3300005340 Bacteria 7602
79 Ga0070691_10090055 3300005341 Bacteria 1511
80 Ga0070661_100000001 3300005344 Bacteria 424830
81 Ga0070661_100000536 3300005344 Bacteria 29149
82 Ga0070661_100012197 3300005344 Bacteria 6008
83 Ga0070661_100012206 3300005344 Bacteria 6006
84 Ga0070661_100024645 3300005344 Bacteria 4315
85 Ga0070661_100033730 3300005344 Bacteria 3710
86 Ga0070661_100056871 3300005344 Bacteria 2866
87 Ga0070661_100125009 3300005344 Bacteria 1929
88 Ga0070661_100182211 3300005344 Bacteria 1598
89 Ga0070692_10010962 3300005345 Bacteria 4148
90 Ga0070692_10011511 3300005345 Bacteria 4065
91 Ga0070692_10015086 3300005345 Bacteria 3645
92 Ga0070692_10118806 3300005345 Bacteria 1471
93 Ga0070668_100000018 3300005347 Bacteria 99142
94 Ga0070668_100002689 3300005347 Bacteria 13075
95 Ga0070668_100023411 3300005347 Bacteria 4671
96 Ga0070668_100597121 3300005347 Bacteria 965
97 Ga0070669_100000075 3300005353 Bacteria 98073
98 Ga0070669_100000244 3300005353 Bacteria 45046
99 Ga0070669_100014556 3300005353 Bacteria 5596
100 Ga0070669_100143388 3300005353 Bacteria 1843
101 Ga0070669_100239482 3300005353 Bacteria 1441
102 Ga0070669_100394120 3300005353 Bacteria 1132
103 Ga0070675_100046500 3300005354 Bacteria 3554
104 Ga0070671_100000015 3300005355 Bacteria 166132
105 Ga0070671_100003459 3300005355 Bacteria 12331
106 Ga0070671_100005129 3300005355 Bacteria 10432
107 Ga0070671_100014760 3300005355 Bacteria 6312
108 Ga0070671_100080753 3300005355 Bacteria 2719
109 Ga0070671_100084378 3300005355 Bacteria 2657
110 Ga0070674_100149427 3300005356 Bacteria 1761
111 Ga0070674_100378024 3300005356 Bacteria 1152
112 Ga0070673_100006497 3300005364 Bacteria 7603
113 Ga0070673_100007677 3300005364 Bacteria 7136
114 Ga0070673_100018220 3300005364 Bacteria 5012
115 Ga0070659_100007487 3300005366 Bacteria 7931
116 Ga0070659_100044806 3300005366 Bacteria 3465
117 Ga0070659_100056790 3300005366 Bacteria 3087
118 Ga0070659_100082238 3300005366 Bacteria 2573
119 Ga0070659_100225813 3300005366 Bacteria 1547
120 Ga0070659_100328517 3300005366 Bacteria 1279
121 Ga0070667_100001306 3300005367 Bacteria 22448
122 Ga0070667_100008405 3300005367 Bacteria 8561
123 Ga0070667_100054554 3300005367 Bacteria 3375
124 Ga0070667_100249868 3300005367 Bacteria 1585
125 Ga0070667_100507174 3300005367 Bacteria 1106
126 Ga0070667_100773823 3300005367 Bacteria 890
127 Ga0070714_100048834 3300005435 Bacteria 3601
128 Ga0070714_100083023 3300005435 Bacteria 2793
129 Ga0070694_100006197 3300005444 Bacteria 7261
130 Ga0070694_100023666 3300005444 Bacteria 3954
131 Ga0070663_100000364 3300005455 Bacteria 23779
132 Ga0070663_100007184 3300005455 Bacteria 6764
133 Ga0070663_100027651 3300005455 Bacteria 3853
134 Ga0070663_100397244 3300005455 Bacteria 1126
135 Ga0070678_100044720 3300005456 Bacteria 3164
136 Ga0070678_100051663 3300005456 Bacteria 2981
137 Ga0070662_100000024 3300005457 Bacteria 91042
138 Ga0070662_100002504 3300005457 Bacteria 11327
139 Ga0070662_100006023 3300005457 Bacteria 7780
140 Ga0070662_100007112 3300005457 Bacteria 7243
141 Ga0070662_100018480 3300005457 Bacteria 4716
142 Ga0070662_100033059 3300005457 Bacteria 3640
143 Ga0070662_100082865 3300005457 Bacteria 2392
144 Ga0070662_100327421 3300005457 Bacteria 1251
145 Ga0070681_10069146 3300005458 Bacteria 3498
146 Ga0070681_10249995 3300005458 Bacteria 1686
147 Ga0070681_10301566 3300005458 Bacteria 1512
148 Ga0070681_10471496 3300005458 Bacteria 1168
149 Ga0068867_100050570 3300005459 Bacteria 3064
150 Ga0070685_10000023 3300005466 Bacteria 102548
151 Ga0070679_100000003 3300005530 Bacteria 307836
152 Ga0070679_100153017 3300005530 Bacteria 2283
153 Ga0070679_100174111 3300005530 Bacteria 2125
154 Ga0070679_100218265 3300005530 Bacteria 1869
155 Ga0070684_100011221 3300005535 Bacteria 7133
156 Ga0070684_100019372 3300005535 Bacteria 5627
157 Ga0070684_100049262 3300005535 Bacteria 3656
158 Ga0070684_100671918 3300005535 Bacteria 965
159 Ga0068853_100000033 3300005539 Bacteria 113700
160 Ga0068853_100003628 3300005539 Bacteria 11836
161 Ga0068853_100035102 3300005539 Bacteria 4259
162 Ga0068853_100122221 3300005539 Bacteria 2324
163 Ga0068853_100625159 3300005539 Bacteria 1024
164 Ga0070672_100090273 3300005543 Bacteria 2471
165 Ga0070672_100106406 3300005543 Bacteria 2282
166 Ga0070686_100000003 3300005544 Bacteria 308397
167 Ga0070686_100139817 3300005544 Bacteria 1684
168 Ga0070695_100037844 3300005545 Bacteria 3042
169 Ga0070696_100010269 3300005546 Bacteria 6266
170 Ga0070693_100010106 3300005547 Bacteria 4713
171 Ga0070693_100039525 3300005547 Bacteria 2643
172 Ga0070693_100188463 3300005547 Bacteria 1332
173 Ga0070693_100222407 3300005547 Bacteria 1237
174 Ga0070665_100000036 3300005548 Bacteria 314603
175 Ga0070665_100010377 3300005548 Bacteria 9426
176 Ga0070665_100012270 3300005548 Bacteria 8637
177 Ga0070665_100027636 3300005548 Bacteria 5713
178 Ga0070665_100032835 3300005548 Bacteria 5222
179 Ga0070665_100050546 3300005548 Bacteria 4172
180 Ga0070665_100110796 3300005548 Bacteria 2747
181 Ga0068855_100012061 3300005563 Bacteria 10447
182 Ga0068855_100031052 3300005563 Bacteria 6383
183 Ga0068855_100152295 3300005563 Bacteria 2629
184 Ga0068855_100226442 3300005563 Bacteria 2095
185 Ga0070664_100002469 3300005564 Bacteria 14893
186 Ga0070664_100003103 3300005564 Bacteria 13439
187 Ga0070664_100005430 3300005564 Bacteria 10232
188 Ga0070664_100046453 3300005564 Bacteria 3667
189 Ga0070664_100049518 3300005564 Bacteria 3553
190 Ga0070664_100253185 3300005564 Bacteria 1583
191 Ga0070664_100272105 3300005564 Bacteria 1526
192 Ga0070664_100615541 3300005564 Bacteria 1008
193 Ga0068857_100001595 3300005577 Bacteria 18192
194 Ga0068857_100077751 3300005577 Bacteria 2961
195 Ga0068857_100078863 3300005577 Bacteria 2939
196 Ga0068857_100139184 3300005577 Bacteria 2193
197 Ga0068857_100153008 3300005577 Bacteria 2091
198 Ga0068854_100002372 3300005578 Bacteria 11621
199 Ga0068854_100047771 3300005578 Bacteria 3051
200 Ga0068854_100080320 3300005578 Bacteria 2406
201 Ga0068854_100145916 3300005578 Bacteria 1820
202 Ga0068854_100146513 3300005578 Bacteria 1817
203 Ga0068854_100280936 3300005578 Bacteria 1340
204 Ga0068856_100012156 3300005614 Bacteria 8339
205 Ga0068856_100035913 3300005614 Bacteria 4859
206 Ga0068856_100152844 3300005614 Bacteria 2317
207 Ga0068856_100282101 3300005614 Bacteria 1678
208 Ga0068856_100413084 3300005614 Bacteria 1369
209 Ga0068852_100000442 3300005616 Bacteria 27467
210 Ga0068852_100002110 3300005616 Bacteria 13604
211 Ga0068852_100006174 3300005616 Bacteria 8640
212 Ga0068852_100043129 3300005616 Bacteria 3824
213 Ga0068852_100053764 3300005616 Bacteria 3468
214 Ga0068852_100067306 3300005616 Bacteria 3131
215 Ga0068852_100069523 3300005616 Bacteria 3087
216 Ga0068852_100098642 3300005616 Bacteria 2631
217 Ga0068852_100348984 3300005616 Bacteria 1444
218 Ga0068852_100397276 3300005616 Bacteria 1355
219 Ga0068852_100549812 3300005616 Bacteria 1155
220 Ga0068852_100777783 3300005616 Bacteria 970
221 Ga0068859_100000194 3300005617 Bacteria 59075
222 Ga0068859_100015135 3300005617 Bacteria 7742
223 Ga0068859_100037870 3300005617 Bacteria 4840
224 Ga0068859_100048525 3300005617 Bacteria 4265
225 Ga0068859_100053137 3300005617 Bacteria 4073
226 Ga0068859_100325605 3300005617 Bacteria 1630
227 Ga0068864_100002410 3300005618 Bacteria 15443
228 Ga0068864_100004829 3300005618 Bacteria 11048
229 Ga0068864_100123051 3300005618 Bacteria 2322
230 Ga0068864_100222049 3300005618 Bacteria 1744
231 Ga0068864_100388645 3300005618 Bacteria 1324
232 Ga0068866_10012441 3300005718 Bacteria 3707
233 Ga0068861_100000396 3300005719 Bacteria 25163
234 Ga0068861_100000541 3300005719 Bacteria 22233
235 Ga0068861_100229067 3300005719 Bacteria 1575
236 Ga0068851_10001361 3300005834 Bacteria 10657
237 Ga0068851_10008392 3300005834 Bacteria 4775
238 Ga0068851_10009581 3300005834 Bacteria 4509
239 Ga0068851_10108174 3300005834 Bacteria 1482
240 Ga0068863_100000122 3300005841 Bacteria 81534
241 Ga0068863_100000447 3300005841 Bacteria 41934
242 Ga0068863_100031202 3300005841 Bacteria 5087
243 Ga0068863_100153081 3300005841 Bacteria 2207
244 Ga0068863_100201464 3300005841 Bacteria 1915
245 Ga0068858_100003091 3300005842 Bacteria 16651
246 Ga0068858_100003713 3300005842 Bacteria 15119
247 Ga0068858_100013190 3300005842 Bacteria 7787
248 Ga0068858_100038421 3300005842 Bacteria 4440
249 Ga0068858_100294668 3300005842 Bacteria 1547
250 Ga0068860_100000001 3300005843 Bacteria 703043
251 Ga0068860_100009292 3300005843 Bacteria 9768
252 Ga0068860_100035137 3300005843 Bacteria 4809
253 Ga0068860_100041014 3300005843 Bacteria 4422
254 Ga0068860_100162322 3300005843 Bacteria 2155
255 Ga0068860_100403613 3300005843 Bacteria 1352
256 Ga0068860_100581715 3300005843 Bacteria 1124
257 Ga0068862_100000088 3300005844 Bacteria 109244
258 Ga0068862_100000169 3300005844 Bacteria 72633
259 Ga0068862_100003026 3300005844 Bacteria 14649
260 Ga0068862_100173236 3300005844 Bacteria 1933
261 Ga0068862_100184797 3300005844 Bacteria 1872
262 Ga0068862_100290436 3300005844 Bacteria 1501
263 Ga0068862_100664264 3300005844 Bacteria 1006
264 Ga0081539_10068968 3300005985 Bacteria 1905
265 Ga0097621_100010978 3300006237 Bacteria 6653
266 Ga0068871_100097916 3300006358 Bacteria 2453
267 Ga0068871_100104899 3300006358 Bacteria 2371
268 Ga0068871_100188951 3300006358 Bacteria 1773
269 Ga0075428_100057430 3300006844 Bacteria 4260
270 Ga0075431_100199731 3300006847 Bacteria 2046
271 Ga0075433_10044439 3300006852 Bacteria 3859
272 Ga0075434_100586704 3300006871 Bacteria 1134
273 Ga0068865_100022540 3300006881 Bacteria 4110
274 Ga0068865_100033002 3300006881 Bacteria 3463
275 Ga0068865_100267597 3300006881 Bacteria 1356
276 Ga0097620_100000194 3300006931 Bacteria 59075
277 Ga0097620_100015136 3300006931 Bacteria 7742
278 Ga0097620_100037870 3300006931 Bacteria 4840
279 Ga0097620_100048525 3300006931 Bacteria 4265
280 Ga0097620_100053134 3300006931 Bacteria 4073
281 Ga0097620_100325617 3300006931 Bacteria 1630
282 Ga0105240_10002881 3300009093 Bacteria 27174
283 Ga0105240_10019011 3300009093 Bacteria 9198
284 Ga0105240_10063296 3300009093 Bacteria 4602
285 Ga0105240_10208548 3300009093 Bacteria 2285
286 Ga0111539_10077698 3300009094 Bacteria 3906
287 Ga0105247_10003917 3300009101 Bacteria 9601
288 Ga0105247_10026917 3300009101 Bacteria 3476
289 Ga0105243_10203751 3300009148 Bacteria 1737
290 Ga0105241_10039084 3300009174 Bacteria 3579
291 Ga0105248_10000059 3300009177 Bacteria 137176
292 Ga0105248_10016178 3300009177 Bacteria 8208
293 Ga0105248_10032513 3300009177 Bacteria 5830
294 Ga0105248_10042692 3300009177 Bacteria 5086
295 Ga0105248_10047803 3300009177 Bacteria 4798
296 Ga0105248_10152266 3300009177 Bacteria 2610
297 Ga0105248_10152760 3300009177 Bacteria 2605
298 Ga0105248_10201318 3300009177 Bacteria 2243
299 Ga0105248_10453008 3300009177 Bacteria 1446
300 Ga0105248_11075950 3300009177 Bacteria 909
301 Ga0105237_10043045 3300009545 Bacteria 4551
302 Ga0105237_10148386 3300009545 Bacteria 2341
303 Ga0105238_10014487 3300009551 Bacteria 7973
304 Ga0105238_10026132 3300009551 Bacteria 5949
305 Ga0105238_10027868 3300009551 Bacteria 5757
306 Ga0105249_10000114 3300009553 Bacteria 108599
307 Ga0105249_10011902 3300009553 Bacteria 7652
308 Ga0105249_10023765 3300009553 Bacteria 5504
309 Ga0105239_10036292 3300010375 Bacteria 5412
310 Ga0105239_10053209 3300010375 Bacteria 4441
311 Ga0105239_10054509 3300010375 Bacteria 4386
312 Ga0157373_10035467 3300013100 Bacteria 3581
313 Ga0157373_10035817 3300013100 Bacteria 3562
314 Ga0157373_10039770 3300013100 Bacteria 3366
315 Ga0157373_10039950 3300013100 Bacteria 3357
316 Ga0157373_10052520 3300013100 Bacteria 2901
317 Ga0157373_10055262 3300013100 Bacteria 2820
318 Ga0157373_10067939 3300013100 Bacteria 2520
319 Ga0157373_10084651 3300013100 Bacteria 2235
320 Ga0157373_10126847 3300013100 Bacteria 1795
321 Ga0157373_10144333 3300013100 Bacteria 1674
322 Ga0157373_10483823 3300013100 Bacteria 893
323 Ga0157371_10001377 3300013102 Bacteria 25491
324 Ga0157371_10015137 3300013102 Bacteria 5797
325 Ga0157371_10017875 3300013102 Bacteria 5256
326 Ga0157371_10037109 3300013102 Bacteria 3489
327 Ga0157371_10096253 3300013102 Bacteria 2098
328 Ga0157371_10114922 3300013102 Bacteria 1911
329 Ga0157371_10148879 3300013102 Bacteria 1669
330 Ga0157370_10015915 3300013104 Bacteria 7631
331 Ga0157370_10137801 3300013104 Bacteria 2274
332 Ga0157370_10175964 3300013104 Bacteria 1989
333 Ga0157370_10476310 3300013104 Bacteria 1147
334 Ga0157369_10001177 3300013105 Bacteria 32602
335 Ga0157369_10007864 3300013105 Bacteria 12260
336 Ga0157369_10021183 3300013105 Bacteria 7268
337 Ga0157369_10023254 3300013105 Bacteria 6906
338 Ga0157369_10072432 3300013105 Bacteria 3698
339 Ga0157369_10124371 3300013105 Bacteria 2735
340 Ga0157369_10200641 3300013105 Bacteria 2094
341 Ga0157369_10501788 3300013105 Bacteria 1255
342 Ga0157374_10013537 3300013296 Bacteria 7121
343 Ga0157374_10015389 3300013296 Bacteria 6709
344 Ga0157378_10992550 3300013297 Bacteria 874
345 Ga0163162_10002477 3300013306 Bacteria 17444
346 Ga0163162_10005984 3300013306 Bacteria 11777
347 Ga0163162_10165441 3300013306 Bacteria 2335
348 Ga0163162_10271502 3300013306 Bacteria 1828
349 Ga0163162_10300592 3300013306 Bacteria 1737
350 Ga0163162_10842046 3300013306 Bacteria 1033
351 Ga0157372_10013006 3300013307 Bacteria 8879
352 Ga0157372_10112515 3300013307 Bacteria 3119
353 Ga0157372_10454277 3300013307 Bacteria 1493
354 Ga0157375_10170873 3300013308 Bacteria 2321
355 Ga0157375_11106797 3300013308 Bacteria 927
356 Ga0163163_10001821 3300014325 Bacteria 18002
357 Ga0163163_10370030 3300014325 Bacteria 1490
358 Ga0157380_10054361 3300014326 Bacteria 3177
359 Ga0157380_10263802 3300014326 Bacteria 1566
360 Ga0157380_10566107 3300014326 Bacteria 1118
361 Ga0157377_10108773 3300014745 Bacteria 1663
362 Ga0157379_10016026 3300014968 Bacteria 6589
363 Ga0157379_10062381 3300014968 Bacteria 3334
364 Ga0157379_10122298 3300014968 Bacteria 2342
365 Ga0157379_10158740 3300014968 Bacteria 2041
366 Ga0163161_10000008 3300017792 Bacteria 294642
367 Ga0163161_10042633 3300017792 Bacteria 3265
368 Ga0163161_10484262 3300017792 Bacteria 1005
369 Ga0206354_10247148 3300020081 Bacteria 1540
370 Ga0206353_10397570 3300020082 Bacteria 1086
371 Ga0206353_11608620 3300020082 Bacteria 22025
372 Ga0206353_11737640 3300020082 Bacteria 3895
373 Ga0213873_10000025 3300021358 Bacteria 86171
374 Ga0213876_10000004 3300021384 Bacteria 943822
375 Ga0213876_10037095 3300021384 Bacteria 2571
376 Ga0207697_10000415 3300025315 Bacteria 24139
377 Ga0207697_10012773 3300025315 Bacteria 3514
378 Ga0207656_10004523 3300025321 Bacteria 4864
379 Ga0207656_10046127 3300025321 Bacteria 1868
380 Ga0207656_10061739 3300025321 Bacteria 1646
381 Ga0207682_10000833 3300025893 Bacteria 14256
382 Ga0207710_10002250 3300025900 Bacteria 9037
383 Ga0207710_10031249 3300025900 Bacteria 2327
384 Ga0207688_10018560 3300025901 Bacteria 3783
385 Ga0207688_10070269 3300025901 Bacteria 1985
386 Ga0207680_10000004 3300025903 Bacteria 827324
387 Ga0207680_10000421 3300025903 Bacteria 20175
388 Ga0207680_10001930 3300025903 Bacteria 9727
389 Ga0207680_10081673 3300025903 Bacteria 2032
390 Ga0207680_10083411 3300025903 Bacteria 2014
391 Ga0207647_10000383 3300025904 Bacteria 36032
392 Ga0207647_10000713 3300025904 Bacteria 26072
393 Ga0207647_10001284 3300025904 Bacteria 19290
394 Ga0207647_10004399 3300025904 Bacteria 10448
395 Ga0207647_10007057 3300025904 Bacteria 8146
396 Ga0207647_10011206 3300025904 Bacteria 6296
397 Ga0207647_10042869 3300025904 Bacteria 2835
398 Ga0207647_10066345 3300025904 Bacteria 2188
399 Ga0207645_10003962 3300025907 Bacteria 11054
400 Ga0207645_10006878 3300025907 Bacteria 8111
401 Ga0207645_10249915 3300025907 Bacteria 1173
402 Ga0207643_10167976 3300025908 Bacteria 1323
403 Ga0207705_10000062 3300025909 Bacteria 149432
404 Ga0207705_10005890 3300025909 Bacteria 9114
405 Ga0207705_10014129 3300025909 Bacteria 5751
406 Ga0207705_10018254 3300025909 Bacteria 5016
407 Ga0207705_10021396 3300025909 Bacteria 4615
408 Ga0207705_10024795 3300025909 Bacteria 4280
409 Ga0207705_10026770 3300025909 Bacteria 4110
410 Ga0207705_10228832 3300025909 Bacteria 1414
411 Ga0207705_10245988 3300025909 Bacteria 1363
412 Ga0207705_10492035 3300025909 Bacteria 952
413 Ga0207654_10000529 3300025911 Bacteria 21802
414 Ga0207707_10035899 3300025912 Bacteria 4335
415 Ga0207707_10087286 3300025912 Bacteria 2726
416 Ga0207707_10093246 3300025912 Bacteria 2630
417 Ga0207707_10429510 3300025912 Bacteria 1132
418 Ga0207695_10001388 3300025913 Bacteria 40914
419 Ga0207695_10003145 3300025913 Bacteria 23572
420 Ga0207671_10000479 3300025914 Bacteria 54184
421 Ga0207671_10110131 3300025914 Bacteria 2094
422 Ga0207660_10003552 3300025917 Bacteria 10152
423 Ga0207660_10005888 3300025917 Bacteria 7963
424 Ga0207660_10006304 3300025917 Bacteria 7692
425 Ga0207660_10015982 3300025917 Bacteria 4961
426 Ga0207660_10137903 3300025917 Bacteria 1863
427 Ga0207657_10000015 3300025919 Bacteria 175776
428 Ga0207657_10002109 3300025919 Bacteria 21508
429 Ga0207657_10009209 3300025919 Bacteria 9953
430 Ga0207657_10018283 3300025919 Bacteria 6701
431 Ga0207657_10025311 3300025919 Bacteria 5474
432 Ga0207657_10037392 3300025919 Bacteria 4335
433 Ga0207657_10037664 3300025919 Bacteria 4315
434 Ga0207657_10109082 3300025919 Bacteria 2288
435 Ga0207657_10119715 3300025919 Bacteria 2166
436 Ga0207657_10148800 3300025919 Bacteria 1908
437 Ga0207657_10156263 3300025919 Bacteria 1855
438 Ga0207657_10172801 3300025919 Bacteria 1750
439 Ga0207657_10359659 3300025919 Bacteria 1147
440 Ga0207649_10000011 3300025920 Bacteria 266219
441 Ga0207649_10000264 3300025920 Bacteria 41423
442 Ga0207649_10021606 3300025920 Bacteria 3708
443 Ga0207649_10204341 3300025920 Bacteria 1397
444 Ga0207649_10283479 3300025920 Bacteria 1205
445 Ga0207652_10000004 3300025921 Bacteria 436303
446 Ga0207652_10436579 3300025921 Bacteria 1180
447 Ga0207681_10000002 3300025923 Bacteria 985597
448 Ga0207681_10000079 3300025923 Bacteria 87683
449 Ga0207681_10103192 3300025923 Bacteria 2060
450 Ga0207681_10168076 3300025923 Bacteria 1660
451 Ga0207681_10204965 3300025923 Bacteria 1516
452 Ga0207694_10004197 3300025924 Bacteria 11293
453 Ga0207694_10005445 3300025924 Bacteria 9794
454 Ga0207694_10047060 3300025924 Bacteria 3336
455 Ga0207694_10172688 3300025924 Bacteria 1751
456 Ga0207650_10013831 3300025925 Bacteria 5596
457 Ga0207650_10067004 3300025925 Bacteria 2693
458 Ga0207650_10263454 3300025925 Bacteria 1399
459 Ga0207659_10039520 3300025926 Bacteria 3292
460 Ga0207664_10430879 3300025929 Bacteria 1176
461 Ga0207644_10000002 3300025931 Bacteria 942221
462 Ga0207644_10003279 3300025931 Bacteria 10459
463 Ga0207644_10007294 3300025931 Bacteria 7196
464 Ga0207644_10083923 3300025931 Bacteria 2360
465 Ga0207644_10115033 3300025931 Bacteria 2039
466 Ga0207644_10372060 3300025931 Bacteria 1164
467 Ga0207644_10443308 3300025931 Bacteria 1066
468 Ga0207690_10000032 3300025932 Bacteria 152479
469 Ga0207690_10003533 3300025932 Bacteria 9312
470 Ga0207690_10029499 3300025932 Bacteria 3489
471 Ga0207690_10032167 3300025932 Bacteria 3363
472 Ga0207690_10038053 3300025932 Bacteria 3128
473 Ga0207690_10055137 3300025932 Bacteria 2676
474 Ga0207690_10168070 3300025932 Bacteria 1641
475 Ga0207690_10189189 3300025932 Bacteria 1556
476 Ga0207690_10241398 3300025932 Bacteria 1392
477 Ga0207690_10411318 3300025932 Bacteria 1080
478 Ga0207690_10449229 3300025932 Bacteria 1036
479 Ga0207706_10000032 3300025933 Bacteria 142723
480 Ga0207706_10003797 3300025933 Bacteria 14399
481 Ga0207706_10008916 3300025933 Bacteria 9232
482 Ga0207706_10017705 3300025933 Bacteria 6419
483 Ga0207706_10048588 3300025933 Bacteria 3752
484 Ga0207706_10082556 3300025933 Bacteria 2825
485 Ga0207706_10131304 3300025933 Bacteria 2203
486 Ga0207706_10584227 3300025933 Bacteria 960
487 Ga0207706_10609125 3300025933 Bacteria 938
488 Ga0207706_10690455 3300025933 Bacteria 872
489 Ga0207669_10121285 3300025937 Bacteria 1775
490 Ga0207669_10131438 3300025937 Bacteria 1721
491 Ga0207704_10023730 3300025938 Bacteria 3311
492 Ga0207691_10054017 3300025940 Bacteria 3665
493 Ga0207691_10069313 3300025940 Bacteria 3186
494 Ga0207691_10125245 3300025940 Bacteria 2274
495 Ga0207711_10000476 3300025941 Bacteria 41373
496 Ga0207711_10003942 3300025941 Bacteria 12767
497 Ga0207711_10006527 3300025941 Bacteria 9820
498 Ga0207711_10007836 3300025941 Bacteria 8929
499 Ga0207711_10085985 3300025941 Bacteria 2756
500 Ga0207711_10103621 3300025941 Bacteria 2520
501 Ga0207711_10140078 3300025941 Bacteria 2175
502 Ga0207711_10247673 3300025941 Bacteria 1635
503 Ga0207711_10890922 3300025941 Bacteria 827
504 Ga0207689_10238639 3300025942 Bacteria 1503
505 Ga0207661_10015766 3300025944 Bacteria 5565
506 Ga0207661_10030714 3300025944 Bacteria 4141
507 Ga0207661_10211689 3300025944 Bacteria 1709
508 Ga0207661_10638583 3300025944 Bacteria 978
509 Ga0207679_10000466 3300025945 Bacteria 28495
510 Ga0207679_10002870 3300025945 Bacteria 10686
511 Ga0207679_10006436 3300025945 Bacteria 7420
512 Ga0207679_10352739 3300025945 Bacteria 1283
513 Ga0207679_10524377 3300025945 Bacteria 1060
514 Ga0207667_10004727 3300025949 Bacteria 16670
515 Ga0207667_10011320 3300025949 Bacteria 10371
516 Ga0207667_10012620 3300025949 Bacteria 9713
517 Ga0207667_10015693 3300025949 Bacteria 8591
518 Ga0207667_10025120 3300025949 Bacteria 6528
519 Ga0207667_10079206 3300025949 Bacteria 3405
520 Ga0207667_10117972 3300025949 Bacteria 2735
521 Ga0207667_10118577 3300025949 Bacteria 2727
522 Ga0207667_10403872 3300025949 Bacteria 1391
523 Ga0207667_10436391 3300025949 Bacteria 1332
524 Ga0207667_10456718 3300025949 Bacteria 1298
525 Ga0207651_10010148 3300025960 Bacteria 5202
526 Ga0207651_10518740 3300025960 Bacteria 1032
527 Ga0207712_10000001 3300025961 Bacteria 750309
528 Ga0207712_10007135 3300025961 Bacteria 7049
529 Ga0207712_10008302 3300025961 Bacteria 6565
530 Ga0207712_10086609 3300025961 Bacteria 2295
531 Ga0207668_10000060 3300025972 Bacteria 89732
532 Ga0207668_10000155 3300025972 Bacteria 47429
533 Ga0207668_10000342 3300025972 Bacteria 30270
534 Ga0207668_10279116 3300025972 Bacteria 1369
535 Ga0207668_10426032 3300025972 Bacteria 1127
536 Ga0207640_10002809 3300025981 Bacteria 9335
537 Ga0207640_10006191 3300025981 Bacteria 6551
538 Ga0207640_10032776 3300025981 Bacteria 3224
539 Ga0207640_10040078 3300025981 Bacteria 2969
540 Ga0207640_10054121 3300025981 Bacteria 2623
541 Ga0207640_10054693 3300025981 Bacteria 2611
542 Ga0207658_10000903 3300025986 Bacteria 24694
543 Ga0207658_10006238 3300025986 Bacteria 8145
544 Ga0207658_10007390 3300025986 Bacteria 7492
545 Ga0207658_10009321 3300025986 Bacteria 6656
546 Ga0207658_10009971 3300025986 Bacteria 6456
547 Ga0207658_10165895 3300025986 Bacteria 1814
548 Ga0207658_10357361 3300025986 Bacteria 1273
549 Ga0207677_10535282 3300026023 Bacteria 1018
550 Ga0207677_10644956 3300026023 Bacteria 934
551 Ga0207703_10021265 3300026035 Bacteria 5080
552 Ga0207703_10025934 3300026035 Bacteria 4612
553 Ga0207703_10101612 3300026035 Bacteria 2438
554 Ga0207703_10599846 3300026035 Bacteria 1042
555 Ga0207639_10000260 3300026041 Bacteria 38302
556 Ga0207639_10000410 3300026041 Bacteria 29670
557 Ga0207639_10045273 3300026041 Bacteria 3313
558 Ga0207639_10054105 3300026041 Bacteria 3066
559 Ga0207639_10109196 3300026041 Bacteria 2250
560 Ga0207639_10127341 3300026041 Bacteria 2102
561 Ga0207639_10171003 3300026041 Bacteria 1840
562 Ga0207639_10204623 3300026041 Bacteria 1695
563 Ga0207639_10549012 3300026041 Bacteria 1061
564 Ga0207678_10000913 3300026067 Bacteria 27026
565 Ga0207678_10004123 3300026067 Bacteria 13060
566 Ga0207678_10006236 3300026067 Bacteria 10592
567 Ga0207678_10018078 3300026067 Bacteria 6191
568 Ga0207678_10041680 3300026067 Bacteria 3980
569 Ga0207678_10055689 3300026067 Bacteria 3406
570 Ga0207702_10000072 3300026078 Bacteria 113840
571 Ga0207702_10014384 3300026078 Bacteria 6569
572 Ga0207702_10047352 3300026078 Bacteria 3623
573 Ga0207702_10049186 3300026078 Bacteria 3557
574 Ga0207702_10072288 3300026078 Bacteria 2972
575 Ga0207702_10174825 3300026078 Bacteria 1972
576 Ga0207702_10196208 3300026078 Bacteria 1869
577 Ga0207702_10256789 3300026078 Bacteria 1644
578 Ga0207641_10000001 3300026088 Bacteria 1180841
579 Ga0207641_10000154 3300026088 Bacteria 97781
580 Ga0207641_10023361 3300026088 Bacteria 5094
581 Ga0207641_10072637 3300026088 Bacteria 2963
582 Ga0207648_10004169 3300026089 Bacteria 14937
583 Ga0207648_10114550 3300026089 Bacteria 2369
584 Ga0207648_10205301 3300026089 Bacteria 1748
585 Ga0207676_10002226 3300026095 Bacteria 13958
586 Ga0207676_10067902 3300026095 Bacteria 2849
587 Ga0207676_10093993 3300026095 Bacteria 2470
588 Ga0207676_10136128 3300026095 Bacteria 2096
589 Ga0207676_10789791 3300026095 Bacteria 925
590 Ga0207674_10002883 3300026116 Bacteria 21374
591 Ga0207674_10023004 3300026116 Bacteria 6683
592 Ga0207674_10050845 3300026116 Bacteria 4232
593 Ga0207674_10054085 3300026116 Bacteria 4089
594 Ga0207674_10144544 3300026116 Bacteria 2337
595 Ga0207674_10341332 3300026116 Bacteria 1448
596 Ga0207674_10344761 3300026116 Bacteria 1440
597 Ga0207674_10757447 3300026116 Bacteria 937
598 Ga0207675_100001479 3300026118 Bacteria 23600
599 Ga0207675_100004101 3300026118 Bacteria 14102
600 Ga0207675_100074151 3300026118 Bacteria 3184
601 Ga0207683_10005280 3300026121 Bacteria 11086
602 Ga0207683_10010998 3300026121 Bacteria 7716
603 Ga0207698_10000401 3300026142 Bacteria 25075
604 Ga0207698_10003068 3300026142 Bacteria 10009
605 Ga0207698_10003399 3300026142 Bacteria 9579
606 Ga0207698_10022740 3300026142 Bacteria 4365
607 Ga0207698_10078953 3300026142 Bacteria 2645
608 Ga0207698_10364104 3300026142 Bacteria 1370
609 Ga0207698_10375574 3300026142 Bacteria 1351
610 Ga0207428_10076159 3300027907 Bacteria 2627
611 Ga0268266_10000042 3300028379 Bacteria 316826
612 Ga0268266_10008481 3300028379 Bacteria 9135
613 Ga0268266_10009180 3300028379 Bacteria 8726
614 Ga0268266_10063121 3300028379 Bacteria 3198
615 Ga0268266_10138999 3300028379 Bacteria 2178
616 Ga0268266_10194991 3300028379 Bacteria 1851
617 Ga0268265_10000190 3300028380 Bacteria 72600
618 Ga0268265_10000497 3300028380 Bacteria 40721
619 Ga0268265_10001444 3300028380 Bacteria 20029
620 Ga0268265_10072127 3300028380 Bacteria 2692
621 Ga0268265_10083424 3300028380 Bacteria 2530
622 Ga0268265_10211045 3300028380 Bacteria 1692
623 Ga0268264_10000006 3300028381 Bacteria 827324
624 Ga0268264_10000010 3300028381 Bacteria 596543
625 Ga0268264_10001806 3300028381 Bacteria 19557
626 Ga0268264_10004648 3300028381 Bacteria 11665
627 Ga0268264_10007250 3300028381 Bacteria 9281
628 Ga0268264_10856200 3300028381 Bacteria 911
629 Ga0307408_100063721 3300031548 Bacteria 2698
630 Ga0307408_100121824 3300031548 Bacteria 2022
631 Ga0307408_100493556 3300031548 Bacteria 1070
632 Ga0307405_10009350 3300031731 Bacteria 5020
633 Ga0307405_10014509 3300031731 Bacteria 4239
634 Ga0307405_10017914 3300031731 Bacteria 3898
635 Ga0307405_10058821 3300031731 Bacteria 2420
636 Ga0307405_10204170 3300031731 Bacteria 1438
637 Ga0307405_10245530 3300031731 Bacteria 1329
638 Ga0307405_10269376 3300031731 Bacteria 1276
639 Ga0307413_10004276 3300031824 Bacteria 6187
640 Ga0307413_10028641 3300031824 Bacteria 3105
641 Ga0307413_10034622 3300031824 Bacteria 2888
642 Ga0307413_10113670 3300031824 Bacteria 1818
643 Ga0307410_10005374 3300031852 Bacteria 6773
644 Ga0307410_10020540 3300031852 Bacteria 4042
645 Ga0307410_10032715 3300031852 Bacteria 3350
646 Ga0307410_10040083 3300031852 Bacteria 3080
647 Ga0307410_10055276 3300031852 Bacteria 2694
648 Ga0307410_10071463 3300031852 Bacteria 2407
649 Ga0307410_10192091 3300031852 Bacteria 1553
650 Ga0307406_10004794 3300031901 Bacteria 7368
651 Ga0307407_10009102 3300031903 Bacteria 4606
652 Ga0307407_10015187 3300031903 Bacteria 3796
653 Ga0307407_10040347 3300031903 Bacteria 2602
654 Ga0307407_10075987 3300031903 Bacteria 2016
655 Ga0307407_10312279 3300031903 Bacteria 1100
656 Ga0307412_10029129 3300031911 Bacteria 3463
657 Ga0307412_10122529 3300031911 Bacteria 1874
658 Ga0307412_10226934 3300031911 Bacteria 1435
659 Ga0307412_10241951 3300031911 Bacteria 1396
660 Ga0307409_100002583 3300031995 Bacteria 9517
661 Ga0307409_100019478 3300031995 Bacteria 4596
662 Ga0307409_100022713 3300031995 Bacteria 4327
663 Ga0307409_100024920 3300031995 Bacteria 4184
664 Ga0307409_100026966 3300031995 Bacteria 4062
665 Ga0307409_100045541 3300031995 Bacteria 3312
666 Ga0307409_100328332 3300031995 Bacteria 1434
667 Ga0307409_100348303 3300031995 Bacteria 1397
668 Ga0307416_100007787 3300032002 Bacteria 6848
669 Ga0307416_100084424 3300032002 Bacteria 2698
670 Ga0307414_10001839 3300032004 Bacteria 10971
671 Ga0307414_10008332 3300032004 Bacteria 5872
672 Ga0307414_10012558 3300032004 Bacteria 5013
673 Ga0307414_10027385 3300032004 Bacteria 3683
674 Ga0307414_10088768 3300032004 Bacteria 2289
675 Ga0307414_10172170 3300032004 Bacteria 1732
676 Ga0307414_10231208 3300032004 Bacteria 1525
677 Ga0307414_10342344 3300032004 Bacteria 1280
678 Ga0307411_10001530 3300032005 Bacteria 9535
679 Ga0307411_10005989 3300032005 Bacteria 6041
680 Ga0307411_10084452 3300032005 Bacteria 2196
681 Ga0307411_10095419 3300032005 Bacteria 2088
682 Ga0307411_10140798 3300032005 Bacteria 1778
683 Ga0307411_10201642 3300032005 Bacteria 1528
684 Ga0307411_10242012 3300032005 Bacteria 1413
685 Ga0307411_10440807 3300032005 Bacteria 1087
686 Ga0307415_100009352 3300032126 Bacteria 5487
687 Ga0307415_100064456 3300032126 Bacteria 2549
688 Ga0307415_100259986 3300032126 Bacteria 1416
689 Ga0307415_100640193 3300032126 Bacteria 952
690 Ga0373929_0025778 3300035085 Bacteria 1224
691 Ga0373954_0090849 3300035118 Bacteria 1467
692 Ga0373931_0010837 3300035691 Bacteria 4388
693 Ga0373937_0003405 3300036401 Bacteria 13351
694 Ga0395899_0006172 3300037312 Bacteria 9287
695 Ga0395899_0015288 3300037312 Bacteria 5848
696 Ga0395899_0025278 3300037312 Bacteria 4483
697 Ga0395899_0061377 3300037312 Bacteria 2769
698 Ga0395899_0116544 3300037312 Bacteria 1916
699 Ga0395899_0119892 3300037312 Bacteria 1885
700 Ga0395899_0130644 3300037312 Bacteria 1793
701 Ga0395899_0209911 3300037312 Bacteria 1353
702 Ga0395899_0214472 3300037312 Bacteria 1336
703 Ga0395899_0381755 3300037312 Bacteria 936
704 Ga0395900_0002764 3300037418 Bacteria 19179
705 Ga0395900_0019481 3300037418 Bacteria 6917
706 Ga0395900_0038911 3300037418 Bacteria 4902
707 Ga0395900_0049795 3300037418 Bacteria 4316
708 Ga0395900_0051017 3300037418 Bacteria 4262
709 Ga0395900_0056227 3300037418 Bacteria 4051
710 Ga0395900_0061052 3300037418 Bacteria 3877
711 Ga0395900_0073498 3300037418 Bacteria 3515
712 Ga0395900_0163233 3300037418 Bacteria 2271
713 Ga0395900_0204647 3300037418 Bacteria 1995
714 Ga0395900_0351984 3300037418 Bacteria 1446
715 Ga0395900_0467967 3300037418 Bacteria 1214
716 Ga0395900_0759353 3300037418 Bacteria 899
717 Ga0395898_0016466 3300037466 Bacteria 7564
718 Ga0395898_0024522 3300037466 Bacteria 6082
719 Ga0395898_0027498 3300037466 Bacteria 5708
720 Ga0395898_0086580 3300037466 Bacteria 3019
721 Ga0395898_0219959 3300037466 Bacteria 1812
722 Ga0395898_0850772 3300037466 Bacteria 851
723 Ga0395905_0004447 3300037471 Bacteria 14566
724 Ga0395905_0014513 3300037471 Bacteria 7517
725 Ga0395905_0016811 3300037471 Bacteria 6949
726 Ga0395905_0031012 3300037471 Bacteria 5035
727 Ga0395905_0037243 3300037471 Bacteria 4568
728 Ga0395905_0038730 3300037471 Bacteria 4471
729 Ga0395905_0045923 3300037471 Bacteria 4097
730 Ga0395905_0084015 3300037471 Bacteria 2982
731 Ga0395905_0100602 3300037471 Bacteria 2714
732 Ga0395905_0152909 3300037471 Bacteria 2170
733 Ga0395905_0216029 3300037471 Bacteria 1796
734 Ga0395905_0295598 3300037471 Bacteria 1506
735 Ga0395905_0300225 3300037471 Bacteria 1493
736 Ga0395905_0355074 3300037471 Bacteria 1358
737 Ga0395905_0401570 3300037471 Bacteria 1265
738 Ga0395905_0418744 3300037471 Bacteria 1235
739 Ga0395905_0475924 3300037471 Bacteria 1148
740 Ga0395905_0480691 3300037471 Bacteria 1141
741 Ga0395901_0000447 3300038443 Bacteria 47979
742 Ga0395901_0006195 3300038443 Bacteria 12120
743 Ga0395901_0025027 3300038443 Bacteria 6127
744 Ga0395901_0034167 3300038443 Bacteria 5250
745 Ga0395901_0065206 3300038443 Bacteria 3791
746 Ga0395901_0217337 3300038443 Bacteria 1998
747 Ga0395901_0726041 3300038443 Bacteria 988
748 Ga0395901_0771858 3300038443 Bacteria 952
749 Ga0237819_00807 3300038705 Bacteria 9935
750 Ga0237816_01189 3300039145 Bacteria 2142
751 Ga0436365_0644123 3300039437 Bacteria 36806
752 Ga0436365_0975016 3300039437 Bacteria 2818
753 Ga0436363_1597891 3300039450 Bacteria 1164
754 Ga0436362_0100223 3300039453 Bacteria 27479
755 Ga0439443_011022 3300042003 Bacteria 1319
756 Ga0439448_0082529 3300042005 Bacteria 1081
757 Ga0439449_0019389 3300042007 Bacteria 2550
758 Ga0450890_008259 3300042127 Bacteria 1331
759 Ga0450905_000818 3300042142 Bacteria 3861
760 Ga0450889_000253 3300042144 Bacteria 5930
761 Ga0466969_0021260 3300044656 Bacteria 3355
762 Ga0466972_0084835 3300044658 Bacteria 1506
763 Ga0466966_0000010 3300044684 Bacteria 150868
764 Ga0466966_0107090 3300044684 Bacteria 1725
765 Ga0466966_0108740 3300044684 Bacteria 1710
766 Ga0466966_0149865 3300044684 Bacteria 1423
767 Ga0466961_0012071 3300044693 Bacteria 5521
768 Ga0466961_0016476 3300044693 Bacteria 4748
769 Ga0466961_0143256 3300044693 Bacteria 1495
770 Ga0466961_0259219 3300044693 Bacteria 1066
771 Ga0466963_0000483 3300044694 Bacteria 18580
772 Ga0466963_0001435 3300044694 Bacteria 12837
773 Ga0466963_0003668 3300044694 Bacteria 8835
774 Ga0466963_0006612 3300044694 Bacteria 6876
775 Ga0466963_0047424 3300044694 Bacteria 2835
776 Ga0466963_0278276 3300044694 Bacteria 1176
777 Ga0466963_0347866 3300044694 Bacteria 1044
778 Ga0466964_0012269 3300044706 Bacteria 3243
779 Ga0466971_0023433 3300044719 Bacteria 2752
780 Ga0466971_0024360 3300044719 Bacteria 2700
781 Ga0466971_0108114 3300044719 Bacteria 1282
782 Ga0466970_0013852 3300044765 Bacteria 4137
783 Ga0466957_0000637 3300044842 Bacteria 17756
784 Ga0466957_0001352 3300044842 Bacteria 12791
785 Ga0466957_0017665 3300044842 Bacteria 4182
786 Ga0466957_0025565 3300044842 Bacteria 3500
787 Ga0466959_0013990 3300045049 Bacteria 5824
788 Ga0466959_0104544 3300045049 Bacteria 2025
789 Ga0466959_0245250 3300045049 Bacteria 1236
790 Ga0466958_0000319 3300045836 Bacteria 19111
791 Ga0466958_0007241 3300045836 Bacteria 6085
792 Ga0466958_0195866 3300045836 Bacteria 1285
793 Ga0466967_0000024 3300045976 Bacteria 71156
794 Ga0466967_0007359 3300045976 Bacteria 7931
795 Ga0466967_0007627 3300045976 Bacteria 7829
796 Ga0466967_0010838 3300045976 Bacteria 6863
797 Ga0466967_0018729 3300045976 Bacteria 5544
798 Ga0466967_0029402 3300045976 Bacteria 4598
799 Ga0495616_0217256 3300046513 Bacteria 834
800 Ga0495642_0034942 3300046528 Bacteria 2027
801 Ga0495621_0120471 3300046539 Bacteria 1013
802 Ga0495668_0006646 3300046616 Bacteria 7535
803 Ga0495668_0063735 3300046616 Bacteria 2029
804 Ga0495668_0087096 3300046616 Bacteria 1713
805 Ga0495668_0222353 3300046616 Bacteria 1034
806 Ga0495625_0227676 3300046660 Bacteria 1219
807 Ga0495669_0002658 3300046684 Bacteria 7321
808 Ga0495669_0003668 3300046684 Bacteria 6320
809 Ga0495669_0061842 3300046684 Bacteria 1695
810 Ga0495669_0086804 3300046684 Bacteria 1441
811 Ga0495669_0182170 3300046684 Bacteria 1001
812 Ga0495687_046035 3300047443 Bacteria 1886
813 Ga0495677_0080456 3300047445 Bacteria 1221
814 Ga0495677_0093018 3300047445 Bacteria 1137
815 Ga0495677_0106009 3300047445 Bacteria 1066
816 Ga0495602_0009385 3300048088 Bacteria 10179
817 Ga0496100_0096142 3300048903 Bacteria 2032
818 Ga0496101_0101804 3300048904 Bacteria 2151
819 Ga0496101_0560606 3300048904 Bacteria 903
820 Ga0496102_0017852 3300048905 Bacteria 6221
821 Ga0496102_0097987 3300048905 Bacteria 2720
822 Ga0496102_0779534 3300048905 Bacteria 879
823 Ga0496103_0001734 3300048906 Bacteria 14249
824 Ga0496104_0232262 3300048907 Bacteria 1756
825 Ga0496105_0057032 3300048908 Bacteria 3225
826 Ga0496107_0001503 3300048910 Bacteria 14474
827 Ga0496107_0088544 3300048910 Bacteria 2260
828 Ga0496108_0002103 3300048911 Bacteria 15940
829 Ga0496108_0067569 3300048911 Bacteria 3015
830 Ga0496109_0002512 3300048912 Bacteria 15386
831 Ga0496109_0060905 3300048912 Bacteria 3450
832 Ga0496112_0018461 3300048915 Bacteria 6568
833 Ga0496112_0073443 3300048915 Bacteria 3381
834 Ga0496112_0551618 3300048915 Bacteria 1086
835 Ga0496113_0341528 3300048916 Bacteria 1201
836 Ga0496116_0070921 3300048919 Bacteria 2209
837 Ga0496117_0005336 3300048920 Bacteria 13550
838 Ga0496118_0049762 3300048921 Bacteria 3223
839 Ga0496121_0004060 3300048924 Bacteria 20104
840 Ga0496124_0164310 3300048927 Bacteria 1727
841 Ga0496125_0084802 3300048928 Bacteria 2404
842 Ga0501292_000549 3300049515 Bacteria 4645
843 Ga0501294_001942 3300049517 Bacteria 2001
844 Ga0501297_003400 3300049520 Bacteria 1583
845 Ga0501300_002616 3300049523 Bacteria 2701
846 Ga0501067_0043107 3300049583 Bacteria 2506
847 Ga0501070_0068576 3300049586 Bacteria 2936
848 Ga0501074_0115976 3300049590 Bacteria 1916
849 Ga0501202_010523 3300049652 Bacteria 1719
850 Ga0501222_000855 3300049662 Bacteria 4399
851 Ga0501224_000449 3300049664 Bacteria 4952
852 Ga0501227_019053 3300049665 Bacteria 1562
853 Ga0501233_004614 3300049668 Bacteria 2534
854 Ga0501235_002955 3300049669 Bacteria 3661
855 Ga0501259_000484 3300049688 Bacteria 6355
856 Ga0501261_000390 3300049690 Bacteria 5840
857 Ga0501225_0014519 3300049705 Bacteria 2198
858 Ga0501245_002415 3300049708 Bacteria 2494
859 Ga0501279_000017 3300049775 Bacteria 62448
860 Ga0501281_00274 3300049777 Bacteria 5364
861 Ga0501282_000244 3300049778 Bacteria 6635
862 Ga0501283_000568 3300049779 Bacteria 4836
863 nmdc:mga08y16_177543_c1 3300050511 Bacteria 2211
864 nmdc:mga08y16_18229_c1 3300050511 Bacteria 7396
865 nmdc:mga0n895_339995_c1 3300050512 Bacteria 1520
866 nmdc:mga0a205_27776_c1 3300050515 Bacteria 5406
867 Ga0495612_0054688 3300053078 Bacteria 1645
868 Ga0500643_002264 3300053087 Bacteria 10109
869 Ga0500643_002303 3300053087 Bacteria 10014
870 Ga0500643_015232 3300053087 Bacteria 2642
871 Ga0500562_015734 3300053108 Bacteria 1942
872 Ga0500592_003742 3300053116 Bacteria 2426
873 Ga0500595_015109 3300053119 Bacteria 2903
874 Ga0500608_000671 3300053122 Bacteria 12516
875 Ga0500614_031429 3300053123 Bacteria 1300
876 Ga0500658_0000133 3300053134 Bacteria 35167
877 Ga0500564_021253 3300053138 Bacteria 2972
878 Ga0500573_0038777 3300053140 Bacteria 2753
879 Ga0500636_0074200 3300053177 Bacteria 1969
880 Ga0500567_006844 3300053723 Bacteria 5340
881 Ga0500625_000003 3300053729 Bacteria 268493
882 Ga0501084_0597313 3300054114 Bacteria 933
883 Ga0466962_0001563 3300061719 Bacteria 10694
884 Ga0466962_0256202 3300061719 Bacteria 860
885 2946788874 2946787523 Bacteria 4366789
886 Ga0207661_10634495
887 LJQas_1003377
888 JGI24736J21556_1000077
889 JGI24741J21665_1021826
890 JGI24752J21851_1000389
891 JGI24740J21852_10003210
892 JGI24740J21852_10026087
893 JGI24740J21852_10035963
894 JGI24740J21852_10041232
895 JGI24739J22299_10004715
896 JGI24739J22299_10008406
897 JGI24739J22299_10009302
898 JGI24739J22299_10016397
899 JGI24737J22298_10001496
900 JGI24737J22298_10001667
901 JGI24737J22298_10004394
902 JGI24737J22298_10017161
903 JGI24743J22301_10029124
904 JGI24735J21928_10001163
905 JGI24735J21928_10003714
906 JGI24735J21928_10028440
907 JGI24735J21928_10048845
908 JGI24750J21931_1001279
909 JGI24748J21848_1000077
910 JGI24738J21930_10001136
911 JGI24738J21930_10002781
912 JGI24738J21930_10003298
913 JGI24749J21850_1000601
914 JGI24034J26672_10000019
915 JGI24742J22300_10001732
916 JGI24751J29686_10009521
917 JGI24751J29686_10030205
918 Ga0065707_10000608
919 Ga0070658_10002385
920 Ga0070658_10002556
921 Ga0070658_10008804
922 Ga0070658_10017679
923 Ga0070658_10047313
924 Ga0070658_10052144
925 Ga0070658_10290969
926 Ga0070658_10540270
927 Ga0070676_10002365
928 Ga0070676_10024716
929 Ga0070676_10159258
930 Ga0070683_100002173
931 Ga0070683_100029236
932 Ga0070683_100194342
933 Ga0070683_100746509
934 Ga0070690_100000041
935 Ga0070670_100001367
936 Ga0070670_100006295
937 Ga0070670_100014459
938 Ga0070670_100059821
939 Ga0070670_100088968
940 Ga0070670_100329854
941 Ga0068869_100325415
942 Ga0070666_10000002
943 Ga0070666_10000033
944 Ga0070666_10000346
945 Ga0070666_10005001
946 Ga0070666_10234884
947 Ga0070680_100001372
948 Ga0070680_100003752
949 Ga0070680_100005783
950 Ga0070680_100035900
951 Ga0070680_100073706
952 Ga0070682_100143077
953 Ga0070682_100324096
954 Ga0068868_100740220
955 Ga0070660_100000350
956 Ga0070660_100023254
957 Ga0070660_100063122
958 Ga0070660_100070259
959 Ga0070660_100246332
960 Ga0070660_100251594
961 Ga0070660_100336621
962 Ga0070660_100567372
963 Ga0070689_100007577
964 Ga0070691_10090055
965 Ga0070661_100000001
966 Ga0070661_100000536
967 Ga0070661_100012197
968 Ga0070661_100012206
969 Ga0070661_100024645
970 Ga0070661_100033730
971 Ga0070661_100056871
972 Ga0070661_100125009
973 Ga0070661_100182211
974 Ga0070692_10010962
975 Ga0070692_10011511
976 Ga0070692_10015086
977 Ga0070692_10118806
978 Ga0070668_100000018
979 Ga0070668_100002689
980 Ga0070668_100023411
981 Ga0070668_100597121
982 Ga0070669_100000075
983 Ga0070669_100000244
984 Ga0070669_100014556
985 Ga0070669_100143388
986 Ga0070669_100239482
987 Ga0070669_100394120
988 Ga0070675_100046500
989 Ga0070671_100000015
990 Ga0070671_100003459
991 Ga0070671_100005129
992 Ga0070671_100014760
993 Ga0070671_100080753
994 Ga0070671_100084378
995 Ga0070674_100149427
996 Ga0070674_100378024
997 Ga0070673_100006497
998 Ga0070673_100007677
999 Ga0070673_100018220
1000 Ga0070659_100007487
1001 Ga0070659_100044806
1002 Ga0070659_100056790
1003 Ga0070659_100082238
1004 Ga0070659_100225813
1005 Ga0070659_100328517
1006 Ga0070667_100001306
1007 Ga0070667_100008405
1008 Ga0070667_100054554
1009 Ga0070667_100249868
1010 Ga0070667_100507174
1011 Ga0070667_100773823
1012 Ga0070714_100048834
1013 Ga0070714_100083023
1014 Ga0070694_100006197
1015 Ga0070694_100023666
1016 Ga0070663_100000364
1017 Ga0070663_100007184
1018 Ga0070663_100027651
1019 Ga0070663_100397244
1020 Ga0070678_100044720
1021 Ga0070678_100051663
1022 Ga0070662_100000024
1023 Ga0070662_100002504
1024 Ga0070662_100006023
1025 Ga0070662_100007112
1026 Ga0070662_100018480
1027 Ga0070662_100033059
1028 Ga0070662_100082865
1029 Ga0070662_100327421
1030 Ga0070681_10069146
1031 Ga0070681_10249995
1032 Ga0070681_10301566
1033 Ga0070681_10471496
1034 Ga0068867_100050570
1035 Ga0070685_10000023
1036 Ga0070679_100000003
1037 Ga0070679_100153017
1038 Ga0070679_100174111
1039 Ga0070679_100218265
1040 Ga0070684_100011221
1041 Ga0070684_100019372
1042 Ga0070684_100049262
1043 Ga0070684_100671918
1044 Ga0068853_100000033
1045 Ga0068853_100003628
1046 Ga0068853_100035102
1047 Ga0068853_100122221
1048 Ga0068853_100625159
1049 Ga0070672_100090273
1050 Ga0070672_100106406
1051 Ga0070686_100000003
1052 Ga0070686_100139817
1053 Ga0070695_100037844
1054 Ga0070696_100010269
1055 Ga0070693_100010106
1056 Ga0070693_100039525
1057 Ga0070693_100188463
1058 Ga0070693_100222407
1059 Ga0070665_100000036
1060 Ga0070665_100010377
1061 Ga0070665_100012270
1062 Ga0070665_100027636
1063 Ga0070665_100032835
1064 Ga0070665_100050546
1065 Ga0070665_100110796
1066 Ga0068855_100012061
1067 Ga0068855_100031052
1068 Ga0068855_100152295
1069 Ga0068855_100226442
1070 Ga0070664_100002469
1071 Ga0070664_100003103
1072 Ga0070664_100005430
1073 Ga0070664_100046453
1074 Ga0070664_100049518
1075 Ga0070664_100253185
1076 Ga0070664_100272105
1077 Ga0070664_100615541
1078 Ga0068857_100001595
1079 Ga0068857_100077751
1080 Ga0068857_100078863
1081 Ga0068857_100139184
1082 Ga0068857_100153008
1083 Ga0068854_100002372
1084 Ga0068854_100047771
1085 Ga0068854_100080320
1086 Ga0068854_100145916
1087 Ga0068854_100146513
1088 Ga0068854_100280936
1089 Ga0068856_100012156
1090 Ga0068856_100035913
1091 Ga0068856_100152844
1092 Ga0068856_100282101
1093 Ga0068856_100413084
1094 Ga0068852_100000442
1095 Ga0068852_100002110
1096 Ga0068852_100006174
1097 Ga0068852_100043129
1098 Ga0068852_100053764
1099 Ga0068852_100067306
1100 Ga0068852_100069523
1101 Ga0068852_100098642
1102 Ga0068852_100348984
1103 Ga0068852_100397276
1104 Ga0068852_100549812
1105 Ga0068852_100777783
1106 Ga0068859_100000194
1107 Ga0068859_100015135
1108 Ga0068859_100037870
1109 Ga0068859_100048525
1110 Ga0068859_100053137
1111 Ga0068859_100325605
1112 Ga0068864_100002410
1113 Ga0068864_100004829
1114 Ga0068864_100123051
1115 Ga0068864_100222049
1116 Ga0068864_100388645
1117 Ga0068866_10012441
1118 Ga0068861_100000396
1119 Ga0068861_100000541
1120 Ga0068861_100229067
1121 Ga0068851_10001361
1122 Ga0068851_10008392
1123 Ga0068851_10009581
1124 Ga0068851_10108174
1125 Ga0068863_100000122
1126 Ga0068863_100000447
1127 Ga0068863_100031202
1128 Ga0068863_100153081
1129 Ga0068863_100201464
1130 Ga0068858_100003091
1131 Ga0068858_100003713
1132 Ga0068858_100013190
1133 Ga0068858_100038421
1134 Ga0068858_100294668
1135 Ga0068860_100000001
1136 Ga0068860_100009292
1137 Ga0068860_100035137
1138 Ga0068860_100041014
1139 Ga0068860_100162322
1140 Ga0068860_100403613
1141 Ga0068860_100581715
1142 Ga0068862_100000088
1143 Ga0068862_100000169
1144 Ga0068862_100003026
1145 Ga0068862_100173236
1146 Ga0068862_100184797
1147 Ga0068862_100290436
1148 Ga0068862_100664264
1149 Ga0081539_10068968
1150 Ga0097621_100010978
1151 Ga0068871_100097916
1152 Ga0068871_100104899
1153 Ga0068871_100188951
1154 Ga0075428_100057430
1155 Ga0075431_100199731
1156 Ga0075433_10044439
1157 Ga0075434_100586704
1158 Ga0068865_100022540
1159 Ga0068865_100033002
1160 Ga0068865_100267597
1161 Ga0097620_100000194
1162 Ga0097620_100015136
1163 Ga0097620_100037870
1164 Ga0097620_100048525
1165 Ga0097620_100053134
1166 Ga0097620_100325617
1167 Ga0105240_10002881
1168 Ga0105240_10019011
1169 Ga0105240_10063296
1170 Ga0105240_10208548
1171 Ga0111539_10077698
1172 Ga0105247_10003917
1173 Ga0105247_10026917
1174 Ga0105243_10203751
1175 Ga0105241_10039084
1176 Ga0105248_10000059
1177 Ga0105248_10016178
1178 Ga0105248_10032513
1179 Ga0105248_10042692
1180 Ga0105248_10047803
1181 Ga0105248_10152266
1182 Ga0105248_10152760
1183 Ga0105248_10201318
1184 Ga0105248_10453008
1185 Ga0105248_11075950
1186 Ga0105237_10043045
1187 Ga0105237_10148386
1188 Ga0105238_10014487
1189 Ga0105238_10026132
1190 Ga0105238_10027868
1191 Ga0105249_10000114
1192 Ga0105249_10011902
1193 Ga0105249_10023765
1194 Ga0105239_10036292
1195 Ga0105239_10053209
1196 Ga0105239_10054509
1197 Ga0157373_10035467
1198 Ga0157373_10035817
1199 Ga0157373_10039770
1200 Ga0157373_10039950
1201 Ga0157373_10052520
1202 Ga0157373_10055262
1203 Ga0157373_10067939
1204 Ga0157373_10084651
1205 Ga0157373_10126847
1206 Ga0157373_10144333
1207 Ga0157373_10483823
1208 Ga0157371_10001377
1209 Ga0157371_10015137
1210 Ga0157371_10017875
1211 Ga0157371_10037109
1212 Ga0157371_10096253
1213 Ga0157371_10114922
1214 Ga0157371_10148879
1215 Ga0157370_10015915
1216 Ga0157370_10137801
1217 Ga0157370_10175964
1218 Ga0157370_10476310
1219 Ga0157369_10001177
1220 Ga0157369_10007864
1221 Ga0157369_10021183
1222 Ga0157369_10023254
1223 Ga0157369_10072432
1224 Ga0157369_10124371
1225 Ga0157369_10200641
1226 Ga0157369_10501788
1227 Ga0157374_10013537
1228 Ga0157374_10015389
1229 Ga0157378_10992550
1230 Ga0163162_10002477
1231 Ga0163162_10005984
1232 Ga0163162_10165441
1233 Ga0163162_10271502
1234 Ga0163162_10300592
1235 Ga0163162_10842046
1236 Ga0157372_10013006
1237 Ga0157372_10112515
1238 Ga0157372_10454277
1239 Ga0157375_10170873
1240 Ga0157375_11106797
1241 Ga0163163_10001821
1242 Ga0163163_10370030
1243 Ga0157380_10054361
1244 Ga0157380_10263802
1245 Ga0157380_10566107
1246 Ga0157377_10108773
1247 Ga0157379_10016026
1248 Ga0157379_10062381
1249 Ga0157379_10122298
1250 Ga0157379_10158740
1251 Ga0163161_10000008
1252 Ga0163161_10042633
1253 Ga0163161_10484262
1254 Ga0206354_10247148
1255 Ga0206353_10397570
1256 Ga0206353_11608620
1257 Ga0206353_11737640
1258 Ga0213873_10000025
1259 Ga0213876_10000004
1260 Ga0213876_10037095
1261 Ga0207697_10000415
1262 Ga0207697_10012773
1263 Ga0207656_10004523
1264 Ga0207656_10046127
1265 Ga0207656_10061739
1266 Ga0207682_10000833
1267 Ga0207710_10002250
1268 Ga0207710_10031249
1269 Ga0207688_10018560
1270 Ga0207688_10070269
1271 Ga0207680_10000004
1272 Ga0207680_10000421
1273 Ga0207680_10001930
1274 Ga0207680_10081673
1275 Ga0207680_10083411
1276 Ga0207647_10000383
1277 Ga0207647_10000713
1278 Ga0207647_10001284
1279 Ga0207647_10004399
1280 Ga0207647_10007057
1281 Ga0207647_10011206
1282 Ga0207647_10042869
1283 Ga0207647_10066345
1284 Ga0207645_10003962
1285 Ga0207645_10006878
1286 Ga0207645_10249915
1287 Ga0207643_10167976
1288 Ga0207705_10000062
1289 Ga0207705_10005890
1290 Ga0207705_10014129
1291 Ga0207705_10018254
1292 Ga0207705_10021396
1293 Ga0207705_10024795
1294 Ga0207705_10026770
1295 Ga0207705_10228832
1296 Ga0207705_10245988
1297 Ga0207705_10492035
1298 Ga0207654_10000529
1299 Ga0207707_10035899
1300 Ga0207707_10087286
1301 Ga0207707_10093246
1302 Ga0207707_10429510
1303 Ga0207695_10001388
1304 Ga0207695_10003145
1305 Ga0207671_10000479
1306 Ga0207671_10110131
1307 Ga0207660_10003552
1308 Ga0207660_10005888
1309 Ga0207660_10006304
1310 Ga0207660_10015982
1311 Ga0207660_10137903
1312 Ga0207657_10000015
1313 Ga0207657_10002109
1314 Ga0207657_10009209
1315 Ga0207657_10018283
1316 Ga0207657_10025311
1317 Ga0207657_10037392
1318 Ga0207657_10037664
1319 Ga0207657_10109082
1320 Ga0207657_10119715
1321 Ga0207657_10148800
1322 Ga0207657_10156263
1323 Ga0207657_10172801
1324 Ga0207657_10359659
1325 Ga0207649_10000011
1326 Ga0207649_10000264
1327 Ga0207649_10021606
1328 Ga0207649_10204341
1329 Ga0207649_10283479
1330 Ga0207652_10000004
1331 Ga0207652_10436579
1332 Ga0207681_10000002
1333 Ga0207681_10000079
1334 Ga0207681_10103192
1335 Ga0207681_10168076
1336 Ga0207681_10204965
1337 Ga0207694_10004197
1338 Ga0207694_10005445
1339 Ga0207694_10047060
1340 Ga0207694_10172688
1341 Ga0207650_10013831
1342 Ga0207650_10067004
1343 Ga0207650_10263454
1344 Ga0207659_10039520
1345 Ga0207664_10430879
1346 Ga0207644_10000002
1347 Ga0207644_10003279
1348 Ga0207644_10007294
1349 Ga0207644_10083923
1350 Ga0207644_10115033
1351 Ga0207644_10372060
1352 Ga0207644_10443308
1353 Ga0207690_10000032
1354 Ga0207690_10003533
1355 Ga0207690_10029499
1356 Ga0207690_10032167
1357 Ga0207690_10038053
1358 Ga0207690_10055137
1359 Ga0207690_10168070
1360 Ga0207690_10189189
1361 Ga0207690_10241398
1362 Ga0207690_10411318
1363 Ga0207690_10449229
1364 Ga0207706_10000032
1365 Ga0207706_10003797
1366 Ga0207706_10008916
1367 Ga0207706_10017705
1368 Ga0207706_10048588
1369 Ga0207706_10082556
1370 Ga0207706_10131304
1371 Ga0207706_10584227
1372 Ga0207706_10609125
1373 Ga0207706_10690455
1374 Ga0207669_10121285
1375 Ga0207669_10131438
1376 Ga0207704_10023730
1377 Ga0207691_10054017
1378 Ga0207691_10069313
1379 Ga0207691_10125245
1380 Ga0207711_10000476
1381 Ga0207711_10003942
1382 Ga0207711_10006527
1383 Ga0207711_10007836
1384 Ga0207711_10085985
1385 Ga0207711_10103621
1386 Ga0207711_10140078
1387 Ga0207711_10247673
1388 Ga0207711_10890922
1389 Ga0207689_10238639
1390 Ga0207661_10015766
1391 Ga0207661_10030714
1392 Ga0207661_10211689
1393 Ga0207661_10638583
1394 Ga0207679_10000466
1395 Ga0207679_10002870
1396 Ga0207679_10006436
1397 Ga0207679_10352739
1398 Ga0207679_10524377
1399 Ga0207667_10004727
1400 Ga0207667_10011320
1401 Ga0207667_10012620
1402 Ga0207667_10015693
1403 Ga0207667_10025120
1404 Ga0207667_10079206
1405 Ga0207667_10117972
1406 Ga0207667_10118577
1407 Ga0207667_10403872
1408 Ga0207667_10436391
1409 Ga0207667_10456718
1410 Ga0207651_10010148
1411 Ga0207651_10518740
1412 Ga0207712_10000001
1413 Ga0207712_10007135
1414 Ga0207712_10008302
1415 Ga0207712_10086609
1416 Ga0207668_10000060
1417 Ga0207668_10000155
1418 Ga0207668_10000342
1419 Ga0207668_10279116
1420 Ga0207668_10426032
1421 Ga0207640_10002809
1422 Ga0207640_10006191
1423 Ga0207640_10032776
1424 Ga0207640_10040078
1425 Ga0207640_10054121
1426 Ga0207640_10054693
1427 Ga0207658_10000903
1428 Ga0207658_10006238
1429 Ga0207658_10007390
1430 Ga0207658_10009321
1431 Ga0207658_10009971
1432 Ga0207658_10165895
1433 Ga0207658_10357361
1434 Ga0207677_10535282
1435 Ga0207677_10644956
1436 Ga0207703_10021265
1437 Ga0207703_10025934
1438 Ga0207703_10101612
1439 Ga0207703_10599846
1440 Ga0207639_10000260
1441 Ga0207639_10000410
1442 Ga0207639_10045273
1443 Ga0207639_10054105
1444 Ga0207639_10109196
1445 Ga0207639_10127341
1446 Ga0207639_10171003
1447 Ga0207639_10204623
1448 Ga0207639_10549012
1449 Ga0207678_10000913
1450 Ga0207678_10004123
1451 Ga0207678_10006236
1452 Ga0207678_10018078
1453 Ga0207678_10041680
1454 Ga0207678_10055689
1455 Ga0207702_10000072
1456 Ga0207702_10014384
1457 Ga0207702_10047352
1458 Ga0207702_10049186
1459 Ga0207702_10072288
1460 Ga0207702_10174825
1461 Ga0207702_10196208
1462 Ga0207702_10256789
1463 Ga0207641_10000001
1464 Ga0207641_10000154
1465 Ga0207641_10023361
1466 Ga0207641_10072637
1467 Ga0207648_10004169
1468 Ga0207648_10114550
1469 Ga0207648_10205301
1470 Ga0207676_10002226
1471 Ga0207676_10067902
1472 Ga0207676_10093993
1473 Ga0207676_10136128
1474 Ga0207676_10789791
1475 Ga0207674_10002883
1476 Ga0207674_10023004
1477 Ga0207674_10050845
1478 Ga0207674_10054085
1479 Ga0207674_10144544
1480 Ga0207674_10341332
1481 Ga0207674_10344761
1482 Ga0207674_10757447
1483 Ga0207675_100001479
1484 Ga0207675_100004101
1485 Ga0207675_100074151
1486 Ga0207683_10005280
1487 Ga0207683_10010998
1488 Ga0207698_10000401
1489 Ga0207698_10003068
1490 Ga0207698_10003399
1491 Ga0207698_10022740
1492 Ga0207698_10078953
1493 Ga0207698_10364104
1494 Ga0207698_10375574
1495 Ga0207428_10076159
1496 Ga0268266_10000042
1497 Ga0268266_10008481
1498 Ga0268266_10009180
1499 Ga0268266_10063121
1500 Ga0268266_10138999
1501 Ga0268266_10194991
1502 Ga0268265_10000190
1503 Ga0268265_10000497
1504 Ga0268265_10001444
1505 Ga0268265_10072127
1506 Ga0268265_10083424
1507 Ga0268265_10211045
1508 Ga0268264_10000006
1509 Ga0268264_10000010
1510 Ga0268264_10001806
1511 Ga0268264_10004648
1512 Ga0268264_10007250
1513 Ga0268264_10856200
1514 Ga0307408_100063721
1515 Ga0307408_100121824
1516 Ga0307408_100493556
1517 Ga0307405_10009350
1518 Ga0307405_10014509
1519 Ga0307405_10017914
1520 Ga0307405_10058821
1521 Ga0307405_10204170
1522 Ga0307405_10245530
1523 Ga0307405_10269376
1524 Ga0307413_10004276
1525 Ga0307413_10028641
1526 Ga0307413_10034622
1527 Ga0307413_10113670
1528 Ga0307410_10005374
1529 Ga0307410_10020540
1530 Ga0307410_10032715
1531 Ga0307410_10040083
1532 Ga0307410_10055276
1533 Ga0307410_10071463
1534 Ga0307410_10192091
1535 Ga0307406_10004794
1536 Ga0307407_10009102
1537 Ga0307407_10015187
1538 Ga0307407_10040347
1539 Ga0307407_10075987
1540 Ga0307407_10312279
1541 Ga0307412_10029129
1542 Ga0307412_10122529
1543 Ga0307412_10226934
1544 Ga0307412_10241951
1545 Ga0307409_100002583
1546 Ga0307409_100019478
1547 Ga0307409_100022713
1548 Ga0307409_100024920
1549 Ga0307409_100026966
1550 Ga0307409_100045541
1551 Ga0307409_100328332
1552 Ga0307409_100348303
1553 Ga0307416_100007787
1554 Ga0307416_100084424
1555 Ga0307414_10001839
1556 Ga0307414_10008332
1557 Ga0307414_10012558
1558 Ga0307414_10027385
1559 Ga0307414_10088768
1560 Ga0307414_10172170
1561 Ga0307414_10231208
1562 Ga0307414_10342344
1563 Ga0307411_10001530
1564 Ga0307411_10005989
1565 Ga0307411_10084452
1566 Ga0307411_10095419
1567 Ga0307411_10140798
1568 Ga0307411_10201642
1569 Ga0307411_10242012
1570 Ga0307411_10440807
1571 Ga0307415_100009352
1572 Ga0307415_100064456
1573 Ga0307415_100259986
1574 Ga0307415_100640193
1575 Ga0373929_0025778
1576 Ga0373954_0090849
1577 Ga0373931_0010837
1578 Ga0373937_0003405
1579 Ga0395899_0006172
1580 Ga0395899_0015288
1581 Ga0395899_0025278
1582 Ga0395899_0061377
1583 Ga0395899_0116544
1584 Ga0395899_0119892
1585 Ga0395899_0130644
1586 Ga0395899_0209911
1587 Ga0395899_0214472
1588 Ga0395899_0381755
1589 Ga0395900_0002764
1590 Ga0395900_0019481
1591 Ga0395900_0038911
1592 Ga0395900_0049795
1593 Ga0395900_0051017
1594 Ga0395900_0056227
1595 Ga0395900_0061052
1596 Ga0395900_0073498
1597 Ga0395900_0163233
1598 Ga0395900_0204647
1599 Ga0395900_0351984
1600 Ga0395900_0467967
1601 Ga0395900_0759353
1602 Ga0395898_0016466
1603 Ga0395898_0024522
1604 Ga0395898_0027498
1605 Ga0395898_0086580
1606 Ga0395898_0219959
1607 Ga0395898_0850772
1608 Ga0395905_0004447
1609 Ga0395905_0014513
1610 Ga0395905_0016811
1611 Ga0395905_0031012
1612 Ga0395905_0037243
1613 Ga0395905_0038730
1614 Ga0395905_0045923
1615 Ga0395905_0084015
1616 Ga0395905_0100602
1617 Ga0395905_0152909
1618 Ga0395905_0216029
1619 Ga0395905_0295598
1620 Ga0395905_0300225
1621 Ga0395905_0355074
1622 Ga0395905_0401570
1623 Ga0395905_0418744
1624 Ga0395905_0475924
1625 Ga0395905_0480691
1626 Ga0395901_0000447
1627 Ga0395901_0006195
1628 Ga0395901_0025027
1629 Ga0395901_0034167
1630 Ga0395901_0065206
1631 Ga0395901_0217337
1632 Ga0395901_0726041
1633 Ga0395901_0771858
1634 Ga0237819_00807
1635 Ga0237816_01189
1636 Ga0436365_0644123
1637 Ga0436365_0975016
1638 Ga0436363_1597891
1639 Ga0436362_0100223
1640 Ga0439443_011022
1641 Ga0439448_0082529
1642 Ga0439449_0019389
1643 Ga0450890_008259
1644 Ga0450905_000818
1645 Ga0450889_000253
1646 Ga0466969_0021260
1647 Ga0466972_0084835
1648 Ga0466966_0000010
1649 Ga0466966_0107090
1650 Ga0466966_0108740
1651 Ga0466966_0149865
1652 Ga0466961_0012071
1653 Ga0466961_0016476
1654 Ga0466961_0143256
1655 Ga0466961_0259219
1656 Ga0466963_0000483
1657 Ga0466963_0001435
1658 Ga0466963_0003668
1659 Ga0466963_0006612
1660 Ga0466963_0047424
1661 Ga0466963_0278276
1662 Ga0466963_0347866
1663 Ga0466964_0012269
1664 Ga0466971_0023433
1665 Ga0466971_0024360
1666 Ga0466971_0108114
1667 Ga0466970_0013852
1668 Ga0466957_0000637
1669 Ga0466957_0001352
1670 Ga0466957_0017665
1671 Ga0466957_0025565
1672 Ga0466959_0013990
1673 Ga0466959_0104544
1674 Ga0466959_0245250
1675 Ga0466958_0000319
1676 Ga0466958_0007241
1677 Ga0466958_0195866
1678 Ga0466967_0000024
1679 Ga0466967_0007359
1680 Ga0466967_0007627
1681 Ga0466967_0010838
1682 Ga0466967_0018729
1683 Ga0466967_0029402
1684 Ga0495616_0217256
1685 Ga0495642_0034942
1686 Ga0495621_0120471
1687 Ga0495668_0006646
1688 Ga0495668_0063735
1689 Ga0495668_0087096
1690 Ga0495668_0222353
1691 Ga0495625_0227676
1692 Ga0495669_0002658
1693 Ga0495669_0003668
1694 Ga0495669_0061842
1695 Ga0495669_0086804
1696 Ga0495669_0182170
1697 Ga0495687_046035
1698 Ga0495677_0080456
1699 Ga0495677_0093018
1700 Ga0495677_0106009
1701 Ga0495602_0009385
1702 Ga0496100_0096142
1703 Ga0496101_0101804
1704 Ga0496101_0560606
1705 Ga0496102_0017852
1706 Ga0496102_0097987
1707 Ga0496102_0779534
1708 Ga0496103_0001734
1709 Ga0496104_0232262
1710 Ga0496105_0057032
1711 Ga0496107_0001503
1712 Ga0496107_0088544
1713 Ga0496108_0002103
1714 Ga0496108_0067569
1715 Ga0496109_0002512
1716 Ga0496109_0060905
1717 Ga0496112_0018461
1718 Ga0496112_0073443
1719 Ga0496112_0551618
1720 Ga0496113_0341528
1721 Ga0496116_0070921
1722 Ga0496117_0005336
1723 Ga0496118_0049762
1724 Ga0496121_0004060
1725 Ga0496124_0164310
1726 Ga0496125_0084802
1727 Ga0501292_000549
1728 Ga0501294_001942
1729 Ga0501297_003400
1730 Ga0501300_002616
1731 Ga0501067_0043107
1732 Ga0501070_0068576
1733 Ga0501074_0115976
1734 Ga0501202_010523
1735 Ga0501222_000855
1736 Ga0501224_000449
1737 Ga0501227_019053
1738 Ga0501233_004614
1739 Ga0501235_002955
1740 Ga0501259_000484
1741 Ga0501261_000390
1742 Ga0501225_0014519
1743 Ga0501245_002415
1744 Ga0501279_000017
1745 Ga0501281_00274
1746 Ga0501282_000244
1747 Ga0501283_000568
1748 nmdc:mga08y16_177543_c1
1749 nmdc:mga08y16_18229_c1
1750 nmdc:mga0n895_339995_c1
1751 nmdc:mga0a205_27776_c1
1752 Ga0495612_0054688
1753 Ga0500643_002264
1754 Ga0500643_002303
1755 Ga0500643_015232
1756 Ga0500562_015734
1757 Ga0500592_003742
1758 Ga0500595_015109
1759 Ga0500608_000671
1760 Ga0500614_031429
1761 Ga0500658_0000133
1762 Ga0500564_021253
1763 Ga0500573_0038777
1764 Ga0500636_0074200
1765 Ga0500567_006844
1766 Ga0500625_000003
1767 Ga0501084_0597313
1768 Ga0466962_0001563
1769 Ga0466962_0256202
1770 2946788874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03309

Pan_kinase

Type III pantothenate kinase

2

209

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3djc-assembly1.cif.gz_L crystal structure of pantothenate kinase from legionella pneumophila 0.9518 1 255
2h3g-assembly1.cif.gz_X-2 structure of the type iii pantothenate kinase (coax) from bacillus anthracis 0.9497 1 255
3djc-assembly2.cif.gz_D crystal structure of pantothenate kinase from legionella pneumophila 0.9452 2 258
3djc-assembly1.cif.gz_K crystal structure of pantothenate kinase from legionella pneumophila 0.9416 1 256
3djc-assembly2.cif.gz_A crystal structure of pantothenate kinase from legionella pneumophila 0.941 1 255
ID Description Score Start End Superfamily
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9676 1 87 3.30.420.40
2h3gX02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9668 96 255 3.30.420.40
3djcB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9528 2 87 3.30.420.40
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9465 1 87 3.30.420.40
af_P9WPA1_91_271_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9355 90 257 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A520I383-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) 0.9935 60 257 GO:0004594
GO:0005524
GO:0005737
GO:0015937
AF-A0A2E8LTB3-F1-model_v4 deleted 0.9923 1 256
AF-A0A846M789-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9922 1 257 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872
AF-A0A520I6S4-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) 0.9855 144 258 GO:0004594
GO:0005524
GO:0005737
GO:0015937
AF-A0A2E8LTB3-F1-model_v4 deleted 0.9847 1 256

Map