F484668
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 885 | 255 | 1770 | 424 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100098841|Ga0307409_1000988412 |
| Length | 451 |
| Sequence | LTGEADTRNDPLVSPTRNEGVFASVSNDLSYLTGFGAHFESEAVPDALPKGRNSPQRPAFGLYTEQLSGTAFTAPRHENRRSWLYRMRPTADHRPFERYLGAELFAPGTVDEPVAPNRLRWDPPELPADTDFVDGLVTMMANRDPASLEGVAIHLYRASRSMRDRVFVNADGELLIIPQSGTLRLFTEFGRMELPPGWVGLVPRGVKFRVEVDGEARGYVAENHGALFRLPELGPIGSNGLANARDFETPVAAYEDVDRPCEVVQKYMGSLWTTTLDHSPLDVVAWHGNLAPCRYELARFNTIGTVSFDHPDPSIFTVLTSPSDTPGRANADFVIFPPRWMVGEDTFRPPWFHRNVMSEAMGLIHGAYDAKADGFAPGGLSLHNMMSGHGPDVESWRKASGAELKPVKIEGTMAFMVESCWPYKPTRFALDRAQPDYDEAWADFPKAELPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 178 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 179 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 180 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 181 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 182 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 183 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 184 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 185 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 186 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 187 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 188 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 193 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 210 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 211 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 214 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 220 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 221 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 222 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 223 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 226 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 227 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 230 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 236 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 237 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 238 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 239 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 240 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 241 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 242 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 243 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 244 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 245 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 246 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 247 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 248 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 249 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 250 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 251 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 252 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 253 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 254 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 255 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 0 |
| Isolates | 2.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.56 |
| Bulb | 0 |
| Endosphere | 1.69 |
| Nodule | 0 |
| Rhizoplane | 3.95 |
| Rhizosphere | 91.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307409_100098841 | 3300031995 | Bacteria | 2415 |
| 2 | ARcpr5oldR_c003416 | 3300000041 | Bacteria | 1412 |
| 3 | JGI24736J21556_1000361 | 3300001904 | Bacteria | 8555 |
| 4 | JGI24740J21852_10016319 | 3300001979 | Bacteria | 2685 |
| 5 | JGI24740J21852_10025735 | 3300001979 | Bacteria | 1979 |
| 6 | JGI24739J22299_10000035 | 3300001989 | Bacteria | 37844 |
| 7 | JGI24739J22299_10023017 | 3300001989 | Bacteria | 2205 |
| 8 | JGI24737J22298_10000020 | 3300001990 | Bacteria | 46324 |
| 9 | JGI24737J22298_10007189 | 3300001990 | Bacteria | 3767 |
| 10 | JGI24737J22298_10023224 | 3300001990 | Bacteria | 1968 |
| 11 | JGI24735J21928_10014192 | 3300002067 | Bacteria | 2497 |
| 12 | JGI24738J21930_10000048 | 3300002075 | Bacteria | 24246 |
| 13 | JGI24738J21930_10007423 | 3300002075 | Bacteria | 2529 |
| 14 | Ga0055524_1000351 | 3300003775 | Bacteria | 41918 |
| 15 | Ga0055530_10000144 | 3300003791 | Bacteria | 63595 |
| 16 | Ga0055531_10000188 | 3300003794 | Bacteria | 68777 |
| 17 | Ga0055531_10019042 | 3300003794 | Bacteria | 2801 |
| 18 | Ga0070658_10000220 | 3300005327 | Bacteria | 50700 |
| 19 | Ga0070658_10000264 | 3300005327 | Bacteria | 46199 |
| 20 | Ga0070658_10002220 | 3300005327 | Bacteria | 16299 |
| 21 | Ga0070658_10015611 | 3300005327 | Bacteria | 6073 |
| 22 | Ga0070658_10045810 | 3300005327 | Bacteria | 3537 |
| 23 | Ga0070658_10074692 | 3300005327 | Bacteria | 2780 |
| 24 | Ga0070658_10077096 | 3300005327 | Bacteria | 2734 |
| 25 | Ga0070676_10008339 | 3300005328 | Bacteria | 5583 |
| 26 | Ga0070683_100009023 | 3300005329 | Bacteria | 8507 |
| 27 | Ga0070683_100011883 | 3300005329 | Bacteria | 7548 |
| 28 | Ga0070683_100036805 | 3300005329 | Bacteria | 4479 |
| 29 | Ga0070683_100133841 | 3300005329 | Bacteria | 2347 |
| 30 | Ga0070670_100009146 | 3300005331 | Bacteria | 8467 |
| 31 | Ga0070670_100021908 | 3300005331 | Bacteria | 5498 |
| 32 | Ga0070670_100028039 | 3300005331 | Bacteria | 4845 |
| 33 | Ga0070670_100033024 | 3300005331 | Bacteria | 4459 |
| 34 | Ga0070670_100033080 | 3300005331 | Bacteria | 4454 |
| 35 | Ga0070670_100045987 | 3300005331 | Bacteria | 3753 |
| 36 | Ga0070670_100046834 | 3300005331 | Bacteria | 3719 |
| 37 | Ga0070670_100054617 | 3300005331 | Bacteria | 3429 |
| 38 | Ga0070670_100071120 | 3300005331 | Bacteria | 2987 |
| 39 | Ga0070670_100131084 | 3300005331 | Bacteria | 2165 |
| 40 | Ga0070670_100141532 | 3300005331 | Bacteria | 2080 |
| 41 | Ga0070677_10000460 | 3300005333 | Bacteria | 13951 |
| 42 | Ga0070677_10000776 | 3300005333 | Bacteria | 10645 |
| 43 | Ga0068869_100000043 | 3300005334 | Bacteria | 52392 |
| 44 | Ga0070666_10001568 | 3300005335 | Bacteria | 13884 |
| 45 | Ga0070666_10036747 | 3300005335 | Bacteria | 3253 |
| 46 | Ga0070666_10049979 | 3300005335 | Bacteria | 2812 |
| 47 | Ga0070680_100000406 | 3300005336 | Bacteria | 29408 |
| 48 | Ga0070680_100015034 | 3300005336 | Bacteria | 6059 |
| 49 | Ga0070680_100060976 | 3300005336 | Bacteria | 3087 |
| 50 | Ga0070680_100123262 | 3300005336 | Bacteria | 2164 |
| 51 | Ga0070680_100125407 | 3300005336 | Bacteria | 2145 |
| 52 | Ga0070680_100281703 | 3300005336 | Bacteria | 1408 |
| 53 | Ga0070682_100060468 | 3300005337 | Bacteria | 2396 |
| 54 | Ga0070682_100084418 | 3300005337 | Bacteria | 2063 |
| 55 | Ga0068868_100000957 | 3300005338 | Bacteria | 19654 |
| 56 | Ga0070660_100000091 | 3300005339 | Bacteria | 54397 |
| 57 | Ga0070660_100000218 | 3300005339 | Bacteria | 37921 |
| 58 | Ga0070660_100000415 | 3300005339 | Bacteria | 28402 |
| 59 | Ga0070660_100008260 | 3300005339 | Bacteria | 7276 |
| 60 | Ga0070660_100018258 | 3300005339 | Bacteria | 5123 |
| 61 | Ga0070660_100026322 | 3300005339 | Bacteria | 4329 |
| 62 | Ga0070660_100028865 | 3300005339 | Bacteria | 4154 |
| 63 | Ga0070660_100062331 | 3300005339 | Bacteria | 2896 |
| 64 | Ga0070689_100024220 | 3300005340 | Bacteria | 4551 |
| 65 | Ga0070691_10006893 | 3300005341 | Bacteria | 5197 |
| 66 | Ga0070687_100064342 | 3300005343 | Bacteria | 1948 |
| 67 | Ga0070661_100000181 | 3300005344 | Bacteria | 52052 |
| 68 | Ga0070661_100018437 | 3300005344 | Bacteria | 4960 |
| 69 | Ga0070661_100019737 | 3300005344 | Bacteria | 4803 |
| 70 | Ga0070661_100026891 | 3300005344 | Bacteria | 4141 |
| 71 | Ga0070661_100027478 | 3300005344 | Bacteria | 4097 |
| 72 | Ga0070661_100038040 | 3300005344 | Bacteria | 3502 |
| 73 | Ga0070692_10003786 | 3300005345 | Bacteria | 6220 |
| 74 | Ga0070692_10006331 | 3300005345 | Bacteria | 5135 |
| 75 | Ga0070692_10006444 | 3300005345 | Bacteria | 5097 |
| 76 | Ga0070692_10026911 | 3300005345 | Bacteria | 2847 |
| 77 | Ga0070668_100005171 | 3300005347 | Bacteria | 9675 |
| 78 | Ga0070669_100000209 | 3300005353 | Bacteria | 48982 |
| 79 | Ga0070669_100072542 | 3300005353 | Bacteria | 2549 |
| 80 | Ga0070675_100003209 | 3300005354 | Bacteria | 12385 |
| 81 | Ga0070675_100028103 | 3300005354 | Bacteria | 4525 |
| 82 | Ga0070675_100053098 | 3300005354 | Bacteria | 3333 |
| 83 | Ga0070675_100080480 | 3300005354 | Bacteria | 2715 |
| 84 | Ga0070671_100000946 | 3300005355 | Bacteria | 21265 |
| 85 | Ga0070671_100002968 | 3300005355 | Bacteria | 13201 |
| 86 | Ga0070671_100012684 | 3300005355 | Bacteria | 6792 |
| 87 | Ga0070671_100024791 | 3300005355 | Bacteria | 4914 |
| 88 | Ga0070671_100025393 | 3300005355 | Bacteria | 4861 |
| 89 | Ga0070671_100027296 | 3300005355 | Bacteria | 4698 |
| 90 | Ga0070671_100045117 | 3300005355 | Bacteria | 3664 |
| 91 | Ga0070671_100048574 | 3300005355 | Bacteria | 3529 |
| 92 | Ga0070671_100102513 | 3300005355 | Bacteria | 2401 |
| 93 | Ga0070674_100042634 | 3300005356 | Bacteria | 3084 |
| 94 | Ga0070674_100099248 | 3300005356 | Bacteria | 2118 |
| 95 | Ga0070673_100000354 | 3300005364 | Bacteria | 24130 |
| 96 | Ga0070673_100008820 | 3300005364 | Bacteria | 6733 |
| 97 | Ga0070673_100017737 | 3300005364 | Bacteria | 5071 |
| 98 | Ga0070673_100041312 | 3300005364 | Bacteria | 3546 |
| 99 | Ga0070659_100000310 | 3300005366 | Bacteria | 37921 |
| 100 | Ga0070659_100000463 | 3300005366 | Bacteria | 29968 |
| 101 | Ga0070659_100010426 | 3300005366 | Bacteria | 6834 |
| 102 | Ga0070659_100032895 | 3300005366 | Bacteria | 4026 |
| 103 | Ga0070659_100090425 | 3300005366 | Bacteria | 2453 |
| 104 | Ga0070659_100143964 | 3300005366 | Bacteria | 1941 |
| 105 | Ga0070659_100170636 | 3300005366 | Bacteria | 1782 |
| 106 | Ga0070667_100020045 | 3300005367 | Bacteria | 5552 |
| 107 | Ga0070667_100020452 | 3300005367 | Bacteria | 5494 |
| 108 | Ga0070667_100048276 | 3300005367 | Bacteria | 3583 |
| 109 | Ga0070667_100068583 | 3300005367 | Bacteria | 3017 |
| 110 | Ga0070713_100020766 | 3300005436 | Bacteria | 5041 |
| 111 | Ga0070713_100085671 | 3300005436 | Bacteria | 2700 |
| 112 | Ga0070663_100000991 | 3300005455 | Bacteria | 15463 |
| 113 | Ga0070663_100007128 | 3300005455 | Bacteria | 6785 |
| 114 | Ga0070663_100008110 | 3300005455 | Bacteria | 6443 |
| 115 | Ga0070663_100077759 | 3300005455 | Bacteria | 2430 |
| 116 | Ga0070663_100108360 | 3300005455 | Bacteria | 2083 |
| 117 | Ga0070663_100112765 | 3300005455 | Bacteria | 2045 |
| 118 | Ga0070663_100127369 | 3300005455 | Bacteria | 1930 |
| 119 | Ga0070663_100237344 | 3300005455 | Bacteria | 1438 |
| 120 | Ga0070678_100008935 | 3300005456 | Bacteria | 6035 |
| 121 | Ga0070678_100022943 | 3300005456 | Bacteria | 4149 |
| 122 | Ga0070678_100093552 | 3300005456 | Bacteria | 2312 |
| 123 | Ga0070678_100111605 | 3300005456 | Bacteria | 2140 |
| 124 | Ga0070678_100127384 | 3300005456 | Bacteria | 2018 |
| 125 | Ga0070662_100000080 | 3300005457 | Bacteria | 53280 |
| 126 | Ga0070662_100000754 | 3300005457 | Bacteria | 19853 |
| 127 | Ga0070662_100004660 | 3300005457 | Bacteria | 8696 |
| 128 | Ga0070662_100007202 | 3300005457 | Bacteria | 7205 |
| 129 | Ga0070662_100015854 | 3300005457 | Bacteria | 5055 |
| 130 | Ga0070662_100017439 | 3300005457 | Bacteria | 4842 |
| 131 | Ga0070662_100022342 | 3300005457 | Bacteria | 4330 |
| 132 | Ga0070662_100029969 | 3300005457 | Bacteria | 3803 |
| 133 | Ga0070662_100050500 | 3300005457 | Bacteria | 3000 |
| 134 | Ga0070662_100158421 | 3300005457 | Bacteria | 1769 |
| 135 | Ga0070681_10038880 | 3300005458 | Bacteria | 4770 |
| 136 | Ga0070681_10041232 | 3300005458 | Bacteria | 4626 |
| 137 | Ga0068867_100008883 | 3300005459 | Bacteria | 7089 |
| 138 | Ga0068867_100014754 | 3300005459 | Bacteria | 5537 |
| 139 | Ga0068867_100029006 | 3300005459 | Bacteria | 3986 |
| 140 | Ga0070679_100025521 | 3300005530 | Bacteria | 5800 |
| 141 | Ga0070684_100016504 | 3300005535 | Bacteria | 6035 |
| 142 | Ga0070684_100030299 | 3300005535 | Bacteria | 4595 |
| 143 | Ga0068853_100000134 | 3300005539 | Bacteria | 50184 |
| 144 | Ga0068853_100001421 | 3300005539 | Bacteria | 17280 |
| 145 | Ga0068853_100040321 | 3300005539 | Bacteria | 3984 |
| 146 | Ga0068853_100083647 | 3300005539 | Bacteria | 2796 |
| 147 | Ga0068853_100102504 | 3300005539 | Bacteria | 2532 |
| 148 | Ga0070672_100000380 | 3300005543 | Bacteria | 25710 |
| 149 | Ga0070672_100016111 | 3300005543 | Bacteria | 5346 |
| 150 | Ga0070672_100064233 | 3300005543 | Bacteria | 2900 |
| 151 | Ga0070672_100077256 | 3300005543 | Bacteria | 2662 |
| 152 | Ga0070696_100016806 | 3300005546 | Bacteria | 4935 |
| 153 | Ga0070693_100000536 | 3300005547 | Bacteria | 17016 |
| 154 | Ga0070693_100061774 | 3300005547 | Bacteria | 2179 |
| 155 | Ga0070665_100000054 | 3300005548 | Bacteria | 244426 |
| 156 | Ga0070665_100023191 | 3300005548 | Bacteria | 6252 |
| 157 | Ga0070665_100028342 | 3300005548 | Bacteria | 5641 |
| 158 | Ga0070665_100067607 | 3300005548 | Bacteria | 3583 |
| 159 | Ga0070665_100116472 | 3300005548 | Bacteria | 2675 |
| 160 | Ga0068855_100000129 | 3300005563 | Bacteria | 96519 |
| 161 | Ga0068855_100000780 | 3300005563 | Bacteria | 39315 |
| 162 | Ga0068855_100044279 | 3300005563 | Bacteria | 5267 |
| 163 | Ga0068855_100047304 | 3300005563 | Bacteria | 5082 |
| 164 | Ga0068855_100052397 | 3300005563 | Bacteria | 4804 |
| 165 | Ga0068855_100073049 | 3300005563 | Bacteria | 3986 |
| 166 | Ga0068855_100206491 | 3300005563 | Bacteria | 2210 |
| 167 | Ga0070664_100000047 | 3300005564 | Bacteria | 73560 |
| 168 | Ga0070664_100003329 | 3300005564 | Bacteria | 12989 |
| 169 | Ga0070664_100012056 | 3300005564 | Bacteria | 7023 |
| 170 | Ga0070664_100024362 | 3300005564 | Bacteria | 5005 |
| 171 | Ga0070664_100052616 | 3300005564 | Bacteria | 3449 |
| 172 | Ga0070664_100157749 | 3300005564 | Bacteria | 2006 |
| 173 | Ga0070664_100173301 | 3300005564 | Bacteria | 1914 |
| 174 | Ga0068857_100007558 | 3300005577 | Bacteria | 9355 |
| 175 | Ga0068857_100023330 | 3300005577 | Bacteria | 5445 |
| 176 | Ga0068857_100034442 | 3300005577 | Bacteria | 4480 |
| 177 | Ga0068857_100046735 | 3300005577 | Bacteria | 3842 |
| 178 | Ga0068857_100179196 | 3300005577 | Bacteria | 1928 |
| 179 | Ga0068854_100000414 | 3300005578 | Bacteria | 26795 |
| 180 | Ga0068854_100026433 | 3300005578 | Bacteria | 3989 |
| 181 | Ga0068854_100032791 | 3300005578 | Bacteria | 3616 |
| 182 | Ga0068854_100056555 | 3300005578 | Bacteria | 2827 |
| 183 | Ga0068854_100121723 | 3300005578 | Bacteria | 1982 |
| 184 | Ga0068854_100166436 | 3300005578 | Bacteria | 1712 |
| 185 | Ga0068854_100180451 | 3300005578 | Bacteria | 1649 |
| 186 | Ga0068856_100001328 | 3300005614 | Bacteria | 26042 |
| 187 | Ga0068856_100029171 | 3300005614 | Bacteria | 5389 |
| 188 | Ga0068856_100040215 | 3300005614 | Bacteria | 4592 |
| 189 | Ga0068856_100091223 | 3300005614 | Bacteria | 3031 |
| 190 | Ga0068856_100113303 | 3300005614 | Bacteria | 2710 |
| 191 | Ga0068852_100000798 | 3300005616 | Bacteria | 20761 |
| 192 | Ga0068852_100002050 | 3300005616 | Bacteria | 13737 |
| 193 | Ga0068852_100002251 | 3300005616 | Bacteria | 13240 |
| 194 | Ga0068852_100010705 | 3300005616 | Bacteria | 6867 |
| 195 | Ga0068852_100048328 | 3300005616 | Bacteria | 3634 |
| 196 | Ga0068852_100086847 | 3300005616 | Bacteria | 2789 |
| 197 | Ga0068852_100110050 | 3300005616 | Bacteria | 2503 |
| 198 | Ga0068852_100152921 | 3300005616 | Bacteria | 2147 |
| 199 | Ga0068859_100003417 | 3300005617 | Bacteria | 16150 |
| 200 | Ga0068859_100004856 | 3300005617 | Bacteria | 13679 |
| 201 | Ga0068859_100008232 | 3300005617 | Bacteria | 10577 |
| 202 | Ga0068859_100251848 | 3300005617 | Bacteria | 1856 |
| 203 | Ga0068864_100000181 | 3300005618 | Bacteria | 58221 |
| 204 | Ga0068864_100000652 | 3300005618 | Bacteria | 28966 |
| 205 | Ga0068864_100001327 | 3300005618 | Bacteria | 20582 |
| 206 | Ga0068864_100006134 | 3300005618 | Bacteria | 9859 |
| 207 | Ga0068864_100038107 | 3300005618 | Bacteria | 4103 |
| 208 | Ga0068864_100106455 | 3300005618 | Bacteria | 2494 |
| 209 | Ga0068864_100115478 | 3300005618 | Bacteria | 2395 |
| 210 | Ga0068866_10006592 | 3300005718 | Bacteria | 4840 |
| 211 | Ga0068866_10019163 | 3300005718 | Bacteria | 3108 |
| 212 | Ga0068861_100000036 | 3300005719 | Bacteria | 60355 |
| 213 | Ga0068851_10002516 | 3300005834 | Bacteria | 8061 |
| 214 | Ga0068851_10043372 | 3300005834 | Bacteria | 2268 |
| 215 | Ga0068863_100003734 | 3300005841 | Bacteria | 15056 |
| 216 | Ga0068863_100004126 | 3300005841 | Bacteria | 14361 |
| 217 | Ga0068863_100013157 | 3300005841 | Bacteria | 7984 |
| 218 | Ga0068863_100044951 | 3300005841 | Bacteria | 4191 |
| 219 | Ga0068863_100064625 | 3300005841 | Bacteria | 3461 |
| 220 | Ga0068863_100149391 | 3300005841 | Bacteria | 2235 |
| 221 | Ga0068858_100005075 | 3300005842 | Bacteria | 12907 |
| 222 | Ga0068858_100019868 | 3300005842 | Bacteria | 6281 |
| 223 | Ga0068858_100080601 | 3300005842 | Bacteria | 3025 |
| 224 | Ga0068858_100105442 | 3300005842 | Bacteria | 2630 |
| 225 | Ga0068860_100002079 | 3300005843 | Bacteria | 21111 |
| 226 | Ga0068860_100021050 | 3300005843 | Bacteria | 6318 |
| 227 | Ga0068860_100087843 | 3300005843 | Bacteria | 2959 |
| 228 | Ga0068860_100137300 | 3300005843 | Bacteria | 2348 |
| 229 | Ga0068862_100005042 | 3300005844 | Bacteria | 11111 |
| 230 | Ga0068862_100013934 | 3300005844 | Bacteria | 6665 |
| 231 | Ga0068862_100088938 | 3300005844 | Bacteria | 2687 |
| 232 | Ga0068862_100089198 | 3300005844 | Bacteria | 2683 |
| 233 | Ga0068862_100107130 | 3300005844 | Bacteria | 2451 |
| 234 | Ga0081539_10013055 | 3300005985 | Bacteria | 6301 |
| 235 | Ga0081539_10056537 | 3300005985 | Bacteria | 2177 |
| 236 | Ga0070717_10022023 | 3300006028 | Bacteria | 5030 |
| 237 | Ga0070717_10065554 | 3300006028 | Bacteria | 3019 |
| 238 | Ga0097621_100088259 | 3300006237 | Bacteria | 2591 |
| 239 | Ga0097621_100108627 | 3300006237 | Bacteria | 2342 |
| 240 | Ga0068871_100051389 | 3300006358 | Bacteria | 3337 |
| 241 | Ga0068871_100066219 | 3300006358 | Bacteria | 2961 |
| 242 | Ga0075431_100068229 | 3300006847 | Bacteria | 3670 |
| 243 | Ga0075433_10022184 | 3300006852 | Bacteria | 5329 |
| 244 | Ga0068865_100002737 | 3300006881 | Bacteria | 10470 |
| 245 | Ga0068865_100068973 | 3300006881 | Bacteria | 2501 |
| 246 | Ga0097620_100003417 | 3300006931 | Bacteria | 16150 |
| 247 | Ga0097620_100004857 | 3300006931 | Bacteria | 13679 |
| 248 | Ga0097620_100008232 | 3300006931 | Bacteria | 10577 |
| 249 | Ga0105250_10009470 | 3300009092 | Bacteria | 4099 |
| 250 | Ga0105240_10010591 | 3300009093 | Bacteria | 12956 |
| 251 | Ga0105240_10085341 | 3300009093 | Bacteria | 3868 |
| 252 | Ga0105240_10141777 | 3300009093 | Bacteria | 2872 |
| 253 | Ga0105245_10003294 | 3300009098 | Bacteria | 14501 |
| 254 | Ga0105245_10009900 | 3300009098 | Bacteria | 8303 |
| 255 | Ga0105245_10062190 | 3300009098 | Bacteria | 3368 |
| 256 | Ga0105245_10303719 | 3300009098 | Bacteria | 1567 |
| 257 | Ga0105241_10154089 | 3300009174 | Bacteria | 1883 |
| 258 | Ga0105242_10028920 | 3300009176 | Bacteria | 4416 |
| 259 | Ga0105248_10000256 | 3300009177 | Bacteria | 62138 |
| 260 | Ga0105248_10000276 | 3300009177 | Bacteria | 60451 |
| 261 | Ga0105248_10002271 | 3300009177 | Bacteria | 21272 |
| 262 | Ga0105248_10004379 | 3300009177 | Bacteria | 15623 |
| 263 | Ga0105248_10016393 | 3300009177 | Bacteria | 8154 |
| 264 | Ga0105248_10072344 | 3300009177 | Bacteria | 3875 |
| 265 | Ga0105248_10111509 | 3300009177 | Bacteria | 3085 |
| 266 | Ga0105248_10277806 | 3300009177 | Bacteria | 1886 |
| 267 | Ga0105248_10470140 | 3300009177 | Bacteria | 1417 |
| 268 | Ga0105237_10014619 | 3300009545 | Bacteria | 8200 |
| 269 | Ga0105237_10035296 | 3300009545 | Bacteria | 5060 |
| 270 | Ga0105238_10009452 | 3300009551 | Bacteria | 9757 |
| 271 | Ga0105238_10010235 | 3300009551 | Bacteria | 9406 |
| 272 | Ga0105238_10021875 | 3300009551 | Bacteria | 6514 |
| 273 | Ga0105238_10034298 | 3300009551 | Bacteria | 5164 |
| 274 | Ga0105238_10035247 | 3300009551 | Bacteria | 5088 |
| 275 | Ga0105238_10152158 | 3300009551 | Bacteria | 2289 |
| 276 | Ga0105249_10022753 | 3300009553 | Bacteria | 5617 |
| 277 | Ga0105246_10002855 | 3300011119 | Bacteria | 10456 |
| 278 | Ga0105246_10036076 | 3300011119 | Bacteria | 3310 |
| 279 | Ga0157373_10007891 | 3300013100 | Bacteria | 7920 |
| 280 | Ga0157373_10009719 | 3300013100 | Bacteria | 7098 |
| 281 | Ga0157373_10025323 | 3300013100 | Bacteria | 4293 |
| 282 | Ga0157373_10031157 | 3300013100 | Bacteria | 3838 |
| 283 | Ga0157373_10115444 | 3300013100 | Bacteria | 1887 |
| 284 | Ga0157373_10151746 | 3300013100 | Bacteria | 1630 |
| 285 | Ga0157373_10196427 | 3300013100 | Bacteria | 1422 |
| 286 | Ga0157371_10005808 | 3300013102 | Bacteria | 10326 |
| 287 | Ga0157371_10006963 | 3300013102 | Bacteria | 9209 |
| 288 | Ga0157371_10012737 | 3300013102 | Bacteria | 6411 |
| 289 | Ga0157371_10064850 | 3300013102 | Bacteria | 2587 |
| 290 | Ga0157371_10085466 | 3300013102 | Bacteria | 2235 |
| 291 | Ga0157371_10085664 | 3300013102 | Bacteria | 2232 |
| 292 | Ga0157371_10173760 | 3300013102 | Bacteria | 1540 |
| 293 | Ga0157370_10024160 | 3300013104 | Bacteria | 6022 |
| 294 | Ga0157370_10093538 | 3300013104 | Bacteria | 2821 |
| 295 | Ga0157369_10000256 | 3300013105 | Bacteria | 73068 |
| 296 | Ga0157369_10002909 | 3300013105 | Bacteria | 20470 |
| 297 | Ga0157369_10071182 | 3300013105 | Bacteria | 3734 |
| 298 | Ga0157369_10116877 | 3300013105 | Bacteria | 2831 |
| 299 | Ga0157369_10127279 | 3300013105 | Bacteria | 2700 |
| 300 | Ga0157369_10162123 | 3300013105 | Bacteria | 2360 |
| 301 | Ga0157369_10171283 | 3300013105 | Bacteria | 2288 |
| 302 | Ga0157369_10218804 | 3300013105 | Bacteria | 1994 |
| 303 | Ga0157369_10263447 | 3300013105 | Bacteria | 1797 |
| 304 | Ga0157374_10007006 | 3300013296 | Bacteria | 9595 |
| 305 | Ga0157378_10009565 | 3300013297 | Bacteria | 8441 |
| 306 | Ga0163162_10031161 | 3300013306 | Bacteria | 5288 |
| 307 | Ga0163162_10057952 | 3300013306 | Bacteria | 3901 |
| 308 | Ga0163162_10136067 | 3300013306 | Bacteria | 2568 |
| 309 | Ga0157372_10042552 | 3300013307 | Bacteria | 5025 |
| 310 | Ga0157372_10087129 | 3300013307 | Bacteria | 3542 |
| 311 | Ga0157372_10368297 | 3300013307 | Bacteria | 1674 |
| 312 | Ga0157375_10117638 | 3300013308 | Bacteria | 2763 |
| 313 | Ga0157375_10133810 | 3300013308 | Bacteria | 2601 |
| 314 | Ga0163163_10001248 | 3300014325 | Bacteria | 21440 |
| 315 | Ga0163163_10002058 | 3300014325 | Bacteria | 16986 |
| 316 | Ga0157379_10009412 | 3300014968 | Bacteria | 8511 |
| 317 | Ga0183363_1003 | 3300015690 | Bacteria | 421263 |
| 318 | Ga0213876_10002881 | 3300021384 | Bacteria | 9990 |
| 319 | Ga0213876_10004001 | 3300021384 | Bacteria | 8298 |
| 320 | Ga0213876_10004890 | 3300021384 | Bacteria | 7431 |
| 321 | Ga0209565_1000012 | 3300025263 | Bacteria | 606500 |
| 322 | Ga0209673_1002916 | 3300025273 | Bacteria | 10783 |
| 323 | Ga0209758_1014215 | 3300025297 | Bacteria | 4255 |
| 324 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 325 | Ga0209050_1006599 | 3300025298 | Bacteria | 6814 |
| 326 | Ga0209256_1000012 | 3300025299 | Bacteria | 790371 |
| 327 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 328 | Ga0209257_1002618 | 3300025304 | Bacteria | 17382 |
| 329 | Ga0209257_1008681 | 3300025304 | Bacteria | 5684 |
| 330 | Ga0207697_10000007 | 3300025315 | Bacteria | 81785 |
| 331 | Ga0207656_10031657 | 3300025321 | Bacteria | 2193 |
| 332 | Ga0207682_10000990 | 3300025893 | Bacteria | 13121 |
| 333 | Ga0207688_10000318 | 3300025901 | Bacteria | 22194 |
| 334 | Ga0207680_10002818 | 3300025903 | Bacteria | 8142 |
| 335 | Ga0207680_10137738 | 3300025903 | Bacteria | 1615 |
| 336 | Ga0207647_10000052 | 3300025904 | Bacteria | 87651 |
| 337 | Ga0207647_10002807 | 3300025904 | Bacteria | 13133 |
| 338 | Ga0207647_10004040 | 3300025904 | Bacteria | 10933 |
| 339 | Ga0207647_10004972 | 3300025904 | Bacteria | 9802 |
| 340 | Ga0207647_10007015 | 3300025904 | Bacteria | 8171 |
| 341 | Ga0207647_10017277 | 3300025904 | Bacteria | 4905 |
| 342 | Ga0207647_10022358 | 3300025904 | Bacteria | 4201 |
| 343 | Ga0207647_10096726 | 3300025904 | Bacteria | 1756 |
| 344 | Ga0207643_10023313 | 3300025908 | Bacteria | 3412 |
| 345 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 346 | Ga0207705_10000091 | 3300025909 | Bacteria | 110768 |
| 347 | Ga0207705_10000164 | 3300025909 | Bacteria | 71606 |
| 348 | Ga0207705_10008160 | 3300025909 | Bacteria | 7668 |
| 349 | Ga0207705_10013215 | 3300025909 | Bacteria | 5959 |
| 350 | Ga0207705_10016261 | 3300025909 | Bacteria | 5335 |
| 351 | Ga0207705_10025987 | 3300025909 | Bacteria | 4178 |
| 352 | Ga0207705_10034518 | 3300025909 | Bacteria | 3617 |
| 353 | Ga0207705_10052020 | 3300025909 | Bacteria | 2948 |
| 354 | Ga0207705_10093022 | 3300025909 | Bacteria | 2210 |
| 355 | Ga0207705_10140640 | 3300025909 | Bacteria | 1802 |
| 356 | Ga0207705_10145941 | 3300025909 | Bacteria | 1770 |
| 357 | Ga0207705_10150601 | 3300025909 | Bacteria | 1743 |
| 358 | Ga0207654_10169330 | 3300025911 | Bacteria | 1417 |
| 359 | Ga0207707_10011788 | 3300025912 | Bacteria | 7605 |
| 360 | Ga0207707_10079403 | 3300025912 | Bacteria | 2865 |
| 361 | Ga0207695_10018139 | 3300025913 | Bacteria | 8145 |
| 362 | Ga0207695_10195379 | 3300025913 | Bacteria | 1940 |
| 363 | Ga0207671_10072953 | 3300025914 | Bacteria | 2563 |
| 364 | Ga0207660_10000515 | 3300025917 | Bacteria | 25797 |
| 365 | Ga0207660_10018580 | 3300025917 | Bacteria | 4636 |
| 366 | Ga0207660_10037917 | 3300025917 | Bacteria | 3361 |
| 367 | Ga0207660_10072371 | 3300025917 | Bacteria | 2510 |
| 368 | Ga0207657_10000090 | 3300025919 | Bacteria | 86852 |
| 369 | Ga0207657_10000092 | 3300025919 | Bacteria | 85665 |
| 370 | Ga0207657_10000252 | 3300025919 | Bacteria | 57036 |
| 371 | Ga0207657_10002608 | 3300025919 | Bacteria | 19479 |
| 372 | Ga0207657_10002996 | 3300025919 | Bacteria | 18106 |
| 373 | Ga0207657_10006356 | 3300025919 | Bacteria | 12274 |
| 374 | Ga0207657_10021378 | 3300025919 | Bacteria | 6092 |
| 375 | Ga0207657_10021511 | 3300025919 | Bacteria | 6066 |
| 376 | Ga0207657_10025279 | 3300025919 | Bacteria | 5479 |
| 377 | Ga0207657_10039639 | 3300025919 | Bacteria | 4184 |
| 378 | Ga0207657_10049207 | 3300025919 | Bacteria | 3675 |
| 379 | Ga0207657_10062635 | 3300025919 | Bacteria | 3183 |
| 380 | Ga0207657_10100874 | 3300025919 | Bacteria | 2396 |
| 381 | Ga0207657_10113188 | 3300025919 | Bacteria | 2239 |
| 382 | Ga0207657_10128074 | 3300025919 | Bacteria | 2083 |
| 383 | Ga0207649_10000324 | 3300025920 | Bacteria | 36296 |
| 384 | Ga0207649_10003256 | 3300025920 | Bacteria | 8884 |
| 385 | Ga0207649_10022792 | 3300025920 | Bacteria | 3619 |
| 386 | Ga0207649_10062731 | 3300025920 | Bacteria | 2344 |
| 387 | Ga0207649_10068631 | 3300025920 | Bacteria | 2255 |
| 388 | Ga0207649_10076008 | 3300025920 | Bacteria | 2160 |
| 389 | Ga0207652_10005656 | 3300025921 | Bacteria | 10140 |
| 390 | Ga0207652_10077375 | 3300025921 | Bacteria | 2903 |
| 391 | Ga0207652_10125035 | 3300025921 | Bacteria | 2290 |
| 392 | Ga0207681_10001637 | 3300025923 | Bacteria | 14424 |
| 393 | Ga0207681_10045124 | 3300025923 | Bacteria | 2957 |
| 394 | Ga0207694_10002074 | 3300025924 | Bacteria | 16573 |
| 395 | Ga0207694_10013642 | 3300025924 | Bacteria | 6123 |
| 396 | Ga0207650_10006298 | 3300025925 | Bacteria | 8089 |
| 397 | Ga0207650_10026898 | 3300025925 | Bacteria | 4110 |
| 398 | Ga0207650_10089581 | 3300025925 | Bacteria | 2348 |
| 399 | Ga0207650_10153112 | 3300025925 | Bacteria | 1821 |
| 400 | Ga0207659_10009713 | 3300025926 | Bacteria | 6016 |
| 401 | Ga0207659_10022318 | 3300025926 | Bacteria | 4213 |
| 402 | Ga0207659_10119291 | 3300025926 | Bacteria | 2019 |
| 403 | Ga0207659_10190505 | 3300025926 | Bacteria | 1632 |
| 404 | Ga0207687_10001182 | 3300025927 | Bacteria | 17845 |
| 405 | Ga0207687_10074809 | 3300025927 | Bacteria | 2429 |
| 406 | Ga0207700_10044939 | 3300025928 | Bacteria | 3256 |
| 407 | Ga0207664_10070301 | 3300025929 | Bacteria | 2817 |
| 408 | Ga0207644_10000960 | 3300025931 | Bacteria | 18405 |
| 409 | Ga0207644_10001690 | 3300025931 | Bacteria | 14227 |
| 410 | Ga0207644_10003068 | 3300025931 | Bacteria | 10758 |
| 411 | Ga0207644_10013613 | 3300025931 | Bacteria | 5428 |
| 412 | Ga0207644_10145751 | 3300025931 | Bacteria | 1828 |
| 413 | Ga0207690_10000184 | 3300025932 | Bacteria | 48035 |
| 414 | Ga0207690_10000463 | 3300025932 | Bacteria | 26092 |
| 415 | Ga0207690_10004224 | 3300025932 | Bacteria | 8491 |
| 416 | Ga0207690_10022380 | 3300025932 | Bacteria | 3931 |
| 417 | Ga0207690_10045185 | 3300025932 | Bacteria | 2908 |
| 418 | Ga0207690_10082109 | 3300025932 | Bacteria | 2254 |
| 419 | Ga0207690_10166858 | 3300025932 | Bacteria | 1646 |
| 420 | Ga0207706_10000110 | 3300025933 | Bacteria | 87522 |
| 421 | Ga0207706_10000705 | 3300025933 | Bacteria | 34845 |
| 422 | Ga0207706_10002377 | 3300025933 | Bacteria | 18374 |
| 423 | Ga0207706_10004248 | 3300025933 | Bacteria | 13491 |
| 424 | Ga0207706_10004820 | 3300025933 | Bacteria | 12639 |
| 425 | Ga0207706_10016933 | 3300025933 | Bacteria | 6575 |
| 426 | Ga0207706_10017389 | 3300025933 | Bacteria | 6477 |
| 427 | Ga0207706_10027566 | 3300025933 | Bacteria | 5079 |
| 428 | Ga0207706_10036885 | 3300025933 | Bacteria | 4342 |
| 429 | Ga0207706_10043467 | 3300025933 | Bacteria | 3981 |
| 430 | Ga0207706_10045339 | 3300025933 | Bacteria | 3896 |
| 431 | Ga0207706_10068218 | 3300025933 | Bacteria | 3130 |
| 432 | Ga0207670_10026192 | 3300025936 | Bacteria | 3673 |
| 433 | Ga0207669_10020498 | 3300025937 | Bacteria | 3469 |
| 434 | Ga0207704_10007674 | 3300025938 | Bacteria | 5111 |
| 435 | Ga0207691_10001179 | 3300025940 | Bacteria | 25979 |
| 436 | Ga0207691_10006830 | 3300025940 | Bacteria | 11007 |
| 437 | Ga0207691_10015481 | 3300025940 | Bacteria | 7252 |
| 438 | Ga0207691_10025389 | 3300025940 | Bacteria | 5564 |
| 439 | Ga0207691_10050326 | 3300025940 | Bacteria | 3815 |
| 440 | Ga0207691_10089990 | 3300025940 | Bacteria | 2751 |
| 441 | Ga0207711_10000586 | 3300025941 | Bacteria | 36944 |
| 442 | Ga0207711_10000922 | 3300025941 | Bacteria | 28344 |
| 443 | Ga0207711_10001460 | 3300025941 | Bacteria | 22085 |
| 444 | Ga0207711_10001669 | 3300025941 | Bacteria | 20448 |
| 445 | Ga0207711_10007771 | 3300025941 | Bacteria | 8959 |
| 446 | Ga0207711_10010179 | 3300025941 | Bacteria | 7807 |
| 447 | Ga0207711_10014091 | 3300025941 | Bacteria | 6643 |
| 448 | Ga0207711_10022743 | 3300025941 | Bacteria | 5244 |
| 449 | Ga0207711_10086054 | 3300025941 | Bacteria | 2755 |
| 450 | Ga0207711_10177036 | 3300025941 | Bacteria | 1938 |
| 451 | Ga0207689_10000014 | 3300025942 | Bacteria | 122534 |
| 452 | Ga0207689_10000840 | 3300025942 | Bacteria | 29578 |
| 453 | Ga0207689_10089510 | 3300025942 | Bacteria | 2528 |
| 454 | Ga0207689_10125762 | 3300025942 | Bacteria | 2109 |
| 455 | Ga0207661_10000179 | 3300025944 | Bacteria | 40861 |
| 456 | Ga0207661_10001420 | 3300025944 | Bacteria | 16133 |
| 457 | Ga0207661_10078905 | 3300025944 | Bacteria | 2712 |
| 458 | Ga0207661_10109447 | 3300025944 | Bacteria | 2334 |
| 459 | Ga0207661_10111803 | 3300025944 | Bacteria | 2311 |
| 460 | Ga0207679_10000329 | 3300025945 | Bacteria | 35247 |
| 461 | Ga0207679_10006275 | 3300025945 | Bacteria | 7501 |
| 462 | Ga0207679_10010964 | 3300025945 | Bacteria | 5848 |
| 463 | Ga0207679_10013820 | 3300025945 | Bacteria | 5295 |
| 464 | Ga0207679_10025379 | 3300025945 | Bacteria | 4074 |
| 465 | Ga0207679_10038207 | 3300025945 | Bacteria | 3419 |
| 466 | Ga0207679_10059770 | 3300025945 | Bacteria | 2829 |
| 467 | Ga0207679_10065804 | 3300025945 | Bacteria | 2714 |
| 468 | Ga0207679_10131241 | 3300025945 | Bacteria | 2010 |
| 469 | Ga0207679_10201529 | 3300025945 | Bacteria | 1662 |
| 470 | Ga0207667_10000303 | 3300025949 | Bacteria | 68209 |
| 471 | Ga0207667_10003943 | 3300025949 | Bacteria | 18261 |
| 472 | Ga0207667_10017917 | 3300025949 | Bacteria | 7959 |
| 473 | Ga0207667_10213795 | 3300025949 | Bacteria | 1976 |
| 474 | Ga0207667_10240147 | 3300025949 | Bacteria | 1854 |
| 475 | Ga0207651_10002150 | 3300025960 | Bacteria | 9314 |
| 476 | Ga0207651_10008275 | 3300025960 | Bacteria | 5609 |
| 477 | Ga0207651_10010582 | 3300025960 | Bacteria | 5119 |
| 478 | Ga0207651_10021255 | 3300025960 | Bacteria | 3940 |
| 479 | Ga0207651_10027315 | 3300025960 | Bacteria | 3583 |
| 480 | Ga0207712_10024214 | 3300025961 | Bacteria | 4018 |
| 481 | Ga0207640_10000404 | 3300025981 | Bacteria | 27391 |
| 482 | Ga0207640_10001192 | 3300025981 | Bacteria | 14205 |
| 483 | Ga0207640_10040222 | 3300025981 | Bacteria | 2964 |
| 484 | Ga0207640_10053167 | 3300025981 | Bacteria | 2643 |
| 485 | Ga0207640_10069913 | 3300025981 | Bacteria | 2359 |
| 486 | Ga0207658_10003404 | 3300025986 | Bacteria | 11260 |
| 487 | Ga0207658_10057702 | 3300025986 | Bacteria | 2886 |
| 488 | Ga0207658_10106759 | 3300025986 | Bacteria | 2205 |
| 489 | Ga0207677_10000905 | 3300026023 | Bacteria | 16619 |
| 490 | Ga0207677_10117684 | 3300026023 | Bacteria | 1992 |
| 491 | Ga0207703_10000933 | 3300026035 | Bacteria | 28397 |
| 492 | Ga0207703_10013815 | 3300026035 | Bacteria | 6292 |
| 493 | Ga0207703_10079833 | 3300026035 | Bacteria | 2724 |
| 494 | Ga0207703_10278030 | 3300026035 | Bacteria | 1519 |
| 495 | Ga0207639_10001273 | 3300026041 | Bacteria | 17019 |
| 496 | Ga0207639_10021459 | 3300026041 | Bacteria | 4639 |
| 497 | Ga0207639_10047095 | 3300026041 | Bacteria | 3256 |
| 498 | Ga0207639_10197667 | 3300026041 | Bacteria | 1722 |
| 499 | Ga0207678_10000681 | 3300026067 | Bacteria | 31104 |
| 500 | Ga0207678_10003366 | 3300026067 | Bacteria | 14426 |
| 501 | Ga0207678_10010854 | 3300026067 | Bacteria | 8006 |
| 502 | Ga0207678_10012732 | 3300026067 | Bacteria | 7386 |
| 503 | Ga0207678_10013063 | 3300026067 | Bacteria | 7285 |
| 504 | Ga0207678_10013162 | 3300026067 | Bacteria | 7258 |
| 505 | Ga0207678_10015058 | 3300026067 | Bacteria | 6804 |
| 506 | Ga0207678_10179403 | 3300026067 | Bacteria | 1808 |
| 507 | Ga0207678_10185774 | 3300026067 | Bacteria | 1775 |
| 508 | Ga0207702_10000391 | 3300026078 | Bacteria | 49957 |
| 509 | Ga0207702_10015887 | 3300026078 | Bacteria | 6233 |
| 510 | Ga0207702_10026416 | 3300026078 | Bacteria | 4821 |
| 511 | Ga0207702_10060817 | 3300026078 | Bacteria | 3220 |
| 512 | Ga0207702_10077591 | 3300026078 | Bacteria | 2873 |
| 513 | Ga0207702_10084531 | 3300026078 | Bacteria | 2763 |
| 514 | Ga0207702_10147938 | 3300026078 | Bacteria | 2134 |
| 515 | Ga0207702_10185500 | 3300026078 | Bacteria | 1918 |
| 516 | Ga0207641_10000817 | 3300026088 | Bacteria | 33157 |
| 517 | Ga0207641_10001015 | 3300026088 | Bacteria | 28538 |
| 518 | Ga0207641_10053290 | 3300026088 | Bacteria | 3428 |
| 519 | Ga0207641_10058993 | 3300026088 | Bacteria | 3267 |
| 520 | Ga0207641_10146935 | 3300026088 | Bacteria | 2132 |
| 521 | Ga0207648_10002058 | 3300026089 | Bacteria | 21922 |
| 522 | Ga0207648_10015266 | 3300026089 | Bacteria | 7065 |
| 523 | Ga0207648_10027466 | 3300026089 | Bacteria | 5051 |
| 524 | Ga0207676_10000666 | 3300026095 | Bacteria | 27542 |
| 525 | Ga0207676_10001889 | 3300026095 | Bacteria | 15314 |
| 526 | Ga0207676_10012435 | 3300026095 | Bacteria | 6098 |
| 527 | Ga0207676_10013953 | 3300026095 | Bacteria | 5767 |
| 528 | Ga0207676_10092559 | 3300026095 | Bacteria | 2487 |
| 529 | Ga0207674_10000244 | 3300026116 | Bacteria | 67590 |
| 530 | Ga0207674_10004883 | 3300026116 | Bacteria | 16049 |
| 531 | Ga0207674_10006854 | 3300026116 | Bacteria | 13359 |
| 532 | Ga0207674_10010088 | 3300026116 | Bacteria | 10740 |
| 533 | Ga0207674_10020867 | 3300026116 | Bacteria | 7069 |
| 534 | Ga0207674_10028082 | 3300026116 | Bacteria | 5944 |
| 535 | Ga0207674_10033668 | 3300026116 | Bacteria | 5363 |
| 536 | Ga0207674_10064106 | 3300026116 | Bacteria | 3707 |
| 537 | Ga0207674_10085920 | 3300026116 | Bacteria | 3140 |
| 538 | Ga0207674_10128850 | 3300026116 | Bacteria | 2495 |
| 539 | Ga0207675_100000154 | 3300026118 | Bacteria | 60483 |
| 540 | Ga0207683_10001230 | 3300026121 | Bacteria | 23264 |
| 541 | Ga0207683_10020679 | 3300026121 | Bacteria | 5631 |
| 542 | Ga0207683_10029126 | 3300026121 | Bacteria | 4779 |
| 543 | Ga0207683_10120897 | 3300026121 | Bacteria | 2351 |
| 544 | Ga0207683_10205453 | 3300026121 | Bacteria | 1791 |
| 545 | Ga0207698_10000394 | 3300026142 | Bacteria | 25237 |
| 546 | Ga0207698_10000986 | 3300026142 | Bacteria | 16510 |
| 547 | Ga0207698_10007443 | 3300026142 | Bacteria | 6855 |
| 548 | Ga0207698_10015382 | 3300026142 | Bacteria | 5121 |
| 549 | Ga0207698_10029761 | 3300026142 | Bacteria | 3916 |
| 550 | Ga0207698_10041230 | 3300026142 | Bacteria | 3438 |
| 551 | Ga0207698_10103137 | 3300026142 | Bacteria | 2370 |
| 552 | Ga0207698_10108682 | 3300026142 | Bacteria | 2319 |
| 553 | Ga0207698_10119446 | 3300026142 | Bacteria | 2228 |
| 554 | Ga0207698_10198441 | 3300026142 | Bacteria | 1794 |
| 555 | Ga0207698_10320120 | 3300026142 | Bacteria | 1452 |
| 556 | Ga0268266_10000414 | 3300028379 | Bacteria | 65028 |
| 557 | Ga0268266_10006064 | 3300028379 | Bacteria | 11139 |
| 558 | Ga0268266_10019119 | 3300028379 | Bacteria | 5834 |
| 559 | Ga0268266_10020464 | 3300028379 | Bacteria | 5639 |
| 560 | Ga0268266_10025423 | 3300028379 | Bacteria | 5037 |
| 561 | Ga0268265_10004462 | 3300028380 | Bacteria | 9704 |
| 562 | Ga0268265_10009593 | 3300028380 | Bacteria | 6538 |
| 563 | Ga0268265_10043225 | 3300028380 | Bacteria | 3348 |
| 564 | Ga0268265_10048932 | 3300028380 | Bacteria | 3177 |
| 565 | Ga0268265_10119030 | 3300028380 | Bacteria | 2172 |
| 566 | Ga0268264_10007446 | 3300028381 | Bacteria | 9134 |
| 567 | Ga0268264_10017800 | 3300028381 | Bacteria | 5817 |
| 568 | Ga0268264_10032942 | 3300028381 | Bacteria | 4253 |
| 569 | Ga0268264_10051140 | 3300028381 | Bacteria | 3442 |
| 570 | Ga0307408_100021553 | 3300031548 | Bacteria | 4362 |
| 571 | Ga0307408_100022859 | 3300031548 | Bacteria | 4254 |
| 572 | Ga0307408_100068725 | 3300031548 | Bacteria | 2609 |
| 573 | Ga0307408_100118878 | 3300031548 | Bacteria | 2044 |
| 574 | Ga0307408_100139016 | 3300031548 | Bacteria | 1904 |
| 575 | Ga0307408_100141395 | 3300031548 | Bacteria | 1890 |
| 576 | Ga0307405_10004585 | 3300031731 | Bacteria | 6556 |
| 577 | Ga0307405_10010353 | 3300031731 | Bacteria | 4826 |
| 578 | Ga0307405_10022883 | 3300031731 | Bacteria | 3541 |
| 579 | Ga0307405_10031737 | 3300031731 | Bacteria | 3113 |
| 580 | Ga0307405_10054700 | 3300031731 | Bacteria | 2493 |
| 581 | Ga0307405_10179988 | 3300031731 | Bacteria | 1517 |
| 582 | Ga0307413_10007996 | 3300031824 | Bacteria | 4957 |
| 583 | Ga0307413_10017144 | 3300031824 | Bacteria | 3766 |
| 584 | Ga0307413_10036435 | 3300031824 | Bacteria | 2831 |
| 585 | Ga0307413_10057000 | 3300031824 | Bacteria | 2386 |
| 586 | Ga0307413_10070126 | 3300031824 | Bacteria | 2202 |
| 587 | Ga0307413_10135352 | 3300031824 | Bacteria | 1693 |
| 588 | Ga0307413_10170029 | 3300031824 | Bacteria | 1541 |
| 589 | Ga0307410_10000411 | 3300031852 | Bacteria | 16975 |
| 590 | Ga0307410_10001663 | 3300031852 | Bacteria | 10224 |
| 591 | Ga0307410_10001930 | 3300031852 | Bacteria | 9725 |
| 592 | Ga0307410_10005040 | 3300031852 | Bacteria | 6938 |
| 593 | Ga0307410_10013390 | 3300031852 | Bacteria | 4784 |
| 594 | Ga0307410_10019864 | 3300031852 | Bacteria | 4097 |
| 595 | Ga0307410_10028488 | 3300031852 | Bacteria | 3544 |
| 596 | Ga0307410_10047182 | 3300031852 | Bacteria | 2877 |
| 597 | Ga0307410_10050226 | 3300031852 | Bacteria | 2803 |
| 598 | Ga0307410_10063028 | 3300031852 | Bacteria | 2542 |
| 599 | Ga0307410_10143819 | 3300031852 | Bacteria | 1767 |
| 600 | Ga0307410_10225423 | 3300031852 | Bacteria | 1444 |
| 601 | Ga0307406_10016033 | 3300031901 | Bacteria | 4347 |
| 602 | Ga0307406_10022203 | 3300031901 | Bacteria | 3762 |
| 603 | Ga0307406_10026333 | 3300031901 | Bacteria | 3490 |
| 604 | Ga0307406_10129776 | 3300031901 | Bacteria | 1767 |
| 605 | Ga0307407_10038623 | 3300031903 | Bacteria | 2647 |
| 606 | Ga0307407_10042541 | 3300031903 | Bacteria | 2548 |
| 607 | Ga0307407_10069254 | 3300031903 | Bacteria | 2093 |
| 608 | Ga0307412_10008877 | 3300031911 | Bacteria | 5758 |
| 609 | Ga0307412_10069822 | 3300031911 | Bacteria | 2393 |
| 610 | Ga0307412_10100463 | 3300031911 | Bacteria | 2045 |
| 611 | Ga0307409_100000126 | 3300031995 | Bacteria | 28589 |
| 612 | Ga0307409_100013592 | 3300031995 | Bacteria | 5249 |
| 613 | Ga0307409_100018477 | 3300031995 | Bacteria | 4689 |
| 614 | Ga0307409_100024369 | 3300031995 | Bacteria | 4219 |
| 615 | Ga0307409_100029327 | 3300031995 | Bacteria | 3936 |
| 616 | Ga0307409_100043131 | 3300031995 | Bacteria | 3384 |
| 617 | Ga0307409_100050920 | 3300031995 | Bacteria | 3166 |
| 618 | Ga0307409_100072414 | 3300031995 | Bacteria | 2744 |
| 619 | Ga0307409_100089058 | 3300031995 | Bacteria | 2521 |
| 620 | Ga0307416_100033299 | 3300032002 | Bacteria | 3905 |
| 621 | Ga0307416_100056360 | 3300032002 | Bacteria | 3171 |
| 622 | Ga0307416_100059803 | 3300032002 | Bacteria | 3098 |
| 623 | Ga0307416_100080192 | 3300032002 | Bacteria | 2754 |
| 624 | Ga0307416_100088050 | 3300032002 | Bacteria | 2653 |
| 625 | Ga0307414_10003535 | 3300032004 | Bacteria | 8360 |
| 626 | Ga0307414_10011260 | 3300032004 | Bacteria | 5237 |
| 627 | Ga0307414_10012124 | 3300032004 | Bacteria | 5084 |
| 628 | Ga0307414_10014705 | 3300032004 | Bacteria | 4701 |
| 629 | Ga0307414_10054354 | 3300032004 | Bacteria | 2798 |
| 630 | Ga0307414_10065437 | 3300032004 | Bacteria | 2593 |
| 631 | Ga0307414_10076988 | 3300032004 | Bacteria | 2426 |
| 632 | Ga0307414_10085367 | 3300032004 | Bacteria | 2325 |
| 633 | Ga0307414_10088268 | 3300032004 | Bacteria | 2294 |
| 634 | Ga0307414_10099590 | 3300032004 | Bacteria | 2184 |
| 635 | Ga0307414_10106235 | 3300032004 | Bacteria | 2124 |
| 636 | Ga0307414_10133951 | 3300032004 | Bacteria | 1928 |
| 637 | Ga0307414_10148156 | 3300032004 | Bacteria | 1847 |
| 638 | Ga0307414_10226789 | 3300032004 | Bacteria | 1537 |
| 639 | Ga0307411_10012766 | 3300032005 | Bacteria | 4602 |
| 640 | Ga0307411_10015043 | 3300032005 | Bacteria | 4329 |
| 641 | Ga0307411_10018822 | 3300032005 | Bacteria | 3973 |
| 642 | Ga0307411_10041409 | 3300032005 | Bacteria | 2930 |
| 643 | Ga0307411_10052369 | 3300032005 | Bacteria | 2668 |
| 644 | Ga0307411_10057169 | 3300032005 | Bacteria | 2575 |
| 645 | Ga0307411_10120109 | 3300032005 | Bacteria | 1899 |
| 646 | Ga0307411_10129951 | 3300032005 | Bacteria | 1839 |
| 647 | Ga0307411_10143768 | 3300032005 | Bacteria | 1762 |
| 648 | Ga0307411_10145523 | 3300032005 | Bacteria | 1753 |
| 649 | Ga0307411_10148807 | 3300032005 | Bacteria | 1737 |
| 650 | Ga0307411_10163652 | 3300032005 | Bacteria | 1670 |
| 651 | Ga0307411_10169601 | 3300032005 | Bacteria | 1644 |
| 652 | Ga0307415_100003894 | 3300032126 | Bacteria | 7667 |
| 653 | Ga0307415_100022325 | 3300032126 | Bacteria | 3902 |
| 654 | Ga0307415_100150090 | 3300032126 | Bacteria | 1793 |
| 655 | Ga0373943_0010492 | 3300035170 | Bacteria | 4151 |
| 656 | Ga0373942_0018714 | 3300035207 | Bacteria | 1722 |
| 657 | Ga0373935_0117361 | 3300035692 | Bacteria | 1774 |
| 658 | Ga0373925_0005291 | 3300037068 | Bacteria | 9632 |
| 659 | Ga0395899_0000132 | 3300037312 | Bacteria | 115455 |
| 660 | Ga0395899_0001019 | 3300037312 | Bacteria | 25588 |
| 661 | Ga0395899_0002681 | 3300037312 | Bacteria | 14350 |
| 662 | Ga0395899_0011909 | 3300037312 | Bacteria | 6661 |
| 663 | Ga0395899_0022870 | 3300037312 | Bacteria | 4736 |
| 664 | Ga0395899_0030661 | 3300037312 | Bacteria | 4043 |
| 665 | Ga0395899_0034654 | 3300037312 | Bacteria | 3791 |
| 666 | Ga0395899_0046130 | 3300037312 | Bacteria | 3246 |
| 667 | Ga0395899_0061799 | 3300037312 | Bacteria | 2758 |
| 668 | Ga0395899_0086959 | 3300037312 | Bacteria | 2269 |
| 669 | Ga0395899_0087043 | 3300037312 | Bacteria | 2268 |
| 670 | Ga0395899_0115625 | 3300037312 | Bacteria | 1925 |
| 671 | Ga0395899_0145786 | 3300037312 | Bacteria | 1681 |
| 672 | Ga0395899_0154053 | 3300037312 | Bacteria | 1627 |
| 673 | Ga0395900_0000075 | 3300037418 | Bacteria | 183525 |
| 674 | Ga0395900_0000289 | 3300037418 | Bacteria | 75525 |
| 675 | Ga0395900_0000477 | 3300037418 | Bacteria | 56791 |
| 676 | Ga0395900_0001617 | 3300037418 | Bacteria | 26505 |
| 677 | Ga0395900_0009867 | 3300037418 | Bacteria | 9780 |
| 678 | Ga0395900_0016780 | 3300037418 | Bacteria | 7469 |
| 679 | Ga0395900_0021363 | 3300037418 | Bacteria | 6617 |
| 680 | Ga0395900_0022848 | 3300037418 | Bacteria | 6398 |
| 681 | Ga0395900_0027658 | 3300037418 | Bacteria | 5809 |
| 682 | Ga0395900_0031939 | 3300037418 | Bacteria | 5412 |
| 683 | Ga0395900_0063046 | 3300037418 | Bacteria | 3810 |
| 684 | Ga0395900_0067815 | 3300037418 | Bacteria | 3665 |
| 685 | Ga0395900_0080090 | 3300037418 | Bacteria | 3356 |
| 686 | Ga0395900_0090896 | 3300037418 | Bacteria | 3137 |
| 687 | Ga0395900_0098116 | 3300037418 | Bacteria | 3010 |
| 688 | Ga0395900_0102405 | 3300037418 | Bacteria | 2941 |
| 689 | Ga0395900_0130015 | 3300037418 | Bacteria | 2581 |
| 690 | Ga0395900_0146245 | 3300037418 | Bacteria | 2416 |
| 691 | Ga0395900_0149131 | 3300037418 | Bacteria | 2390 |
| 692 | Ga0395900_0179058 | 3300037418 | Bacteria | 2155 |
| 693 | Ga0395900_0192559 | 3300037418 | Bacteria | 2067 |
| 694 | Ga0395900_0211288 | 3300037418 | Bacteria | 1959 |
| 695 | Ga0395900_0211525 | 3300037418 | Bacteria | 1958 |
| 696 | Ga0395900_0221931 | 3300037418 | Bacteria | 1904 |
| 697 | Ga0395900_0251524 | 3300037418 | Bacteria | 1768 |
| 698 | Ga0395900_0297197 | 3300037418 | Bacteria | 1602 |
| 699 | Ga0395898_0000055 | 3300037466 | Bacteria | 278557 |
| 700 | Ga0395898_0000898 | 3300037466 | Bacteria | 47961 |
| 701 | Ga0395898_0011944 | 3300037466 | Bacteria | 8994 |
| 702 | Ga0395898_0020318 | 3300037466 | Bacteria | 6745 |
| 703 | Ga0395898_0025357 | 3300037466 | Bacteria | 5975 |
| 704 | Ga0395898_0033668 | 3300037466 | Bacteria | 5111 |
| 705 | Ga0395898_0042212 | 3300037466 | Bacteria | 4501 |
| 706 | Ga0395898_0063311 | 3300037466 | Bacteria | 3589 |
| 707 | Ga0395898_0227645 | 3300037466 | Bacteria | 1778 |
| 708 | Ga0395905_0000067 | 3300037471 | Bacteria | 181887 |
| 709 | Ga0395905_0000204 | 3300037471 | Bacteria | 92152 |
| 710 | Ga0395905_0001128 | 3300037471 | Bacteria | 33451 |
| 711 | Ga0395905_0002395 | 3300037471 | Bacteria | 20868 |
| 712 | Ga0395905_0009949 | 3300037471 | Bacteria | 9266 |
| 713 | Ga0395905_0011713 | 3300037471 | Bacteria | 8465 |
| 714 | Ga0395905_0012837 | 3300037471 | Bacteria | 8054 |
| 715 | Ga0395905_0019289 | 3300037471 | Bacteria | 6465 |
| 716 | Ga0395905_0023614 | 3300037471 | Bacteria | 5807 |
| 717 | Ga0395905_0035877 | 3300037471 | Bacteria | 4656 |
| 718 | Ga0395905_0054494 | 3300037471 | Bacteria | 3742 |
| 719 | Ga0395905_0073577 | 3300037471 | Bacteria | 3203 |
| 720 | Ga0395905_0075407 | 3300037471 | Bacteria | 3161 |
| 721 | Ga0395905_0095544 | 3300037471 | Bacteria | 2789 |
| 722 | Ga0395905_0102026 | 3300037471 | Bacteria | 2693 |
| 723 | Ga0395905_0169737 | 3300037471 | Bacteria | 2049 |
| 724 | Ga0395905_0212021 | 3300037471 | Bacteria | 1814 |
| 725 | Ga0395905_0332764 | 3300037471 | Bacteria | 1409 |
| 726 | Ga0395901_0000208 | 3300038443 | Bacteria | 73874 |
| 727 | Ga0395901_0000648 | 3300038443 | Bacteria | 40227 |
| 728 | Ga0395901_0001244 | 3300038443 | Bacteria | 27197 |
| 729 | Ga0395901_0002867 | 3300038443 | Bacteria | 17407 |
| 730 | Ga0395901_0009196 | 3300038443 | Bacteria | 10011 |
| 731 | Ga0395901_0013298 | 3300038443 | Bacteria | 8360 |
| 732 | Ga0395901_0020133 | 3300038443 | Bacteria | 6827 |
| 733 | Ga0395901_0026895 | 3300038443 | Bacteria | 5906 |
| 734 | Ga0395901_0027910 | 3300038443 | Bacteria | 5804 |
| 735 | Ga0395901_0033661 | 3300038443 | Bacteria | 5291 |
| 736 | Ga0395901_0084033 | 3300038443 | Bacteria | 3327 |
| 737 | Ga0395901_0109785 | 3300038443 | Bacteria | 2896 |
| 738 | Ga0395901_0114584 | 3300038443 | Bacteria | 2831 |
| 739 | Ga0395901_0194919 | 3300038443 | Bacteria | 2124 |
| 740 | Ga0395901_0241635 | 3300038443 | Bacteria | 1883 |
| 741 | Ga0395901_0355197 | 3300038443 | Bacteria | 1512 |
| 742 | Ga0395901_0378857 | 3300038443 | Bacteria | 1456 |
| 743 | Ga0395901_0412374 | 3300038443 | Bacteria | 1386 |
| 744 | Ga0436365_0024047 | 3300039437 | Bacteria | 2286 |
| 745 | Ga0436365_0546549 | 3300039437 | Bacteria | 13799 |
| 746 | Ga0436365_0636584 | 3300039437 | Bacteria | 8099 |
| 747 | Ga0436365_1104251 | 3300039437 | Bacteria | 95104 |
| 748 | Ga0436363_1592812 | 3300039450 | Bacteria | 1781 |
| 749 | Ga0439466_0020549 | 3300041411 | Bacteria | 2352 |
| 750 | Ga0439431_0000643 | 3300041997 | Bacteria | 7429 |
| 751 | Ga0439442_000926 | 3300042002 | Bacteria | 5959 |
| 752 | Ga0439432_000868 | 3300042006 | Bacteria | 11320 |
| 753 | Ga0439432_005945 | 3300042006 | Bacteria | 4380 |
| 754 | Ga0439449_0012363 | 3300042007 | Bacteria | 3210 |
| 755 | Ga0439462_0030757 | 3300042015 | Bacteria | 1420 |
| 756 | Ga0450889_000032 | 3300042144 | Bacteria | 11898 |
| 757 | Ga0439458_0004126 | 3300042157 | Bacteria | 3350 |
| 758 | Ga0439434_0000800 | 3300042435 | Bacteria | 9069 |
| 759 | Ga0466969_0007655 | 3300044656 | Bacteria | 5741 |
| 760 | Ga0466966_0000010 | 3300044684 | Bacteria | 150868 |
| 761 | Ga0466966_0007224 | 3300044684 | Bacteria | 7362 |
| 762 | Ga0466966_0043747 | 3300044684 | Bacteria | 2869 |
| 763 | Ga0466966_0070027 | 3300044684 | Bacteria | 2199 |
| 764 | Ga0466966_0171397 | 3300044684 | Bacteria | 1319 |
| 765 | Ga0466961_0097377 | 3300044693 | Bacteria | 1855 |
| 766 | Ga0466963_0002563 | 3300044694 | Bacteria | 10193 |
| 767 | Ga0466963_0003212 | 3300044694 | Bacteria | 9298 |
| 768 | Ga0466963_0042133 | 3300044694 | Bacteria | 2997 |
| 769 | Ga0466964_0004943 | 3300044706 | Bacteria | 4927 |
| 770 | Ga0466964_0033921 | 3300044706 | Bacteria | 2035 |
| 771 | Ga0466970_0008642 | 3300044765 | Bacteria | 5132 |
| 772 | Ga0466970_0043837 | 3300044765 | Bacteria | 2381 |
| 773 | Ga0466970_0073353 | 3300044765 | Bacteria | 1842 |
| 774 | Ga0466957_0002570 | 3300044842 | Bacteria | 9769 |
| 775 | Ga0466957_0066677 | 3300044842 | Bacteria | 2220 |
| 776 | Ga0466960_0053920 | 3300044901 | Bacteria | 1950 |
| 777 | Ga0466959_0004427 | 3300045049 | Bacteria | 9409 |
| 778 | Ga0466959_0022664 | 3300045049 | Bacteria | 4643 |
| 779 | Ga0466959_0086537 | 3300045049 | Bacteria | 2254 |
| 780 | Ga0466959_0110833 | 3300045049 | Bacteria | 1959 |
| 781 | Ga0466959_0155320 | 3300045049 | Bacteria | 1611 |
| 782 | Ga0466958_0030302 | 3300045836 | Bacteria | 3213 |
| 783 | Ga0466958_0145914 | 3300045836 | Bacteria | 1491 |
| 784 | Ga0466967_0025320 | 3300045976 | Bacteria | 4891 |
| 785 | Ga0466967_0153631 | 3300045976 | Bacteria | 2154 |
| 786 | Ga0466967_0178338 | 3300045976 | Bacteria | 2002 |
| 787 | Ga0466967_0211239 | 3300045976 | Bacteria | 1841 |
| 788 | Ga0466967_0237983 | 3300045976 | Bacteria | 1735 |
| 789 | Ga0466967_0276487 | 3300045976 | Bacteria | 1610 |
| 790 | Ga0466967_0343206 | 3300045976 | Bacteria | 1444 |
| 791 | Ga0466967_0353307 | 3300045976 | Bacteria | 1423 |
| 792 | Ga0495663_0003736 | 3300046525 | Bacteria | 4347 |
| 793 | Ga0495663_0009624 | 3300046525 | Bacteria | 2680 |
| 794 | Ga0495642_0044198 | 3300046528 | Bacteria | 1818 |
| 795 | Ga0495598_0001164 | 3300046537 | Bacteria | 5078 |
| 796 | Ga0495621_0000179 | 3300046539 | Bacteria | 14449 |
| 797 | Ga0495621_0003583 | 3300046539 | Bacteria | 4286 |
| 798 | Ga0495633_0003748 | 3300046558 | Bacteria | 9994 |
| 799 | Ga0495633_0033264 | 3300046558 | Bacteria | 2487 |
| 800 | Ga0495668_0005101 | 3300046616 | Bacteria | 9031 |
| 801 | Ga0495668_0074606 | 3300046616 | Bacteria | 1862 |
| 802 | Ga0495625_0029408 | 3300046660 | Bacteria | 4110 |
| 803 | Ga0495669_0007585 | 3300046684 | Bacteria | 4550 |
| 804 | Ga0495669_0020214 | 3300046684 | Bacteria | 2880 |
| 805 | Ga0495669_0037026 | 3300046684 | Bacteria | 2158 |
| 806 | Ga0495669_0037993 | 3300046684 | Bacteria | 2132 |
| 807 | Ga0495669_0074629 | 3300046684 | Bacteria | 1551 |
| 808 | Ga0495670_0000004 | 3300046691 | Bacteria | 310086 |
| 809 | Ga0495670_0002449 | 3300046691 | Bacteria | 9172 |
| 810 | Ga0495670_0016058 | 3300046691 | Bacteria | 3680 |
| 811 | Ga0495670_0025750 | 3300046691 | Bacteria | 2910 |
| 812 | Ga0496101_0008722 | 3300048904 | Bacteria | 6629 |
| 813 | Ga0496102_0223635 | 3300048905 | Bacteria | 1775 |
| 814 | Ga0496103_0091785 | 3300048906 | Bacteria | 1917 |
| 815 | Ga0496106_0103099 | 3300048909 | Bacteria | 2214 |
| 816 | Ga0496107_0006177 | 3300048910 | Bacteria | 8229 |
| 817 | Ga0496107_0024175 | 3300048910 | Bacteria | 4298 |
| 818 | Ga0496107_0062848 | 3300048910 | Bacteria | 2690 |
| 819 | Ga0496108_0014020 | 3300048911 | Bacteria | 6540 |
| 820 | Ga0496108_0017557 | 3300048911 | Bacteria | 5855 |
| 821 | Ga0496108_0018531 | 3300048911 | Bacteria | 5701 |
| 822 | Ga0496108_0018850 | 3300048911 | Bacteria | 5658 |
| 823 | Ga0496109_0002106 | 3300048912 | Bacteria | 16540 |
| 824 | Ga0496109_0046383 | 3300048912 | Bacteria | 3947 |
| 825 | Ga0496109_0048948 | 3300048912 | Bacteria | 3846 |
| 826 | Ga0496109_0130518 | 3300048912 | Bacteria | 2345 |
| 827 | Ga0496109_0330987 | 3300048912 | Bacteria | 1438 |
| 828 | Ga0496109_0362724 | 3300048912 | Bacteria | 1369 |
| 829 | Ga0496110_0001399 | 3300048913 | Bacteria | 17437 |
| 830 | Ga0496110_0001805 | 3300048913 | Bacteria | 15773 |
| 831 | Ga0496110_0009949 | 3300048913 | Bacteria | 7711 |
| 832 | Ga0496110_0023051 | 3300048913 | Bacteria | 5294 |
| 833 | Ga0496110_0172222 | 3300048913 | Bacteria | 1964 |
| 834 | Ga0496111_0002670 | 3300048914 | Bacteria | 10830 |
| 835 | Ga0496112_0000546 | 3300048915 | Bacteria | 25800 |
| 836 | Ga0496112_0061375 | 3300048915 | Bacteria | 3705 |
| 837 | Ga0496112_0086565 | 3300048915 | Bacteria | 3100 |
| 838 | Ga0496112_0260212 | 3300048915 | Bacteria | 1684 |
| 839 | Ga0496113_0007254 | 3300048916 | Bacteria | 7109 |
| 840 | Ga0496113_0051969 | 3300048916 | Bacteria | 3059 |
| 841 | Ga0496113_0082117 | 3300048916 | Bacteria | 2471 |
| 842 | Ga0496114_0088021 | 3300048917 | Bacteria | 2634 |
| 843 | Ga0496114_0216521 | 3300048917 | Bacteria | 1681 |
| 844 | Ga0496115_0013299 | 3300048918 | Bacteria | 6223 |
| 845 | Ga0496123_0022908 | 3300048926 | Bacteria | 4797 |
| 846 | Ga0496123_0053333 | 3300048926 | Bacteria | 2673 |
| 847 | Ga0496124_0000186 | 3300048927 | Bacteria | 123307 |
| 848 | Ga0496124_0001152 | 3300048927 | Bacteria | 41432 |
| 849 | Ga0496124_0010571 | 3300048927 | Bacteria | 9332 |
| 850 | Ga0496125_0004150 | 3300048928 | Bacteria | 16894 |
| 851 | Ga0496126_0000733 | 3300048929 | Bacteria | 59621 |
| 852 | Ga0501034_0255766 | 3300049571 | Bacteria | 1695 |
| 853 | Ga0501070_0018414 | 3300049586 | Bacteria | 5859 |
| 854 | Ga0501217_010627 | 3300049661 | Bacteria | 2020 |
| 855 | Ga0501223_005950 | 3300049663 | Bacteria | 2543 |
| 856 | Ga0501233_008538 | 3300049668 | Bacteria | 1977 |
| 857 | Ga0501225_0014779 | 3300049705 | Bacteria | 2177 |
| 858 | Ga0501241_014988 | 3300049758 | Bacteria | 1409 |
| 859 | Ga0501204_002627 | 3300049850 | Bacteria | 1838 |
| 860 | nmdc:mga06r32_38212_c1 | 3300050510 | Bacteria | 4546 |
| 861 | nmdc:mga0n895_129274_c1 | 3300050512 | Bacteria | 2550 |
| 862 | nmdc:mga0n895_269101_c1 | 3300050512 | Bacteria | 1729 |
| 863 | nmdc:mga0a205_2429_c1 | 3300050515 | Bacteria | 16427 |
| 864 | Ga0495655_0008165 | 3300053083 | Bacteria | 1978 |
| 865 | Ga0500566_0028830 | 3300053094 | Bacteria | 3242 |
| 866 | Ga0500573_0000016 | 3300053140 | Bacteria | 182675 |
| 867 | Ga0466962_0009757 | 3300061719 | Bacteria | 4605 |
| 868 | 2511124029 | 2510917020 | Bacteria | 5657507 |
| 869 | 2600201678 | 2599185354 | Bacteria | 4398675 |
| 870 | 2600224888 | 2599185359 | Bacteria | 4772316 |
| 871 | 2644126924 | 2643221622 | Bacteria | 4212502 |
| 872 | 2753767902 | 2751185897 | Bacteria | 5322941 |
| 873 | 2819713082 | 2818991466 | Bacteria | 4748179 |
| 874 | 2830076062 | 2830075706 | Bacteria | 3855215 |
| 875 | 2879165673 | 2879163058 | Bacteria | 4223965 |
| 876 | 2896429585 | 2896429255 | Bacteria | 2557483 |
| 877 | 2928027492 | 2928027323 | Bacteria | 4382488 |
| 878 | 2928527621 | 2928526807 | Bacteria | 4760224 |
| 879 | 2928971744 | 2928968154 | Bacteria | 4633371 |
| 880 | 2946788640 | 2946787523 | Bacteria | 4366789 |
| 881 | 2984558207 | 2984555340 | Bacteria | 4247089 |
| 882 | 2984567414 | 2984564862 | Bacteria | 4339992 |
| 883 | 2990268688 | 2990265787 | Bacteria | 3943888 |
| 884 | 2993358479 | 2993356040 | Bacteria | 4247105 |
| 885 | 2993694605 | 2993693658 | Bacteria | 4040749 |
| 886 | Ga0307409_100098841 | |||
| 887 | ARcpr5oldR_c003416 | |||
| 888 | JGI24736J21556_1000361 | |||
| 889 | JGI24740J21852_10016319 | |||
| 890 | JGI24740J21852_10025735 | |||
| 891 | JGI24739J22299_10000035 | |||
| 892 | JGI24739J22299_10023017 | |||
| 893 | JGI24737J22298_10000020 | |||
| 894 | JGI24737J22298_10007189 | |||
| 895 | JGI24737J22298_10023224 | |||
| 896 | JGI24735J21928_10014192 | |||
| 897 | JGI24738J21930_10000048 | |||
| 898 | JGI24738J21930_10007423 | |||
| 899 | Ga0055524_1000351 | |||
| 900 | Ga0055530_10000144 | |||
| 901 | Ga0055531_10000188 | |||
| 902 | Ga0055531_10019042 | |||
| 903 | Ga0070658_10000220 | |||
| 904 | Ga0070658_10000264 | |||
| 905 | Ga0070658_10002220 | |||
| 906 | Ga0070658_10015611 | |||
| 907 | Ga0070658_10045810 | |||
| 908 | Ga0070658_10074692 | |||
| 909 | Ga0070658_10077096 | |||
| 910 | Ga0070676_10008339 | |||
| 911 | Ga0070683_100009023 | |||
| 912 | Ga0070683_100011883 | |||
| 913 | Ga0070683_100036805 | |||
| 914 | Ga0070683_100133841 | |||
| 915 | Ga0070670_100009146 | |||
| 916 | Ga0070670_100021908 | |||
| 917 | Ga0070670_100028039 | |||
| 918 | Ga0070670_100033024 | |||
| 919 | Ga0070670_100033080 | |||
| 920 | Ga0070670_100045987 | |||
| 921 | Ga0070670_100046834 | |||
| 922 | Ga0070670_100054617 | |||
| 923 | Ga0070670_100071120 | |||
| 924 | Ga0070670_100131084 | |||
| 925 | Ga0070670_100141532 | |||
| 926 | Ga0070677_10000460 | |||
| 927 | Ga0070677_10000776 | |||
| 928 | Ga0068869_100000043 | |||
| 929 | Ga0070666_10001568 | |||
| 930 | Ga0070666_10036747 | |||
| 931 | Ga0070666_10049979 | |||
| 932 | Ga0070680_100000406 | |||
| 933 | Ga0070680_100015034 | |||
| 934 | Ga0070680_100060976 | |||
| 935 | Ga0070680_100123262 | |||
| 936 | Ga0070680_100125407 | |||
| 937 | Ga0070680_100281703 | |||
| 938 | Ga0070682_100060468 | |||
| 939 | Ga0070682_100084418 | |||
| 940 | Ga0068868_100000957 | |||
| 941 | Ga0070660_100000091 | |||
| 942 | Ga0070660_100000218 | |||
| 943 | Ga0070660_100000415 | |||
| 944 | Ga0070660_100008260 | |||
| 945 | Ga0070660_100018258 | |||
| 946 | Ga0070660_100026322 | |||
| 947 | Ga0070660_100028865 | |||
| 948 | Ga0070660_100062331 | |||
| 949 | Ga0070689_100024220 | |||
| 950 | Ga0070691_10006893 | |||
| 951 | Ga0070687_100064342 | |||
| 952 | Ga0070661_100000181 | |||
| 953 | Ga0070661_100018437 | |||
| 954 | Ga0070661_100019737 | |||
| 955 | Ga0070661_100026891 | |||
| 956 | Ga0070661_100027478 | |||
| 957 | Ga0070661_100038040 | |||
| 958 | Ga0070692_10003786 | |||
| 959 | Ga0070692_10006331 | |||
| 960 | Ga0070692_10006444 | |||
| 961 | Ga0070692_10026911 | |||
| 962 | Ga0070668_100005171 | |||
| 963 | Ga0070669_100000209 | |||
| 964 | Ga0070669_100072542 | |||
| 965 | Ga0070675_100003209 | |||
| 966 | Ga0070675_100028103 | |||
| 967 | Ga0070675_100053098 | |||
| 968 | Ga0070675_100080480 | |||
| 969 | Ga0070671_100000946 | |||
| 970 | Ga0070671_100002968 | |||
| 971 | Ga0070671_100012684 | |||
| 972 | Ga0070671_100024791 | |||
| 973 | Ga0070671_100025393 | |||
| 974 | Ga0070671_100027296 | |||
| 975 | Ga0070671_100045117 | |||
| 976 | Ga0070671_100048574 | |||
| 977 | Ga0070671_100102513 | |||
| 978 | Ga0070674_100042634 | |||
| 979 | Ga0070674_100099248 | |||
| 980 | Ga0070673_100000354 | |||
| 981 | Ga0070673_100008820 | |||
| 982 | Ga0070673_100017737 | |||
| 983 | Ga0070673_100041312 | |||
| 984 | Ga0070659_100000310 | |||
| 985 | Ga0070659_100000463 | |||
| 986 | Ga0070659_100010426 | |||
| 987 | Ga0070659_100032895 | |||
| 988 | Ga0070659_100090425 | |||
| 989 | Ga0070659_100143964 | |||
| 990 | Ga0070659_100170636 | |||
| 991 | Ga0070667_100020045 | |||
| 992 | Ga0070667_100020452 | |||
| 993 | Ga0070667_100048276 | |||
| 994 | Ga0070667_100068583 | |||
| 995 | Ga0070713_100020766 | |||
| 996 | Ga0070713_100085671 | |||
| 997 | Ga0070663_100000991 | |||
| 998 | Ga0070663_100007128 | |||
| 999 | Ga0070663_100008110 | |||
| 1000 | Ga0070663_100077759 | |||
| 1001 | Ga0070663_100108360 | |||
| 1002 | Ga0070663_100112765 | |||
| 1003 | Ga0070663_100127369 | |||
| 1004 | Ga0070663_100237344 | |||
| 1005 | Ga0070678_100008935 | |||
| 1006 | Ga0070678_100022943 | |||
| 1007 | Ga0070678_100093552 | |||
| 1008 | Ga0070678_100111605 | |||
| 1009 | Ga0070678_100127384 | |||
| 1010 | Ga0070662_100000080 | |||
| 1011 | Ga0070662_100000754 | |||
| 1012 | Ga0070662_100004660 | |||
| 1013 | Ga0070662_100007202 | |||
| 1014 | Ga0070662_100015854 | |||
| 1015 | Ga0070662_100017439 | |||
| 1016 | Ga0070662_100022342 | |||
| 1017 | Ga0070662_100029969 | |||
| 1018 | Ga0070662_100050500 | |||
| 1019 | Ga0070662_100158421 | |||
| 1020 | Ga0070681_10038880 | |||
| 1021 | Ga0070681_10041232 | |||
| 1022 | Ga0068867_100008883 | |||
| 1023 | Ga0068867_100014754 | |||
| 1024 | Ga0068867_100029006 | |||
| 1025 | Ga0070679_100025521 | |||
| 1026 | Ga0070684_100016504 | |||
| 1027 | Ga0070684_100030299 | |||
| 1028 | Ga0068853_100000134 | |||
| 1029 | Ga0068853_100001421 | |||
| 1030 | Ga0068853_100040321 | |||
| 1031 | Ga0068853_100083647 | |||
| 1032 | Ga0068853_100102504 | |||
| 1033 | Ga0070672_100000380 | |||
| 1034 | Ga0070672_100016111 | |||
| 1035 | Ga0070672_100064233 | |||
| 1036 | Ga0070672_100077256 | |||
| 1037 | Ga0070696_100016806 | |||
| 1038 | Ga0070693_100000536 | |||
| 1039 | Ga0070693_100061774 | |||
| 1040 | Ga0070665_100000054 | |||
| 1041 | Ga0070665_100023191 | |||
| 1042 | Ga0070665_100028342 | |||
| 1043 | Ga0070665_100067607 | |||
| 1044 | Ga0070665_100116472 | |||
| 1045 | Ga0068855_100000129 | |||
| 1046 | Ga0068855_100000780 | |||
| 1047 | Ga0068855_100044279 | |||
| 1048 | Ga0068855_100047304 | |||
| 1049 | Ga0068855_100052397 | |||
| 1050 | Ga0068855_100073049 | |||
| 1051 | Ga0068855_100206491 | |||
| 1052 | Ga0070664_100000047 | |||
| 1053 | Ga0070664_100003329 | |||
| 1054 | Ga0070664_100012056 | |||
| 1055 | Ga0070664_100024362 | |||
| 1056 | Ga0070664_100052616 | |||
| 1057 | Ga0070664_100157749 | |||
| 1058 | Ga0070664_100173301 | |||
| 1059 | Ga0068857_100007558 | |||
| 1060 | Ga0068857_100023330 | |||
| 1061 | Ga0068857_100034442 | |||
| 1062 | Ga0068857_100046735 | |||
| 1063 | Ga0068857_100179196 | |||
| 1064 | Ga0068854_100000414 | |||
| 1065 | Ga0068854_100026433 | |||
| 1066 | Ga0068854_100032791 | |||
| 1067 | Ga0068854_100056555 | |||
| 1068 | Ga0068854_100121723 | |||
| 1069 | Ga0068854_100166436 | |||
| 1070 | Ga0068854_100180451 | |||
| 1071 | Ga0068856_100001328 | |||
| 1072 | Ga0068856_100029171 | |||
| 1073 | Ga0068856_100040215 | |||
| 1074 | Ga0068856_100091223 | |||
| 1075 | Ga0068856_100113303 | |||
| 1076 | Ga0068852_100000798 | |||
| 1077 | Ga0068852_100002050 | |||
| 1078 | Ga0068852_100002251 | |||
| 1079 | Ga0068852_100010705 | |||
| 1080 | Ga0068852_100048328 | |||
| 1081 | Ga0068852_100086847 | |||
| 1082 | Ga0068852_100110050 | |||
| 1083 | Ga0068852_100152921 | |||
| 1084 | Ga0068859_100003417 | |||
| 1085 | Ga0068859_100004856 | |||
| 1086 | Ga0068859_100008232 | |||
| 1087 | Ga0068859_100251848 | |||
| 1088 | Ga0068864_100000181 | |||
| 1089 | Ga0068864_100000652 | |||
| 1090 | Ga0068864_100001327 | |||
| 1091 | Ga0068864_100006134 | |||
| 1092 | Ga0068864_100038107 | |||
| 1093 | Ga0068864_100106455 | |||
| 1094 | Ga0068864_100115478 | |||
| 1095 | Ga0068866_10006592 | |||
| 1096 | Ga0068866_10019163 | |||
| 1097 | Ga0068861_100000036 | |||
| 1098 | Ga0068851_10002516 | |||
| 1099 | Ga0068851_10043372 | |||
| 1100 | Ga0068863_100003734 | |||
| 1101 | Ga0068863_100004126 | |||
| 1102 | Ga0068863_100013157 | |||
| 1103 | Ga0068863_100044951 | |||
| 1104 | Ga0068863_100064625 | |||
| 1105 | Ga0068863_100149391 | |||
| 1106 | Ga0068858_100005075 | |||
| 1107 | Ga0068858_100019868 | |||
| 1108 | Ga0068858_100080601 | |||
| 1109 | Ga0068858_100105442 | |||
| 1110 | Ga0068860_100002079 | |||
| 1111 | Ga0068860_100021050 | |||
| 1112 | Ga0068860_100087843 | |||
| 1113 | Ga0068860_100137300 | |||
| 1114 | Ga0068862_100005042 | |||
| 1115 | Ga0068862_100013934 | |||
| 1116 | Ga0068862_100088938 | |||
| 1117 | Ga0068862_100089198 | |||
| 1118 | Ga0068862_100107130 | |||
| 1119 | Ga0081539_10013055 | |||
| 1120 | Ga0081539_10056537 | |||
| 1121 | Ga0070717_10022023 | |||
| 1122 | Ga0070717_10065554 | |||
| 1123 | Ga0097621_100088259 | |||
| 1124 | Ga0097621_100108627 | |||
| 1125 | Ga0068871_100051389 | |||
| 1126 | Ga0068871_100066219 | |||
| 1127 | Ga0075431_100068229 | |||
| 1128 | Ga0075433_10022184 | |||
| 1129 | Ga0068865_100002737 | |||
| 1130 | Ga0068865_100068973 | |||
| 1131 | Ga0097620_100003417 | |||
| 1132 | Ga0097620_100004857 | |||
| 1133 | Ga0097620_100008232 | |||
| 1134 | Ga0105250_10009470 | |||
| 1135 | Ga0105240_10010591 | |||
| 1136 | Ga0105240_10085341 | |||
| 1137 | Ga0105240_10141777 | |||
| 1138 | Ga0105245_10003294 | |||
| 1139 | Ga0105245_10009900 | |||
| 1140 | Ga0105245_10062190 | |||
| 1141 | Ga0105245_10303719 | |||
| 1142 | Ga0105241_10154089 | |||
| 1143 | Ga0105242_10028920 | |||
| 1144 | Ga0105248_10000256 | |||
| 1145 | Ga0105248_10000276 | |||
| 1146 | Ga0105248_10002271 | |||
| 1147 | Ga0105248_10004379 | |||
| 1148 | Ga0105248_10016393 | |||
| 1149 | Ga0105248_10072344 | |||
| 1150 | Ga0105248_10111509 | |||
| 1151 | Ga0105248_10277806 | |||
| 1152 | Ga0105248_10470140 | |||
| 1153 | Ga0105237_10014619 | |||
| 1154 | Ga0105237_10035296 | |||
| 1155 | Ga0105238_10009452 | |||
| 1156 | Ga0105238_10010235 | |||
| 1157 | Ga0105238_10021875 | |||
| 1158 | Ga0105238_10034298 | |||
| 1159 | Ga0105238_10035247 | |||
| 1160 | Ga0105238_10152158 | |||
| 1161 | Ga0105249_10022753 | |||
| 1162 | Ga0105246_10002855 | |||
| 1163 | Ga0105246_10036076 | |||
| 1164 | Ga0157373_10007891 | |||
| 1165 | Ga0157373_10009719 | |||
| 1166 | Ga0157373_10025323 | |||
| 1167 | Ga0157373_10031157 | |||
| 1168 | Ga0157373_10115444 | |||
| 1169 | Ga0157373_10151746 | |||
| 1170 | Ga0157373_10196427 | |||
| 1171 | Ga0157371_10005808 | |||
| 1172 | Ga0157371_10006963 | |||
| 1173 | Ga0157371_10012737 | |||
| 1174 | Ga0157371_10064850 | |||
| 1175 | Ga0157371_10085466 | |||
| 1176 | Ga0157371_10085664 | |||
| 1177 | Ga0157371_10173760 | |||
| 1178 | Ga0157370_10024160 | |||
| 1179 | Ga0157370_10093538 | |||
| 1180 | Ga0157369_10000256 | |||
| 1181 | Ga0157369_10002909 | |||
| 1182 | Ga0157369_10071182 | |||
| 1183 | Ga0157369_10116877 | |||
| 1184 | Ga0157369_10127279 | |||
| 1185 | Ga0157369_10162123 | |||
| 1186 | Ga0157369_10171283 | |||
| 1187 | Ga0157369_10218804 | |||
| 1188 | Ga0157369_10263447 | |||
| 1189 | Ga0157374_10007006 | |||
| 1190 | Ga0157378_10009565 | |||
| 1191 | Ga0163162_10031161 | |||
| 1192 | Ga0163162_10057952 | |||
| 1193 | Ga0163162_10136067 | |||
| 1194 | Ga0157372_10042552 | |||
| 1195 | Ga0157372_10087129 | |||
| 1196 | Ga0157372_10368297 | |||
| 1197 | Ga0157375_10117638 | |||
| 1198 | Ga0157375_10133810 | |||
| 1199 | Ga0163163_10001248 | |||
| 1200 | Ga0163163_10002058 | |||
| 1201 | Ga0157379_10009412 | |||
| 1202 | Ga0183363_1003 | |||
| 1203 | Ga0213876_10002881 | |||
| 1204 | Ga0213876_10004001 | |||
| 1205 | Ga0213876_10004890 | |||
| 1206 | Ga0209565_1000012 | |||
| 1207 | Ga0209673_1002916 | |||
| 1208 | Ga0209758_1014215 | |||
| 1209 | Ga0209050_1000010 | |||
| 1210 | Ga0209050_1006599 | |||
| 1211 | Ga0209256_1000012 | |||
| 1212 | Ga0209257_1000009 | |||
| 1213 | Ga0209257_1002618 | |||
| 1214 | Ga0209257_1008681 | |||
| 1215 | Ga0207697_10000007 | |||
| 1216 | Ga0207656_10031657 | |||
| 1217 | Ga0207682_10000990 | |||
| 1218 | Ga0207688_10000318 | |||
| 1219 | Ga0207680_10002818 | |||
| 1220 | Ga0207680_10137738 | |||
| 1221 | Ga0207647_10000052 | |||
| 1222 | Ga0207647_10002807 | |||
| 1223 | Ga0207647_10004040 | |||
| 1224 | Ga0207647_10004972 | |||
| 1225 | Ga0207647_10007015 | |||
| 1226 | Ga0207647_10017277 | |||
| 1227 | Ga0207647_10022358 | |||
| 1228 | Ga0207647_10096726 | |||
| 1229 | Ga0207643_10023313 | |||
| 1230 | Ga0207705_10000003 | |||
| 1231 | Ga0207705_10000091 | |||
| 1232 | Ga0207705_10000164 | |||
| 1233 | Ga0207705_10008160 | |||
| 1234 | Ga0207705_10013215 | |||
| 1235 | Ga0207705_10016261 | |||
| 1236 | Ga0207705_10025987 | |||
| 1237 | Ga0207705_10034518 | |||
| 1238 | Ga0207705_10052020 | |||
| 1239 | Ga0207705_10093022 | |||
| 1240 | Ga0207705_10140640 | |||
| 1241 | Ga0207705_10145941 | |||
| 1242 | Ga0207705_10150601 | |||
| 1243 | Ga0207654_10169330 | |||
| 1244 | Ga0207707_10011788 | |||
| 1245 | Ga0207707_10079403 | |||
| 1246 | Ga0207695_10018139 | |||
| 1247 | Ga0207695_10195379 | |||
| 1248 | Ga0207671_10072953 | |||
| 1249 | Ga0207660_10000515 | |||
| 1250 | Ga0207660_10018580 | |||
| 1251 | Ga0207660_10037917 | |||
| 1252 | Ga0207660_10072371 | |||
| 1253 | Ga0207657_10000090 | |||
| 1254 | Ga0207657_10000092 | |||
| 1255 | Ga0207657_10000252 | |||
| 1256 | Ga0207657_10002608 | |||
| 1257 | Ga0207657_10002996 | |||
| 1258 | Ga0207657_10006356 | |||
| 1259 | Ga0207657_10021378 | |||
| 1260 | Ga0207657_10021511 | |||
| 1261 | Ga0207657_10025279 | |||
| 1262 | Ga0207657_10039639 | |||
| 1263 | Ga0207657_10049207 | |||
| 1264 | Ga0207657_10062635 | |||
| 1265 | Ga0207657_10100874 | |||
| 1266 | Ga0207657_10113188 | |||
| 1267 | Ga0207657_10128074 | |||
| 1268 | Ga0207649_10000324 | |||
| 1269 | Ga0207649_10003256 | |||
| 1270 | Ga0207649_10022792 | |||
| 1271 | Ga0207649_10062731 | |||
| 1272 | Ga0207649_10068631 | |||
| 1273 | Ga0207649_10076008 | |||
| 1274 | Ga0207652_10005656 | |||
| 1275 | Ga0207652_10077375 | |||
| 1276 | Ga0207652_10125035 | |||
| 1277 | Ga0207681_10001637 | |||
| 1278 | Ga0207681_10045124 | |||
| 1279 | Ga0207694_10002074 | |||
| 1280 | Ga0207694_10013642 | |||
| 1281 | Ga0207650_10006298 | |||
| 1282 | Ga0207650_10026898 | |||
| 1283 | Ga0207650_10089581 | |||
| 1284 | Ga0207650_10153112 | |||
| 1285 | Ga0207659_10009713 | |||
| 1286 | Ga0207659_10022318 | |||
| 1287 | Ga0207659_10119291 | |||
| 1288 | Ga0207659_10190505 | |||
| 1289 | Ga0207687_10001182 | |||
| 1290 | Ga0207687_10074809 | |||
| 1291 | Ga0207700_10044939 | |||
| 1292 | Ga0207664_10070301 | |||
| 1293 | Ga0207644_10000960 | |||
| 1294 | Ga0207644_10001690 | |||
| 1295 | Ga0207644_10003068 | |||
| 1296 | Ga0207644_10013613 | |||
| 1297 | Ga0207644_10145751 | |||
| 1298 | Ga0207690_10000184 | |||
| 1299 | Ga0207690_10000463 | |||
| 1300 | Ga0207690_10004224 | |||
| 1301 | Ga0207690_10022380 | |||
| 1302 | Ga0207690_10045185 | |||
| 1303 | Ga0207690_10082109 | |||
| 1304 | Ga0207690_10166858 | |||
| 1305 | Ga0207706_10000110 | |||
| 1306 | Ga0207706_10000705 | |||
| 1307 | Ga0207706_10002377 | |||
| 1308 | Ga0207706_10004248 | |||
| 1309 | Ga0207706_10004820 | |||
| 1310 | Ga0207706_10016933 | |||
| 1311 | Ga0207706_10017389 | |||
| 1312 | Ga0207706_10027566 | |||
| 1313 | Ga0207706_10036885 | |||
| 1314 | Ga0207706_10043467 | |||
| 1315 | Ga0207706_10045339 | |||
| 1316 | Ga0207706_10068218 | |||
| 1317 | Ga0207670_10026192 | |||
| 1318 | Ga0207669_10020498 | |||
| 1319 | Ga0207704_10007674 | |||
| 1320 | Ga0207691_10001179 | |||
| 1321 | Ga0207691_10006830 | |||
| 1322 | Ga0207691_10015481 | |||
| 1323 | Ga0207691_10025389 | |||
| 1324 | Ga0207691_10050326 | |||
| 1325 | Ga0207691_10089990 | |||
| 1326 | Ga0207711_10000586 | |||
| 1327 | Ga0207711_10000922 | |||
| 1328 | Ga0207711_10001460 | |||
| 1329 | Ga0207711_10001669 | |||
| 1330 | Ga0207711_10007771 | |||
| 1331 | Ga0207711_10010179 | |||
| 1332 | Ga0207711_10014091 | |||
| 1333 | Ga0207711_10022743 | |||
| 1334 | Ga0207711_10086054 | |||
| 1335 | Ga0207711_10177036 | |||
| 1336 | Ga0207689_10000014 | |||
| 1337 | Ga0207689_10000840 | |||
| 1338 | Ga0207689_10089510 | |||
| 1339 | Ga0207689_10125762 | |||
| 1340 | Ga0207661_10000179 | |||
| 1341 | Ga0207661_10001420 | |||
| 1342 | Ga0207661_10078905 | |||
| 1343 | Ga0207661_10109447 | |||
| 1344 | Ga0207661_10111803 | |||
| 1345 | Ga0207679_10000329 | |||
| 1346 | Ga0207679_10006275 | |||
| 1347 | Ga0207679_10010964 | |||
| 1348 | Ga0207679_10013820 | |||
| 1349 | Ga0207679_10025379 | |||
| 1350 | Ga0207679_10038207 | |||
| 1351 | Ga0207679_10059770 | |||
| 1352 | Ga0207679_10065804 | |||
| 1353 | Ga0207679_10131241 | |||
| 1354 | Ga0207679_10201529 | |||
| 1355 | Ga0207667_10000303 | |||
| 1356 | Ga0207667_10003943 | |||
| 1357 | Ga0207667_10017917 | |||
| 1358 | Ga0207667_10213795 | |||
| 1359 | Ga0207667_10240147 | |||
| 1360 | Ga0207651_10002150 | |||
| 1361 | Ga0207651_10008275 | |||
| 1362 | Ga0207651_10010582 | |||
| 1363 | Ga0207651_10021255 | |||
| 1364 | Ga0207651_10027315 | |||
| 1365 | Ga0207712_10024214 | |||
| 1366 | Ga0207640_10000404 | |||
| 1367 | Ga0207640_10001192 | |||
| 1368 | Ga0207640_10040222 | |||
| 1369 | Ga0207640_10053167 | |||
| 1370 | Ga0207640_10069913 | |||
| 1371 | Ga0207658_10003404 | |||
| 1372 | Ga0207658_10057702 | |||
| 1373 | Ga0207658_10106759 | |||
| 1374 | Ga0207677_10000905 | |||
| 1375 | Ga0207677_10117684 | |||
| 1376 | Ga0207703_10000933 | |||
| 1377 | Ga0207703_10013815 | |||
| 1378 | Ga0207703_10079833 | |||
| 1379 | Ga0207703_10278030 | |||
| 1380 | Ga0207639_10001273 | |||
| 1381 | Ga0207639_10021459 | |||
| 1382 | Ga0207639_10047095 | |||
| 1383 | Ga0207639_10197667 | |||
| 1384 | Ga0207678_10000681 | |||
| 1385 | Ga0207678_10003366 | |||
| 1386 | Ga0207678_10010854 | |||
| 1387 | Ga0207678_10012732 | |||
| 1388 | Ga0207678_10013063 | |||
| 1389 | Ga0207678_10013162 | |||
| 1390 | Ga0207678_10015058 | |||
| 1391 | Ga0207678_10179403 | |||
| 1392 | Ga0207678_10185774 | |||
| 1393 | Ga0207702_10000391 | |||
| 1394 | Ga0207702_10015887 | |||
| 1395 | Ga0207702_10026416 | |||
| 1396 | Ga0207702_10060817 | |||
| 1397 | Ga0207702_10077591 | |||
| 1398 | Ga0207702_10084531 | |||
| 1399 | Ga0207702_10147938 | |||
| 1400 | Ga0207702_10185500 | |||
| 1401 | Ga0207641_10000817 | |||
| 1402 | Ga0207641_10001015 | |||
| 1403 | Ga0207641_10053290 | |||
| 1404 | Ga0207641_10058993 | |||
| 1405 | Ga0207641_10146935 | |||
| 1406 | Ga0207648_10002058 | |||
| 1407 | Ga0207648_10015266 | |||
| 1408 | Ga0207648_10027466 | |||
| 1409 | Ga0207676_10000666 | |||
| 1410 | Ga0207676_10001889 | |||
| 1411 | Ga0207676_10012435 | |||
| 1412 | Ga0207676_10013953 | |||
| 1413 | Ga0207676_10092559 | |||
| 1414 | Ga0207674_10000244 | |||
| 1415 | Ga0207674_10004883 | |||
| 1416 | Ga0207674_10006854 | |||
| 1417 | Ga0207674_10010088 | |||
| 1418 | Ga0207674_10020867 | |||
| 1419 | Ga0207674_10028082 | |||
| 1420 | Ga0207674_10033668 | |||
| 1421 | Ga0207674_10064106 | |||
| 1422 | Ga0207674_10085920 | |||
| 1423 | Ga0207674_10128850 | |||
| 1424 | Ga0207675_100000154 | |||
| 1425 | Ga0207683_10001230 | |||
| 1426 | Ga0207683_10020679 | |||
| 1427 | Ga0207683_10029126 | |||
| 1428 | Ga0207683_10120897 | |||
| 1429 | Ga0207683_10205453 | |||
| 1430 | Ga0207698_10000394 | |||
| 1431 | Ga0207698_10000986 | |||
| 1432 | Ga0207698_10007443 | |||
| 1433 | Ga0207698_10015382 | |||
| 1434 | Ga0207698_10029761 | |||
| 1435 | Ga0207698_10041230 | |||
| 1436 | Ga0207698_10103137 | |||
| 1437 | Ga0207698_10108682 | |||
| 1438 | Ga0207698_10119446 | |||
| 1439 | Ga0207698_10198441 | |||
| 1440 | Ga0207698_10320120 | |||
| 1441 | Ga0268266_10000414 | |||
| 1442 | Ga0268266_10006064 | |||
| 1443 | Ga0268266_10019119 | |||
| 1444 | Ga0268266_10020464 | |||
| 1445 | Ga0268266_10025423 | |||
| 1446 | Ga0268265_10004462 | |||
| 1447 | Ga0268265_10009593 | |||
| 1448 | Ga0268265_10043225 | |||
| 1449 | Ga0268265_10048932 | |||
| 1450 | Ga0268265_10119030 | |||
| 1451 | Ga0268264_10007446 | |||
| 1452 | Ga0268264_10017800 | |||
| 1453 | Ga0268264_10032942 | |||
| 1454 | Ga0268264_10051140 | |||
| 1455 | Ga0307408_100021553 | |||
| 1456 | Ga0307408_100022859 | |||
| 1457 | Ga0307408_100068725 | |||
| 1458 | Ga0307408_100118878 | |||
| 1459 | Ga0307408_100139016 | |||
| 1460 | Ga0307408_100141395 | |||
| 1461 | Ga0307405_10004585 | |||
| 1462 | Ga0307405_10010353 | |||
| 1463 | Ga0307405_10022883 | |||
| 1464 | Ga0307405_10031737 | |||
| 1465 | Ga0307405_10054700 | |||
| 1466 | Ga0307405_10179988 | |||
| 1467 | Ga0307413_10007996 | |||
| 1468 | Ga0307413_10017144 | |||
| 1469 | Ga0307413_10036435 | |||
| 1470 | Ga0307413_10057000 | |||
| 1471 | Ga0307413_10070126 | |||
| 1472 | Ga0307413_10135352 | |||
| 1473 | Ga0307413_10170029 | |||
| 1474 | Ga0307410_10000411 | |||
| 1475 | Ga0307410_10001663 | |||
| 1476 | Ga0307410_10001930 | |||
| 1477 | Ga0307410_10005040 | |||
| 1478 | Ga0307410_10013390 | |||
| 1479 | Ga0307410_10019864 | |||
| 1480 | Ga0307410_10028488 | |||
| 1481 | Ga0307410_10047182 | |||
| 1482 | Ga0307410_10050226 | |||
| 1483 | Ga0307410_10063028 | |||
| 1484 | Ga0307410_10143819 | |||
| 1485 | Ga0307410_10225423 | |||
| 1486 | Ga0307406_10016033 | |||
| 1487 | Ga0307406_10022203 | |||
| 1488 | Ga0307406_10026333 | |||
| 1489 | Ga0307406_10129776 | |||
| 1490 | Ga0307407_10038623 | |||
| 1491 | Ga0307407_10042541 | |||
| 1492 | Ga0307407_10069254 | |||
| 1493 | Ga0307412_10008877 | |||
| 1494 | Ga0307412_10069822 | |||
| 1495 | Ga0307412_10100463 | |||
| 1496 | Ga0307409_100000126 | |||
| 1497 | Ga0307409_100013592 | |||
| 1498 | Ga0307409_100018477 | |||
| 1499 | Ga0307409_100024369 | |||
| 1500 | Ga0307409_100029327 | |||
| 1501 | Ga0307409_100043131 | |||
| 1502 | Ga0307409_100050920 | |||
| 1503 | Ga0307409_100072414 | |||
| 1504 | Ga0307409_100089058 | |||
| 1505 | Ga0307416_100033299 | |||
| 1506 | Ga0307416_100056360 | |||
| 1507 | Ga0307416_100059803 | |||
| 1508 | Ga0307416_100080192 | |||
| 1509 | Ga0307416_100088050 | |||
| 1510 | Ga0307414_10003535 | |||
| 1511 | Ga0307414_10011260 | |||
| 1512 | Ga0307414_10012124 | |||
| 1513 | Ga0307414_10014705 | |||
| 1514 | Ga0307414_10054354 | |||
| 1515 | Ga0307414_10065437 | |||
| 1516 | Ga0307414_10076988 | |||
| 1517 | Ga0307414_10085367 | |||
| 1518 | Ga0307414_10088268 | |||
| 1519 | Ga0307414_10099590 | |||
| 1520 | Ga0307414_10106235 | |||
| 1521 | Ga0307414_10133951 | |||
| 1522 | Ga0307414_10148156 | |||
| 1523 | Ga0307414_10226789 | |||
| 1524 | Ga0307411_10012766 | |||
| 1525 | Ga0307411_10015043 | |||
| 1526 | Ga0307411_10018822 | |||
| 1527 | Ga0307411_10041409 | |||
| 1528 | Ga0307411_10052369 | |||
| 1529 | Ga0307411_10057169 | |||
| 1530 | Ga0307411_10120109 | |||
| 1531 | Ga0307411_10129951 | |||
| 1532 | Ga0307411_10143768 | |||
| 1533 | Ga0307411_10145523 | |||
| 1534 | Ga0307411_10148807 | |||
| 1535 | Ga0307411_10163652 | |||
| 1536 | Ga0307411_10169601 | |||
| 1537 | Ga0307415_100003894 | |||
| 1538 | Ga0307415_100022325 | |||
| 1539 | Ga0307415_100150090 | |||
| 1540 | Ga0373943_0010492 | |||
| 1541 | Ga0373942_0018714 | |||
| 1542 | Ga0373935_0117361 | |||
| 1543 | Ga0373925_0005291 | |||
| 1544 | Ga0395899_0000132 | |||
| 1545 | Ga0395899_0001019 | |||
| 1546 | Ga0395899_0002681 | |||
| 1547 | Ga0395899_0011909 | |||
| 1548 | Ga0395899_0022870 | |||
| 1549 | Ga0395899_0030661 | |||
| 1550 | Ga0395899_0034654 | |||
| 1551 | Ga0395899_0046130 | |||
| 1552 | Ga0395899_0061799 | |||
| 1553 | Ga0395899_0086959 | |||
| 1554 | Ga0395899_0087043 | |||
| 1555 | Ga0395899_0115625 | |||
| 1556 | Ga0395899_0145786 | |||
| 1557 | Ga0395899_0154053 | |||
| 1558 | Ga0395900_0000075 | |||
| 1559 | Ga0395900_0000289 | |||
| 1560 | Ga0395900_0000477 | |||
| 1561 | Ga0395900_0001617 | |||
| 1562 | Ga0395900_0009867 | |||
| 1563 | Ga0395900_0016780 | |||
| 1564 | Ga0395900_0021363 | |||
| 1565 | Ga0395900_0022848 | |||
| 1566 | Ga0395900_0027658 | |||
| 1567 | Ga0395900_0031939 | |||
| 1568 | Ga0395900_0063046 | |||
| 1569 | Ga0395900_0067815 | |||
| 1570 | Ga0395900_0080090 | |||
| 1571 | Ga0395900_0090896 | |||
| 1572 | Ga0395900_0098116 | |||
| 1573 | Ga0395900_0102405 | |||
| 1574 | Ga0395900_0130015 | |||
| 1575 | Ga0395900_0146245 | |||
| 1576 | Ga0395900_0149131 | |||
| 1577 | Ga0395900_0179058 | |||
| 1578 | Ga0395900_0192559 | |||
| 1579 | Ga0395900_0211288 | |||
| 1580 | Ga0395900_0211525 | |||
| 1581 | Ga0395900_0221931 | |||
| 1582 | Ga0395900_0251524 | |||
| 1583 | Ga0395900_0297197 | |||
| 1584 | Ga0395898_0000055 | |||
| 1585 | Ga0395898_0000898 | |||
| 1586 | Ga0395898_0011944 | |||
| 1587 | Ga0395898_0020318 | |||
| 1588 | Ga0395898_0025357 | |||
| 1589 | Ga0395898_0033668 | |||
| 1590 | Ga0395898_0042212 | |||
| 1591 | Ga0395898_0063311 | |||
| 1592 | Ga0395898_0227645 | |||
| 1593 | Ga0395905_0000067 | |||
| 1594 | Ga0395905_0000204 | |||
| 1595 | Ga0395905_0001128 | |||
| 1596 | Ga0395905_0002395 | |||
| 1597 | Ga0395905_0009949 | |||
| 1598 | Ga0395905_0011713 | |||
| 1599 | Ga0395905_0012837 | |||
| 1600 | Ga0395905_0019289 | |||
| 1601 | Ga0395905_0023614 | |||
| 1602 | Ga0395905_0035877 | |||
| 1603 | Ga0395905_0054494 | |||
| 1604 | Ga0395905_0073577 | |||
| 1605 | Ga0395905_0075407 | |||
| 1606 | Ga0395905_0095544 | |||
| 1607 | Ga0395905_0102026 | |||
| 1608 | Ga0395905_0169737 | |||
| 1609 | Ga0395905_0212021 | |||
| 1610 | Ga0395905_0332764 | |||
| 1611 | Ga0395901_0000208 | |||
| 1612 | Ga0395901_0000648 | |||
| 1613 | Ga0395901_0001244 | |||
| 1614 | Ga0395901_0002867 | |||
| 1615 | Ga0395901_0009196 | |||
| 1616 | Ga0395901_0013298 | |||
| 1617 | Ga0395901_0020133 | |||
| 1618 | Ga0395901_0026895 | |||
| 1619 | Ga0395901_0027910 | |||
| 1620 | Ga0395901_0033661 | |||
| 1621 | Ga0395901_0084033 | |||
| 1622 | Ga0395901_0109785 | |||
| 1623 | Ga0395901_0114584 | |||
| 1624 | Ga0395901_0194919 | |||
| 1625 | Ga0395901_0241635 | |||
| 1626 | Ga0395901_0355197 | |||
| 1627 | Ga0395901_0378857 | |||
| 1628 | Ga0395901_0412374 | |||
| 1629 | Ga0436365_0024047 | |||
| 1630 | Ga0436365_0546549 | |||
| 1631 | Ga0436365_0636584 | |||
| 1632 | Ga0436365_1104251 | |||
| 1633 | Ga0436363_1592812 | |||
| 1634 | Ga0439466_0020549 | |||
| 1635 | Ga0439431_0000643 | |||
| 1636 | Ga0439442_000926 | |||
| 1637 | Ga0439432_000868 | |||
| 1638 | Ga0439432_005945 | |||
| 1639 | Ga0439449_0012363 | |||
| 1640 | Ga0439462_0030757 | |||
| 1641 | Ga0450889_000032 | |||
| 1642 | Ga0439458_0004126 | |||
| 1643 | Ga0439434_0000800 | |||
| 1644 | Ga0466969_0007655 | |||
| 1645 | Ga0466966_0000010 | |||
| 1646 | Ga0466966_0007224 | |||
| 1647 | Ga0466966_0043747 | |||
| 1648 | Ga0466966_0070027 | |||
| 1649 | Ga0466966_0171397 | |||
| 1650 | Ga0466961_0097377 | |||
| 1651 | Ga0466963_0002563 | |||
| 1652 | Ga0466963_0003212 | |||
| 1653 | Ga0466963_0042133 | |||
| 1654 | Ga0466964_0004943 | |||
| 1655 | Ga0466964_0033921 | |||
| 1656 | Ga0466970_0008642 | |||
| 1657 | Ga0466970_0043837 | |||
| 1658 | Ga0466970_0073353 | |||
| 1659 | Ga0466957_0002570 | |||
| 1660 | Ga0466957_0066677 | |||
| 1661 | Ga0466960_0053920 | |||
| 1662 | Ga0466959_0004427 | |||
| 1663 | Ga0466959_0022664 | |||
| 1664 | Ga0466959_0086537 | |||
| 1665 | Ga0466959_0110833 | |||
| 1666 | Ga0466959_0155320 | |||
| 1667 | Ga0466958_0030302 | |||
| 1668 | Ga0466958_0145914 | |||
| 1669 | Ga0466967_0025320 | |||
| 1670 | Ga0466967_0153631 | |||
| 1671 | Ga0466967_0178338 | |||
| 1672 | Ga0466967_0211239 | |||
| 1673 | Ga0466967_0237983 | |||
| 1674 | Ga0466967_0276487 | |||
| 1675 | Ga0466967_0343206 | |||
| 1676 | Ga0466967_0353307 | |||
| 1677 | Ga0495663_0003736 | |||
| 1678 | Ga0495663_0009624 | |||
| 1679 | Ga0495642_0044198 | |||
| 1680 | Ga0495598_0001164 | |||
| 1681 | Ga0495621_0000179 | |||
| 1682 | Ga0495621_0003583 | |||
| 1683 | Ga0495633_0003748 | |||
| 1684 | Ga0495633_0033264 | |||
| 1685 | Ga0495668_0005101 | |||
| 1686 | Ga0495668_0074606 | |||
| 1687 | Ga0495625_0029408 | |||
| 1688 | Ga0495669_0007585 | |||
| 1689 | Ga0495669_0020214 | |||
| 1690 | Ga0495669_0037026 | |||
| 1691 | Ga0495669_0037993 | |||
| 1692 | Ga0495669_0074629 | |||
| 1693 | Ga0495670_0000004 | |||
| 1694 | Ga0495670_0002449 | |||
| 1695 | Ga0495670_0016058 | |||
| 1696 | Ga0495670_0025750 | |||
| 1697 | Ga0496101_0008722 | |||
| 1698 | Ga0496102_0223635 | |||
| 1699 | Ga0496103_0091785 | |||
| 1700 | Ga0496106_0103099 | |||
| 1701 | Ga0496107_0006177 | |||
| 1702 | Ga0496107_0024175 | |||
| 1703 | Ga0496107_0062848 | |||
| 1704 | Ga0496108_0014020 | |||
| 1705 | Ga0496108_0017557 | |||
| 1706 | Ga0496108_0018531 | |||
| 1707 | Ga0496108_0018850 | |||
| 1708 | Ga0496109_0002106 | |||
| 1709 | Ga0496109_0046383 | |||
| 1710 | Ga0496109_0048948 | |||
| 1711 | Ga0496109_0130518 | |||
| 1712 | Ga0496109_0330987 | |||
| 1713 | Ga0496109_0362724 | |||
| 1714 | Ga0496110_0001399 | |||
| 1715 | Ga0496110_0001805 | |||
| 1716 | Ga0496110_0009949 | |||
| 1717 | Ga0496110_0023051 | |||
| 1718 | Ga0496110_0172222 | |||
| 1719 | Ga0496111_0002670 | |||
| 1720 | Ga0496112_0000546 | |||
| 1721 | Ga0496112_0061375 | |||
| 1722 | Ga0496112_0086565 | |||
| 1723 | Ga0496112_0260212 | |||
| 1724 | Ga0496113_0007254 | |||
| 1725 | Ga0496113_0051969 | |||
| 1726 | Ga0496113_0082117 | |||
| 1727 | Ga0496114_0088021 | |||
| 1728 | Ga0496114_0216521 | |||
| 1729 | Ga0496115_0013299 | |||
| 1730 | Ga0496123_0022908 | |||
| 1731 | Ga0496123_0053333 | |||
| 1732 | Ga0496124_0000186 | |||
| 1733 | Ga0496124_0001152 | |||
| 1734 | Ga0496124_0010571 | |||
| 1735 | Ga0496125_0004150 | |||
| 1736 | Ga0496126_0000733 | |||
| 1737 | Ga0501034_0255766 | |||
| 1738 | Ga0501070_0018414 | |||
| 1739 | Ga0501217_010627 | |||
| 1740 | Ga0501223_005950 | |||
| 1741 | Ga0501233_008538 | |||
| 1742 | Ga0501225_0014779 | |||
| 1743 | Ga0501241_014988 | |||
| 1744 | Ga0501204_002627 | |||
| 1745 | nmdc:mga06r32_38212_c1 | |||
| 1746 | nmdc:mga0n895_129274_c1 | |||
| 1747 | nmdc:mga0n895_269101_c1 | |||
| 1748 | nmdc:mga0a205_2429_c1 | |||
| 1749 | Ga0495655_0008165 | |||
| 1750 | Ga0500566_0028830 | |||
| 1751 | Ga0500573_0000016 | |||
| 1752 | Ga0466962_0009757 | |||
| 1753 | 2511124029 | |||
| 1754 | 2600201678 | |||
| 1755 | 2600224888 | |||
| 1756 | 2644126924 | |||
| 1757 | 2753767902 | |||
| 1758 | 2819713082 | |||
| 1759 | 2830076062 | |||
| 1760 | 2879165673 | |||
| 1761 | 2896429585 | |||
| 1762 | 2928027492 | |||
| 1763 | 2928527621 | |||
| 1764 | 2928971744 | |||
| 1765 | 2946788640 | |||
| 1766 | 2984558207 | |||
| 1767 | 2984567414 | |||
| 1768 | 2990268688 | |||
| 1769 | 2993358479 | |||
| 1770 | 2993694605 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4aq6-assembly2.cif.gz_K | substrate bound homogentisate 1,2-dioxygenase | 0.9005 | 4 | 408 |
| 4aq2-assembly2.cif.gz_H | resting state of homogentisate 1,2-dioxygenase | 0.8931 | 4 | 408 |
| 4aq6-assembly2.cif.gz_K | substrate bound homogentisate 1,2-dioxygenase | 0.8921 | 4 | 408 |
| 4aq2-assembly2.cif.gz_G | resting state of homogentisate 1,2-dioxygenase | 0.8892 | 4 | 408 |
| 4aq2-assembly2.cif.gz_L | resting state of homogentisate 1,2-dioxygenase | 0.887 | 4 | 408 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9ZRA2_1_273_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8828 | 4 | 242 | 2.60.120.10 |
| af_A0A1D6NXP1_1_243_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8449 | 25 | 242 | 2.60.120.10 |
| af_G3V6C2_268_404_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8082 | 253 | 378 | 2.60.120.10 |
| af_Q9ZRA2_1_273_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7742 | 4 | 242 | 2.60.120.10 |
| af_A0A1D6NXP1_1_243_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7593 | 25 | 242 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1BRL9-F1-model_v4 | Homogentisate 1,2-dioxygenase (EC 1.13.-.-) | 0.9434 | 153 | 257 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-T1BRL9-F1-model_v4 | Homogentisate 1,2-dioxygenase (EC 1.13.-.-) | 0.9348 | 153 | 257 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A521HMS6-F1-model_v4 | Homogentisate 1,2-dioxygenase (HGDO) (EC 1.13.11.5) (Homogentisate oxygenase) (Homogentisic acid oxidase) (Homogentisicase) | 0.9258 | 2 | 408 |
GO:0004411
GO:0005506 GO:0005737 GO:0006559 GO:0006572 |
| AF-A0A656QE43-F1-model_v4 | Homogentisate 1,2-dioxygenase (EC 1.13.11.5) | 0.9233 | 1 | 298 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A328P3V7-F1-model_v4 | Homogentisate 1,2-dioxygenase (HGDO) (EC 1.13.11.5) (Homogentisate oxygenase) (Homogentisic acid oxidase) (Homogentisicase) | 0.9226 | 1 | 408 |
GO:0004411
GO:0005506 GO:0005737 GO:0006559 GO:0006572 |