F484668

General Info

Members Datasets Scaffolds Average Seq Length
885 255 1770 424

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100098841|Ga0307409_1000988412
Length 451
Sequence LTGEADTRNDPLVSPTRNEGVFASVSNDLSYLTGFGAHFESEAVPDALPKGRNSPQRPAFGLYTEQLSGTAFTAPRHENRRSWLYRMRPTADHRPFERYLGAELFAPGTVDEPVAPNRLRWDPPELPADTDFVDGLVTMMANRDPASLEGVAIHLYRASRSMRDRVFVNADGELLIIPQSGTLRLFTEFGRMELPPGWVGLVPRGVKFRVEVDGEARGYVAENHGALFRLPELGPIGSNGLANARDFETPVAAYEDVDRPCEVVQKYMGSLWTTTLDHSPLDVVAWHGNLAPCRYELARFNTIGTVSFDHPDPSIFTVLTSPSDTPGRANADFVIFPPRWMVGEDTFRPPWFHRNVMSEAMGLIHGAYDAKADGFAPGGLSLHNMMSGHGPDVESWRKASGAELKPVKIEGTMAFMVESCWPYKPTRFALDRAQPDYDEAWADFPKAELPK

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
178 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
179 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
180 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
183 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
184 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
226 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
227 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
228 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
229 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
230 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
235 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
236 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
238 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
239 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
240 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
241 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
242 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
243 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
244 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
245 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
246 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
247 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
248 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
249 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
250 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
251 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
252 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
253 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
254 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
255 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 3.95
Rhizosphere 91.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100098841 3300031995 Bacteria 2415
2 ARcpr5oldR_c003416 3300000041 Bacteria 1412
3 JGI24736J21556_1000361 3300001904 Bacteria 8555
4 JGI24740J21852_10016319 3300001979 Bacteria 2685
5 JGI24740J21852_10025735 3300001979 Bacteria 1979
6 JGI24739J22299_10000035 3300001989 Bacteria 37844
7 JGI24739J22299_10023017 3300001989 Bacteria 2205
8 JGI24737J22298_10000020 3300001990 Bacteria 46324
9 JGI24737J22298_10007189 3300001990 Bacteria 3767
10 JGI24737J22298_10023224 3300001990 Bacteria 1968
11 JGI24735J21928_10014192 3300002067 Bacteria 2497
12 JGI24738J21930_10000048 3300002075 Bacteria 24246
13 JGI24738J21930_10007423 3300002075 Bacteria 2529
14 Ga0055524_1000351 3300003775 Bacteria 41918
15 Ga0055530_10000144 3300003791 Bacteria 63595
16 Ga0055531_10000188 3300003794 Bacteria 68777
17 Ga0055531_10019042 3300003794 Bacteria 2801
18 Ga0070658_10000220 3300005327 Bacteria 50700
19 Ga0070658_10000264 3300005327 Bacteria 46199
20 Ga0070658_10002220 3300005327 Bacteria 16299
21 Ga0070658_10015611 3300005327 Bacteria 6073
22 Ga0070658_10045810 3300005327 Bacteria 3537
23 Ga0070658_10074692 3300005327 Bacteria 2780
24 Ga0070658_10077096 3300005327 Bacteria 2734
25 Ga0070676_10008339 3300005328 Bacteria 5583
26 Ga0070683_100009023 3300005329 Bacteria 8507
27 Ga0070683_100011883 3300005329 Bacteria 7548
28 Ga0070683_100036805 3300005329 Bacteria 4479
29 Ga0070683_100133841 3300005329 Bacteria 2347
30 Ga0070670_100009146 3300005331 Bacteria 8467
31 Ga0070670_100021908 3300005331 Bacteria 5498
32 Ga0070670_100028039 3300005331 Bacteria 4845
33 Ga0070670_100033024 3300005331 Bacteria 4459
34 Ga0070670_100033080 3300005331 Bacteria 4454
35 Ga0070670_100045987 3300005331 Bacteria 3753
36 Ga0070670_100046834 3300005331 Bacteria 3719
37 Ga0070670_100054617 3300005331 Bacteria 3429
38 Ga0070670_100071120 3300005331 Bacteria 2987
39 Ga0070670_100131084 3300005331 Bacteria 2165
40 Ga0070670_100141532 3300005331 Bacteria 2080
41 Ga0070677_10000460 3300005333 Bacteria 13951
42 Ga0070677_10000776 3300005333 Bacteria 10645
43 Ga0068869_100000043 3300005334 Bacteria 52392
44 Ga0070666_10001568 3300005335 Bacteria 13884
45 Ga0070666_10036747 3300005335 Bacteria 3253
46 Ga0070666_10049979 3300005335 Bacteria 2812
47 Ga0070680_100000406 3300005336 Bacteria 29408
48 Ga0070680_100015034 3300005336 Bacteria 6059
49 Ga0070680_100060976 3300005336 Bacteria 3087
50 Ga0070680_100123262 3300005336 Bacteria 2164
51 Ga0070680_100125407 3300005336 Bacteria 2145
52 Ga0070680_100281703 3300005336 Bacteria 1408
53 Ga0070682_100060468 3300005337 Bacteria 2396
54 Ga0070682_100084418 3300005337 Bacteria 2063
55 Ga0068868_100000957 3300005338 Bacteria 19654
56 Ga0070660_100000091 3300005339 Bacteria 54397
57 Ga0070660_100000218 3300005339 Bacteria 37921
58 Ga0070660_100000415 3300005339 Bacteria 28402
59 Ga0070660_100008260 3300005339 Bacteria 7276
60 Ga0070660_100018258 3300005339 Bacteria 5123
61 Ga0070660_100026322 3300005339 Bacteria 4329
62 Ga0070660_100028865 3300005339 Bacteria 4154
63 Ga0070660_100062331 3300005339 Bacteria 2896
64 Ga0070689_100024220 3300005340 Bacteria 4551
65 Ga0070691_10006893 3300005341 Bacteria 5197
66 Ga0070687_100064342 3300005343 Bacteria 1948
67 Ga0070661_100000181 3300005344 Bacteria 52052
68 Ga0070661_100018437 3300005344 Bacteria 4960
69 Ga0070661_100019737 3300005344 Bacteria 4803
70 Ga0070661_100026891 3300005344 Bacteria 4141
71 Ga0070661_100027478 3300005344 Bacteria 4097
72 Ga0070661_100038040 3300005344 Bacteria 3502
73 Ga0070692_10003786 3300005345 Bacteria 6220
74 Ga0070692_10006331 3300005345 Bacteria 5135
75 Ga0070692_10006444 3300005345 Bacteria 5097
76 Ga0070692_10026911 3300005345 Bacteria 2847
77 Ga0070668_100005171 3300005347 Bacteria 9675
78 Ga0070669_100000209 3300005353 Bacteria 48982
79 Ga0070669_100072542 3300005353 Bacteria 2549
80 Ga0070675_100003209 3300005354 Bacteria 12385
81 Ga0070675_100028103 3300005354 Bacteria 4525
82 Ga0070675_100053098 3300005354 Bacteria 3333
83 Ga0070675_100080480 3300005354 Bacteria 2715
84 Ga0070671_100000946 3300005355 Bacteria 21265
85 Ga0070671_100002968 3300005355 Bacteria 13201
86 Ga0070671_100012684 3300005355 Bacteria 6792
87 Ga0070671_100024791 3300005355 Bacteria 4914
88 Ga0070671_100025393 3300005355 Bacteria 4861
89 Ga0070671_100027296 3300005355 Bacteria 4698
90 Ga0070671_100045117 3300005355 Bacteria 3664
91 Ga0070671_100048574 3300005355 Bacteria 3529
92 Ga0070671_100102513 3300005355 Bacteria 2401
93 Ga0070674_100042634 3300005356 Bacteria 3084
94 Ga0070674_100099248 3300005356 Bacteria 2118
95 Ga0070673_100000354 3300005364 Bacteria 24130
96 Ga0070673_100008820 3300005364 Bacteria 6733
97 Ga0070673_100017737 3300005364 Bacteria 5071
98 Ga0070673_100041312 3300005364 Bacteria 3546
99 Ga0070659_100000310 3300005366 Bacteria 37921
100 Ga0070659_100000463 3300005366 Bacteria 29968
101 Ga0070659_100010426 3300005366 Bacteria 6834
102 Ga0070659_100032895 3300005366 Bacteria 4026
103 Ga0070659_100090425 3300005366 Bacteria 2453
104 Ga0070659_100143964 3300005366 Bacteria 1941
105 Ga0070659_100170636 3300005366 Bacteria 1782
106 Ga0070667_100020045 3300005367 Bacteria 5552
107 Ga0070667_100020452 3300005367 Bacteria 5494
108 Ga0070667_100048276 3300005367 Bacteria 3583
109 Ga0070667_100068583 3300005367 Bacteria 3017
110 Ga0070713_100020766 3300005436 Bacteria 5041
111 Ga0070713_100085671 3300005436 Bacteria 2700
112 Ga0070663_100000991 3300005455 Bacteria 15463
113 Ga0070663_100007128 3300005455 Bacteria 6785
114 Ga0070663_100008110 3300005455 Bacteria 6443
115 Ga0070663_100077759 3300005455 Bacteria 2430
116 Ga0070663_100108360 3300005455 Bacteria 2083
117 Ga0070663_100112765 3300005455 Bacteria 2045
118 Ga0070663_100127369 3300005455 Bacteria 1930
119 Ga0070663_100237344 3300005455 Bacteria 1438
120 Ga0070678_100008935 3300005456 Bacteria 6035
121 Ga0070678_100022943 3300005456 Bacteria 4149
122 Ga0070678_100093552 3300005456 Bacteria 2312
123 Ga0070678_100111605 3300005456 Bacteria 2140
124 Ga0070678_100127384 3300005456 Bacteria 2018
125 Ga0070662_100000080 3300005457 Bacteria 53280
126 Ga0070662_100000754 3300005457 Bacteria 19853
127 Ga0070662_100004660 3300005457 Bacteria 8696
128 Ga0070662_100007202 3300005457 Bacteria 7205
129 Ga0070662_100015854 3300005457 Bacteria 5055
130 Ga0070662_100017439 3300005457 Bacteria 4842
131 Ga0070662_100022342 3300005457 Bacteria 4330
132 Ga0070662_100029969 3300005457 Bacteria 3803
133 Ga0070662_100050500 3300005457 Bacteria 3000
134 Ga0070662_100158421 3300005457 Bacteria 1769
135 Ga0070681_10038880 3300005458 Bacteria 4770
136 Ga0070681_10041232 3300005458 Bacteria 4626
137 Ga0068867_100008883 3300005459 Bacteria 7089
138 Ga0068867_100014754 3300005459 Bacteria 5537
139 Ga0068867_100029006 3300005459 Bacteria 3986
140 Ga0070679_100025521 3300005530 Bacteria 5800
141 Ga0070684_100016504 3300005535 Bacteria 6035
142 Ga0070684_100030299 3300005535 Bacteria 4595
143 Ga0068853_100000134 3300005539 Bacteria 50184
144 Ga0068853_100001421 3300005539 Bacteria 17280
145 Ga0068853_100040321 3300005539 Bacteria 3984
146 Ga0068853_100083647 3300005539 Bacteria 2796
147 Ga0068853_100102504 3300005539 Bacteria 2532
148 Ga0070672_100000380 3300005543 Bacteria 25710
149 Ga0070672_100016111 3300005543 Bacteria 5346
150 Ga0070672_100064233 3300005543 Bacteria 2900
151 Ga0070672_100077256 3300005543 Bacteria 2662
152 Ga0070696_100016806 3300005546 Bacteria 4935
153 Ga0070693_100000536 3300005547 Bacteria 17016
154 Ga0070693_100061774 3300005547 Bacteria 2179
155 Ga0070665_100000054 3300005548 Bacteria 244426
156 Ga0070665_100023191 3300005548 Bacteria 6252
157 Ga0070665_100028342 3300005548 Bacteria 5641
158 Ga0070665_100067607 3300005548 Bacteria 3583
159 Ga0070665_100116472 3300005548 Bacteria 2675
160 Ga0068855_100000129 3300005563 Bacteria 96519
161 Ga0068855_100000780 3300005563 Bacteria 39315
162 Ga0068855_100044279 3300005563 Bacteria 5267
163 Ga0068855_100047304 3300005563 Bacteria 5082
164 Ga0068855_100052397 3300005563 Bacteria 4804
165 Ga0068855_100073049 3300005563 Bacteria 3986
166 Ga0068855_100206491 3300005563 Bacteria 2210
167 Ga0070664_100000047 3300005564 Bacteria 73560
168 Ga0070664_100003329 3300005564 Bacteria 12989
169 Ga0070664_100012056 3300005564 Bacteria 7023
170 Ga0070664_100024362 3300005564 Bacteria 5005
171 Ga0070664_100052616 3300005564 Bacteria 3449
172 Ga0070664_100157749 3300005564 Bacteria 2006
173 Ga0070664_100173301 3300005564 Bacteria 1914
174 Ga0068857_100007558 3300005577 Bacteria 9355
175 Ga0068857_100023330 3300005577 Bacteria 5445
176 Ga0068857_100034442 3300005577 Bacteria 4480
177 Ga0068857_100046735 3300005577 Bacteria 3842
178 Ga0068857_100179196 3300005577 Bacteria 1928
179 Ga0068854_100000414 3300005578 Bacteria 26795
180 Ga0068854_100026433 3300005578 Bacteria 3989
181 Ga0068854_100032791 3300005578 Bacteria 3616
182 Ga0068854_100056555 3300005578 Bacteria 2827
183 Ga0068854_100121723 3300005578 Bacteria 1982
184 Ga0068854_100166436 3300005578 Bacteria 1712
185 Ga0068854_100180451 3300005578 Bacteria 1649
186 Ga0068856_100001328 3300005614 Bacteria 26042
187 Ga0068856_100029171 3300005614 Bacteria 5389
188 Ga0068856_100040215 3300005614 Bacteria 4592
189 Ga0068856_100091223 3300005614 Bacteria 3031
190 Ga0068856_100113303 3300005614 Bacteria 2710
191 Ga0068852_100000798 3300005616 Bacteria 20761
192 Ga0068852_100002050 3300005616 Bacteria 13737
193 Ga0068852_100002251 3300005616 Bacteria 13240
194 Ga0068852_100010705 3300005616 Bacteria 6867
195 Ga0068852_100048328 3300005616 Bacteria 3634
196 Ga0068852_100086847 3300005616 Bacteria 2789
197 Ga0068852_100110050 3300005616 Bacteria 2503
198 Ga0068852_100152921 3300005616 Bacteria 2147
199 Ga0068859_100003417 3300005617 Bacteria 16150
200 Ga0068859_100004856 3300005617 Bacteria 13679
201 Ga0068859_100008232 3300005617 Bacteria 10577
202 Ga0068859_100251848 3300005617 Bacteria 1856
203 Ga0068864_100000181 3300005618 Bacteria 58221
204 Ga0068864_100000652 3300005618 Bacteria 28966
205 Ga0068864_100001327 3300005618 Bacteria 20582
206 Ga0068864_100006134 3300005618 Bacteria 9859
207 Ga0068864_100038107 3300005618 Bacteria 4103
208 Ga0068864_100106455 3300005618 Bacteria 2494
209 Ga0068864_100115478 3300005618 Bacteria 2395
210 Ga0068866_10006592 3300005718 Bacteria 4840
211 Ga0068866_10019163 3300005718 Bacteria 3108
212 Ga0068861_100000036 3300005719 Bacteria 60355
213 Ga0068851_10002516 3300005834 Bacteria 8061
214 Ga0068851_10043372 3300005834 Bacteria 2268
215 Ga0068863_100003734 3300005841 Bacteria 15056
216 Ga0068863_100004126 3300005841 Bacteria 14361
217 Ga0068863_100013157 3300005841 Bacteria 7984
218 Ga0068863_100044951 3300005841 Bacteria 4191
219 Ga0068863_100064625 3300005841 Bacteria 3461
220 Ga0068863_100149391 3300005841 Bacteria 2235
221 Ga0068858_100005075 3300005842 Bacteria 12907
222 Ga0068858_100019868 3300005842 Bacteria 6281
223 Ga0068858_100080601 3300005842 Bacteria 3025
224 Ga0068858_100105442 3300005842 Bacteria 2630
225 Ga0068860_100002079 3300005843 Bacteria 21111
226 Ga0068860_100021050 3300005843 Bacteria 6318
227 Ga0068860_100087843 3300005843 Bacteria 2959
228 Ga0068860_100137300 3300005843 Bacteria 2348
229 Ga0068862_100005042 3300005844 Bacteria 11111
230 Ga0068862_100013934 3300005844 Bacteria 6665
231 Ga0068862_100088938 3300005844 Bacteria 2687
232 Ga0068862_100089198 3300005844 Bacteria 2683
233 Ga0068862_100107130 3300005844 Bacteria 2451
234 Ga0081539_10013055 3300005985 Bacteria 6301
235 Ga0081539_10056537 3300005985 Bacteria 2177
236 Ga0070717_10022023 3300006028 Bacteria 5030
237 Ga0070717_10065554 3300006028 Bacteria 3019
238 Ga0097621_100088259 3300006237 Bacteria 2591
239 Ga0097621_100108627 3300006237 Bacteria 2342
240 Ga0068871_100051389 3300006358 Bacteria 3337
241 Ga0068871_100066219 3300006358 Bacteria 2961
242 Ga0075431_100068229 3300006847 Bacteria 3670
243 Ga0075433_10022184 3300006852 Bacteria 5329
244 Ga0068865_100002737 3300006881 Bacteria 10470
245 Ga0068865_100068973 3300006881 Bacteria 2501
246 Ga0097620_100003417 3300006931 Bacteria 16150
247 Ga0097620_100004857 3300006931 Bacteria 13679
248 Ga0097620_100008232 3300006931 Bacteria 10577
249 Ga0105250_10009470 3300009092 Bacteria 4099
250 Ga0105240_10010591 3300009093 Bacteria 12956
251 Ga0105240_10085341 3300009093 Bacteria 3868
252 Ga0105240_10141777 3300009093 Bacteria 2872
253 Ga0105245_10003294 3300009098 Bacteria 14501
254 Ga0105245_10009900 3300009098 Bacteria 8303
255 Ga0105245_10062190 3300009098 Bacteria 3368
256 Ga0105245_10303719 3300009098 Bacteria 1567
257 Ga0105241_10154089 3300009174 Bacteria 1883
258 Ga0105242_10028920 3300009176 Bacteria 4416
259 Ga0105248_10000256 3300009177 Bacteria 62138
260 Ga0105248_10000276 3300009177 Bacteria 60451
261 Ga0105248_10002271 3300009177 Bacteria 21272
262 Ga0105248_10004379 3300009177 Bacteria 15623
263 Ga0105248_10016393 3300009177 Bacteria 8154
264 Ga0105248_10072344 3300009177 Bacteria 3875
265 Ga0105248_10111509 3300009177 Bacteria 3085
266 Ga0105248_10277806 3300009177 Bacteria 1886
267 Ga0105248_10470140 3300009177 Bacteria 1417
268 Ga0105237_10014619 3300009545 Bacteria 8200
269 Ga0105237_10035296 3300009545 Bacteria 5060
270 Ga0105238_10009452 3300009551 Bacteria 9757
271 Ga0105238_10010235 3300009551 Bacteria 9406
272 Ga0105238_10021875 3300009551 Bacteria 6514
273 Ga0105238_10034298 3300009551 Bacteria 5164
274 Ga0105238_10035247 3300009551 Bacteria 5088
275 Ga0105238_10152158 3300009551 Bacteria 2289
276 Ga0105249_10022753 3300009553 Bacteria 5617
277 Ga0105246_10002855 3300011119 Bacteria 10456
278 Ga0105246_10036076 3300011119 Bacteria 3310
279 Ga0157373_10007891 3300013100 Bacteria 7920
280 Ga0157373_10009719 3300013100 Bacteria 7098
281 Ga0157373_10025323 3300013100 Bacteria 4293
282 Ga0157373_10031157 3300013100 Bacteria 3838
283 Ga0157373_10115444 3300013100 Bacteria 1887
284 Ga0157373_10151746 3300013100 Bacteria 1630
285 Ga0157373_10196427 3300013100 Bacteria 1422
286 Ga0157371_10005808 3300013102 Bacteria 10326
287 Ga0157371_10006963 3300013102 Bacteria 9209
288 Ga0157371_10012737 3300013102 Bacteria 6411
289 Ga0157371_10064850 3300013102 Bacteria 2587
290 Ga0157371_10085466 3300013102 Bacteria 2235
291 Ga0157371_10085664 3300013102 Bacteria 2232
292 Ga0157371_10173760 3300013102 Bacteria 1540
293 Ga0157370_10024160 3300013104 Bacteria 6022
294 Ga0157370_10093538 3300013104 Bacteria 2821
295 Ga0157369_10000256 3300013105 Bacteria 73068
296 Ga0157369_10002909 3300013105 Bacteria 20470
297 Ga0157369_10071182 3300013105 Bacteria 3734
298 Ga0157369_10116877 3300013105 Bacteria 2831
299 Ga0157369_10127279 3300013105 Bacteria 2700
300 Ga0157369_10162123 3300013105 Bacteria 2360
301 Ga0157369_10171283 3300013105 Bacteria 2288
302 Ga0157369_10218804 3300013105 Bacteria 1994
303 Ga0157369_10263447 3300013105 Bacteria 1797
304 Ga0157374_10007006 3300013296 Bacteria 9595
305 Ga0157378_10009565 3300013297 Bacteria 8441
306 Ga0163162_10031161 3300013306 Bacteria 5288
307 Ga0163162_10057952 3300013306 Bacteria 3901
308 Ga0163162_10136067 3300013306 Bacteria 2568
309 Ga0157372_10042552 3300013307 Bacteria 5025
310 Ga0157372_10087129 3300013307 Bacteria 3542
311 Ga0157372_10368297 3300013307 Bacteria 1674
312 Ga0157375_10117638 3300013308 Bacteria 2763
313 Ga0157375_10133810 3300013308 Bacteria 2601
314 Ga0163163_10001248 3300014325 Bacteria 21440
315 Ga0163163_10002058 3300014325 Bacteria 16986
316 Ga0157379_10009412 3300014968 Bacteria 8511
317 Ga0183363_1003 3300015690 Bacteria 421263
318 Ga0213876_10002881 3300021384 Bacteria 9990
319 Ga0213876_10004001 3300021384 Bacteria 8298
320 Ga0213876_10004890 3300021384 Bacteria 7431
321 Ga0209565_1000012 3300025263 Bacteria 606500
322 Ga0209673_1002916 3300025273 Bacteria 10783
323 Ga0209758_1014215 3300025297 Bacteria 4255
324 Ga0209050_1000010 3300025298 Bacteria 980454
325 Ga0209050_1006599 3300025298 Bacteria 6814
326 Ga0209256_1000012 3300025299 Bacteria 790371
327 Ga0209257_1000009 3300025304 Bacteria 1205047
328 Ga0209257_1002618 3300025304 Bacteria 17382
329 Ga0209257_1008681 3300025304 Bacteria 5684
330 Ga0207697_10000007 3300025315 Bacteria 81785
331 Ga0207656_10031657 3300025321 Bacteria 2193
332 Ga0207682_10000990 3300025893 Bacteria 13121
333 Ga0207688_10000318 3300025901 Bacteria 22194
334 Ga0207680_10002818 3300025903 Bacteria 8142
335 Ga0207680_10137738 3300025903 Bacteria 1615
336 Ga0207647_10000052 3300025904 Bacteria 87651
337 Ga0207647_10002807 3300025904 Bacteria 13133
338 Ga0207647_10004040 3300025904 Bacteria 10933
339 Ga0207647_10004972 3300025904 Bacteria 9802
340 Ga0207647_10007015 3300025904 Bacteria 8171
341 Ga0207647_10017277 3300025904 Bacteria 4905
342 Ga0207647_10022358 3300025904 Bacteria 4201
343 Ga0207647_10096726 3300025904 Bacteria 1756
344 Ga0207643_10023313 3300025908 Bacteria 3412
345 Ga0207705_10000003 3300025909 Bacteria 709270
346 Ga0207705_10000091 3300025909 Bacteria 110768
347 Ga0207705_10000164 3300025909 Bacteria 71606
348 Ga0207705_10008160 3300025909 Bacteria 7668
349 Ga0207705_10013215 3300025909 Bacteria 5959
350 Ga0207705_10016261 3300025909 Bacteria 5335
351 Ga0207705_10025987 3300025909 Bacteria 4178
352 Ga0207705_10034518 3300025909 Bacteria 3617
353 Ga0207705_10052020 3300025909 Bacteria 2948
354 Ga0207705_10093022 3300025909 Bacteria 2210
355 Ga0207705_10140640 3300025909 Bacteria 1802
356 Ga0207705_10145941 3300025909 Bacteria 1770
357 Ga0207705_10150601 3300025909 Bacteria 1743
358 Ga0207654_10169330 3300025911 Bacteria 1417
359 Ga0207707_10011788 3300025912 Bacteria 7605
360 Ga0207707_10079403 3300025912 Bacteria 2865
361 Ga0207695_10018139 3300025913 Bacteria 8145
362 Ga0207695_10195379 3300025913 Bacteria 1940
363 Ga0207671_10072953 3300025914 Bacteria 2563
364 Ga0207660_10000515 3300025917 Bacteria 25797
365 Ga0207660_10018580 3300025917 Bacteria 4636
366 Ga0207660_10037917 3300025917 Bacteria 3361
367 Ga0207660_10072371 3300025917 Bacteria 2510
368 Ga0207657_10000090 3300025919 Bacteria 86852
369 Ga0207657_10000092 3300025919 Bacteria 85665
370 Ga0207657_10000252 3300025919 Bacteria 57036
371 Ga0207657_10002608 3300025919 Bacteria 19479
372 Ga0207657_10002996 3300025919 Bacteria 18106
373 Ga0207657_10006356 3300025919 Bacteria 12274
374 Ga0207657_10021378 3300025919 Bacteria 6092
375 Ga0207657_10021511 3300025919 Bacteria 6066
376 Ga0207657_10025279 3300025919 Bacteria 5479
377 Ga0207657_10039639 3300025919 Bacteria 4184
378 Ga0207657_10049207 3300025919 Bacteria 3675
379 Ga0207657_10062635 3300025919 Bacteria 3183
380 Ga0207657_10100874 3300025919 Bacteria 2396
381 Ga0207657_10113188 3300025919 Bacteria 2239
382 Ga0207657_10128074 3300025919 Bacteria 2083
383 Ga0207649_10000324 3300025920 Bacteria 36296
384 Ga0207649_10003256 3300025920 Bacteria 8884
385 Ga0207649_10022792 3300025920 Bacteria 3619
386 Ga0207649_10062731 3300025920 Bacteria 2344
387 Ga0207649_10068631 3300025920 Bacteria 2255
388 Ga0207649_10076008 3300025920 Bacteria 2160
389 Ga0207652_10005656 3300025921 Bacteria 10140
390 Ga0207652_10077375 3300025921 Bacteria 2903
391 Ga0207652_10125035 3300025921 Bacteria 2290
392 Ga0207681_10001637 3300025923 Bacteria 14424
393 Ga0207681_10045124 3300025923 Bacteria 2957
394 Ga0207694_10002074 3300025924 Bacteria 16573
395 Ga0207694_10013642 3300025924 Bacteria 6123
396 Ga0207650_10006298 3300025925 Bacteria 8089
397 Ga0207650_10026898 3300025925 Bacteria 4110
398 Ga0207650_10089581 3300025925 Bacteria 2348
399 Ga0207650_10153112 3300025925 Bacteria 1821
400 Ga0207659_10009713 3300025926 Bacteria 6016
401 Ga0207659_10022318 3300025926 Bacteria 4213
402 Ga0207659_10119291 3300025926 Bacteria 2019
403 Ga0207659_10190505 3300025926 Bacteria 1632
404 Ga0207687_10001182 3300025927 Bacteria 17845
405 Ga0207687_10074809 3300025927 Bacteria 2429
406 Ga0207700_10044939 3300025928 Bacteria 3256
407 Ga0207664_10070301 3300025929 Bacteria 2817
408 Ga0207644_10000960 3300025931 Bacteria 18405
409 Ga0207644_10001690 3300025931 Bacteria 14227
410 Ga0207644_10003068 3300025931 Bacteria 10758
411 Ga0207644_10013613 3300025931 Bacteria 5428
412 Ga0207644_10145751 3300025931 Bacteria 1828
413 Ga0207690_10000184 3300025932 Bacteria 48035
414 Ga0207690_10000463 3300025932 Bacteria 26092
415 Ga0207690_10004224 3300025932 Bacteria 8491
416 Ga0207690_10022380 3300025932 Bacteria 3931
417 Ga0207690_10045185 3300025932 Bacteria 2908
418 Ga0207690_10082109 3300025932 Bacteria 2254
419 Ga0207690_10166858 3300025932 Bacteria 1646
420 Ga0207706_10000110 3300025933 Bacteria 87522
421 Ga0207706_10000705 3300025933 Bacteria 34845
422 Ga0207706_10002377 3300025933 Bacteria 18374
423 Ga0207706_10004248 3300025933 Bacteria 13491
424 Ga0207706_10004820 3300025933 Bacteria 12639
425 Ga0207706_10016933 3300025933 Bacteria 6575
426 Ga0207706_10017389 3300025933 Bacteria 6477
427 Ga0207706_10027566 3300025933 Bacteria 5079
428 Ga0207706_10036885 3300025933 Bacteria 4342
429 Ga0207706_10043467 3300025933 Bacteria 3981
430 Ga0207706_10045339 3300025933 Bacteria 3896
431 Ga0207706_10068218 3300025933 Bacteria 3130
432 Ga0207670_10026192 3300025936 Bacteria 3673
433 Ga0207669_10020498 3300025937 Bacteria 3469
434 Ga0207704_10007674 3300025938 Bacteria 5111
435 Ga0207691_10001179 3300025940 Bacteria 25979
436 Ga0207691_10006830 3300025940 Bacteria 11007
437 Ga0207691_10015481 3300025940 Bacteria 7252
438 Ga0207691_10025389 3300025940 Bacteria 5564
439 Ga0207691_10050326 3300025940 Bacteria 3815
440 Ga0207691_10089990 3300025940 Bacteria 2751
441 Ga0207711_10000586 3300025941 Bacteria 36944
442 Ga0207711_10000922 3300025941 Bacteria 28344
443 Ga0207711_10001460 3300025941 Bacteria 22085
444 Ga0207711_10001669 3300025941 Bacteria 20448
445 Ga0207711_10007771 3300025941 Bacteria 8959
446 Ga0207711_10010179 3300025941 Bacteria 7807
447 Ga0207711_10014091 3300025941 Bacteria 6643
448 Ga0207711_10022743 3300025941 Bacteria 5244
449 Ga0207711_10086054 3300025941 Bacteria 2755
450 Ga0207711_10177036 3300025941 Bacteria 1938
451 Ga0207689_10000014 3300025942 Bacteria 122534
452 Ga0207689_10000840 3300025942 Bacteria 29578
453 Ga0207689_10089510 3300025942 Bacteria 2528
454 Ga0207689_10125762 3300025942 Bacteria 2109
455 Ga0207661_10000179 3300025944 Bacteria 40861
456 Ga0207661_10001420 3300025944 Bacteria 16133
457 Ga0207661_10078905 3300025944 Bacteria 2712
458 Ga0207661_10109447 3300025944 Bacteria 2334
459 Ga0207661_10111803 3300025944 Bacteria 2311
460 Ga0207679_10000329 3300025945 Bacteria 35247
461 Ga0207679_10006275 3300025945 Bacteria 7501
462 Ga0207679_10010964 3300025945 Bacteria 5848
463 Ga0207679_10013820 3300025945 Bacteria 5295
464 Ga0207679_10025379 3300025945 Bacteria 4074
465 Ga0207679_10038207 3300025945 Bacteria 3419
466 Ga0207679_10059770 3300025945 Bacteria 2829
467 Ga0207679_10065804 3300025945 Bacteria 2714
468 Ga0207679_10131241 3300025945 Bacteria 2010
469 Ga0207679_10201529 3300025945 Bacteria 1662
470 Ga0207667_10000303 3300025949 Bacteria 68209
471 Ga0207667_10003943 3300025949 Bacteria 18261
472 Ga0207667_10017917 3300025949 Bacteria 7959
473 Ga0207667_10213795 3300025949 Bacteria 1976
474 Ga0207667_10240147 3300025949 Bacteria 1854
475 Ga0207651_10002150 3300025960 Bacteria 9314
476 Ga0207651_10008275 3300025960 Bacteria 5609
477 Ga0207651_10010582 3300025960 Bacteria 5119
478 Ga0207651_10021255 3300025960 Bacteria 3940
479 Ga0207651_10027315 3300025960 Bacteria 3583
480 Ga0207712_10024214 3300025961 Bacteria 4018
481 Ga0207640_10000404 3300025981 Bacteria 27391
482 Ga0207640_10001192 3300025981 Bacteria 14205
483 Ga0207640_10040222 3300025981 Bacteria 2964
484 Ga0207640_10053167 3300025981 Bacteria 2643
485 Ga0207640_10069913 3300025981 Bacteria 2359
486 Ga0207658_10003404 3300025986 Bacteria 11260
487 Ga0207658_10057702 3300025986 Bacteria 2886
488 Ga0207658_10106759 3300025986 Bacteria 2205
489 Ga0207677_10000905 3300026023 Bacteria 16619
490 Ga0207677_10117684 3300026023 Bacteria 1992
491 Ga0207703_10000933 3300026035 Bacteria 28397
492 Ga0207703_10013815 3300026035 Bacteria 6292
493 Ga0207703_10079833 3300026035 Bacteria 2724
494 Ga0207703_10278030 3300026035 Bacteria 1519
495 Ga0207639_10001273 3300026041 Bacteria 17019
496 Ga0207639_10021459 3300026041 Bacteria 4639
497 Ga0207639_10047095 3300026041 Bacteria 3256
498 Ga0207639_10197667 3300026041 Bacteria 1722
499 Ga0207678_10000681 3300026067 Bacteria 31104
500 Ga0207678_10003366 3300026067 Bacteria 14426
501 Ga0207678_10010854 3300026067 Bacteria 8006
502 Ga0207678_10012732 3300026067 Bacteria 7386
503 Ga0207678_10013063 3300026067 Bacteria 7285
504 Ga0207678_10013162 3300026067 Bacteria 7258
505 Ga0207678_10015058 3300026067 Bacteria 6804
506 Ga0207678_10179403 3300026067 Bacteria 1808
507 Ga0207678_10185774 3300026067 Bacteria 1775
508 Ga0207702_10000391 3300026078 Bacteria 49957
509 Ga0207702_10015887 3300026078 Bacteria 6233
510 Ga0207702_10026416 3300026078 Bacteria 4821
511 Ga0207702_10060817 3300026078 Bacteria 3220
512 Ga0207702_10077591 3300026078 Bacteria 2873
513 Ga0207702_10084531 3300026078 Bacteria 2763
514 Ga0207702_10147938 3300026078 Bacteria 2134
515 Ga0207702_10185500 3300026078 Bacteria 1918
516 Ga0207641_10000817 3300026088 Bacteria 33157
517 Ga0207641_10001015 3300026088 Bacteria 28538
518 Ga0207641_10053290 3300026088 Bacteria 3428
519 Ga0207641_10058993 3300026088 Bacteria 3267
520 Ga0207641_10146935 3300026088 Bacteria 2132
521 Ga0207648_10002058 3300026089 Bacteria 21922
522 Ga0207648_10015266 3300026089 Bacteria 7065
523 Ga0207648_10027466 3300026089 Bacteria 5051
524 Ga0207676_10000666 3300026095 Bacteria 27542
525 Ga0207676_10001889 3300026095 Bacteria 15314
526 Ga0207676_10012435 3300026095 Bacteria 6098
527 Ga0207676_10013953 3300026095 Bacteria 5767
528 Ga0207676_10092559 3300026095 Bacteria 2487
529 Ga0207674_10000244 3300026116 Bacteria 67590
530 Ga0207674_10004883 3300026116 Bacteria 16049
531 Ga0207674_10006854 3300026116 Bacteria 13359
532 Ga0207674_10010088 3300026116 Bacteria 10740
533 Ga0207674_10020867 3300026116 Bacteria 7069
534 Ga0207674_10028082 3300026116 Bacteria 5944
535 Ga0207674_10033668 3300026116 Bacteria 5363
536 Ga0207674_10064106 3300026116 Bacteria 3707
537 Ga0207674_10085920 3300026116 Bacteria 3140
538 Ga0207674_10128850 3300026116 Bacteria 2495
539 Ga0207675_100000154 3300026118 Bacteria 60483
540 Ga0207683_10001230 3300026121 Bacteria 23264
541 Ga0207683_10020679 3300026121 Bacteria 5631
542 Ga0207683_10029126 3300026121 Bacteria 4779
543 Ga0207683_10120897 3300026121 Bacteria 2351
544 Ga0207683_10205453 3300026121 Bacteria 1791
545 Ga0207698_10000394 3300026142 Bacteria 25237
546 Ga0207698_10000986 3300026142 Bacteria 16510
547 Ga0207698_10007443 3300026142 Bacteria 6855
548 Ga0207698_10015382 3300026142 Bacteria 5121
549 Ga0207698_10029761 3300026142 Bacteria 3916
550 Ga0207698_10041230 3300026142 Bacteria 3438
551 Ga0207698_10103137 3300026142 Bacteria 2370
552 Ga0207698_10108682 3300026142 Bacteria 2319
553 Ga0207698_10119446 3300026142 Bacteria 2228
554 Ga0207698_10198441 3300026142 Bacteria 1794
555 Ga0207698_10320120 3300026142 Bacteria 1452
556 Ga0268266_10000414 3300028379 Bacteria 65028
557 Ga0268266_10006064 3300028379 Bacteria 11139
558 Ga0268266_10019119 3300028379 Bacteria 5834
559 Ga0268266_10020464 3300028379 Bacteria 5639
560 Ga0268266_10025423 3300028379 Bacteria 5037
561 Ga0268265_10004462 3300028380 Bacteria 9704
562 Ga0268265_10009593 3300028380 Bacteria 6538
563 Ga0268265_10043225 3300028380 Bacteria 3348
564 Ga0268265_10048932 3300028380 Bacteria 3177
565 Ga0268265_10119030 3300028380 Bacteria 2172
566 Ga0268264_10007446 3300028381 Bacteria 9134
567 Ga0268264_10017800 3300028381 Bacteria 5817
568 Ga0268264_10032942 3300028381 Bacteria 4253
569 Ga0268264_10051140 3300028381 Bacteria 3442
570 Ga0307408_100021553 3300031548 Bacteria 4362
571 Ga0307408_100022859 3300031548 Bacteria 4254
572 Ga0307408_100068725 3300031548 Bacteria 2609
573 Ga0307408_100118878 3300031548 Bacteria 2044
574 Ga0307408_100139016 3300031548 Bacteria 1904
575 Ga0307408_100141395 3300031548 Bacteria 1890
576 Ga0307405_10004585 3300031731 Bacteria 6556
577 Ga0307405_10010353 3300031731 Bacteria 4826
578 Ga0307405_10022883 3300031731 Bacteria 3541
579 Ga0307405_10031737 3300031731 Bacteria 3113
580 Ga0307405_10054700 3300031731 Bacteria 2493
581 Ga0307405_10179988 3300031731 Bacteria 1517
582 Ga0307413_10007996 3300031824 Bacteria 4957
583 Ga0307413_10017144 3300031824 Bacteria 3766
584 Ga0307413_10036435 3300031824 Bacteria 2831
585 Ga0307413_10057000 3300031824 Bacteria 2386
586 Ga0307413_10070126 3300031824 Bacteria 2202
587 Ga0307413_10135352 3300031824 Bacteria 1693
588 Ga0307413_10170029 3300031824 Bacteria 1541
589 Ga0307410_10000411 3300031852 Bacteria 16975
590 Ga0307410_10001663 3300031852 Bacteria 10224
591 Ga0307410_10001930 3300031852 Bacteria 9725
592 Ga0307410_10005040 3300031852 Bacteria 6938
593 Ga0307410_10013390 3300031852 Bacteria 4784
594 Ga0307410_10019864 3300031852 Bacteria 4097
595 Ga0307410_10028488 3300031852 Bacteria 3544
596 Ga0307410_10047182 3300031852 Bacteria 2877
597 Ga0307410_10050226 3300031852 Bacteria 2803
598 Ga0307410_10063028 3300031852 Bacteria 2542
599 Ga0307410_10143819 3300031852 Bacteria 1767
600 Ga0307410_10225423 3300031852 Bacteria 1444
601 Ga0307406_10016033 3300031901 Bacteria 4347
602 Ga0307406_10022203 3300031901 Bacteria 3762
603 Ga0307406_10026333 3300031901 Bacteria 3490
604 Ga0307406_10129776 3300031901 Bacteria 1767
605 Ga0307407_10038623 3300031903 Bacteria 2647
606 Ga0307407_10042541 3300031903 Bacteria 2548
607 Ga0307407_10069254 3300031903 Bacteria 2093
608 Ga0307412_10008877 3300031911 Bacteria 5758
609 Ga0307412_10069822 3300031911 Bacteria 2393
610 Ga0307412_10100463 3300031911 Bacteria 2045
611 Ga0307409_100000126 3300031995 Bacteria 28589
612 Ga0307409_100013592 3300031995 Bacteria 5249
613 Ga0307409_100018477 3300031995 Bacteria 4689
614 Ga0307409_100024369 3300031995 Bacteria 4219
615 Ga0307409_100029327 3300031995 Bacteria 3936
616 Ga0307409_100043131 3300031995 Bacteria 3384
617 Ga0307409_100050920 3300031995 Bacteria 3166
618 Ga0307409_100072414 3300031995 Bacteria 2744
619 Ga0307409_100089058 3300031995 Bacteria 2521
620 Ga0307416_100033299 3300032002 Bacteria 3905
621 Ga0307416_100056360 3300032002 Bacteria 3171
622 Ga0307416_100059803 3300032002 Bacteria 3098
623 Ga0307416_100080192 3300032002 Bacteria 2754
624 Ga0307416_100088050 3300032002 Bacteria 2653
625 Ga0307414_10003535 3300032004 Bacteria 8360
626 Ga0307414_10011260 3300032004 Bacteria 5237
627 Ga0307414_10012124 3300032004 Bacteria 5084
628 Ga0307414_10014705 3300032004 Bacteria 4701
629 Ga0307414_10054354 3300032004 Bacteria 2798
630 Ga0307414_10065437 3300032004 Bacteria 2593
631 Ga0307414_10076988 3300032004 Bacteria 2426
632 Ga0307414_10085367 3300032004 Bacteria 2325
633 Ga0307414_10088268 3300032004 Bacteria 2294
634 Ga0307414_10099590 3300032004 Bacteria 2184
635 Ga0307414_10106235 3300032004 Bacteria 2124
636 Ga0307414_10133951 3300032004 Bacteria 1928
637 Ga0307414_10148156 3300032004 Bacteria 1847
638 Ga0307414_10226789 3300032004 Bacteria 1537
639 Ga0307411_10012766 3300032005 Bacteria 4602
640 Ga0307411_10015043 3300032005 Bacteria 4329
641 Ga0307411_10018822 3300032005 Bacteria 3973
642 Ga0307411_10041409 3300032005 Bacteria 2930
643 Ga0307411_10052369 3300032005 Bacteria 2668
644 Ga0307411_10057169 3300032005 Bacteria 2575
645 Ga0307411_10120109 3300032005 Bacteria 1899
646 Ga0307411_10129951 3300032005 Bacteria 1839
647 Ga0307411_10143768 3300032005 Bacteria 1762
648 Ga0307411_10145523 3300032005 Bacteria 1753
649 Ga0307411_10148807 3300032005 Bacteria 1737
650 Ga0307411_10163652 3300032005 Bacteria 1670
651 Ga0307411_10169601 3300032005 Bacteria 1644
652 Ga0307415_100003894 3300032126 Bacteria 7667
653 Ga0307415_100022325 3300032126 Bacteria 3902
654 Ga0307415_100150090 3300032126 Bacteria 1793
655 Ga0373943_0010492 3300035170 Bacteria 4151
656 Ga0373942_0018714 3300035207 Bacteria 1722
657 Ga0373935_0117361 3300035692 Bacteria 1774
658 Ga0373925_0005291 3300037068 Bacteria 9632
659 Ga0395899_0000132 3300037312 Bacteria 115455
660 Ga0395899_0001019 3300037312 Bacteria 25588
661 Ga0395899_0002681 3300037312 Bacteria 14350
662 Ga0395899_0011909 3300037312 Bacteria 6661
663 Ga0395899_0022870 3300037312 Bacteria 4736
664 Ga0395899_0030661 3300037312 Bacteria 4043
665 Ga0395899_0034654 3300037312 Bacteria 3791
666 Ga0395899_0046130 3300037312 Bacteria 3246
667 Ga0395899_0061799 3300037312 Bacteria 2758
668 Ga0395899_0086959 3300037312 Bacteria 2269
669 Ga0395899_0087043 3300037312 Bacteria 2268
670 Ga0395899_0115625 3300037312 Bacteria 1925
671 Ga0395899_0145786 3300037312 Bacteria 1681
672 Ga0395899_0154053 3300037312 Bacteria 1627
673 Ga0395900_0000075 3300037418 Bacteria 183525
674 Ga0395900_0000289 3300037418 Bacteria 75525
675 Ga0395900_0000477 3300037418 Bacteria 56791
676 Ga0395900_0001617 3300037418 Bacteria 26505
677 Ga0395900_0009867 3300037418 Bacteria 9780
678 Ga0395900_0016780 3300037418 Bacteria 7469
679 Ga0395900_0021363 3300037418 Bacteria 6617
680 Ga0395900_0022848 3300037418 Bacteria 6398
681 Ga0395900_0027658 3300037418 Bacteria 5809
682 Ga0395900_0031939 3300037418 Bacteria 5412
683 Ga0395900_0063046 3300037418 Bacteria 3810
684 Ga0395900_0067815 3300037418 Bacteria 3665
685 Ga0395900_0080090 3300037418 Bacteria 3356
686 Ga0395900_0090896 3300037418 Bacteria 3137
687 Ga0395900_0098116 3300037418 Bacteria 3010
688 Ga0395900_0102405 3300037418 Bacteria 2941
689 Ga0395900_0130015 3300037418 Bacteria 2581
690 Ga0395900_0146245 3300037418 Bacteria 2416
691 Ga0395900_0149131 3300037418 Bacteria 2390
692 Ga0395900_0179058 3300037418 Bacteria 2155
693 Ga0395900_0192559 3300037418 Bacteria 2067
694 Ga0395900_0211288 3300037418 Bacteria 1959
695 Ga0395900_0211525 3300037418 Bacteria 1958
696 Ga0395900_0221931 3300037418 Bacteria 1904
697 Ga0395900_0251524 3300037418 Bacteria 1768
698 Ga0395900_0297197 3300037418 Bacteria 1602
699 Ga0395898_0000055 3300037466 Bacteria 278557
700 Ga0395898_0000898 3300037466 Bacteria 47961
701 Ga0395898_0011944 3300037466 Bacteria 8994
702 Ga0395898_0020318 3300037466 Bacteria 6745
703 Ga0395898_0025357 3300037466 Bacteria 5975
704 Ga0395898_0033668 3300037466 Bacteria 5111
705 Ga0395898_0042212 3300037466 Bacteria 4501
706 Ga0395898_0063311 3300037466 Bacteria 3589
707 Ga0395898_0227645 3300037466 Bacteria 1778
708 Ga0395905_0000067 3300037471 Bacteria 181887
709 Ga0395905_0000204 3300037471 Bacteria 92152
710 Ga0395905_0001128 3300037471 Bacteria 33451
711 Ga0395905_0002395 3300037471 Bacteria 20868
712 Ga0395905_0009949 3300037471 Bacteria 9266
713 Ga0395905_0011713 3300037471 Bacteria 8465
714 Ga0395905_0012837 3300037471 Bacteria 8054
715 Ga0395905_0019289 3300037471 Bacteria 6465
716 Ga0395905_0023614 3300037471 Bacteria 5807
717 Ga0395905_0035877 3300037471 Bacteria 4656
718 Ga0395905_0054494 3300037471 Bacteria 3742
719 Ga0395905_0073577 3300037471 Bacteria 3203
720 Ga0395905_0075407 3300037471 Bacteria 3161
721 Ga0395905_0095544 3300037471 Bacteria 2789
722 Ga0395905_0102026 3300037471 Bacteria 2693
723 Ga0395905_0169737 3300037471 Bacteria 2049
724 Ga0395905_0212021 3300037471 Bacteria 1814
725 Ga0395905_0332764 3300037471 Bacteria 1409
726 Ga0395901_0000208 3300038443 Bacteria 73874
727 Ga0395901_0000648 3300038443 Bacteria 40227
728 Ga0395901_0001244 3300038443 Bacteria 27197
729 Ga0395901_0002867 3300038443 Bacteria 17407
730 Ga0395901_0009196 3300038443 Bacteria 10011
731 Ga0395901_0013298 3300038443 Bacteria 8360
732 Ga0395901_0020133 3300038443 Bacteria 6827
733 Ga0395901_0026895 3300038443 Bacteria 5906
734 Ga0395901_0027910 3300038443 Bacteria 5804
735 Ga0395901_0033661 3300038443 Bacteria 5291
736 Ga0395901_0084033 3300038443 Bacteria 3327
737 Ga0395901_0109785 3300038443 Bacteria 2896
738 Ga0395901_0114584 3300038443 Bacteria 2831
739 Ga0395901_0194919 3300038443 Bacteria 2124
740 Ga0395901_0241635 3300038443 Bacteria 1883
741 Ga0395901_0355197 3300038443 Bacteria 1512
742 Ga0395901_0378857 3300038443 Bacteria 1456
743 Ga0395901_0412374 3300038443 Bacteria 1386
744 Ga0436365_0024047 3300039437 Bacteria 2286
745 Ga0436365_0546549 3300039437 Bacteria 13799
746 Ga0436365_0636584 3300039437 Bacteria 8099
747 Ga0436365_1104251 3300039437 Bacteria 95104
748 Ga0436363_1592812 3300039450 Bacteria 1781
749 Ga0439466_0020549 3300041411 Bacteria 2352
750 Ga0439431_0000643 3300041997 Bacteria 7429
751 Ga0439442_000926 3300042002 Bacteria 5959
752 Ga0439432_000868 3300042006 Bacteria 11320
753 Ga0439432_005945 3300042006 Bacteria 4380
754 Ga0439449_0012363 3300042007 Bacteria 3210
755 Ga0439462_0030757 3300042015 Bacteria 1420
756 Ga0450889_000032 3300042144 Bacteria 11898
757 Ga0439458_0004126 3300042157 Bacteria 3350
758 Ga0439434_0000800 3300042435 Bacteria 9069
759 Ga0466969_0007655 3300044656 Bacteria 5741
760 Ga0466966_0000010 3300044684 Bacteria 150868
761 Ga0466966_0007224 3300044684 Bacteria 7362
762 Ga0466966_0043747 3300044684 Bacteria 2869
763 Ga0466966_0070027 3300044684 Bacteria 2199
764 Ga0466966_0171397 3300044684 Bacteria 1319
765 Ga0466961_0097377 3300044693 Bacteria 1855
766 Ga0466963_0002563 3300044694 Bacteria 10193
767 Ga0466963_0003212 3300044694 Bacteria 9298
768 Ga0466963_0042133 3300044694 Bacteria 2997
769 Ga0466964_0004943 3300044706 Bacteria 4927
770 Ga0466964_0033921 3300044706 Bacteria 2035
771 Ga0466970_0008642 3300044765 Bacteria 5132
772 Ga0466970_0043837 3300044765 Bacteria 2381
773 Ga0466970_0073353 3300044765 Bacteria 1842
774 Ga0466957_0002570 3300044842 Bacteria 9769
775 Ga0466957_0066677 3300044842 Bacteria 2220
776 Ga0466960_0053920 3300044901 Bacteria 1950
777 Ga0466959_0004427 3300045049 Bacteria 9409
778 Ga0466959_0022664 3300045049 Bacteria 4643
779 Ga0466959_0086537 3300045049 Bacteria 2254
780 Ga0466959_0110833 3300045049 Bacteria 1959
781 Ga0466959_0155320 3300045049 Bacteria 1611
782 Ga0466958_0030302 3300045836 Bacteria 3213
783 Ga0466958_0145914 3300045836 Bacteria 1491
784 Ga0466967_0025320 3300045976 Bacteria 4891
785 Ga0466967_0153631 3300045976 Bacteria 2154
786 Ga0466967_0178338 3300045976 Bacteria 2002
787 Ga0466967_0211239 3300045976 Bacteria 1841
788 Ga0466967_0237983 3300045976 Bacteria 1735
789 Ga0466967_0276487 3300045976 Bacteria 1610
790 Ga0466967_0343206 3300045976 Bacteria 1444
791 Ga0466967_0353307 3300045976 Bacteria 1423
792 Ga0495663_0003736 3300046525 Bacteria 4347
793 Ga0495663_0009624 3300046525 Bacteria 2680
794 Ga0495642_0044198 3300046528 Bacteria 1818
795 Ga0495598_0001164 3300046537 Bacteria 5078
796 Ga0495621_0000179 3300046539 Bacteria 14449
797 Ga0495621_0003583 3300046539 Bacteria 4286
798 Ga0495633_0003748 3300046558 Bacteria 9994
799 Ga0495633_0033264 3300046558 Bacteria 2487
800 Ga0495668_0005101 3300046616 Bacteria 9031
801 Ga0495668_0074606 3300046616 Bacteria 1862
802 Ga0495625_0029408 3300046660 Bacteria 4110
803 Ga0495669_0007585 3300046684 Bacteria 4550
804 Ga0495669_0020214 3300046684 Bacteria 2880
805 Ga0495669_0037026 3300046684 Bacteria 2158
806 Ga0495669_0037993 3300046684 Bacteria 2132
807 Ga0495669_0074629 3300046684 Bacteria 1551
808 Ga0495670_0000004 3300046691 Bacteria 310086
809 Ga0495670_0002449 3300046691 Bacteria 9172
810 Ga0495670_0016058 3300046691 Bacteria 3680
811 Ga0495670_0025750 3300046691 Bacteria 2910
812 Ga0496101_0008722 3300048904 Bacteria 6629
813 Ga0496102_0223635 3300048905 Bacteria 1775
814 Ga0496103_0091785 3300048906 Bacteria 1917
815 Ga0496106_0103099 3300048909 Bacteria 2214
816 Ga0496107_0006177 3300048910 Bacteria 8229
817 Ga0496107_0024175 3300048910 Bacteria 4298
818 Ga0496107_0062848 3300048910 Bacteria 2690
819 Ga0496108_0014020 3300048911 Bacteria 6540
820 Ga0496108_0017557 3300048911 Bacteria 5855
821 Ga0496108_0018531 3300048911 Bacteria 5701
822 Ga0496108_0018850 3300048911 Bacteria 5658
823 Ga0496109_0002106 3300048912 Bacteria 16540
824 Ga0496109_0046383 3300048912 Bacteria 3947
825 Ga0496109_0048948 3300048912 Bacteria 3846
826 Ga0496109_0130518 3300048912 Bacteria 2345
827 Ga0496109_0330987 3300048912 Bacteria 1438
828 Ga0496109_0362724 3300048912 Bacteria 1369
829 Ga0496110_0001399 3300048913 Bacteria 17437
830 Ga0496110_0001805 3300048913 Bacteria 15773
831 Ga0496110_0009949 3300048913 Bacteria 7711
832 Ga0496110_0023051 3300048913 Bacteria 5294
833 Ga0496110_0172222 3300048913 Bacteria 1964
834 Ga0496111_0002670 3300048914 Bacteria 10830
835 Ga0496112_0000546 3300048915 Bacteria 25800
836 Ga0496112_0061375 3300048915 Bacteria 3705
837 Ga0496112_0086565 3300048915 Bacteria 3100
838 Ga0496112_0260212 3300048915 Bacteria 1684
839 Ga0496113_0007254 3300048916 Bacteria 7109
840 Ga0496113_0051969 3300048916 Bacteria 3059
841 Ga0496113_0082117 3300048916 Bacteria 2471
842 Ga0496114_0088021 3300048917 Bacteria 2634
843 Ga0496114_0216521 3300048917 Bacteria 1681
844 Ga0496115_0013299 3300048918 Bacteria 6223
845 Ga0496123_0022908 3300048926 Bacteria 4797
846 Ga0496123_0053333 3300048926 Bacteria 2673
847 Ga0496124_0000186 3300048927 Bacteria 123307
848 Ga0496124_0001152 3300048927 Bacteria 41432
849 Ga0496124_0010571 3300048927 Bacteria 9332
850 Ga0496125_0004150 3300048928 Bacteria 16894
851 Ga0496126_0000733 3300048929 Bacteria 59621
852 Ga0501034_0255766 3300049571 Bacteria 1695
853 Ga0501070_0018414 3300049586 Bacteria 5859
854 Ga0501217_010627 3300049661 Bacteria 2020
855 Ga0501223_005950 3300049663 Bacteria 2543
856 Ga0501233_008538 3300049668 Bacteria 1977
857 Ga0501225_0014779 3300049705 Bacteria 2177
858 Ga0501241_014988 3300049758 Bacteria 1409
859 Ga0501204_002627 3300049850 Bacteria 1838
860 nmdc:mga06r32_38212_c1 3300050510 Bacteria 4546
861 nmdc:mga0n895_129274_c1 3300050512 Bacteria 2550
862 nmdc:mga0n895_269101_c1 3300050512 Bacteria 1729
863 nmdc:mga0a205_2429_c1 3300050515 Bacteria 16427
864 Ga0495655_0008165 3300053083 Bacteria 1978
865 Ga0500566_0028830 3300053094 Bacteria 3242
866 Ga0500573_0000016 3300053140 Bacteria 182675
867 Ga0466962_0009757 3300061719 Bacteria 4605
868 2511124029 2510917020 Bacteria 5657507
869 2600201678 2599185354 Bacteria 4398675
870 2600224888 2599185359 Bacteria 4772316
871 2644126924 2643221622 Bacteria 4212502
872 2753767902 2751185897 Bacteria 5322941
873 2819713082 2818991466 Bacteria 4748179
874 2830076062 2830075706 Bacteria 3855215
875 2879165673 2879163058 Bacteria 4223965
876 2896429585 2896429255 Bacteria 2557483
877 2928027492 2928027323 Bacteria 4382488
878 2928527621 2928526807 Bacteria 4760224
879 2928971744 2928968154 Bacteria 4633371
880 2946788640 2946787523 Bacteria 4366789
881 2984558207 2984555340 Bacteria 4247089
882 2984567414 2984564862 Bacteria 4339992
883 2990268688 2990265787 Bacteria 3943888
884 2993358479 2993356040 Bacteria 4247105
885 2993694605 2993693658 Bacteria 4040749
886 Ga0307409_100098841
887 ARcpr5oldR_c003416
888 JGI24736J21556_1000361
889 JGI24740J21852_10016319
890 JGI24740J21852_10025735
891 JGI24739J22299_10000035
892 JGI24739J22299_10023017
893 JGI24737J22298_10000020
894 JGI24737J22298_10007189
895 JGI24737J22298_10023224
896 JGI24735J21928_10014192
897 JGI24738J21930_10000048
898 JGI24738J21930_10007423
899 Ga0055524_1000351
900 Ga0055530_10000144
901 Ga0055531_10000188
902 Ga0055531_10019042
903 Ga0070658_10000220
904 Ga0070658_10000264
905 Ga0070658_10002220
906 Ga0070658_10015611
907 Ga0070658_10045810
908 Ga0070658_10074692
909 Ga0070658_10077096
910 Ga0070676_10008339
911 Ga0070683_100009023
912 Ga0070683_100011883
913 Ga0070683_100036805
914 Ga0070683_100133841
915 Ga0070670_100009146
916 Ga0070670_100021908
917 Ga0070670_100028039
918 Ga0070670_100033024
919 Ga0070670_100033080
920 Ga0070670_100045987
921 Ga0070670_100046834
922 Ga0070670_100054617
923 Ga0070670_100071120
924 Ga0070670_100131084
925 Ga0070670_100141532
926 Ga0070677_10000460
927 Ga0070677_10000776
928 Ga0068869_100000043
929 Ga0070666_10001568
930 Ga0070666_10036747
931 Ga0070666_10049979
932 Ga0070680_100000406
933 Ga0070680_100015034
934 Ga0070680_100060976
935 Ga0070680_100123262
936 Ga0070680_100125407
937 Ga0070680_100281703
938 Ga0070682_100060468
939 Ga0070682_100084418
940 Ga0068868_100000957
941 Ga0070660_100000091
942 Ga0070660_100000218
943 Ga0070660_100000415
944 Ga0070660_100008260
945 Ga0070660_100018258
946 Ga0070660_100026322
947 Ga0070660_100028865
948 Ga0070660_100062331
949 Ga0070689_100024220
950 Ga0070691_10006893
951 Ga0070687_100064342
952 Ga0070661_100000181
953 Ga0070661_100018437
954 Ga0070661_100019737
955 Ga0070661_100026891
956 Ga0070661_100027478
957 Ga0070661_100038040
958 Ga0070692_10003786
959 Ga0070692_10006331
960 Ga0070692_10006444
961 Ga0070692_10026911
962 Ga0070668_100005171
963 Ga0070669_100000209
964 Ga0070669_100072542
965 Ga0070675_100003209
966 Ga0070675_100028103
967 Ga0070675_100053098
968 Ga0070675_100080480
969 Ga0070671_100000946
970 Ga0070671_100002968
971 Ga0070671_100012684
972 Ga0070671_100024791
973 Ga0070671_100025393
974 Ga0070671_100027296
975 Ga0070671_100045117
976 Ga0070671_100048574
977 Ga0070671_100102513
978 Ga0070674_100042634
979 Ga0070674_100099248
980 Ga0070673_100000354
981 Ga0070673_100008820
982 Ga0070673_100017737
983 Ga0070673_100041312
984 Ga0070659_100000310
985 Ga0070659_100000463
986 Ga0070659_100010426
987 Ga0070659_100032895
988 Ga0070659_100090425
989 Ga0070659_100143964
990 Ga0070659_100170636
991 Ga0070667_100020045
992 Ga0070667_100020452
993 Ga0070667_100048276
994 Ga0070667_100068583
995 Ga0070713_100020766
996 Ga0070713_100085671
997 Ga0070663_100000991
998 Ga0070663_100007128
999 Ga0070663_100008110
1000 Ga0070663_100077759
1001 Ga0070663_100108360
1002 Ga0070663_100112765
1003 Ga0070663_100127369
1004 Ga0070663_100237344
1005 Ga0070678_100008935
1006 Ga0070678_100022943
1007 Ga0070678_100093552
1008 Ga0070678_100111605
1009 Ga0070678_100127384
1010 Ga0070662_100000080
1011 Ga0070662_100000754
1012 Ga0070662_100004660
1013 Ga0070662_100007202
1014 Ga0070662_100015854
1015 Ga0070662_100017439
1016 Ga0070662_100022342
1017 Ga0070662_100029969
1018 Ga0070662_100050500
1019 Ga0070662_100158421
1020 Ga0070681_10038880
1021 Ga0070681_10041232
1022 Ga0068867_100008883
1023 Ga0068867_100014754
1024 Ga0068867_100029006
1025 Ga0070679_100025521
1026 Ga0070684_100016504
1027 Ga0070684_100030299
1028 Ga0068853_100000134
1029 Ga0068853_100001421
1030 Ga0068853_100040321
1031 Ga0068853_100083647
1032 Ga0068853_100102504
1033 Ga0070672_100000380
1034 Ga0070672_100016111
1035 Ga0070672_100064233
1036 Ga0070672_100077256
1037 Ga0070696_100016806
1038 Ga0070693_100000536
1039 Ga0070693_100061774
1040 Ga0070665_100000054
1041 Ga0070665_100023191
1042 Ga0070665_100028342
1043 Ga0070665_100067607
1044 Ga0070665_100116472
1045 Ga0068855_100000129
1046 Ga0068855_100000780
1047 Ga0068855_100044279
1048 Ga0068855_100047304
1049 Ga0068855_100052397
1050 Ga0068855_100073049
1051 Ga0068855_100206491
1052 Ga0070664_100000047
1053 Ga0070664_100003329
1054 Ga0070664_100012056
1055 Ga0070664_100024362
1056 Ga0070664_100052616
1057 Ga0070664_100157749
1058 Ga0070664_100173301
1059 Ga0068857_100007558
1060 Ga0068857_100023330
1061 Ga0068857_100034442
1062 Ga0068857_100046735
1063 Ga0068857_100179196
1064 Ga0068854_100000414
1065 Ga0068854_100026433
1066 Ga0068854_100032791
1067 Ga0068854_100056555
1068 Ga0068854_100121723
1069 Ga0068854_100166436
1070 Ga0068854_100180451
1071 Ga0068856_100001328
1072 Ga0068856_100029171
1073 Ga0068856_100040215
1074 Ga0068856_100091223
1075 Ga0068856_100113303
1076 Ga0068852_100000798
1077 Ga0068852_100002050
1078 Ga0068852_100002251
1079 Ga0068852_100010705
1080 Ga0068852_100048328
1081 Ga0068852_100086847
1082 Ga0068852_100110050
1083 Ga0068852_100152921
1084 Ga0068859_100003417
1085 Ga0068859_100004856
1086 Ga0068859_100008232
1087 Ga0068859_100251848
1088 Ga0068864_100000181
1089 Ga0068864_100000652
1090 Ga0068864_100001327
1091 Ga0068864_100006134
1092 Ga0068864_100038107
1093 Ga0068864_100106455
1094 Ga0068864_100115478
1095 Ga0068866_10006592
1096 Ga0068866_10019163
1097 Ga0068861_100000036
1098 Ga0068851_10002516
1099 Ga0068851_10043372
1100 Ga0068863_100003734
1101 Ga0068863_100004126
1102 Ga0068863_100013157
1103 Ga0068863_100044951
1104 Ga0068863_100064625
1105 Ga0068863_100149391
1106 Ga0068858_100005075
1107 Ga0068858_100019868
1108 Ga0068858_100080601
1109 Ga0068858_100105442
1110 Ga0068860_100002079
1111 Ga0068860_100021050
1112 Ga0068860_100087843
1113 Ga0068860_100137300
1114 Ga0068862_100005042
1115 Ga0068862_100013934
1116 Ga0068862_100088938
1117 Ga0068862_100089198
1118 Ga0068862_100107130
1119 Ga0081539_10013055
1120 Ga0081539_10056537
1121 Ga0070717_10022023
1122 Ga0070717_10065554
1123 Ga0097621_100088259
1124 Ga0097621_100108627
1125 Ga0068871_100051389
1126 Ga0068871_100066219
1127 Ga0075431_100068229
1128 Ga0075433_10022184
1129 Ga0068865_100002737
1130 Ga0068865_100068973
1131 Ga0097620_100003417
1132 Ga0097620_100004857
1133 Ga0097620_100008232
1134 Ga0105250_10009470
1135 Ga0105240_10010591
1136 Ga0105240_10085341
1137 Ga0105240_10141777
1138 Ga0105245_10003294
1139 Ga0105245_10009900
1140 Ga0105245_10062190
1141 Ga0105245_10303719
1142 Ga0105241_10154089
1143 Ga0105242_10028920
1144 Ga0105248_10000256
1145 Ga0105248_10000276
1146 Ga0105248_10002271
1147 Ga0105248_10004379
1148 Ga0105248_10016393
1149 Ga0105248_10072344
1150 Ga0105248_10111509
1151 Ga0105248_10277806
1152 Ga0105248_10470140
1153 Ga0105237_10014619
1154 Ga0105237_10035296
1155 Ga0105238_10009452
1156 Ga0105238_10010235
1157 Ga0105238_10021875
1158 Ga0105238_10034298
1159 Ga0105238_10035247
1160 Ga0105238_10152158
1161 Ga0105249_10022753
1162 Ga0105246_10002855
1163 Ga0105246_10036076
1164 Ga0157373_10007891
1165 Ga0157373_10009719
1166 Ga0157373_10025323
1167 Ga0157373_10031157
1168 Ga0157373_10115444
1169 Ga0157373_10151746
1170 Ga0157373_10196427
1171 Ga0157371_10005808
1172 Ga0157371_10006963
1173 Ga0157371_10012737
1174 Ga0157371_10064850
1175 Ga0157371_10085466
1176 Ga0157371_10085664
1177 Ga0157371_10173760
1178 Ga0157370_10024160
1179 Ga0157370_10093538
1180 Ga0157369_10000256
1181 Ga0157369_10002909
1182 Ga0157369_10071182
1183 Ga0157369_10116877
1184 Ga0157369_10127279
1185 Ga0157369_10162123
1186 Ga0157369_10171283
1187 Ga0157369_10218804
1188 Ga0157369_10263447
1189 Ga0157374_10007006
1190 Ga0157378_10009565
1191 Ga0163162_10031161
1192 Ga0163162_10057952
1193 Ga0163162_10136067
1194 Ga0157372_10042552
1195 Ga0157372_10087129
1196 Ga0157372_10368297
1197 Ga0157375_10117638
1198 Ga0157375_10133810
1199 Ga0163163_10001248
1200 Ga0163163_10002058
1201 Ga0157379_10009412
1202 Ga0183363_1003
1203 Ga0213876_10002881
1204 Ga0213876_10004001
1205 Ga0213876_10004890
1206 Ga0209565_1000012
1207 Ga0209673_1002916
1208 Ga0209758_1014215
1209 Ga0209050_1000010
1210 Ga0209050_1006599
1211 Ga0209256_1000012
1212 Ga0209257_1000009
1213 Ga0209257_1002618
1214 Ga0209257_1008681
1215 Ga0207697_10000007
1216 Ga0207656_10031657
1217 Ga0207682_10000990
1218 Ga0207688_10000318
1219 Ga0207680_10002818
1220 Ga0207680_10137738
1221 Ga0207647_10000052
1222 Ga0207647_10002807
1223 Ga0207647_10004040
1224 Ga0207647_10004972
1225 Ga0207647_10007015
1226 Ga0207647_10017277
1227 Ga0207647_10022358
1228 Ga0207647_10096726
1229 Ga0207643_10023313
1230 Ga0207705_10000003
1231 Ga0207705_10000091
1232 Ga0207705_10000164
1233 Ga0207705_10008160
1234 Ga0207705_10013215
1235 Ga0207705_10016261
1236 Ga0207705_10025987
1237 Ga0207705_10034518
1238 Ga0207705_10052020
1239 Ga0207705_10093022
1240 Ga0207705_10140640
1241 Ga0207705_10145941
1242 Ga0207705_10150601
1243 Ga0207654_10169330
1244 Ga0207707_10011788
1245 Ga0207707_10079403
1246 Ga0207695_10018139
1247 Ga0207695_10195379
1248 Ga0207671_10072953
1249 Ga0207660_10000515
1250 Ga0207660_10018580
1251 Ga0207660_10037917
1252 Ga0207660_10072371
1253 Ga0207657_10000090
1254 Ga0207657_10000092
1255 Ga0207657_10000252
1256 Ga0207657_10002608
1257 Ga0207657_10002996
1258 Ga0207657_10006356
1259 Ga0207657_10021378
1260 Ga0207657_10021511
1261 Ga0207657_10025279
1262 Ga0207657_10039639
1263 Ga0207657_10049207
1264 Ga0207657_10062635
1265 Ga0207657_10100874
1266 Ga0207657_10113188
1267 Ga0207657_10128074
1268 Ga0207649_10000324
1269 Ga0207649_10003256
1270 Ga0207649_10022792
1271 Ga0207649_10062731
1272 Ga0207649_10068631
1273 Ga0207649_10076008
1274 Ga0207652_10005656
1275 Ga0207652_10077375
1276 Ga0207652_10125035
1277 Ga0207681_10001637
1278 Ga0207681_10045124
1279 Ga0207694_10002074
1280 Ga0207694_10013642
1281 Ga0207650_10006298
1282 Ga0207650_10026898
1283 Ga0207650_10089581
1284 Ga0207650_10153112
1285 Ga0207659_10009713
1286 Ga0207659_10022318
1287 Ga0207659_10119291
1288 Ga0207659_10190505
1289 Ga0207687_10001182
1290 Ga0207687_10074809
1291 Ga0207700_10044939
1292 Ga0207664_10070301
1293 Ga0207644_10000960
1294 Ga0207644_10001690
1295 Ga0207644_10003068
1296 Ga0207644_10013613
1297 Ga0207644_10145751
1298 Ga0207690_10000184
1299 Ga0207690_10000463
1300 Ga0207690_10004224
1301 Ga0207690_10022380
1302 Ga0207690_10045185
1303 Ga0207690_10082109
1304 Ga0207690_10166858
1305 Ga0207706_10000110
1306 Ga0207706_10000705
1307 Ga0207706_10002377
1308 Ga0207706_10004248
1309 Ga0207706_10004820
1310 Ga0207706_10016933
1311 Ga0207706_10017389
1312 Ga0207706_10027566
1313 Ga0207706_10036885
1314 Ga0207706_10043467
1315 Ga0207706_10045339
1316 Ga0207706_10068218
1317 Ga0207670_10026192
1318 Ga0207669_10020498
1319 Ga0207704_10007674
1320 Ga0207691_10001179
1321 Ga0207691_10006830
1322 Ga0207691_10015481
1323 Ga0207691_10025389
1324 Ga0207691_10050326
1325 Ga0207691_10089990
1326 Ga0207711_10000586
1327 Ga0207711_10000922
1328 Ga0207711_10001460
1329 Ga0207711_10001669
1330 Ga0207711_10007771
1331 Ga0207711_10010179
1332 Ga0207711_10014091
1333 Ga0207711_10022743
1334 Ga0207711_10086054
1335 Ga0207711_10177036
1336 Ga0207689_10000014
1337 Ga0207689_10000840
1338 Ga0207689_10089510
1339 Ga0207689_10125762
1340 Ga0207661_10000179
1341 Ga0207661_10001420
1342 Ga0207661_10078905
1343 Ga0207661_10109447
1344 Ga0207661_10111803
1345 Ga0207679_10000329
1346 Ga0207679_10006275
1347 Ga0207679_10010964
1348 Ga0207679_10013820
1349 Ga0207679_10025379
1350 Ga0207679_10038207
1351 Ga0207679_10059770
1352 Ga0207679_10065804
1353 Ga0207679_10131241
1354 Ga0207679_10201529
1355 Ga0207667_10000303
1356 Ga0207667_10003943
1357 Ga0207667_10017917
1358 Ga0207667_10213795
1359 Ga0207667_10240147
1360 Ga0207651_10002150
1361 Ga0207651_10008275
1362 Ga0207651_10010582
1363 Ga0207651_10021255
1364 Ga0207651_10027315
1365 Ga0207712_10024214
1366 Ga0207640_10000404
1367 Ga0207640_10001192
1368 Ga0207640_10040222
1369 Ga0207640_10053167
1370 Ga0207640_10069913
1371 Ga0207658_10003404
1372 Ga0207658_10057702
1373 Ga0207658_10106759
1374 Ga0207677_10000905
1375 Ga0207677_10117684
1376 Ga0207703_10000933
1377 Ga0207703_10013815
1378 Ga0207703_10079833
1379 Ga0207703_10278030
1380 Ga0207639_10001273
1381 Ga0207639_10021459
1382 Ga0207639_10047095
1383 Ga0207639_10197667
1384 Ga0207678_10000681
1385 Ga0207678_10003366
1386 Ga0207678_10010854
1387 Ga0207678_10012732
1388 Ga0207678_10013063
1389 Ga0207678_10013162
1390 Ga0207678_10015058
1391 Ga0207678_10179403
1392 Ga0207678_10185774
1393 Ga0207702_10000391
1394 Ga0207702_10015887
1395 Ga0207702_10026416
1396 Ga0207702_10060817
1397 Ga0207702_10077591
1398 Ga0207702_10084531
1399 Ga0207702_10147938
1400 Ga0207702_10185500
1401 Ga0207641_10000817
1402 Ga0207641_10001015
1403 Ga0207641_10053290
1404 Ga0207641_10058993
1405 Ga0207641_10146935
1406 Ga0207648_10002058
1407 Ga0207648_10015266
1408 Ga0207648_10027466
1409 Ga0207676_10000666
1410 Ga0207676_10001889
1411 Ga0207676_10012435
1412 Ga0207676_10013953
1413 Ga0207676_10092559
1414 Ga0207674_10000244
1415 Ga0207674_10004883
1416 Ga0207674_10006854
1417 Ga0207674_10010088
1418 Ga0207674_10020867
1419 Ga0207674_10028082
1420 Ga0207674_10033668
1421 Ga0207674_10064106
1422 Ga0207674_10085920
1423 Ga0207674_10128850
1424 Ga0207675_100000154
1425 Ga0207683_10001230
1426 Ga0207683_10020679
1427 Ga0207683_10029126
1428 Ga0207683_10120897
1429 Ga0207683_10205453
1430 Ga0207698_10000394
1431 Ga0207698_10000986
1432 Ga0207698_10007443
1433 Ga0207698_10015382
1434 Ga0207698_10029761
1435 Ga0207698_10041230
1436 Ga0207698_10103137
1437 Ga0207698_10108682
1438 Ga0207698_10119446
1439 Ga0207698_10198441
1440 Ga0207698_10320120
1441 Ga0268266_10000414
1442 Ga0268266_10006064
1443 Ga0268266_10019119
1444 Ga0268266_10020464
1445 Ga0268266_10025423
1446 Ga0268265_10004462
1447 Ga0268265_10009593
1448 Ga0268265_10043225
1449 Ga0268265_10048932
1450 Ga0268265_10119030
1451 Ga0268264_10007446
1452 Ga0268264_10017800
1453 Ga0268264_10032942
1454 Ga0268264_10051140
1455 Ga0307408_100021553
1456 Ga0307408_100022859
1457 Ga0307408_100068725
1458 Ga0307408_100118878
1459 Ga0307408_100139016
1460 Ga0307408_100141395
1461 Ga0307405_10004585
1462 Ga0307405_10010353
1463 Ga0307405_10022883
1464 Ga0307405_10031737
1465 Ga0307405_10054700
1466 Ga0307405_10179988
1467 Ga0307413_10007996
1468 Ga0307413_10017144
1469 Ga0307413_10036435
1470 Ga0307413_10057000
1471 Ga0307413_10070126
1472 Ga0307413_10135352
1473 Ga0307413_10170029
1474 Ga0307410_10000411
1475 Ga0307410_10001663
1476 Ga0307410_10001930
1477 Ga0307410_10005040
1478 Ga0307410_10013390
1479 Ga0307410_10019864
1480 Ga0307410_10028488
1481 Ga0307410_10047182
1482 Ga0307410_10050226
1483 Ga0307410_10063028
1484 Ga0307410_10143819
1485 Ga0307410_10225423
1486 Ga0307406_10016033
1487 Ga0307406_10022203
1488 Ga0307406_10026333
1489 Ga0307406_10129776
1490 Ga0307407_10038623
1491 Ga0307407_10042541
1492 Ga0307407_10069254
1493 Ga0307412_10008877
1494 Ga0307412_10069822
1495 Ga0307412_10100463
1496 Ga0307409_100000126
1497 Ga0307409_100013592
1498 Ga0307409_100018477
1499 Ga0307409_100024369
1500 Ga0307409_100029327
1501 Ga0307409_100043131
1502 Ga0307409_100050920
1503 Ga0307409_100072414
1504 Ga0307409_100089058
1505 Ga0307416_100033299
1506 Ga0307416_100056360
1507 Ga0307416_100059803
1508 Ga0307416_100080192
1509 Ga0307416_100088050
1510 Ga0307414_10003535
1511 Ga0307414_10011260
1512 Ga0307414_10012124
1513 Ga0307414_10014705
1514 Ga0307414_10054354
1515 Ga0307414_10065437
1516 Ga0307414_10076988
1517 Ga0307414_10085367
1518 Ga0307414_10088268
1519 Ga0307414_10099590
1520 Ga0307414_10106235
1521 Ga0307414_10133951
1522 Ga0307414_10148156
1523 Ga0307414_10226789
1524 Ga0307411_10012766
1525 Ga0307411_10015043
1526 Ga0307411_10018822
1527 Ga0307411_10041409
1528 Ga0307411_10052369
1529 Ga0307411_10057169
1530 Ga0307411_10120109
1531 Ga0307411_10129951
1532 Ga0307411_10143768
1533 Ga0307411_10145523
1534 Ga0307411_10148807
1535 Ga0307411_10163652
1536 Ga0307411_10169601
1537 Ga0307415_100003894
1538 Ga0307415_100022325
1539 Ga0307415_100150090
1540 Ga0373943_0010492
1541 Ga0373942_0018714
1542 Ga0373935_0117361
1543 Ga0373925_0005291
1544 Ga0395899_0000132
1545 Ga0395899_0001019
1546 Ga0395899_0002681
1547 Ga0395899_0011909
1548 Ga0395899_0022870
1549 Ga0395899_0030661
1550 Ga0395899_0034654
1551 Ga0395899_0046130
1552 Ga0395899_0061799
1553 Ga0395899_0086959
1554 Ga0395899_0087043
1555 Ga0395899_0115625
1556 Ga0395899_0145786
1557 Ga0395899_0154053
1558 Ga0395900_0000075
1559 Ga0395900_0000289
1560 Ga0395900_0000477
1561 Ga0395900_0001617
1562 Ga0395900_0009867
1563 Ga0395900_0016780
1564 Ga0395900_0021363
1565 Ga0395900_0022848
1566 Ga0395900_0027658
1567 Ga0395900_0031939
1568 Ga0395900_0063046
1569 Ga0395900_0067815
1570 Ga0395900_0080090
1571 Ga0395900_0090896
1572 Ga0395900_0098116
1573 Ga0395900_0102405
1574 Ga0395900_0130015
1575 Ga0395900_0146245
1576 Ga0395900_0149131
1577 Ga0395900_0179058
1578 Ga0395900_0192559
1579 Ga0395900_0211288
1580 Ga0395900_0211525
1581 Ga0395900_0221931
1582 Ga0395900_0251524
1583 Ga0395900_0297197
1584 Ga0395898_0000055
1585 Ga0395898_0000898
1586 Ga0395898_0011944
1587 Ga0395898_0020318
1588 Ga0395898_0025357
1589 Ga0395898_0033668
1590 Ga0395898_0042212
1591 Ga0395898_0063311
1592 Ga0395898_0227645
1593 Ga0395905_0000067
1594 Ga0395905_0000204
1595 Ga0395905_0001128
1596 Ga0395905_0002395
1597 Ga0395905_0009949
1598 Ga0395905_0011713
1599 Ga0395905_0012837
1600 Ga0395905_0019289
1601 Ga0395905_0023614
1602 Ga0395905_0035877
1603 Ga0395905_0054494
1604 Ga0395905_0073577
1605 Ga0395905_0075407
1606 Ga0395905_0095544
1607 Ga0395905_0102026
1608 Ga0395905_0169737
1609 Ga0395905_0212021
1610 Ga0395905_0332764
1611 Ga0395901_0000208
1612 Ga0395901_0000648
1613 Ga0395901_0001244
1614 Ga0395901_0002867
1615 Ga0395901_0009196
1616 Ga0395901_0013298
1617 Ga0395901_0020133
1618 Ga0395901_0026895
1619 Ga0395901_0027910
1620 Ga0395901_0033661
1621 Ga0395901_0084033
1622 Ga0395901_0109785
1623 Ga0395901_0114584
1624 Ga0395901_0194919
1625 Ga0395901_0241635
1626 Ga0395901_0355197
1627 Ga0395901_0378857
1628 Ga0395901_0412374
1629 Ga0436365_0024047
1630 Ga0436365_0546549
1631 Ga0436365_0636584
1632 Ga0436365_1104251
1633 Ga0436363_1592812
1634 Ga0439466_0020549
1635 Ga0439431_0000643
1636 Ga0439442_000926
1637 Ga0439432_000868
1638 Ga0439432_005945
1639 Ga0439449_0012363
1640 Ga0439462_0030757
1641 Ga0450889_000032
1642 Ga0439458_0004126
1643 Ga0439434_0000800
1644 Ga0466969_0007655
1645 Ga0466966_0000010
1646 Ga0466966_0007224
1647 Ga0466966_0043747
1648 Ga0466966_0070027
1649 Ga0466966_0171397
1650 Ga0466961_0097377
1651 Ga0466963_0002563
1652 Ga0466963_0003212
1653 Ga0466963_0042133
1654 Ga0466964_0004943
1655 Ga0466964_0033921
1656 Ga0466970_0008642
1657 Ga0466970_0043837
1658 Ga0466970_0073353
1659 Ga0466957_0002570
1660 Ga0466957_0066677
1661 Ga0466960_0053920
1662 Ga0466959_0004427
1663 Ga0466959_0022664
1664 Ga0466959_0086537
1665 Ga0466959_0110833
1666 Ga0466959_0155320
1667 Ga0466958_0030302
1668 Ga0466958_0145914
1669 Ga0466967_0025320
1670 Ga0466967_0153631
1671 Ga0466967_0178338
1672 Ga0466967_0211239
1673 Ga0466967_0237983
1674 Ga0466967_0276487
1675 Ga0466967_0343206
1676 Ga0466967_0353307
1677 Ga0495663_0003736
1678 Ga0495663_0009624
1679 Ga0495642_0044198
1680 Ga0495598_0001164
1681 Ga0495621_0000179
1682 Ga0495621_0003583
1683 Ga0495633_0003748
1684 Ga0495633_0033264
1685 Ga0495668_0005101
1686 Ga0495668_0074606
1687 Ga0495625_0029408
1688 Ga0495669_0007585
1689 Ga0495669_0020214
1690 Ga0495669_0037026
1691 Ga0495669_0037993
1692 Ga0495669_0074629
1693 Ga0495670_0000004
1694 Ga0495670_0002449
1695 Ga0495670_0016058
1696 Ga0495670_0025750
1697 Ga0496101_0008722
1698 Ga0496102_0223635
1699 Ga0496103_0091785
1700 Ga0496106_0103099
1701 Ga0496107_0006177
1702 Ga0496107_0024175
1703 Ga0496107_0062848
1704 Ga0496108_0014020
1705 Ga0496108_0017557
1706 Ga0496108_0018531
1707 Ga0496108_0018850
1708 Ga0496109_0002106
1709 Ga0496109_0046383
1710 Ga0496109_0048948
1711 Ga0496109_0130518
1712 Ga0496109_0330987
1713 Ga0496109_0362724
1714 Ga0496110_0001399
1715 Ga0496110_0001805
1716 Ga0496110_0009949
1717 Ga0496110_0023051
1718 Ga0496110_0172222
1719 Ga0496111_0002670
1720 Ga0496112_0000546
1721 Ga0496112_0061375
1722 Ga0496112_0086565
1723 Ga0496112_0260212
1724 Ga0496113_0007254
1725 Ga0496113_0051969
1726 Ga0496113_0082117
1727 Ga0496114_0088021
1728 Ga0496114_0216521
1729 Ga0496115_0013299
1730 Ga0496123_0022908
1731 Ga0496123_0053333
1732 Ga0496124_0000186
1733 Ga0496124_0001152
1734 Ga0496124_0010571
1735 Ga0496125_0004150
1736 Ga0496126_0000733
1737 Ga0501034_0255766
1738 Ga0501070_0018414
1739 Ga0501217_010627
1740 Ga0501223_005950
1741 Ga0501233_008538
1742 Ga0501225_0014779
1743 Ga0501241_014988
1744 Ga0501204_002627
1745 nmdc:mga06r32_38212_c1
1746 nmdc:mga0n895_129274_c1
1747 nmdc:mga0n895_269101_c1
1748 nmdc:mga0a205_2429_c1
1749 Ga0495655_0008165
1750 Ga0500566_0028830
1751 Ga0500573_0000016
1752 Ga0466962_0009757
1753 2511124029
1754 2600201678
1755 2600224888
1756 2644126924
1757 2753767902
1758 2819713082
1759 2830076062
1760 2879165673
1761 2896429585
1762 2928027492
1763 2928527621
1764 2928971744
1765 2946788640
1766 2984558207
1767 2984567414
1768 2990268688
1769 2993358479
1770 2993694605

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04209

HgmA_C

Homogentisate 1,2-dioxygenase C-terminal

298

448

0.98

PF20510

HgmA_N

Homogentisate 1,2-dioxygenase N-terminal

30

297

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aq6-assembly2.cif.gz_K substrate bound homogentisate 1,2-dioxygenase 0.9005 4 408
4aq2-assembly2.cif.gz_H resting state of homogentisate 1,2-dioxygenase 0.8931 4 408
4aq6-assembly2.cif.gz_K substrate bound homogentisate 1,2-dioxygenase 0.8921 4 408
4aq2-assembly2.cif.gz_G resting state of homogentisate 1,2-dioxygenase 0.8892 4 408
4aq2-assembly2.cif.gz_L resting state of homogentisate 1,2-dioxygenase 0.887 4 408
ID Description Score Start End Superfamily
af_Q9ZRA2_1_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8828 4 242 2.60.120.10
af_A0A1D6NXP1_1_243_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8449 25 242 2.60.120.10
af_G3V6C2_268_404_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8082 253 378 2.60.120.10
af_Q9ZRA2_1_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7742 4 242 2.60.120.10
af_A0A1D6NXP1_1_243_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7593 25 242 2.60.120.10
ID Description Score Start End GO Terms
AF-T1BRL9-F1-model_v4 Homogentisate 1,2-dioxygenase (EC 1.13.-.-) 0.9434 153 257 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-T1BRL9-F1-model_v4 Homogentisate 1,2-dioxygenase (EC 1.13.-.-) 0.9348 153 257 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A521HMS6-F1-model_v4 Homogentisate 1,2-dioxygenase (HGDO) (EC 1.13.11.5) (Homogentisate oxygenase) (Homogentisic acid oxidase) (Homogentisicase) 0.9258 2 408 GO:0004411
GO:0005506
GO:0005737
GO:0006559
GO:0006572
AF-A0A656QE43-F1-model_v4 Homogentisate 1,2-dioxygenase (EC 1.13.11.5) 0.9233 1 298 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A328P3V7-F1-model_v4 Homogentisate 1,2-dioxygenase (HGDO) (EC 1.13.11.5) (Homogentisate oxygenase) (Homogentisic acid oxidase) (Homogentisicase) 0.9226 1 408 GO:0004411
GO:0005506
GO:0005737
GO:0006559
GO:0006572

Map