F484675

General Info

Members Datasets Scaffolds Average Seq Length
885 246 885 148

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0105924|Ga0466966_0105924_976_1455
Length 159
Sequence MRRSVLLISAAGLLASAASAQLPGLRRYTPADNATQQANGKQQGPVPVGIDALRADFAAQAGGTTVYFGNGSSVLAPPARMTLAAQAAWLRRHPEVAVKIEGYGDGGDTRDHALAVGARRAEEARDYLVLLGVPAAQVSITSWGRERPGLGRAVTLLVS

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
186 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
187 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
188 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
230 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
231 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
232 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
233 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
236 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
237 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
238 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
239 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
240 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
241 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
242 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
243 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
244 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
245 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 5.2
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10012071 3300001990 Bacteria 2820
2 JGI24743J22301_10009435 3300001991 Bacteria 1729
3 JGI24735J21928_10124451 3300002067 Bacteria 743
4 JGI24744J21845_10000021 3300002077 Bacteria 18312
5 JGI24034J26672_10004989 3300002239 Bacteria 1894
6 JGI24751J29686_10029682 3300002459 Bacteria 1135
7 rootH2_10129989 3300003320 Bacteria 1113
8 rootH1_10057877 3300003323 Bacteria 1269
9 Ga0070658_10041477 3300005327 Bacteria 3713
10 Ga0070658_10072568 3300005327 Bacteria 2821
11 Ga0070658_10148511 3300005327 Bacteria 1961
12 Ga0070658_10311372 3300005327 Bacteria 1343
13 Ga0070658_10410330 3300005327 Bacteria 1164
14 Ga0070658_10539273 3300005327 Bacteria 1009
15 Ga0070658_11129490 3300005327 Bacteria 681
16 Ga0070658_11410324 3300005327 Bacteria 604
17 Ga0070676_10060754 3300005328 Bacteria 2245
18 Ga0070676_10085256 3300005328 Bacteria 1924
19 Ga0070676_10494197 3300005328 Bacteria 867
20 Ga0070683_100004824 3300005329 Bacteria 11168
21 Ga0070683_100050548 3300005329 Bacteria 3849
22 Ga0070683_100086884 3300005329 Bacteria 2932
23 Ga0070683_100607702 3300005329 Bacteria 1047
24 Ga0070690_100022321 3300005330 Bacteria 3871
25 Ga0070690_100023448 3300005330 Bacteria 3784
26 Ga0070690_100240527 3300005330 Bacteria 1276
27 Ga0070690_100793039 3300005330 Bacteria 734
28 Ga0070670_100002043 3300005331 Bacteria 16511
29 Ga0070670_100002145 3300005331 Bacteria 16197
30 Ga0070670_100016978 3300005331 Bacteria 6249
31 Ga0070670_100151347 3300005331 Bacteria 2008
32 Ga0070670_100159440 3300005331 Unclassified 1955
33 Ga0070670_100171378 3300005331 Bacteria 1882
34 Ga0070670_100268635 3300005331 Bacteria 1488
35 Ga0070670_100909132 3300005331 Bacteria 798
36 Ga0070677_10018338 3300005333 Bacteria 2519
37 Ga0070677_10402896 3300005333 Bacteria 721
38 Ga0070666_10000877 3300005335 Bacteria 18237
39 Ga0070666_10004850 3300005335 Bacteria 8221
40 Ga0070666_10028328 3300005335 Bacteria 3675
41 Ga0070666_10045968 3300005335 Bacteria 2927
42 Ga0070680_100002845 3300005336 Bacteria 12866
43 Ga0070680_100093199 3300005336 Bacteria 2495
44 Ga0070680_100151075 3300005336 Bacteria 1950
45 Ga0070680_100285536 3300005336 Bacteria 1398
46 Ga0070680_100739952 3300005336 Bacteria 846
47 Ga0070682_100024258 3300005337 Bacteria 3608
48 Ga0070682_100223562 3300005337 Bacteria 1342
49 Ga0070682_100790442 3300005337 Bacteria 770
50 Ga0068868_100000540 3300005338 Bacteria 25382
51 Ga0068868_100054365 3300005338 Bacteria 3155
52 Ga0068868_100151402 3300005338 Bacteria 1910
53 Ga0068868_100380073 3300005338 Bacteria 1215
54 Ga0068868_100533013 3300005338 Bacteria 1032
55 Ga0070660_100001061 3300005339 Bacteria 18495
56 Ga0070660_100009593 3300005339 Bacteria 6816
57 Ga0070660_100032137 3300005339 Bacteria 3948
58 Ga0070660_100060950 3300005339 Bacteria 2929
59 Ga0070660_100068844 3300005339 Bacteria 2759
60 Ga0070660_100096401 3300005339 Bacteria 2339
61 Ga0070660_100145188 3300005339 Bacteria 1905
62 Ga0070660_100151237 3300005339 Bacteria 1866
63 Ga0070660_100155061 3300005339 Bacteria 1843
64 Ga0070660_100175854 3300005339 Bacteria 1731
65 Ga0070660_100239239 3300005339 Bacteria 1478
66 Ga0070660_100951722 3300005339 Bacteria 725
67 Ga0070660_101245627 3300005339 Bacteria 631
68 Ga0070689_100131542 3300005340 Bacteria 2007
69 Ga0070691_10002720 3300005341 Bacteria 7872
70 Ga0070687_100465319 3300005343 Bacteria 844
71 Ga0070661_100001787 3300005344 Bacteria 14912
72 Ga0070661_100008568 3300005344 Bacteria 7072
73 Ga0070661_100022428 3300005344 Bacteria 4521
74 Ga0070661_100026281 3300005344 Bacteria 4186
75 Ga0070661_100034430 3300005344 Bacteria 3672
76 Ga0070661_100084876 3300005344 Bacteria 2339
77 Ga0070661_100096580 3300005344 Bacteria 2193
78 Ga0070661_100107317 3300005344 Bacteria 2082
79 Ga0070661_100358954 3300005344 Unclassified 1145
80 Ga0070661_100371003 3300005344 Bacteria 1126
81 Ga0070692_10279000 3300005345 Bacteria 1012
82 Ga0070669_100178122 3300005353 Bacteria 1661
83 Ga0070669_100252359 3300005353 Bacteria 1405
84 Ga0070675_100022113 3300005354 Bacteria 5081
85 Ga0070675_100089053 3300005354 Bacteria 2583
86 Ga0070675_100586772 3300005354 Bacteria 1010
87 Ga0070675_101746403 3300005354 Bacteria 574
88 Ga0070671_100003631 3300005355 Bacteria 12078
89 Ga0070671_100004155 3300005355 Bacteria 11437
90 Ga0070671_100008614 3300005355 Bacteria 8177
91 Ga0070671_100009032 3300005355 Bacteria 7996
92 Ga0070671_100015111 3300005355 Bacteria 6235
93 Ga0070671_100061193 3300005355 Bacteria 3135
94 Ga0070671_100091963 3300005355 Bacteria 2541
95 Ga0070671_100160288 3300005355 Bacteria 1902
96 Ga0070671_100855138 3300005355 Bacteria 793
97 Ga0070674_100009512 3300005356 Bacteria 5821
98 Ga0070674_100011429 3300005356 Bacteria 5408
99 Ga0070674_100072363 3300005356 Bacteria 2441
100 Ga0070674_100089221 3300005356 Bacteria 2221
101 Ga0070674_100754886 3300005356 Bacteria 836
102 Ga0070674_100899984 3300005356 Bacteria 771
103 Ga0070673_100008965 3300005364 Bacteria 6690
104 Ga0070673_100028107 3300005364 Bacteria 4178
105 Ga0070673_100146154 3300005364 Bacteria 1999
106 Ga0070673_100869071 3300005364 Bacteria 835
107 Ga0070673_101076417 3300005364 Bacteria 750
108 Ga0070659_100002156 3300005366 Bacteria 14026
109 Ga0070659_100012198 3300005366 Bacteria 6370
110 Ga0070659_100016639 3300005366 Bacteria 5523
111 Ga0070659_100024356 3300005366 Bacteria 4640
112 Ga0070659_100066061 3300005366 Bacteria 2866
113 Ga0070659_100084675 3300005366 Bacteria 2535
114 Ga0070659_100198738 3300005366 Bacteria 1650
115 Ga0070659_100547383 3300005366 Bacteria 990
116 Ga0070659_101347466 3300005366 Bacteria 633
117 Ga0070667_100001880 3300005367 Bacteria 18647
118 Ga0070667_100004036 3300005367 Bacteria 12418
119 Ga0070667_100042051 3300005367 Bacteria 3833
120 Ga0070667_100106767 3300005367 Bacteria 2424
121 Ga0070667_100208062 3300005367 Bacteria 1738
122 Ga0070667_100327653 3300005367 Bacteria 1383
123 Ga0070667_101831747 3300005367 Bacteria 571
124 Ga0070709_10665003 3300005434 Bacteria 808
125 Ga0070714_100022207 3300005435 Bacteria 5202
126 Ga0070714_100028449 3300005435 Bacteria 4638
127 Ga0070714_100133863 3300005435 Bacteria 2217
128 Ga0070714_100318947 3300005435 Bacteria 1453
129 Ga0070713_100079950 3300005436 Bacteria 2786
130 Ga0070713_100168117 3300005436 Bacteria 1962
131 Ga0070713_100319514 3300005436 Bacteria 1433
132 Ga0070713_102023214 3300005436 Bacteria 559
133 Ga0070663_100016307 3300005455 Bacteria 4822
134 Ga0070663_100032252 3300005455 Bacteria 3609
135 Ga0070663_100057503 3300005455 Bacteria 2790
136 Ga0070663_100071942 3300005455 Bacteria 2518
137 Ga0070663_100108379 3300005455 Bacteria 2083
138 Ga0070663_100126921 3300005455 Bacteria 1933
139 Ga0070663_100169718 3300005455 Bacteria 1685
140 Ga0070663_100230312 3300005455 Bacteria 1459
141 Ga0070678_100002062 3300005456 Bacteria 10889
142 Ga0070678_100012893 3300005456 Bacteria 5217
143 Ga0070678_100023912 3300005456 Bacteria 4081
144 Ga0070678_100214885 3300005456 Bacteria 1595
145 Ga0070678_101515479 3300005456 Unclassified 628
146 Ga0070662_100001323 3300005457 Bacteria 15219
147 Ga0070662_100006647 3300005457 Bacteria 7467
148 Ga0070662_100018683 3300005457 Bacteria 4693
149 Ga0070662_100124332 3300005457 Bacteria 1981
150 Ga0070662_100139100 3300005457 Bacteria 1880
151 Ga0070662_100149183 3300005457 Bacteria 1819
152 Ga0070662_100250395 3300005457 Bacteria 1424
153 Ga0070662_100430257 3300005457 Bacteria 1093
154 Ga0070662_100530355 3300005457 Bacteria 985
155 Ga0070662_101461638 3300005457 Bacteria 589
156 Ga0070681_10028705 3300005458 Bacteria 5593
157 Ga0070681_10071742 3300005458 Bacteria 3428
158 Ga0070681_10143556 3300005458 Bacteria 2316
159 Ga0070681_10343395 3300005458 Bacteria 1403
160 Ga0068867_100262102 3300005459 Bacteria 1409
161 Ga0068867_100323444 3300005459 Bacteria 1278
162 Ga0068867_100740138 3300005459 Bacteria 871
163 Ga0068867_101016412 3300005459 Unclassified 752
164 Ga0070685_10029982 3300005466 Bacteria 3026
165 Ga0070685_10157102 3300005466 Bacteria 1446
166 Ga0070685_10920050 3300005466 Unclassified 652
167 Ga0070679_100026734 3300005530 Bacteria 5674
168 Ga0070679_100033833 3300005530 Bacteria 5061
169 Ga0070679_100165095 3300005530 Bacteria 2188
170 Ga0070679_100738838 3300005530 Bacteria 927
171 Ga0070684_100003373 3300005535 Bacteria 11965
172 Ga0070684_100005950 3300005535 Bacteria 9394
173 Ga0070684_100406222 3300005535 Bacteria 1256
174 Ga0070684_101445390 3300005535 Bacteria 648
175 Ga0068853_100103745 3300005539 Bacteria 2517
176 Ga0068853_100150264 3300005539 Bacteria 2096
177 Ga0068853_100289616 3300005539 Bacteria 1511
178 Ga0068853_100316992 3300005539 Bacteria 1445
179 Ga0068853_100373494 3300005539 Bacteria 1331
180 Ga0068853_100385497 3300005539 Bacteria 1309
181 Ga0068853_100454856 3300005539 Bacteria 1204
182 Ga0068853_100504952 3300005539 Bacteria 1142
183 Ga0068853_101204120 3300005539 Bacteria 731
184 Ga0068853_101520060 3300005539 Bacteria 648
185 Ga0070672_100012992 3300005543 Bacteria 5868
186 Ga0070672_100037701 3300005543 Bacteria 3689
187 Ga0070672_100047548 3300005543 Bacteria 3330
188 Ga0070672_100062807 3300005543 Bacteria 2932
189 Ga0070672_100193546 3300005543 Bacteria 1699
190 Ga0070672_100399319 3300005543 Unclassified 1178
191 Ga0070686_100047912 3300005544 Bacteria 2705
192 Ga0070693_100141298 3300005547 Bacteria 1516
193 Ga0070665_100050630 3300005548 Bacteria 4168
194 Ga0070665_100105181 3300005548 Bacteria 2824
195 Ga0068855_100014603 3300005563 Bacteria 9459
196 Ga0068855_100060002 3300005563 Bacteria 4449
197 Ga0068855_100166060 3300005563 Bacteria 2502
198 Ga0068855_100225252 3300005563 Bacteria 2101
199 Ga0068855_100723041 3300005563 Bacteria 1064
200 Ga0068855_100924204 3300005563 Bacteria 920
201 Ga0068855_101245710 3300005563 Unclassified 772
202 Ga0068855_101467440 3300005563 Unclassified 701
203 Ga0070664_100004583 3300005564 Bacteria 11091
204 Ga0070664_100005728 3300005564 Bacteria 10014
205 Ga0070664_100013554 3300005564 Bacteria 6642
206 Ga0070664_100020711 3300005564 Bacteria 5416
207 Ga0070664_100035241 3300005564 Bacteria 4201
208 Ga0070664_100045232 3300005564 Bacteria 3718
209 Ga0070664_100148055 3300005564 Bacteria 2071
210 Ga0070664_100538408 3300005564 Unclassified 1079
211 Ga0068857_100012718 3300005577 Bacteria 7336
212 Ga0068857_100031092 3300005577 Bacteria 4718
213 Ga0068857_100171813 3300005577 Bacteria 1970
214 Ga0068857_100212268 3300005577 Bacteria 1767
215 Ga0068857_100311046 3300005577 Bacteria 1453
216 Ga0068857_100314305 3300005577 Bacteria 1446
217 Ga0068857_101783223 3300005577 Bacteria 602
218 Ga0068854_100009843 3300005578 Bacteria 6182
219 Ga0068854_100018356 3300005578 Bacteria 4695
220 Ga0068854_100052082 3300005578 Bacteria 2934
221 Ga0068854_100185912 3300005578 Bacteria 1626
222 Ga0068854_100228820 3300005578 Bacteria 1475
223 Ga0068854_100357226 3300005578 Bacteria 1198
224 Ga0068854_100390911 3300005578 Bacteria 1148
225 Ga0068856_100042934 3300005614 Bacteria 4449
226 Ga0068856_100248319 3300005614 Bacteria 1794
227 Ga0068856_100424438 3300005614 Bacteria 1350
228 Ga0068856_101147068 3300005614 Bacteria 794
229 Ga0070702_100111413 3300005615 Bacteria 1697
230 Ga0068852_100007881 3300005616 Bacteria 7798
231 Ga0068852_100038865 3300005616 Bacteria 4003
232 Ga0068852_100041508 3300005616 Bacteria 3888
233 Ga0068852_100081641 3300005616 Bacteria 2870
234 Ga0068852_100181379 3300005616 Bacteria 1980
235 Ga0068852_100191532 3300005616 Bacteria 1930
236 Ga0068852_100267084 3300005616 Bacteria 1645
237 Ga0068852_100348263 3300005616 Bacteria 1446
238 Ga0068852_100494211 3300005616 Bacteria 1217
239 Ga0068852_100618103 3300005616 Bacteria 1089
240 Ga0068852_100764701 3300005616 Bacteria 979
241 Ga0068852_100886851 3300005616 Bacteria 909
242 Ga0068852_101154267 3300005616 Unclassified 795
243 Ga0068852_101168425 3300005616 Bacteria 790
244 Ga0068859_100039867 3300005617 Bacteria 4713
245 Ga0068859_100250995 3300005617 Bacteria 1860
246 Ga0068864_100001952 3300005618 Bacteria 16953
247 Ga0068864_100008756 3300005618 Bacteria 8343
248 Ga0068864_100018445 3300005618 Bacteria 5830
249 Ga0068864_100065886 3300005618 Bacteria 3142
250 Ga0068864_100267979 3300005618 Bacteria 1590
251 Ga0068866_10034977 3300005718 Bacteria 2451
252 Ga0068866_10052426 3300005718 Bacteria 2082
253 Ga0068866_10095958 3300005718 Bacteria 1625
254 Ga0068861_100135833 3300005719 Bacteria 2001
255 Ga0068861_100624015 3300005719 Bacteria 992
256 Ga0068851_10075198 3300005834 Bacteria 1755
257 Ga0068851_10164604 3300005834 Bacteria 1220
258 Ga0068851_10391682 3300005834 Bacteria 816
259 Ga0068851_10453959 3300005834 Bacteria 762
260 Ga0068870_10247491 3300005840 Bacteria 1104
261 Ga0068863_100020336 3300005841 Bacteria 6347
262 Ga0068863_100156718 3300005841 Bacteria 2180
263 Ga0068863_100327710 3300005841 Bacteria 1488
264 Ga0068858_100015586 3300005842 Bacteria 7149
265 Ga0068858_100017967 3300005842 Bacteria 6623
266 Ga0068860_100193218 3300005843 Bacteria 1970
267 Ga0068860_102164779 3300005843 Unclassified 577
268 Ga0068862_100256225 3300005844 Bacteria 1596
269 Ga0070717_10034526 3300006028 Bacteria 4089
270 Ga0070717_10180121 3300006028 Bacteria 1841
271 Ga0070716_100025494 3300006173 Bacteria 3155
272 Ga0070716_100238537 3300006173 Bacteria 1232
273 Ga0070712_100028025 3300006175 Bacteria 3764
274 Ga0075366_10142042 3300006195 Bacteria 1452
275 Ga0097621_100098106 3300006237 Bacteria 2461
276 Ga0097621_100240914 3300006237 Bacteria 1581
277 Ga0097621_100312849 3300006237 Bacteria 1389
278 Ga0068871_100024968 3300006358 Bacteria 4643
279 Ga0068871_100264376 3300006358 Bacteria 1501
280 Ga0068871_100674063 3300006358 Bacteria 946
281 Ga0068865_100028753 3300006881 Bacteria 3682
282 Ga0068865_100124950 3300006881 Bacteria 1919
283 Ga0068865_100390299 3300006881 Bacteria 1138
284 Ga0097620_100039868 3300006931 Bacteria 4713
285 Ga0097620_100250982 3300006931 Bacteria 1860
286 Ga0105240_10019380 3300009093 Bacteria 9089
287 Ga0105240_10329832 3300009093 Bacteria 1737
288 Ga0105240_10357186 3300009093 Bacteria 1656
289 Ga0105245_10153409 3300009098 Bacteria 2180
290 Ga0105245_10181861 3300009098 Bacteria 2009
291 Ga0105245_10338393 3300009098 Bacteria 1487
292 Ga0105245_10455925 3300009098 Bacteria 1288
293 Ga0105243_10060153 3300009148 Bacteria 3034
294 Ga0105243_10123153 3300009148 Bacteria 2189
295 Ga0105241_10034765 3300009174 Bacteria 3789
296 Ga0105242_10243417 3300009176 Bacteria 1618
297 Ga0105242_10679719 3300009176 Bacteria 1004
298 Ga0105242_11408460 3300009176 Bacteria 725
299 Ga0105248_10002275 3300009177 Bacteria 21260
300 Ga0105248_10002500 3300009177 Bacteria 20447
301 Ga0105248_10004589 3300009177 Bacteria 15299
302 Ga0105248_10039061 3300009177 Bacteria 5315
303 Ga0105248_10112061 3300009177 Bacteria 3077
304 Ga0105248_10248477 3300009177 Bacteria 2002
305 Ga0105248_10297792 3300009177 Bacteria 1816
306 Ga0105248_10468777 3300009177 Bacteria 1420
307 Ga0105248_11718686 3300009177 Bacteria 711
308 Ga0105248_11937777 3300009177 Bacteria 669
309 Ga0105237_10013446 3300009545 Bacteria 8583
310 Ga0105238_10023266 3300009551 Bacteria 6316
311 Ga0105238_10181661 3300009551 Bacteria 2080
312 Ga0105238_10205934 3300009551 Bacteria 1943
313 Ga0105238_10395057 3300009551 Bacteria 1375
314 Ga0105238_11300184 3300009551 Bacteria 753
315 Ga0105239_10338501 3300010375 Bacteria 1698
316 Ga0157373_10007319 3300013100 Bacteria 8220
317 Ga0157373_10051084 3300013100 Bacteria 2944
318 Ga0157373_10066196 3300013100 Bacteria 2556
319 Ga0157373_10082890 3300013100 Bacteria 2260
320 Ga0157373_10092370 3300013100 Bacteria 2131
321 Ga0157373_10132984 3300013100 Bacteria 1749
322 Ga0157373_10474639 3300013100 Bacteria 902
323 Ga0157373_10489811 3300013100 Bacteria 887
324 Ga0157371_10029991 3300013102 Bacteria 3926
325 Ga0157371_10056851 3300013102 Bacteria 2775
326 Ga0157371_10096631 3300013102 Bacteria 2093
327 Ga0157371_11318291 3300013102 Unclassified 559
328 Ga0157370_10000497 3300013104 Bacteria 48916
329 Ga0157370_10032144 3300013104 Bacteria 5126
330 Ga0157370_10051504 3300013104 Bacteria 3933
331 Ga0157370_10097694 3300013104 Bacteria 2755
332 Ga0157370_10161493 3300013104 Bacteria 2084
333 Ga0157370_10320549 3300013104 Bacteria 1429
334 Ga0157370_10356717 3300013104 Bacteria 1347
335 Ga0157370_10553265 3300013104 Bacteria 1055
336 Ga0157370_11046511 3300013104 Bacteria 738
337 Ga0157370_11372224 3300013104 Bacteria 636
338 Ga0157369_10112222 3300013105 Bacteria 2896
339 Ga0157369_10152251 3300013105 Bacteria 2444
340 Ga0157369_10177092 3300013105 Bacteria 2245
341 Ga0157369_10330557 3300013105 Bacteria 1584
342 Ga0157369_10439559 3300013105 Bacteria 1351
343 Ga0157369_11953484 3300013105 Unclassified 595
344 Ga0157374_10006812 3300013296 Bacteria 9720
345 Ga0157378_10063734 3300013297 Bacteria 3294
346 Ga0157378_10378559 3300013297 Bacteria 1389
347 Ga0157378_10788027 3300013297 Bacteria 976
348 Ga0157378_11794056 3300013297 Bacteria 661
349 Ga0157378_12374034 3300013297 Unclassified 582
350 Ga0163162_10008116 3300013306 Bacteria 10244
351 Ga0163162_10277612 3300013306 Unclassified 1808
352 Ga0163162_11968195 3300013306 Bacteria 669
353 Ga0157372_10052507 3300013307 Bacteria 4540
354 Ga0157372_10237916 3300013307 Bacteria 2112
355 Ga0157372_10320909 3300013307 Bacteria 1803
356 Ga0157372_10454270 3300013307 Bacteria 1493
357 Ga0157372_10629150 3300013307 Bacteria 1250
358 Ga0157372_11503142 3300013307 Bacteria 776
359 Ga0157372_11723683 3300013307 Unclassified 721
360 Ga0157375_10002069 3300013308 Bacteria 17350
361 Ga0157375_10054020 3300013308 Bacteria 3955
362 Ga0157375_10272296 3300013308 Bacteria 1855
363 Ga0157375_10585388 3300013308 Bacteria 1276
364 Ga0157375_11427103 3300013308 Unclassified 816
365 Ga0163163_10005023 3300014325 Bacteria 11402
366 Ga0163163_10021041 3300014325 Bacteria 6153
367 Ga0163163_10382065 3300014325 Bacteria 1466
368 Ga0157380_10492898 3300014326 Bacteria 1188
369 Ga0157380_11328287 3300014326 Bacteria 767
370 Ga0157379_10033250 3300014968 Bacteria 4599
371 Ga0157379_10226747 3300014968 Bacteria 1693
372 Ga0157376_10274911 3300014969 Bacteria 1584
373 Ga0163161_10030131 3300017792 Bacteria 3860
374 Ga0206356_11732949 3300020070 Bacteria 2515
375 Ga0206353_10506929 3300020082 Bacteria 740
376 Ga0206353_11527701 3300020082 Bacteria 743
377 Ga0213876_10073437 3300021384 Bacteria 1806
378 Ga0207697_10213914 3300025315 Bacteria 850
379 Ga0207656_10044703 3300025321 Bacteria 1892
380 Ga0207656_10086815 3300025321 Bacteria 1414
381 Ga0207656_10155705 3300025321 Bacteria 1084
382 Ga0207656_10404974 3300025321 Unclassified 686
383 Ga0207682_10015022 3300025893 Bacteria 3015
384 Ga0207682_10024752 3300025893 Bacteria 2379
385 Ga0207682_10156195 3300025893 Unclassified 1031
386 Ga0207642_10025501 3300025899 Bacteria 2393
387 Ga0207642_10909223 3300025899 Unclassified 564
388 Ga0207688_10204756 3300025901 Bacteria 1184
389 Ga0207688_10801516 3300025901 Unclassified 597
390 Ga0207680_10002816 3300025903 Bacteria 8144
391 Ga0207680_10022081 3300025903 Bacteria 3456
392 Ga0207680_10054410 3300025903 Bacteria 2407
393 Ga0207647_10009032 3300025904 Bacteria 7098
394 Ga0207647_10055492 3300025904 Bacteria 2434
395 Ga0207647_10055785 3300025904 Bacteria 2427
396 Ga0207647_10085192 3300025904 Bacteria 1890
397 Ga0207647_10214681 3300025904 Bacteria 1110
398 Ga0207647_10308294 3300025904 Bacteria 900
399 Ga0207699_10084550 3300025906 Bacteria 1976
400 Ga0207645_10080255 3300025907 Bacteria 2091
401 Ga0207645_10116468 3300025907 Bacteria 1733
402 Ga0207643_10119506 3300025908 Bacteria 1560
403 Ga0207705_10000123 3300025909 Bacteria 85382
404 Ga0207705_10003112 3300025909 Bacteria 12660
405 Ga0207705_10005892 3300025909 Bacteria 9112
406 Ga0207705_10023003 3300025909 Bacteria 4445
407 Ga0207705_10145749 3300025909 Bacteria 1771
408 Ga0207705_10334958 3300025909 Bacteria 1164
409 Ga0207705_10468713 3300025909 Bacteria 977
410 Ga0207707_10267597 3300025912 Bacteria 1482
411 Ga0207707_10536319 3300025912 Bacteria 995
412 Ga0207695_10019756 3300025913 Bacteria 7745
413 Ga0207671_10040892 3300025914 Bacteria 3431
414 Ga0207693_10006527 3300025915 Bacteria 9654
415 Ga0207663_11646690 3300025916 Unclassified 516
416 Ga0207660_10004906 3300025917 Bacteria 8711
417 Ga0207660_10287443 3300025917 Bacteria 1307
418 Ga0207660_10563670 3300025917 Bacteria 927
419 Ga0207660_10626903 3300025917 Bacteria 876
420 Ga0207662_10137730 3300025918 Bacteria 1544
421 Ga0207662_10207514 3300025918 Bacteria 1271
422 Ga0207657_10000650 3300025919 Bacteria 36973
423 Ga0207657_10015919 3300025919 Bacteria 7265
424 Ga0207657_10021597 3300025919 Bacteria 6052
425 Ga0207657_10036095 3300025919 Bacteria 4426
426 Ga0207657_10037057 3300025919 Bacteria 4360
427 Ga0207657_10043151 3300025919 Bacteria 3975
428 Ga0207657_10046829 3300025919 Bacteria 3786
429 Ga0207657_10064016 3300025919 Bacteria 3141
430 Ga0207657_10120974 3300025919 Bacteria 2154
431 Ga0207657_10142002 3300025919 Bacteria 1961
432 Ga0207657_10156314 3300025919 Bacteria 1854
433 Ga0207657_10251239 3300025919 Bacteria 1409
434 Ga0207657_10459006 3300025919 Bacteria 999
435 Ga0207657_10985601 3300025919 Bacteria 647
436 Ga0207657_11377829 3300025919 Unclassified 530
437 Ga0207649_10006477 3300025920 Bacteria 6358
438 Ga0207649_10007819 3300025920 Bacteria 5817
439 Ga0207649_10012717 3300025920 Bacteria 4678
440 Ga0207649_10028634 3300025920 Bacteria 3281
441 Ga0207649_10061755 3300025920 Bacteria 2360
442 Ga0207649_10136418 3300025920 Bacteria 1673
443 Ga0207649_10192176 3300025920 Bacteria 1436
444 Ga0207649_10205728 3300025920 Bacteria 1393
445 Ga0207649_10628796 3300025920 Bacteria 828
446 Ga0207649_10742575 3300025920 Bacteria 763
447 Ga0207649_10759833 3300025920 Unclassified 755
448 Ga0207649_11067846 3300025920 Bacteria 636
449 Ga0207652_10000034 3300025921 Bacteria 138571
450 Ga0207652_10103873 3300025921 Bacteria 2513
451 Ga0207652_10227372 3300025921 Bacteria 1682
452 Ga0207652_10324329 3300025921 Bacteria 1390
453 Ga0207652_10598662 3300025921 Bacteria 989
454 Ga0207681_10068097 3300025923 Bacteria 2471
455 Ga0207694_10651681 3300025924 Bacteria 887
456 Ga0207650_10001872 3300025925 Bacteria 14855
457 Ga0207650_10007236 3300025925 Bacteria 7559
458 Ga0207650_10163307 3300025925 Bacteria 1766
459 Ga0207650_10378579 3300025925 Bacteria 1168
460 Ga0207650_10452711 3300025925 Bacteria 1068
461 Ga0207650_10721750 3300025925 Bacteria 842
462 Ga0207650_10889204 3300025925 Unclassified 756
463 Ga0207659_10122238 3300025926 Bacteria 1996
464 Ga0207659_11313156 3300025926 Bacteria 621
465 Ga0207687_10103334 3300025927 Bacteria 2101
466 Ga0207687_10126363 3300025927 Bacteria 1920
467 Ga0207687_10224950 3300025927 Bacteria 1479
468 Ga0207700_10193889 3300025928 Bacteria 1708
469 Ga0207700_10239641 3300025928 Bacteria 1545
470 Ga0207664_10043401 3300025929 Bacteria 3516
471 Ga0207664_10122032 3300025929 Bacteria 2182
472 Ga0207664_10334196 3300025929 Bacteria 1339
473 Ga0207664_10428650 3300025929 Bacteria 1179
474 Ga0207644_10000773 3300025931 Bacteria 20259
475 Ga0207644_10000847 3300025931 Bacteria 19396
476 Ga0207644_10000998 3300025931 Bacteria 18072
477 Ga0207644_10017928 3300025931 Bacteria 4787
478 Ga0207644_10038435 3300025931 Bacteria 3371
479 Ga0207644_10313397 3300025931 Bacteria 1267
480 Ga0207644_10321703 3300025931 Bacteria 1251
481 Ga0207644_10447389 3300025931 Bacteria 1061
482 Ga0207644_10544825 3300025931 Bacteria 960
483 Ga0207690_10006143 3300025932 Bacteria 7116
484 Ga0207690_10011654 3300025932 Bacteria 5255
485 Ga0207690_10020356 3300025932 Bacteria 4098
486 Ga0207690_10025092 3300025932 Bacteria 3739
487 Ga0207690_10152901 3300025932 Bacteria 1712
488 Ga0207690_10292578 3300025932 Bacteria 1272
489 Ga0207690_10406564 3300025932 Bacteria 1086
490 Ga0207690_10651968 3300025932 Unclassified 863
491 Ga0207690_10970886 3300025932 Bacteria 706
492 Ga0207706_10000253 3300025933 Bacteria 58135
493 Ga0207706_10003262 3300025933 Bacteria 15536
494 Ga0207706_10004173 3300025933 Bacteria 13606
495 Ga0207706_10005402 3300025933 Bacteria 11912
496 Ga0207706_10035503 3300025933 Bacteria 4431
497 Ga0207706_10047951 3300025933 Bacteria 3778
498 Ga0207706_10120757 3300025933 Bacteria 2304
499 Ga0207706_10292083 3300025933 Bacteria 1421
500 Ga0207706_10610403 3300025933 Bacteria 936
501 Ga0207706_10753964 3300025933 Bacteria 829
502 Ga0207709_10204147 3300025935 Bacteria 1414
503 Ga0207670_10106352 3300025936 Bacteria 2013
504 Ga0207669_10006240 3300025937 Bacteria 5431
505 Ga0207669_10014692 3300025937 Bacteria 3931
506 Ga0207669_10164671 3300025937 Bacteria 1571
507 Ga0207669_10321025 3300025937 Bacteria 1185
508 Ga0207704_10143493 3300025938 Bacteria 1674
509 Ga0207704_10967718 3300025938 Bacteria 718
510 Ga0207665_10021532 3300025939 Bacteria 4240
511 Ga0207665_10040756 3300025939 Bacteria 3100
512 Ga0207691_10007401 3300025940 Bacteria 10572
513 Ga0207691_10040509 3300025940 Bacteria 4303
514 Ga0207691_10075315 3300025940 Bacteria 3043
515 Ga0207691_10110488 3300025940 Bacteria 2445
516 Ga0207691_10114746 3300025940 Bacteria 2393
517 Ga0207691_10435378 3300025940 Bacteria 1117
518 Ga0207711_10000309 3300025941 Bacteria 52342
519 Ga0207711_10002790 3300025941 Bacteria 15368
520 Ga0207711_10005331 3300025941 Bacteria 10903
521 Ga0207711_10033742 3300025941 Bacteria 4332
522 Ga0207711_10226322 3300025941 Bacteria 1712
523 Ga0207711_10485016 3300025941 Bacteria 1152
524 Ga0207711_10519447 3300025941 Bacteria 1110
525 Ga0207661_10015802 3300025944 Bacteria 5560
526 Ga0207661_10099438 3300025944 Bacteria 2439
527 Ga0207661_10379087 3300025944 Bacteria 1280
528 Ga0207661_11323335 3300025944 Bacteria 662
529 Ga0207679_10006100 3300025945 Bacteria 7603
530 Ga0207679_10007359 3300025945 Bacteria 6981
531 Ga0207679_10011664 3300025945 Bacteria 5704
532 Ga0207679_10060515 3300025945 Bacteria 2814
533 Ga0207679_10062443 3300025945 Bacteria 2776
534 Ga0207679_10097866 3300025945 Bacteria 2286
535 Ga0207679_10456368 3300025945 Unclassified 1134
536 Ga0207679_11605049 3300025945 Unclassified 596
537 Ga0207679_11784370 3300025945 Unclassified 562
538 Ga0207667_10036894 3300025949 Bacteria 5232
539 Ga0207667_10080700 3300025949 Bacteria 3370
540 Ga0207667_10096314 3300025949 Bacteria 3054
541 Ga0207667_10169314 3300025949 Bacteria 2245
542 Ga0207667_10429502 3300025949 Bacteria 1344
543 Ga0207667_10583559 3300025949 Bacteria 1128
544 Ga0207667_10761332 3300025949 Bacteria 967
545 Ga0207667_10911560 3300025949 Bacteria 870
546 Ga0207667_11347496 3300025949 Unclassified 689
547 Ga0207667_11386711 3300025949 Bacteria 677
548 Ga0207651_10006825 3300025960 Bacteria 6021
549 Ga0207651_10024726 3300025960 Bacteria 3720
550 Ga0207651_10058746 3300025960 Bacteria 2659
551 Ga0207651_10063600 3300025960 Bacteria 2577
552 Ga0207651_10100537 3300025960 Bacteria 2144
553 Ga0207651_10476137 3300025960 Bacteria 1075
554 Ga0207651_11771814 3300025960 Unclassified 556
555 Ga0207640_10003637 3300025981 Bacteria 8317
556 Ga0207640_10045020 3300025981 Bacteria 2831
557 Ga0207640_10085859 3300025981 Bacteria 2165
558 Ga0207640_10201935 3300025981 Bacteria 1507
559 Ga0207640_10466978 3300025981 Bacteria 1044
560 Ga0207640_10517459 3300025981 Bacteria 997
561 Ga0207640_11036455 3300025981 Bacteria 723
562 Ga0207640_11247253 3300025981 Bacteria 662
563 Ga0207658_10005278 3300025986 Bacteria 8888
564 Ga0207658_10007111 3300025986 Bacteria 7623
565 Ga0207658_10246860 3300025986 Bacteria 1515
566 Ga0207658_11465508 3300025986 Bacteria 624
567 Ga0207677_10004742 3300026023 Bacteria 7330
568 Ga0207677_10005621 3300026023 Bacteria 6813
569 Ga0207677_10006993 3300026023 Bacteria 6208
570 Ga0207677_10114783 3300026023 Bacteria 2013
571 Ga0207677_10396494 3300026023 Bacteria 1169
572 Ga0207677_10415148 3300026023 Bacteria 1145
573 Ga0207703_10001905 3300026035 Bacteria 18500
574 Ga0207703_10003444 3300026035 Bacteria 13265
575 Ga0207639_10017111 3300026041 Bacteria 5136
576 Ga0207639_10353310 3300026041 Bacteria 1313
577 Ga0207639_10546463 3300026041 Bacteria 1063
578 Ga0207639_10964253 3300026041 Bacteria 798
579 Ga0207678_10000530 3300026067 Bacteria 34763
580 Ga0207678_10033261 3300026067 Bacteria 4493
581 Ga0207678_10043209 3300026067 Bacteria 3901
582 Ga0207678_10057296 3300026067 Bacteria 3353
583 Ga0207678_10107410 3300026067 Bacteria 2381
584 Ga0207678_10125462 3300026067 Bacteria 2190
585 Ga0207702_10018250 3300026078 Bacteria 5803
586 Ga0207702_10022150 3300026078 Bacteria 5266
587 Ga0207702_10022741 3300026078 Bacteria 5200
588 Ga0207702_10080338 3300026078 Bacteria 2829
589 Ga0207702_10097461 3300026078 Bacteria 2588
590 Ga0207702_10415644 3300026078 Bacteria 1300
591 Ga0207641_10004961 3300026088 Bacteria 11414
592 Ga0207641_10035112 3300026088 Bacteria 4175
593 Ga0207641_10035960 3300026088 Bacteria 4131
594 Ga0207641_10944613 3300026088 Bacteria 857
595 Ga0207648_10008589 3300026089 Bacteria 9879
596 Ga0207648_10010729 3300026089 Bacteria 8661
597 Ga0207648_10017417 3300026089 Bacteria 6539
598 Ga0207648_10196909 3300026089 Bacteria 1787
599 Ga0207676_10002086 3300026095 Bacteria 14504
600 Ga0207676_10050546 3300026095 Bacteria 3241
601 Ga0207676_10058420 3300026095 Unclassified 3042
602 Ga0207676_10168808 3300026095 Bacteria 1904
603 Ga0207676_10388761 3300026095 Bacteria 1300
604 Ga0207676_10437349 3300026095 Bacteria 1230
605 Ga0207674_10000086 3300026116 Bacteria 100722
606 Ga0207674_10009133 3300026116 Bacteria 11375
607 Ga0207674_10024503 3300026116 Bacteria 6447
608 Ga0207674_10025828 3300026116 Bacteria 6253
609 Ga0207674_10104762 3300026116 Bacteria 2807
610 Ga0207674_10890687 3300026116 Bacteria 858
611 Ga0207675_100406877 3300026118 Bacteria 1342
612 Ga0207683_10001185 3300026121 Bacteria 23609
613 Ga0207683_10002289 3300026121 Bacteria 16796
614 Ga0207683_10012568 3300026121 Bacteria 7223
615 Ga0207683_10025482 3300026121 Bacteria 5102
616 Ga0207683_10064773 3300026121 Bacteria 3221
617 Ga0207683_10751853 3300026121 Bacteria 904
618 Ga0207698_10022715 3300026142 Bacteria 4367
619 Ga0207698_10035892 3300026142 Bacteria 3632
620 Ga0207698_10059285 3300026142 Bacteria 2971
621 Ga0207698_10082423 3300026142 Bacteria 2600
622 Ga0207698_10204728 3300026142 Bacteria 1770
623 Ga0207698_10224844 3300026142 Bacteria 1699
624 Ga0207698_10246853 3300026142 Bacteria 1631
625 Ga0207698_10365760 3300026142 Bacteria 1367
626 Ga0207698_10424980 3300026142 Bacteria 1276
627 Ga0207698_10478920 3300026142 Bacteria 1207
628 Ga0207698_10990117 3300026142 Unclassified 851
629 Ga0207698_11834691 3300026142 Unclassified 621
630 Ga0268266_10008034 3300028379 Bacteria 9427
631 Ga0268264_10163145 3300028381 Bacteria 2009
632 Ga0307408_100056776 3300031548 Bacteria 2839
633 Ga0307408_100706062 3300031548 Bacteria 907
634 Ga0307405_10510980 3300031731 Unclassified 965
635 Ga0307413_10069858 3300031824 Bacteria 2205
636 Ga0307410_10046796 3300031852 Bacteria 2887
637 Ga0307410_10874639 3300031852 Unclassified 768
638 Ga0307407_10082799 3300031903 Bacteria 1945
639 Ga0307409_100043042 3300031995 Bacteria 3386
640 Ga0307416_100002017 3300032002 Bacteria 11409
641 Ga0307416_100002746 3300032002 Bacteria 10214
642 Ga0307414_11242895 3300032004 Bacteria 690
643 Ga0307411_10026993 3300032005 Bacteria 3466
644 Ga0307411_10421695 3300032005 Bacteria 1109
645 Ga0307415_100004978 3300032126 Bacteria 6990
646 Ga0373950_0120368 3300034818 Bacteria 580
647 Ga0373928_0120946 3300035084 Bacteria 702
648 Ga0373944_0086944 3300035089 Bacteria 1040
649 Ga0373949_0063813 3300035090 Bacteria 953
650 Ga0373923_0258160 3300035111 Bacteria 817
651 Ga0373943_0004797 3300035170 Bacteria 6108
652 Ga0373943_0209055 3300035170 Bacteria 1083
653 Ga0373946_0082908 3300035171 Bacteria 1407
654 Ga0373955_0385931 3300035172 Unclassified 850
655 Ga0373931_0099681 3300035691 Bacteria 1632
656 Ga0373931_1103842 3300035691 Bacteria 540
657 Ga0373947_0025983 3300035725 Bacteria 3417
658 Ga0373925_0068548 3300037068 Bacteria 2678
659 Ga0373925_0222599 3300037068 Bacteria 1507
660 Ga0395899_0000255 3300037312 Bacteria 70382
661 Ga0395899_0009306 3300037312 Bacteria 7544
662 Ga0395899_0020860 3300037312 Bacteria 4969
663 Ga0395899_0038215 3300037312 Bacteria 3596
664 Ga0395899_0056093 3300037312 Bacteria 2912
665 Ga0395899_0081969 3300037312 Bacteria 2346
666 Ga0395899_0211484 3300037312 Bacteria 1347
667 Ga0395899_0287474 3300037312 Bacteria 1116
668 Ga0395899_0306530 3300037312 Unclassified 1073
669 Ga0395899_0420078 3300037312 Bacteria 881
670 Ga0395899_0452383 3300037312 Bacteria 840
671 Ga0395899_0661515 3300037312 Unclassified 659
672 Ga0395900_0000308 3300037418 Bacteria 72664
673 Ga0395900_0011396 3300037418 Bacteria 9100
674 Ga0395900_0012634 3300037418 Bacteria 8634
675 Ga0395900_0019379 3300037418 Bacteria 6938
676 Ga0395900_0080496 3300037418 Bacteria 3347
677 Ga0395900_0081843 3300037418 Bacteria 3316
678 Ga0395900_0118874 3300037418 Bacteria 2712
679 Ga0395900_0126528 3300037418 Bacteria 2621
680 Ga0395900_0137487 3300037418 Bacteria 2503
681 Ga0395900_0153361 3300037418 Bacteria 2353
682 Ga0395900_0189105 3300037418 Bacteria 2089
683 Ga0395900_0204595 3300037418 Bacteria 1995
684 Ga0395900_0214952 3300037418 Bacteria 1940
685 Ga0395900_0293854 3300037418 Bacteria 1613
686 Ga0395900_0317181 3300037418 Bacteria 1540
687 Ga0395900_0323222 3300037418 Bacteria 1522
688 Ga0395900_0323229 3300037418 Bacteria 1522
689 Ga0395900_0368083 3300037418 Bacteria 1407
690 Ga0395900_0381843 3300037418 Bacteria 1376
691 Ga0395900_0449256 3300037418 Bacteria 1245
692 Ga0395900_0588982 3300037418 Bacteria 1053
693 Ga0395900_0686171 3300037418 Bacteria 958
694 Ga0395900_0725241 3300037418 Bacteria 926
695 Ga0395900_0905058 3300037418 Bacteria 805
696 Ga0395898_0000054 3300037466 Bacteria 279561
697 Ga0395898_0008175 3300037466 Bacteria 11074
698 Ga0395898_0018525 3300037466 Bacteria 7095
699 Ga0395898_0026840 3300037466 Bacteria 5788
700 Ga0395898_0034536 3300037466 Bacteria 5039
701 Ga0395898_0047061 3300037466 Bacteria 4234
702 Ga0395898_0091847 3300037466 Bacteria 2920
703 Ga0395898_0123811 3300037466 Bacteria 2477
704 Ga0395898_0128079 3300037466 Bacteria 2432
705 Ga0395898_0242745 3300037466 Bacteria 1718
706 Ga0395898_0303648 3300037466 Bacteria 1522
707 Ga0395898_0303649 3300037466 Bacteria 1522
708 Ga0395898_0361511 3300037466 Bacteria 1384
709 Ga0395898_0808648 3300037466 Bacteria 877
710 Ga0395898_1233077 3300037466 Bacteria 678
711 Ga0395898_1822060 3300037466 Bacteria 529
712 Ga0395905_0000005 3300037471 Bacteria 557808
713 Ga0395905_0002249 3300037471 Bacteria 21706
714 Ga0395905_0005968 3300037471 Bacteria 12337
715 Ga0395905_0009874 3300037471 Bacteria 9303
716 Ga0395905_0010554 3300037471 Bacteria 8972
717 Ga0395905_0011035 3300037471 Bacteria 8743
718 Ga0395905_0021518 3300037471 Bacteria 6098
719 Ga0395905_0021725 3300037471 Bacteria 6071
720 Ga0395905_0026175 3300037471 Bacteria 5501
721 Ga0395905_0026664 3300037471 Bacteria 5448
722 Ga0395905_0036630 3300037471 Bacteria 4608
723 Ga0395905_0045091 3300037471 Bacteria 4136
724 Ga0395905_0045341 3300037471 Bacteria 4123
725 Ga0395905_0055546 3300037471 Bacteria 3705
726 Ga0395905_0058111 3300037471 Bacteria 3617
727 Ga0395905_0067879 3300037471 Bacteria 3340
728 Ga0395905_0091715 3300037471 Bacteria 2848
729 Ga0395905_0112437 3300037471 Bacteria 2558
730 Ga0395905_0276305 3300037471 Bacteria 1565
731 Ga0395905_0278202 3300037471 Bacteria 1559
732 Ga0395905_0283029 3300037471 Bacteria 1544
733 Ga0395905_0386088 3300037471 Bacteria 1294
734 Ga0395905_0509713 3300037471 Bacteria 1103
735 Ga0395905_0600350 3300037471 Bacteria 1002
736 Ga0395905_0603453 3300037471 Unclassified 999
737 Ga0395905_0610706 3300037471 Bacteria 992
738 Ga0395905_0781879 3300037471 Bacteria 857
739 Ga0395905_0838057 3300037471 Bacteria 822
740 Ga0395905_0876684 3300037471 Bacteria 800
741 Ga0395905_0995150 3300037471 Bacteria 741
742 Ga0395905_1220789 3300037471 Bacteria 655
743 Ga0395905_1319058 3300037471 Unclassified 625
744 Ga0395901_0002475 3300038443 Bacteria 18743
745 Ga0395901_0004565 3300038443 Bacteria 13977
746 Ga0395901_0008267 3300038443 Bacteria 10510
747 Ga0395901_0022105 3300038443 Bacteria 6516
748 Ga0395901_0036955 3300038443 Bacteria 5050
749 Ga0395901_0049587 3300038443 Bacteria 4362
750 Ga0395901_0052535 3300038443 Bacteria 4235
751 Ga0395901_0068543 3300038443 Bacteria 3695
752 Ga0395901_0073246 3300038443 Bacteria 3572
753 Ga0395901_0076098 3300038443 Bacteria 3502
754 Ga0395901_0210633 3300038443 Bacteria 2034
755 Ga0395901_0214910 3300038443 Bacteria 2011
756 Ga0395901_0350897 3300038443 Bacteria 1522
757 Ga0395901_0388010 3300038443 Bacteria 1436
758 Ga0395901_0402786 3300038443 Bacteria 1405
759 Ga0395901_0420516 3300038443 Bacteria 1370
760 Ga0395901_0511986 3300038443 Bacteria 1220
761 Ga0395901_0578870 3300038443 Bacteria 1134
762 Ga0395901_0603133 3300038443 Bacteria 1107
763 Ga0395901_0628802 3300038443 Bacteria 1079
764 Ga0395901_0697125 3300038443 Bacteria 1013
765 Ga0395901_0846411 3300038443 Bacteria 900
766 Ga0395901_0886204 3300038443 Bacteria 875
767 Ga0395901_1085758 3300038443 Bacteria 771
768 Ga0395901_1313847 3300038443 Bacteria 684
769 Ga0436365_0334369 3300039437 Bacteria 4991
770 Ga0439448_0006381 3300042005 Bacteria 3390
771 Ga0439432_037635 3300042006 Bacteria 1543
772 Ga0439449_0159720 3300042007 Bacteria 841
773 Ga0439455_0005339 3300042012 Bacteria 2604
774 Ga0439455_0005956 3300042012 Bacteria 2505
775 Ga0439458_0000012 3300042157 Bacteria 27891
776 Ga0466972_0038303 3300044658 Bacteria 2342
777 Ga0466972_0174509 3300044658 Bacteria 1008
778 Ga0466966_0006878 3300044684 Bacteria 7534
779 Ga0466966_0097376 3300044684 Bacteria 1822
780 Ga0466966_0105924 3300044684 Bacteria 1735
781 Ga0466966_0447923 3300044684 Bacteria 776
782 Ga0466966_0583167 3300044684 Bacteria 673
783 Ga0466966_0695116 3300044684 Bacteria 613
784 Ga0466966_0852026 3300044684 Unclassified 549
785 Ga0466961_0078955 3300044693 Bacteria 2084
786 Ga0466963_0048814 3300044694 Bacteria 2798
787 Ga0466963_0212030 3300044694 Bacteria 1355
788 Ga0466963_0333472 3300044694 Bacteria 1068
789 Ga0466963_0625644 3300044694 Bacteria 760
790 Ga0466964_0010281 3300044706 Bacteria 3529
791 Ga0466971_0018338 3300044719 Bacteria 3099
792 Ga0466970_0048727 3300044765 Bacteria 2259
793 Ga0466970_0077358 3300044765 Bacteria 1793
794 Ga0466970_0530737 3300044765 Unclassified 679
795 Ga0466957_0065599 3300044842 Bacteria 2236
796 Ga0466957_0649881 3300044842 Bacteria 741
797 Ga0466960_0026401 3300044901 Bacteria 2638
798 Ga0466959_0030940 3300045049 Bacteria 3963
799 Ga0466959_0106087 3300045049 Bacteria 2009
800 Ga0466959_0360371 3300045049 Unclassified 991
801 Ga0466959_0369563 3300045049 Bacteria 977
802 Ga0466958_0003925 3300045836 Bacteria 7796
803 Ga0466958_0015665 3300045836 Bacteria 4350
804 Ga0466958_0165117 3300045836 Bacteria 1400
805 Ga0466958_1044708 3300045836 Bacteria 533
806 Ga0466967_0422698 3300045976 Bacteria 1299
807 Ga0466967_0694958 3300045976 Bacteria 1007
808 Ga0466967_0782641 3300045976 Bacteria 947
809 Ga0495629_0224959 3300046459 Bacteria 1294
810 Ga0495639_0430492 3300046475 Unclassified 669
811 Ga0495643_0145691 3300046522 Bacteria 1177
812 Ga0495663_0192840 3300046525 Bacteria 709
813 Ga0495598_0000260 3300046537 Bacteria 9513
814 Ga0495621_0000141 3300046539 Bacteria 15332
815 Ga0495621_0258039 3300046539 Bacteria 713
816 Ga0495669_0273968 3300046684 Bacteria 811
817 Ga0495670_0001090 3300046691 Bacteria 13174
818 Ga0495600_0601471 3300046809 Unclassified 668
819 Ga0496100_0011309 3300048903 Bacteria 5079
820 Ga0496100_0180754 3300048903 Bacteria 1525
821 Ga0496101_0001753 3300048904 Bacteria 13007
822 Ga0496101_0060013 3300048904 Bacteria 2758
823 Ga0496101_0420496 3300048904 Unclassified 1053
824 Ga0496101_0490997 3300048904 Bacteria 970
825 Ga0496102_0048281 3300048905 Bacteria 3870
826 Ga0496102_0068861 3300048905 Bacteria 3248
827 Ga0496102_0450043 3300048905 Unclassified 1208
828 Ga0496102_0756720 3300048905 Bacteria 894
829 Ga0496103_0016593 3300048906 Bacteria 4395
830 Ga0496103_0080909 3300048906 Bacteria 2043
831 Ga0496103_0483535 3300048906 Bacteria 793
832 Ga0496104_0253425 3300048907 Bacteria 1673
833 Ga0496105_0094720 3300048908 Bacteria 2466
834 Ga0496106_0035893 3300048909 Bacteria 3708
835 Ga0496106_0059332 3300048909 Bacteria 2898
836 Ga0496106_0406801 3300048909 Bacteria 1094
837 Ga0496106_0481769 3300048909 Bacteria 997
838 Ga0496106_0900057 3300048909 Bacteria 699
839 Ga0496107_0016637 3300048910 Bacteria 5167
840 Ga0496107_0340199 3300048910 Bacteria 1116
841 Ga0496108_0001744 3300048911 Bacteria 17271
842 Ga0496108_0002538 3300048911 Bacteria 14612
843 Ga0496108_0013638 3300048911 Bacteria 6634
844 Ga0496108_0580004 3300048911 Bacteria 978
845 Ga0496109_0012585 3300048912 Bacteria 7305
846 Ga0496109_0019207 3300048912 Bacteria 6020
847 Ga0496110_0002765 3300048913 Bacteria 13248
848 Ga0496110_0013487 3300048913 Bacteria 6759
849 Ga0496111_0026521 3300048914 Bacteria 4093
850 Ga0496111_0118118 3300048914 Bacteria 1957
851 Ga0496112_0006596 3300048915 Bacteria 10213
852 Ga0496112_0015341 3300048915 Bacteria 7144
853 Ga0496112_0015503 3300048915 Bacteria 7116
854 Ga0496112_0083338 3300048915 Bacteria 3162
855 Ga0496112_0111255 3300048915 Bacteria 2709
856 Ga0496112_0143170 3300048915 Bacteria 2360
857 Ga0496113_0007832 3300048916 Bacteria 6904
858 Ga0496113_0009435 3300048916 Bacteria 6401
859 Ga0496113_0017930 3300048916 Bacteria 4923
860 Ga0496113_0047337 3300048916 Unclassified 3195
861 Ga0496113_0497700 3300048916 Bacteria 979
862 Ga0496114_0000016 3300048917 Bacteria 274656
863 Ga0496114_0018758 3300048917 Bacteria 5599
864 Ga0496115_0445548 3300048918 Bacteria 1046
865 Ga0501067_0007369 3300049583 Bacteria 6111
866 Ga0501068_0480315 3300049584 Bacteria 805
867 Ga0501069_0124363 3300049585 Bacteria 1474
868 Ga0501209_005570 3300049656 Bacteria 2284
869 Ga0501211_021198 3300049658 Bacteria 684
870 Ga0501216_019369 3300049660 Bacteria 1180
871 Ga0501217_084876 3300049661 Bacteria 882
872 Ga0501233_022828 3300049668 Bacteria 1355
873 Ga0501235_009855 3300049669 Bacteria 2089
874 Ga0501242_005751 3300049674 Bacteria 1403
875 Ga0501243_019493 3300049675 Bacteria 1112
876 Ga0501249_008573 3300049679 Bacteria 2122
877 Ga0501252_023175 3300049682 Bacteria 824
878 Ga0501221_005493 3300049704 Bacteria 2120
879 Ga0501229_009596 3300049706 Bacteria 1217
880 Ga0501234_003160 3300049707 Bacteria 2591
881 Ga0501262_080626 3300049759 Unclassified 544
882 Ga0501266_093433 3300049763 Unclassified 525
883 Ga0501268_000552 3300049765 Bacteria 4122
884 Ga0501212_008763 3300049851 Bacteria 1413
885 Ga0495595_0136359 3300053084 Bacteria 1202

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0661515 Ga0395899_0661515_113_574 129
2 3300037418 Ga0395900_0293854 Ga0395900_0293854_868_1329 129
3 3300045976 Ga0466967_0694958 Ga0466967_0694958_157_639 131
4 3300005364 Ga0070673_100869071 Ga0070673_1008690712 133
5 3300013104 Ga0157370_10356717 Ga0157370_103567171 133
6 3300045976 Ga0466967_0782641 Ga0466967_0782641_23_454 133
7 3300005435 Ga0070714_100133863 Ga0070714_1001338633 134
8 3300005458 Ga0070681_10343395 Ga0070681_103433953 134
9 3300005535 Ga0070684_101445390 Ga0070684_1014453901 134
10 3300005563 Ga0068855_100225252 Ga0068855_1002252522 134
11 3300013100 Ga0157373_10082890 Ga0157373_100828903 134
12 3300013104 Ga0157370_11046511 Ga0157370_110465112 134
13 3300020082 Ga0206353_10506929 Ga0206353_105069291 134
14 3300025912 Ga0207707_10536319 Ga0207707_105363192 134
15 3300025920 Ga0207649_10061755 Ga0207649_100617552 134
16 3300025929 Ga0207664_10428650 Ga0207664_104286502 134
17 3300025949 Ga0207667_10169314 Ga0207667_101693143 134
18 3300037418 Ga0395900_0368083 Ga0395900_0368083_798_1271 134
19 3300037418 Ga0395900_0449256 Ga0395900_0449256_606_1076 134
20 3300037471 Ga0395905_0283029 Ga0395905_0283029_886_1356 134
21 3300037471 Ga0395905_0386088 Ga0395905_0386088_81_554 134
22 3300037471 Ga0395905_0995150 Ga0395905_0995150_190_663 134
23 3300037471 Ga0395905_1319058 Ga0395905_1319058_79_552 134
24 3300038443 Ga0395901_1085758 Ga0395901_1085758_137_610 134
25 3300005335 Ga0070666_10028328 Ga0070666_100283284 135
26 3300005338 Ga0068868_100380073 Ga0068868_1003800732 135
27 3300005367 Ga0070667_100208062 Ga0070667_1002080623 135
28 3300013308 Ga0157375_11427103 Ga0157375_114271031 135
29 3300025903 Ga0207680_10054410 Ga0207680_100544102 135
30 3300025960 Ga0207651_10476137 Ga0207651_104761372 135
31 3300048917 Ga0496114_0000016 Ga0496114_0000016_259264_259713 135
32 3300005436 Ga0070713_102023214 Ga0070713_1020232141 136
33 3300009093 Ga0105240_10357186 Ga0105240_103571862 136
34 3300025904 Ga0207647_10085192 Ga0207647_100851921 136
35 3300044765 Ga0466970_0048727 Ga0466970_0048727_1201_1641 136
36 3300005355 Ga0070671_100091963 Ga0070671_1000919632 137
37 3300013297 Ga0157378_10788027 Ga0157378_107880272 137
38 3300025931 Ga0207644_10321703 Ga0207644_103217033 137
39 3300044684 Ga0466966_0006878 Ga0466966_0006878_1366_1824 139
40 3300045049 Ga0466959_0030940 Ga0466959_0030940_2309_2767 139
41 3300044694 Ga0466963_0625644 Ga0466963_0625644_258_725 140
42 3300002239 JGI24034J26672_10004989 JGI24034J26672_100049892 143
43 3300005330 Ga0070690_100240527 Ga0070690_1002405272 143
44 3300005331 Ga0070670_100002043 Ga0070670_10000204315 143
45 3300005333 Ga0070677_10402896 Ga0070677_104028962 143
46 3300005335 Ga0070666_10000877 Ga0070666_1000087716 143
47 3300005338 Ga0068868_100054365 Ga0068868_1000543653 143
48 3300005344 Ga0070661_100022428 Ga0070661_1000224282 143
49 3300005354 Ga0070675_100022113 Ga0070675_1000221136 143
50 3300005355 Ga0070671_100015111 Ga0070671_1000151114 143
51 3300005364 Ga0070673_100008965 Ga0070673_1000089654 143
52 3300005367 Ga0070667_100004036 Ga0070667_1000040367 143
53 3300005367 Ga0070667_100327653 Ga0070667_1003276532 143
54 3300005456 Ga0070678_100002062 Ga0070678_1000020626 143
55 3300005456 Ga0070678_101515479 Ga0070678_1015154791 143
56 3300005457 Ga0070662_100001323 Ga0070662_10000132314 143
57 3300005466 Ga0070685_10029982 Ga0070685_100299823 143
58 3300005548 Ga0070665_100050630 Ga0070665_1000506302 143
59 3300005564 Ga0070664_100004583 Ga0070664_10000458310 143
60 3300005616 Ga0068852_100007881 Ga0068852_1000078812 143
61 3300005617 Ga0068859_100250995 Ga0068859_1002509952 143
62 3300005618 Ga0068864_100008756 Ga0068864_1000087564 143
63 3300005841 Ga0068863_100020336 Ga0068863_1000203367 143
64 3300005842 Ga0068858_100015586 Ga0068858_1000155862 143
65 3300006237 Ga0097621_100098106 Ga0097621_1000981062 143
66 3300006237 Ga0097621_100240914 Ga0097621_1002409142 143
67 3300006358 Ga0068871_100024968 Ga0068871_1000249685 143
68 3300006931 Ga0097620_100250982 Ga0097620_1002509824 143
69 3300009177 Ga0105248_10004589 Ga0105248_100045897 143
70 3300009177 Ga0105248_10039061 Ga0105248_100390615 143
71 3300009177 Ga0105248_11718686 Ga0105248_117186862 143
72 3300009551 Ga0105238_11300184 Ga0105238_113001842 143
73 3300013105 Ga0157369_10177092 Ga0157369_101770922 143
74 3300013296 Ga0157374_10006812 Ga0157374_1000681210 143
75 3300013306 Ga0163162_10008116 Ga0163162_100081164 143
76 3300013307 Ga0157372_11723683 Ga0157372_117236832 143
77 3300013308 Ga0157375_10002069 Ga0157375_1000206910 143
78 3300014325 Ga0163163_10005023 Ga0163163_100050238 143
79 3300025893 Ga0207682_10156195 Ga0207682_101561952 143
80 3300025903 Ga0207680_10002816 Ga0207680_100028163 143
81 3300025920 Ga0207649_10006477 Ga0207649_100064772 143
82 3300025925 Ga0207650_10001872 Ga0207650_100018727 143
83 3300025931 Ga0207644_10000847 Ga0207644_1000084714 143
84 3300025931 Ga0207644_10313397 Ga0207644_103133972 143
85 3300025933 Ga0207706_10000253 Ga0207706_1000025324 143
86 3300025941 Ga0207711_10002790 Ga0207711_1000279012 143
87 3300025941 Ga0207711_10033742 Ga0207711_100337424 143
88 3300025945 Ga0207679_10011664 Ga0207679_100116644 143
89 3300025949 Ga0207667_10096314 Ga0207667_100963144 143
90 3300025949 Ga0207667_10583559 Ga0207667_105835592 143
91 3300025960 Ga0207651_10006825 Ga0207651_100068255 143
92 3300025981 Ga0207640_10201935 Ga0207640_102019351 143
93 3300025986 Ga0207658_10007111 Ga0207658_100071118 143
94 3300026023 Ga0207677_10006993 Ga0207677_100069936 143
95 3300026035 Ga0207703_10003444 Ga0207703_100034447 143
96 3300026078 Ga0207702_10415644 Ga0207702_104156442 143
97 3300026088 Ga0207641_10004961 Ga0207641_1000496110 143
98 3300026095 Ga0207676_10002086 Ga0207676_100020864 143
99 3300026121 Ga0207683_10001185 Ga0207683_1000118520 143
100 3300026142 Ga0207698_10035892 Ga0207698_100358922 143
101 3300028379 Ga0268266_10008034 Ga0268266_1000803412 143
102 3300037312 Ga0395899_0452383 Ga0395899_0452383_320_793 143
103 3300037418 Ga0395900_0317181 Ga0395900_0317181_40_471 143
104 3300037418 Ga0395900_0588982 Ga0395900_0588982_74_547 143
105 3300037471 Ga0395905_0021518 Ga0395905_0021518_1034_1465 143
106 3300037471 Ga0395905_0610706 Ga0395905_0610706_158_631 143
107 3300038443 Ga0395901_0388010 Ga0395901_0388010_369_800 143
108 3300044684 Ga0466966_0852026 Ga0466966_0852026_59_526 143
109 3300045836 Ga0466958_1044708 Ga0466958_1044708_55_510 143
110 3300046459 Ga0495629_0224959 Ga0495629_0224959_137_574 143
111 3300046475 Ga0495639_0430492 Ga0495639_0430492_18_455 143
112 3300048903 Ga0496100_0180754 Ga0496100_0180754_301_738 143
113 3300048904 Ga0496101_0060013 Ga0496101_0060013_1852_2289 143
114 3300048904 Ga0496101_0420496 Ga0496101_0420496_185_622 143
115 3300048905 Ga0496102_0068861 Ga0496102_0068861_514_951 143
116 3300048906 Ga0496103_0080909 Ga0496103_0080909_1288_1725 143
117 3300048907 Ga0496104_0253425 Ga0496104_0253425_666_1103 143
118 3300048909 Ga0496106_0059332 Ga0496106_0059332_1709_2146 143
119 3300048910 Ga0496107_0340199 Ga0496107_0340199_49_486 143
120 3300048911 Ga0496108_0001744 Ga0496108_0001744_3367_3804 143
121 3300048912 Ga0496109_0012585 Ga0496109_0012585_1790_2227 143
122 3300048913 Ga0496110_0002765 Ga0496110_0002765_5079_5516 143
123 3300048914 Ga0496111_0026521 Ga0496111_0026521_1730_2167 143
124 3300048915 Ga0496112_0015341 Ga0496112_0015341_2328_2765 143
125 3300048915 Ga0496112_0111255 Ga0496112_0111255_695_1135 143
126 3300048916 Ga0496113_0007832 Ga0496113_0007832_2413_2850 143
127 3300048916 Ga0496113_0497700 Ga0496113_0497700_446_886 143
128 3300048917 Ga0496114_0018758 Ga0496114_0018758_2834_3271 143
129 3300048918 Ga0496115_0445548 Ga0496115_0445548_53_490 143
130 3300005331 Ga0070670_100159440 Ga0070670_1001594402 144
131 3300005344 Ga0070661_100358954 Ga0070661_1003589542 144
132 3300005354 Ga0070675_101746403 Ga0070675_1017464031 144
133 3300005355 Ga0070671_100003631 Ga0070671_10000363112 144
134 3300005355 Ga0070671_100004155 Ga0070671_10000415514 144
135 3300005355 Ga0070671_100009032 Ga0070671_1000090322 144
136 3300005364 Ga0070673_100146154 Ga0070673_1001461542 144
137 3300005367 Ga0070667_101831747 Ga0070667_1018317471 144
138 3300005435 Ga0070714_100022207 Ga0070714_1000222073 144
139 3300005436 Ga0070713_100319514 Ga0070713_1003195143 144
140 3300005456 Ga0070678_100012893 Ga0070678_1000128936 144
141 3300005457 Ga0070662_100006647 Ga0070662_1000066476 144
142 3300005543 Ga0070672_100193546 Ga0070672_1001935462 144
143 3300005543 Ga0070672_100399319 Ga0070672_1003993192 144
144 3300005564 Ga0070664_100538408 Ga0070664_1005384082 144
145 3300005616 Ga0068852_100191532 Ga0068852_1001915323 144
146 3300005618 Ga0068864_100001952 Ga0068864_10000195215 144
147 3300009177 Ga0105248_10002500 Ga0105248_1000250011 144
148 3300009177 Ga0105248_10112061 Ga0105248_101120613 144
149 3300013306 Ga0163162_10277612 Ga0163162_102776122 144
150 3300025903 Ga0207680_10022081 Ga0207680_100220812 144
151 3300025920 Ga0207649_10628796 Ga0207649_106287962 144
152 3300025925 Ga0207650_10378579 Ga0207650_103785792 144
153 3300025926 Ga0207659_11313156 Ga0207659_113131562 144
154 3300025928 Ga0207700_10193889 Ga0207700_101938893 144
155 3300025931 Ga0207644_10000773 Ga0207644_1000077315 144
156 3300025931 Ga0207644_10000998 Ga0207644_100009982 144
157 3300025932 Ga0207690_10651968 Ga0207690_106519682 144
158 3300025933 Ga0207706_10005402 Ga0207706_1000540215 144
159 3300025940 Ga0207691_10040509 Ga0207691_100405095 144
160 3300025940 Ga0207691_10435378 Ga0207691_104353782 144
161 3300025941 Ga0207711_10005331 Ga0207711_1000533111 144
162 3300025944 Ga0207661_11323335 Ga0207661_113233351 144
163 3300025945 Ga0207679_10456368 Ga0207679_104563682 144
164 3300025960 Ga0207651_10100537 Ga0207651_101005373 144
165 3300025986 Ga0207658_11465508 Ga0207658_114655081 144
166 3300026088 Ga0207641_10944613 Ga0207641_109446132 144
167 3300026095 Ga0207676_10058420 Ga0207676_100584203 144
168 3300026121 Ga0207683_10002289 Ga0207683_1000228913 144
169 3300026142 Ga0207698_10059285 Ga0207698_100592852 144
170 3300037418 Ga0395900_0011396 Ga0395900_0011396_4437_4889 144
171 3300037418 Ga0395900_0204595 Ga0395900_0204595_708_1145 144
172 3300037466 Ga0395898_0047061 Ga0395898_0047061_2947_3384 144
173 3300037466 Ga0395898_0123811 Ga0395898_0123811_186_638 144
174 3300037471 Ga0395905_0009874 Ga0395905_0009874_8486_8938 144
175 3300037471 Ga0395905_0045341 Ga0395905_0045341_282_719 144
176 3300038443 Ga0395901_0049587 Ga0395901_0049587_3075_3512 144
177 3300038443 Ga0395901_0402786 Ga0395901_0402786_107_559 144
178 3300048904 Ga0496101_0490997 Ga0496101_0490997_264_707 144
179 3300048905 Ga0496102_0450043 Ga0496102_0450043_170_610 144
180 3300048909 Ga0496106_0406801 Ga0496106_0406801_295_738 144
181 3300048911 Ga0496108_0013638 Ga0496108_0013638_5882_6322 144
182 3300048912 Ga0496109_0019207 Ga0496109_0019207_931_1371 144
183 3300048915 Ga0496112_0006596 Ga0496112_0006596_1728_2168 144
184 3300048916 Ga0496113_0047337 Ga0496113_0047337_738_1178 144
185 3300003320 rootH2_10129989 rootH2_101299892 145
186 3300003323 rootH1_10057877 rootH1_100578773 145
187 3300005327 Ga0070658_10410330 Ga0070658_104103302 145
188 3300005327 Ga0070658_10539273 Ga0070658_105392732 145
189 3300005327 Ga0070658_11129490 Ga0070658_111294902 145
190 3300005327 Ga0070658_11410324 Ga0070658_114103241 145
191 3300005328 Ga0070676_10060754 Ga0070676_100607542 145
192 3300005329 Ga0070683_100607702 Ga0070683_1006077022 145
193 3300005331 Ga0070670_100002145 Ga0070670_1000021454 145
194 3300005336 Ga0070680_100151075 Ga0070680_1001510753 145
195 3300005336 Ga0070680_100285536 Ga0070680_1002855362 145
196 3300005339 Ga0070660_100032137 Ga0070660_1000321373 145
197 3300005339 Ga0070660_100068844 Ga0070660_1000688444 145
198 3300005339 Ga0070660_100155061 Ga0070660_1001550612 145
199 3300005339 Ga0070660_100175854 Ga0070660_1001758541 145
200 3300005344 Ga0070661_100001787 Ga0070661_1000017879 145
201 3300005344 Ga0070661_100008568 Ga0070661_1000085688 145
202 3300005344 Ga0070661_100034430 Ga0070661_1000344302 145
203 3300005356 Ga0070674_100899984 Ga0070674_1008999842 145
204 3300005366 Ga0070659_100016639 Ga0070659_1000166397 145
205 3300005366 Ga0070659_100547383 Ga0070659_1005473832 145
206 3300005366 Ga0070659_101347466 Ga0070659_1013474661 145
207 3300005435 Ga0070714_100028449 Ga0070714_1000284492 145
208 3300005436 Ga0070713_100079950 Ga0070713_1000799502 145
209 3300005455 Ga0070663_100071942 Ga0070663_1000719422 145
210 3300005455 Ga0070663_100108379 Ga0070663_1001083792 145
211 3300005457 Ga0070662_100149183 Ga0070662_1001491831 145
212 3300005457 Ga0070662_100250395 Ga0070662_1002503952 145
213 3300005457 Ga0070662_100430257 Ga0070662_1004302572 145
214 3300005457 Ga0070662_100530355 Ga0070662_1005303552 145
215 3300005457 Ga0070662_101461638 Ga0070662_1014616381 145
216 3300005458 Ga0070681_10143556 Ga0070681_101435562 145
217 3300005459 Ga0068867_100262102 Ga0068867_1002621022 145
218 3300005530 Ga0070679_100033833 Ga0070679_1000338336 145
219 3300005539 Ga0068853_100385497 Ga0068853_1003854973 145
220 3300005539 Ga0068853_100454856 Ga0068853_1004548561 145
221 3300005539 Ga0068853_101204120 Ga0068853_1012041202 145
222 3300005543 Ga0070672_100037701 Ga0070672_1000377015 145
223 3300005563 Ga0068855_100166060 Ga0068855_1001660604 145
224 3300005564 Ga0070664_100005728 Ga0070664_1000057287 145
225 3300005564 Ga0070664_100013554 Ga0070664_1000135544 145
226 3300005577 Ga0068857_100171813 Ga0068857_1001718134 145
227 3300005577 Ga0068857_100212268 Ga0068857_1002122682 145
228 3300005578 Ga0068854_100009843 Ga0068854_1000098436 145
229 3300005578 Ga0068854_100185912 Ga0068854_1001859122 145
230 3300005614 Ga0068856_101147068 Ga0068856_1011470682 145
231 3300005616 Ga0068852_100181379 Ga0068852_1001813793 145
232 3300005616 Ga0068852_100348263 Ga0068852_1003482632 145
233 3300005616 Ga0068852_100618103 Ga0068852_1006181032 145
234 3300005616 Ga0068852_100886851 Ga0068852_1008868512 145
235 3300005618 Ga0068864_100018445 Ga0068864_1000184455 145
236 3300006028 Ga0070717_10034526 Ga0070717_100345263 145
237 3300006173 Ga0070716_100025494 Ga0070716_1000254943 145
238 3300009551 Ga0105238_10181661 Ga0105238_101816613 145
239 3300009551 Ga0105238_10395057 Ga0105238_103950571 145
240 3300013100 Ga0157373_10132984 Ga0157373_101329842 145
241 3300013102 Ga0157371_10096631 Ga0157371_100966312 145
242 3300013102 Ga0157371_11318291 Ga0157371_113182911 145
243 3300013104 Ga0157370_10097694 Ga0157370_100976943 145
244 3300013104 Ga0157370_10553265 Ga0157370_105532652 145
245 3300013105 Ga0157369_10112222 Ga0157369_101122223 145
246 3300013297 Ga0157378_10378559 Ga0157378_103785592 145
247 3300013307 Ga0157372_10320909 Ga0157372_103209093 145
248 3300013307 Ga0157372_10629150 Ga0157372_106291503 145
249 3300013307 Ga0157372_11503142 Ga0157372_115031422 145
250 3300025893 Ga0207682_10024752 Ga0207682_100247522 145
251 3300025901 Ga0207688_10801516 Ga0207688_108015162 145
252 3300025904 Ga0207647_10214681 Ga0207647_102146813 145
253 3300025909 Ga0207705_10005892 Ga0207705_100058922 145
254 3300025917 Ga0207660_10563670 Ga0207660_105636702 145
255 3300025919 Ga0207657_10037057 Ga0207657_100370574 145
256 3300025919 Ga0207657_10046829 Ga0207657_100468292 145
257 3300025919 Ga0207657_10064016 Ga0207657_100640164 145
258 3300025919 Ga0207657_10251239 Ga0207657_102512392 145
259 3300025919 Ga0207657_10985601 Ga0207657_109856011 145
260 3300025920 Ga0207649_10007819 Ga0207649_100078195 145
261 3300025920 Ga0207649_10028634 Ga0207649_100286342 145
262 3300025920 Ga0207649_10742575 Ga0207649_107425752 145
263 3300025921 Ga0207652_10103873 Ga0207652_101038732 145
264 3300025925 Ga0207650_10007236 Ga0207650_100072363 145
265 3300025928 Ga0207700_10239641 Ga0207700_102396413 145
266 3300025929 Ga0207664_10043401 Ga0207664_100434016 145
267 3300025932 Ga0207690_10970886 Ga0207690_109708861 145
268 3300025933 Ga0207706_10120757 Ga0207706_101207572 145
269 3300025933 Ga0207706_10292083 Ga0207706_102920832 145
270 3300025933 Ga0207706_10753964 Ga0207706_107539642 145
271 3300025937 Ga0207669_10014692 Ga0207669_100146925 145
272 3300025939 Ga0207665_10040756 Ga0207665_100407562 145
273 3300025945 Ga0207679_10006100 Ga0207679_100061004 145
274 3300025945 Ga0207679_10007359 Ga0207679_100073598 145
275 3300025945 Ga0207679_11605049 Ga0207679_116050491 145
276 3300025949 Ga0207667_10429502 Ga0207667_104295022 145
277 3300025981 Ga0207640_10003637 Ga0207640_100036378 145
278 3300025981 Ga0207640_11247253 Ga0207640_112472531 145
279 3300026041 Ga0207639_10353310 Ga0207639_103533101 145
280 3300026041 Ga0207639_10964253 Ga0207639_109642532 145
281 3300026067 Ga0207678_10033261 Ga0207678_100332614 145
282 3300026067 Ga0207678_10125462 Ga0207678_101254624 145
283 3300026089 Ga0207648_10010729 Ga0207648_100107298 145
284 3300026095 Ga0207676_10050546 Ga0207676_100505464 145
285 3300026116 Ga0207674_10024503 Ga0207674_100245037 145
286 3300026116 Ga0207674_10890687 Ga0207674_108906871 145
287 3300026121 Ga0207683_10064773 Ga0207683_100647734 145
288 3300026121 Ga0207683_10751853 Ga0207683_107518532 145
289 3300026142 Ga0207698_10204728 Ga0207698_102047282 145
290 3300026142 Ga0207698_10246853 Ga0207698_102468532 145
291 3300026142 Ga0207698_10424980 Ga0207698_104249802 145
292 3300031548 Ga0307408_100056776 Ga0307408_1000567763 145
293 3300031548 Ga0307408_100706062 Ga0307408_1007060622 145
294 3300031824 Ga0307413_10069858 Ga0307413_100698582 145
295 3300031852 Ga0307410_10046796 Ga0307410_100467963 145
296 3300031852 Ga0307410_10874639 Ga0307410_108746392 145
297 3300031903 Ga0307407_10082799 Ga0307407_100827992 145
298 3300031995 Ga0307409_100043042 Ga0307409_1000430426 145
299 3300032002 Ga0307416_100002017 Ga0307416_10000201712 145
300 3300032002 Ga0307416_100002746 Ga0307416_10000274612 145
301 3300032004 Ga0307414_11242895 Ga0307414_112428952 145
302 3300032005 Ga0307411_10026993 Ga0307411_100269933 145
303 3300032005 Ga0307411_10421695 Ga0307411_104216953 145
304 3300034818 Ga0373950_0120368 Ga0373950_0120368_89_535 145
305 3300035170 Ga0373943_0004797 Ga0373943_0004797_5532_5990 145
306 3300035171 Ga0373946_0082908 Ga0373946_0082908_69_527 145
307 3300035691 Ga0373931_1103842 Ga0373931_1103842_36_494 145
308 3300035725 Ga0373947_0025983 Ga0373947_0025983_2760_3218 145
309 3300037068 Ga0373925_0068548 Ga0373925_0068548_1126_1584 145
310 3300037418 Ga0395900_0725241 Ga0395900_0725241_315_773 145
311 3300037471 Ga0395905_0002249 Ga0395905_0002249_2508_2954 145
312 3300042006 Ga0439432_037635 Ga0439432_037635_537_983 145
313 3300042007 Ga0439449_0159720 Ga0439449_0159720_313_759 145
314 3300048905 Ga0496102_0756720 Ga0496102_0756720_250_708 145
315 3300048906 Ga0496103_0483535 Ga0496103_0483535_218_676 145
316 3300049656 Ga0501209_005570 Ga0501209_005570_1814_2260 145
317 3300049658 Ga0501211_021198 Ga0501211_021198_50_496 145
318 3300049660 Ga0501216_019369 Ga0501216_019369_410_856 145
319 3300049661 Ga0501217_084876 Ga0501217_084876_136_582 145
320 3300049668 Ga0501233_022828 Ga0501233_022828_80_526 145
321 3300049669 Ga0501235_009855 Ga0501235_009855_80_526 145
322 3300049674 Ga0501242_005751 Ga0501242_005751_569_1015 145
323 3300049675 Ga0501243_019493 Ga0501243_019493_295_741 145
324 3300049679 Ga0501249_008573 Ga0501249_008573_1192_1638 145
325 3300049682 Ga0501252_023175 Ga0501252_023175_367_813 145
326 3300049704 Ga0501221_005493 Ga0501221_005493_82_528 145
327 3300049706 Ga0501229_009596 Ga0501229_009596_164_610 145
328 3300049707 Ga0501234_003160 Ga0501234_003160_1721_2167 145
329 3300049759 Ga0501262_080626 Ga0501262_080626_19_465 145
330 3300049763 Ga0501266_093433 Ga0501266_093433_35_481 145
331 3300049765 Ga0501268_000552 Ga0501268_000552_2759_3205 145
332 3300049851 Ga0501212_008763 Ga0501212_008763_250_696 145
333 3300001991 JGI24743J22301_10009435 JGI24743J22301_100094353 146
334 3300002077 JGI24744J21845_10000021 JGI24744J21845_100000216 146
335 3300005327 Ga0070658_10041477 Ga0070658_100414776 146
336 3300005327 Ga0070658_10072568 Ga0070658_100725683 146
337 3300005327 Ga0070658_10148511 Ga0070658_101485112 146
338 3300005327 Ga0070658_10311372 Ga0070658_103113723 146
339 3300005328 Ga0070676_10085256 Ga0070676_100852562 146
340 3300005328 Ga0070676_10494197 Ga0070676_104941972 146
341 3300005329 Ga0070683_100004824 Ga0070683_1000048249 146
342 3300005329 Ga0070683_100086884 Ga0070683_1000868843 146
343 3300005330 Ga0070690_100022321 Ga0070690_1000223216 146
344 3300005330 Ga0070690_100023448 Ga0070690_1000234484 146
345 3300005330 Ga0070690_100793039 Ga0070690_1007930392 146
346 3300005331 Ga0070670_100016978 Ga0070670_1000169787 146
347 3300005331 Ga0070670_100151347 Ga0070670_1001513472 146
348 3300005331 Ga0070670_100171378 Ga0070670_1001713782 146
349 3300005331 Ga0070670_100268635 Ga0070670_1002686352 146
350 3300005333 Ga0070677_10018338 Ga0070677_100183382 146
351 3300005335 Ga0070666_10004850 Ga0070666_100048506 146
352 3300005335 Ga0070666_10045968 Ga0070666_100459683 146
353 3300005336 Ga0070680_100002845 Ga0070680_10000284511 146
354 3300005336 Ga0070680_100739952 Ga0070680_1007399522 146
355 3300005337 Ga0070682_100024258 Ga0070682_1000242583 146
356 3300005337 Ga0070682_100223562 Ga0070682_1002235622 146
357 3300005337 Ga0070682_100790442 Ga0070682_1007904421 146
358 3300005338 Ga0068868_100000540 Ga0068868_10000054025 146
359 3300005338 Ga0068868_100151402 Ga0068868_1001514023 146
360 3300005338 Ga0068868_100533013 Ga0068868_1005330132 146
361 3300005339 Ga0070660_100009593 Ga0070660_1000095933 146
362 3300005339 Ga0070660_100060950 Ga0070660_1000609501 146
363 3300005339 Ga0070660_100145188 Ga0070660_1001451881 146
364 3300005339 Ga0070660_100151237 Ga0070660_1001512372 146
365 3300005339 Ga0070660_100239239 Ga0070660_1002392392 146
366 3300005339 Ga0070660_100951722 Ga0070660_1009517221 146
367 3300005340 Ga0070689_100131542 Ga0070689_1001315423 146
368 3300005341 Ga0070691_10002720 Ga0070691_100027206 146
369 3300005343 Ga0070687_100465319 Ga0070687_1004653192 146
370 3300005344 Ga0070661_100026281 Ga0070661_1000262812 146
371 3300005344 Ga0070661_100084876 Ga0070661_1000848763 146
372 3300005344 Ga0070661_100096580 Ga0070661_1000965803 146
373 3300005344 Ga0070661_100107317 Ga0070661_1001073173 146
374 3300005344 Ga0070661_100371003 Ga0070661_1003710032 146
375 3300005345 Ga0070692_10279000 Ga0070692_102790002 146
376 3300005353 Ga0070669_100252359 Ga0070669_1002523592 146
377 3300005354 Ga0070675_100089053 Ga0070675_1000890532 146
378 3300005354 Ga0070675_100586772 Ga0070675_1005867722 146
379 3300005355 Ga0070671_100008614 Ga0070671_1000086145 146
380 3300005355 Ga0070671_100061193 Ga0070671_1000611933 146
381 3300005355 Ga0070671_100855138 Ga0070671_1008551382 146
382 3300005356 Ga0070674_100009512 Ga0070674_1000095122 146
383 3300005356 Ga0070674_100011429 Ga0070674_1000114293 146
384 3300005356 Ga0070674_100072363 Ga0070674_1000723634 146
385 3300005356 Ga0070674_100089221 Ga0070674_1000892213 146
386 3300005364 Ga0070673_100028107 Ga0070673_1000281074 146
387 3300005364 Ga0070673_101076417 Ga0070673_1010764171 146
388 3300005366 Ga0070659_100012198 Ga0070659_1000121987 146
389 3300005366 Ga0070659_100024356 Ga0070659_1000243564 146
390 3300005366 Ga0070659_100084675 Ga0070659_1000846752 146
391 3300005366 Ga0070659_100198738 Ga0070659_1001987383 146
392 3300005367 Ga0070667_100001880 Ga0070667_1000018806 146
393 3300005367 Ga0070667_100042051 Ga0070667_1000420512 146
394 3300005434 Ga0070709_10665003 Ga0070709_106650031 146
395 3300005435 Ga0070714_100318947 Ga0070714_1003189472 146
396 3300005436 Ga0070713_100168117 Ga0070713_1001681172 146
397 3300005455 Ga0070663_100016307 Ga0070663_1000163074 146
398 3300005455 Ga0070663_100032252 Ga0070663_1000322522 146
399 3300005455 Ga0070663_100057503 Ga0070663_1000575033 146
400 3300005455 Ga0070663_100169718 Ga0070663_1001697182 146
401 3300005455 Ga0070663_100230312 Ga0070663_1002303122 146
402 3300005456 Ga0070678_100214885 Ga0070678_1002148852 146
403 3300005457 Ga0070662_100018683 Ga0070662_1000186836 146
404 3300005457 Ga0070662_100124332 Ga0070662_1001243323 146
405 3300005458 Ga0070681_10071742 Ga0070681_100717424 146
406 3300005459 Ga0068867_100323444 Ga0068867_1003234442 146
407 3300005459 Ga0068867_100740138 Ga0068867_1007401382 146
408 3300005459 Ga0068867_101016412 Ga0068867_1010164121 146
409 3300005466 Ga0070685_10157102 Ga0070685_101571022 146
410 3300005466 Ga0070685_10920050 Ga0070685_109200502 146
411 3300005530 Ga0070679_100165095 Ga0070679_1001650951 146
412 3300005530 Ga0070679_100738838 Ga0070679_1007388382 146
413 3300005535 Ga0070684_100003373 Ga0070684_1000033737 146
414 3300005535 Ga0070684_100005950 Ga0070684_1000059504 146
415 3300005539 Ga0068853_100150264 Ga0068853_1001502641 146
416 3300005539 Ga0068853_100289616 Ga0068853_1002896163 146
417 3300005539 Ga0068853_100316992 Ga0068853_1003169922 146
418 3300005539 Ga0068853_100373494 Ga0068853_1003734943 146
419 3300005539 Ga0068853_100504952 Ga0068853_1005049522 146
420 3300005539 Ga0068853_101520060 Ga0068853_1015200601 146
421 3300005543 Ga0070672_100012992 Ga0070672_1000129926 146
422 3300005543 Ga0070672_100062807 Ga0070672_1000628073 146
423 3300005544 Ga0070686_100047912 Ga0070686_1000479123 146
424 3300005547 Ga0070693_100141298 Ga0070693_1001412982 146
425 3300005548 Ga0070665_100105181 Ga0070665_1001051814 146
426 3300005563 Ga0068855_100060002 Ga0068855_1000600024 146
427 3300005563 Ga0068855_100723041 Ga0068855_1007230412 146
428 3300005563 Ga0068855_100924204 Ga0068855_1009242042 146
429 3300005563 Ga0068855_101245710 Ga0068855_1012457102 146
430 3300005564 Ga0070664_100020711 Ga0070664_1000207116 146
431 3300005564 Ga0070664_100035241 Ga0070664_1000352416 146
432 3300005564 Ga0070664_100045232 Ga0070664_1000452322 146
433 3300005564 Ga0070664_100148055 Ga0070664_1001480553 146
434 3300005577 Ga0068857_100012718 Ga0068857_1000127187 146
435 3300005577 Ga0068857_100311046 Ga0068857_1003110463 146
436 3300005577 Ga0068857_100314305 Ga0068857_1003143052 146
437 3300005578 Ga0068854_100018356 Ga0068854_1000183565 146
438 3300005578 Ga0068854_100052082 Ga0068854_1000520821 146
439 3300005578 Ga0068854_100357226 Ga0068854_1003572262 146
440 3300005578 Ga0068854_100390911 Ga0068854_1003909112 146
441 3300005614 Ga0068856_100042934 Ga0068856_1000429344 146
442 3300005614 Ga0068856_100248319 Ga0068856_1002483192 146
443 3300005615 Ga0070702_100111413 Ga0070702_1001114133 146
444 3300005616 Ga0068852_100038865 Ga0068852_1000388652 146
445 3300005616 Ga0068852_100041508 Ga0068852_1000415083 146
446 3300005616 Ga0068852_100081641 Ga0068852_1000816414 146
447 3300005616 Ga0068852_100267084 Ga0068852_1002670842 146
448 3300005616 Ga0068852_100494211 Ga0068852_1004942112 146
449 3300005616 Ga0068852_100764701 Ga0068852_1007647013 146
450 3300005616 Ga0068852_101168425 Ga0068852_1011684252 146
451 3300005617 Ga0068859_100039867 Ga0068859_1000398676 146
452 3300005618 Ga0068864_100065886 Ga0068864_1000658861 146
453 3300005718 Ga0068866_10034977 Ga0068866_100349772 146
454 3300005718 Ga0068866_10052426 Ga0068866_100524262 146
455 3300005719 Ga0068861_100135833 Ga0068861_1001358332 146
456 3300005719 Ga0068861_100624015 Ga0068861_1006240152 146
457 3300005834 Ga0068851_10075198 Ga0068851_100751983 146
458 3300005834 Ga0068851_10164604 Ga0068851_101646042 146
459 3300005834 Ga0068851_10391682 Ga0068851_103916822 146
460 3300005840 Ga0068870_10247491 Ga0068870_102474912 146
461 3300005841 Ga0068863_100327710 Ga0068863_1003277102 146
462 3300005842 Ga0068858_100017967 Ga0068858_1000179678 146
463 3300005843 Ga0068860_100193218 Ga0068860_1001932183 146
464 3300005843 Ga0068860_102164779 Ga0068860_1021647791 146
465 3300006028 Ga0070717_10180121 Ga0070717_101801212 146
466 3300006173 Ga0070716_100238537 Ga0070716_1002385372 146
467 3300006175 Ga0070712_100028025 Ga0070712_1000280252 146
468 3300006237 Ga0097621_100312849 Ga0097621_1003128492 146
469 3300006358 Ga0068871_100264376 Ga0068871_1002643763 146
470 3300006358 Ga0068871_100674063 Ga0068871_1006740633 146
471 3300006881 Ga0068865_100028753 Ga0068865_1000287532 146
472 3300006881 Ga0068865_100390299 Ga0068865_1003902992 146
473 3300006931 Ga0097620_100039868 Ga0097620_1000398686 146
474 3300009093 Ga0105240_10019380 Ga0105240_1001938010 146
475 3300009093 Ga0105240_10329832 Ga0105240_103298323 146
476 3300009098 Ga0105245_10153409 Ga0105245_101534093 146
477 3300009098 Ga0105245_10181861 Ga0105245_101818613 146
478 3300009098 Ga0105245_10338393 Ga0105245_103383932 146
479 3300009098 Ga0105245_10455925 Ga0105245_104559252 146
480 3300009148 Ga0105243_10060153 Ga0105243_100601532 146
481 3300009148 Ga0105243_10123153 Ga0105243_101231533 146
482 3300009174 Ga0105241_10034765 Ga0105241_100347653 146
483 3300009176 Ga0105242_10243417 Ga0105242_102434172 146
484 3300009176 Ga0105242_10679719 Ga0105242_106797192 146
485 3300009177 Ga0105248_10002275 Ga0105248_1000227522 146
486 3300009177 Ga0105248_10297792 Ga0105248_102977923 146
487 3300009177 Ga0105248_10468777 Ga0105248_104687772 146
488 3300009177 Ga0105248_11937777 Ga0105248_119377771 146
489 3300009545 Ga0105237_10013446 Ga0105237_1001344611 146
490 3300009551 Ga0105238_10023266 Ga0105238_100232667 146
491 3300009551 Ga0105238_10205934 Ga0105238_102059342 146
492 3300010375 Ga0105239_10338501 Ga0105239_103385012 146
493 3300013100 Ga0157373_10007319 Ga0157373_100073192 146
494 3300013100 Ga0157373_10051084 Ga0157373_100510844 146
495 3300013100 Ga0157373_10066196 Ga0157373_100661963 146
496 3300013100 Ga0157373_10092370 Ga0157373_100923702 146
497 3300013100 Ga0157373_10489811 Ga0157373_104898111 146
498 3300013102 Ga0157371_10029991 Ga0157371_100299915 146
499 3300013102 Ga0157371_10056851 Ga0157371_100568514 146
500 3300013104 Ga0157370_10000497 Ga0157370_1000049734 146
501 3300013104 Ga0157370_10032144 Ga0157370_100321446 146
502 3300013104 Ga0157370_10161493 Ga0157370_101614932 146
503 3300013104 Ga0157370_10320549 Ga0157370_103205492 146
504 3300013104 Ga0157370_11372224 Ga0157370_113722242 146
505 3300013105 Ga0157369_10152251 Ga0157369_101522514 146
506 3300013105 Ga0157369_10330557 Ga0157369_103305572 146
507 3300013105 Ga0157369_10439559 Ga0157369_104395592 146
508 3300013297 Ga0157378_10063734 Ga0157378_100637344 146
509 3300013297 Ga0157378_11794056 Ga0157378_117940561 146
510 3300013297 Ga0157378_12374034 Ga0157378_123740341 146
511 3300013306 Ga0163162_11968195 Ga0163162_119681951 146
512 3300013307 Ga0157372_10052507 Ga0157372_100525076 146
513 3300013307 Ga0157372_10454270 Ga0157372_104542702 146
514 3300013308 Ga0157375_10054020 Ga0157375_100540203 146
515 3300013308 Ga0157375_10272296 Ga0157375_102722963 146
516 3300013308 Ga0157375_10585388 Ga0157375_105853883 146
517 3300014325 Ga0163163_10382065 Ga0163163_103820652 146
518 3300014326 Ga0157380_10492898 Ga0157380_104928983 146
519 3300014326 Ga0157380_11328287 Ga0157380_113282872 146
520 3300014968 Ga0157379_10033250 Ga0157379_100332506 146
521 3300014968 Ga0157379_10226747 Ga0157379_102267472 146
522 3300014969 Ga0157376_10274911 Ga0157376_102749113 146
523 3300020070 Ga0206356_11732949 Ga0206356_117329492 146
524 3300021384 Ga0213876_10073437 Ga0213876_100734373 146
525 3300025315 Ga0207697_10213914 Ga0207697_102139142 146
526 3300025321 Ga0207656_10044703 Ga0207656_100447033 146
527 3300025321 Ga0207656_10086815 Ga0207656_100868152 146
528 3300025321 Ga0207656_10155705 Ga0207656_101557052 146
529 3300025893 Ga0207682_10015022 Ga0207682_100150223 146
530 3300025899 Ga0207642_10909223 Ga0207642_109092232 146
531 3300025901 Ga0207688_10204756 Ga0207688_102047562 146
532 3300025904 Ga0207647_10009032 Ga0207647_100090323 146
533 3300025904 Ga0207647_10308294 Ga0207647_103082942 146
534 3300025906 Ga0207699_10084550 Ga0207699_100845503 146
535 3300025907 Ga0207645_10080255 Ga0207645_100802553 146
536 3300025907 Ga0207645_10116468 Ga0207645_101164682 146
537 3300025908 Ga0207643_10119506 Ga0207643_101195063 146
538 3300025909 Ga0207705_10003112 Ga0207705_100031127 146
539 3300025909 Ga0207705_10023003 Ga0207705_100230033 146
540 3300025909 Ga0207705_10145749 Ga0207705_101457492 146
541 3300025909 Ga0207705_10334958 Ga0207705_103349581 146
542 3300025909 Ga0207705_10468713 Ga0207705_104687132 146
543 3300025912 Ga0207707_10267597 Ga0207707_102675973 146
544 3300025913 Ga0207695_10019756 Ga0207695_100197565 146
545 3300025914 Ga0207671_10040892 Ga0207671_100408924 146
546 3300025915 Ga0207693_10006527 Ga0207693_1000652713 146
547 3300025916 Ga0207663_11646690 Ga0207663_116466901 146
548 3300025917 Ga0207660_10004906 Ga0207660_100049067 146
549 3300025917 Ga0207660_10287443 Ga0207660_102874433 146
550 3300025918 Ga0207662_10137730 Ga0207662_101377304 146
551 3300025918 Ga0207662_10207514 Ga0207662_102075141 146
552 3300025919 Ga0207657_10015919 Ga0207657_100159193 146
553 3300025919 Ga0207657_10021597 Ga0207657_100215977 146
554 3300025919 Ga0207657_10036095 Ga0207657_100360953 146
555 3300025919 Ga0207657_10043151 Ga0207657_100431512 146
556 3300025919 Ga0207657_10142002 Ga0207657_101420023 146
557 3300025919 Ga0207657_10156314 Ga0207657_101563143 146
558 3300025920 Ga0207649_10012717 Ga0207649_100127176 146
559 3300025920 Ga0207649_10136418 Ga0207649_101364182 146
560 3300025920 Ga0207649_10192176 Ga0207649_101921762 146
561 3300025920 Ga0207649_10205728 Ga0207649_102057282 146
562 3300025920 Ga0207649_10759833 Ga0207649_107598331 146
563 3300025920 Ga0207649_11067846 Ga0207649_110678462 146
564 3300025921 Ga0207652_10227372 Ga0207652_102273722 146
565 3300025921 Ga0207652_10324329 Ga0207652_103243292 146
566 3300025921 Ga0207652_10598662 Ga0207652_105986622 146
567 3300025924 Ga0207694_10651681 Ga0207694_106516811 146
568 3300025925 Ga0207650_10163307 Ga0207650_101633072 146
569 3300025925 Ga0207650_10452711 Ga0207650_104527112 146
570 3300025925 Ga0207650_10721750 Ga0207650_107217502 146
571 3300025925 Ga0207650_10889204 Ga0207650_108892042 146
572 3300025926 Ga0207659_10122238 Ga0207659_101222383 146
573 3300025927 Ga0207687_10103334 Ga0207687_101033342 146
574 3300025927 Ga0207687_10126363 Ga0207687_101263633 146
575 3300025927 Ga0207687_10224950 Ga0207687_102249503 146
576 3300025929 Ga0207664_10122032 Ga0207664_101220323 146
577 3300025929 Ga0207664_10334196 Ga0207664_103341962 146
578 3300025931 Ga0207644_10017928 Ga0207644_100179286 146
579 3300025931 Ga0207644_10038435 Ga0207644_100384354 146
580 3300025931 Ga0207644_10447389 Ga0207644_104473892 146
581 3300025932 Ga0207690_10011654 Ga0207690_100116543 146
582 3300025932 Ga0207690_10020356 Ga0207690_100203564 146
583 3300025932 Ga0207690_10152901 Ga0207690_101529012 146
584 3300025932 Ga0207690_10292578 Ga0207690_102925782 146
585 3300025932 Ga0207690_10406564 Ga0207690_104065642 146
586 3300025933 Ga0207706_10004173 Ga0207706_1000417311 146
587 3300025933 Ga0207706_10035503 Ga0207706_100355036 146
588 3300025933 Ga0207706_10047951 Ga0207706_100479513 146
589 3300025933 Ga0207706_10610403 Ga0207706_106104032 146
590 3300025935 Ga0207709_10204147 Ga0207709_102041472 146
591 3300025936 Ga0207670_10106352 Ga0207670_101063523 146
592 3300025937 Ga0207669_10006240 Ga0207669_100062402 146
593 3300025937 Ga0207669_10164671 Ga0207669_101646713 146
594 3300025938 Ga0207704_10143493 Ga0207704_101434933 146
595 3300025938 Ga0207704_10967718 Ga0207704_109677182 146
596 3300025939 Ga0207665_10021532 Ga0207665_100215322 146
597 3300025940 Ga0207691_10007401 Ga0207691_100074019 146
598 3300025940 Ga0207691_10075315 Ga0207691_100753154 146
599 3300025940 Ga0207691_10110488 Ga0207691_101104883 146
600 3300025941 Ga0207711_10000309 Ga0207711_1000030928 146
601 3300025941 Ga0207711_10226322 Ga0207711_102263223 146
602 3300025941 Ga0207711_10519447 Ga0207711_105194472 146
603 3300025944 Ga0207661_10015802 Ga0207661_100158022 146
604 3300025944 Ga0207661_10099438 Ga0207661_100994383 146
605 3300025944 Ga0207661_10379087 Ga0207661_103790872 146
606 3300025945 Ga0207679_10060515 Ga0207679_100605152 146
607 3300025945 Ga0207679_10062443 Ga0207679_100624432 146
608 3300025945 Ga0207679_10097866 Ga0207679_100978663 146
609 3300025945 Ga0207679_11784370 Ga0207679_117843701 146
610 3300025949 Ga0207667_10080700 Ga0207667_100807004 146
611 3300025949 Ga0207667_10761332 Ga0207667_107613322 146
612 3300025949 Ga0207667_10911560 Ga0207667_109115602 146
613 3300025949 Ga0207667_11347496 Ga0207667_113474961 146
614 3300025960 Ga0207651_10024726 Ga0207651_100247263 146
615 3300025960 Ga0207651_10058746 Ga0207651_100587464 146
616 3300025960 Ga0207651_10063600 Ga0207651_100636002 146
617 3300025960 Ga0207651_11771814 Ga0207651_117718141 146
618 3300025981 Ga0207640_10045020 Ga0207640_100450204 146
619 3300025981 Ga0207640_10085859 Ga0207640_100858593 146
620 3300025981 Ga0207640_11036455 Ga0207640_110364552 146
621 3300025986 Ga0207658_10005278 Ga0207658_100052788 146
622 3300025986 Ga0207658_10246860 Ga0207658_102468602 146
623 3300026023 Ga0207677_10004742 Ga0207677_100047426 146
624 3300026023 Ga0207677_10005621 Ga0207677_100056219 146
625 3300026023 Ga0207677_10114783 Ga0207677_101147831 146
626 3300026023 Ga0207677_10396494 Ga0207677_103964941 146
627 3300026035 Ga0207703_10001905 Ga0207703_1000190520 146
628 3300026041 Ga0207639_10017111 Ga0207639_100171114 146
629 3300026041 Ga0207639_10546463 Ga0207639_105464632 146
630 3300026067 Ga0207678_10043209 Ga0207678_100432092 146
631 3300026067 Ga0207678_10057296 Ga0207678_100572963 146
632 3300026067 Ga0207678_10107410 Ga0207678_101074102 146
633 3300026078 Ga0207702_10018250 Ga0207702_100182504 146
634 3300026078 Ga0207702_10022150 Ga0207702_100221506 146
635 3300026078 Ga0207702_10080338 Ga0207702_100803383 146
636 3300026078 Ga0207702_10097461 Ga0207702_100974612 146
637 3300026088 Ga0207641_10035960 Ga0207641_100359603 146
638 3300026089 Ga0207648_10008589 Ga0207648_100085896 146
639 3300026089 Ga0207648_10017417 Ga0207648_100174173 146
640 3300026089 Ga0207648_10196909 Ga0207648_101969092 146
641 3300026095 Ga0207676_10168808 Ga0207676_101688082 146
642 3300026095 Ga0207676_10388761 Ga0207676_103887612 146
643 3300026116 Ga0207674_10009133 Ga0207674_100091337 146
644 3300026116 Ga0207674_10025828 Ga0207674_100258283 146
645 3300026116 Ga0207674_10104762 Ga0207674_101047623 146
646 3300026118 Ga0207675_100406877 Ga0207675_1004068772 146
647 3300026121 Ga0207683_10025482 Ga0207683_100254823 146
648 3300026142 Ga0207698_10022715 Ga0207698_100227154 146
649 3300026142 Ga0207698_10082423 Ga0207698_100824232 146
650 3300026142 Ga0207698_10224844 Ga0207698_102248442 146
651 3300026142 Ga0207698_10365760 Ga0207698_103657602 146
652 3300026142 Ga0207698_10990117 Ga0207698_109901171 146
653 3300028381 Ga0268264_10163145 Ga0268264_101631451 146
654 3300035084 Ga0373928_0120946 Ga0373928_0120946_203_649 146
655 3300035089 Ga0373944_0086944 Ga0373944_0086944_375_824 146
656 3300035090 Ga0373949_0063813 Ga0373949_0063813_73_519 146
657 3300035111 Ga0373923_0258160 Ga0373923_0258160_252_701 146
658 3300035170 Ga0373943_0209055 Ga0373943_0209055_69_518 146
659 3300035172 Ga0373955_0385931 Ga0373955_0385931_343_792 146
660 3300035691 Ga0373931_0099681 Ga0373931_0099681_538_984 146
661 3300037068 Ga0373925_0222599 Ga0373925_0222599_609_1058 146
662 3300037312 Ga0395899_0020860 Ga0395899_0020860_120_575 146
663 3300037312 Ga0395899_0038215 Ga0395899_0038215_592_1035 146
664 3300037312 Ga0395899_0211484 Ga0395899_0211484_758_1213 146
665 3300037312 Ga0395899_0287474 Ga0395899_0287474_201_656 146
666 3300037312 Ga0395899_0420078 Ga0395899_0420078_313_765 146
667 3300037418 Ga0395900_0012634 Ga0395900_0012634_466_909 146
668 3300037418 Ga0395900_0081843 Ga0395900_0081843_137_592 146
669 3300037418 Ga0395900_0118874 Ga0395900_0118874_1419_1874 146
670 3300037418 Ga0395900_0137487 Ga0395900_0137487_1338_1790 146
671 3300037418 Ga0395900_0323222 Ga0395900_0323222_385_828 146
672 3300037418 Ga0395900_0323229 Ga0395900_0323229_385_828 146
673 3300037418 Ga0395900_0381843 Ga0395900_0381843_164_619 146
674 3300037418 Ga0395900_0905058 Ga0395900_0905058_137_592 146
675 3300037466 Ga0395898_0018525 Ga0395898_0018525_4471_4914 146
676 3300037466 Ga0395898_0128079 Ga0395898_0128079_306_749 146
677 3300037466 Ga0395898_0303648 Ga0395898_0303648_385_828 146
678 3300037466 Ga0395898_0303649 Ga0395898_0303649_385_828 146
679 3300037466 Ga0395898_0808648 Ga0395898_0808648_136_591 146
680 3300037466 Ga0395898_1233077 Ga0395898_1233077_188_643 146
681 3300037466 Ga0395898_1822060 Ga0395898_1822060_13_468 146
682 3300037471 Ga0395905_0036630 Ga0395905_0036630_3886_4329 146
683 3300037471 Ga0395905_0055546 Ga0395905_0055546_1527_1970 146
684 3300037471 Ga0395905_0067879 Ga0395905_0067879_1466_1918 146
685 3300037471 Ga0395905_0091715 Ga0395905_0091715_1420_1875 146
686 3300037471 Ga0395905_0278202 Ga0395905_0278202_948_1403 146
687 3300037471 Ga0395905_0781879 Ga0395905_0781879_156_611 146
688 3300037471 Ga0395905_0838057 Ga0395905_0838057_102_557 146
689 3300037471 Ga0395905_0876684 Ga0395905_0876684_137_592 146
690 3300037471 Ga0395905_1220789 Ga0395905_1220789_153_608 146
691 3300038443 Ga0395901_0022105 Ga0395901_0022105_1592_2035 146
692 3300038443 Ga0395901_0068543 Ga0395901_0068543_114_569 146
693 3300038443 Ga0395901_0076098 Ga0395901_0076098_1459_1899 146
694 3300038443 Ga0395901_0350897 Ga0395901_0350897_385_828 146
695 3300038443 Ga0395901_0420516 Ga0395901_0420516_205_660 146
696 3300038443 Ga0395901_0511986 Ga0395901_0511986_393_836 146
697 3300038443 Ga0395901_0578870 Ga0395901_0578870_479_934 146
698 3300038443 Ga0395901_0886204 Ga0395901_0886204_229_681 146
699 3300038443 Ga0395901_1313847 Ga0395901_1313847_162_617 146
700 3300039437 Ga0436365_0334369 Ga0436365_0334369_3434_3889 146
701 3300044658 Ga0466972_0038303 Ga0466972_0038303_1353_1820 146
702 3300044658 Ga0466972_0174509 Ga0466972_0174509_38_484 146
703 3300044684 Ga0466966_0097376 Ga0466966_0097376_230_697 146
704 3300044684 Ga0466966_0105924 Ga0466966_0105924_976_1455 146
705 3300044684 Ga0466966_0447923 Ga0466966_0447923_315_764 146
706 3300044684 Ga0466966_0583167 Ga0466966_0583167_181_648 146
707 3300044684 Ga0466966_0695116 Ga0466966_0695116_94_561 146
708 3300044693 Ga0466961_0078955 Ga0466961_0078955_1266_1733 146
709 3300044694 Ga0466963_0048814 Ga0466963_0048814_816_1292 146
710 3300044694 Ga0466963_0212030 Ga0466963_0212030_176_619 146
711 3300044694 Ga0466963_0333472 Ga0466963_0333472_552_1019 146
712 3300044706 Ga0466964_0010281 Ga0466964_0010281_835_1302 146
713 3300044719 Ga0466971_0018338 Ga0466971_0018338_868_1311 146
714 3300044765 Ga0466970_0077358 Ga0466970_0077358_853_1320 146
715 3300044765 Ga0466970_0530737 Ga0466970_0530737_138_605 146
716 3300044842 Ga0466957_0065599 Ga0466957_0065599_784_1227 146
717 3300044842 Ga0466957_0649881 Ga0466957_0649881_102_563 146
718 3300044901 Ga0466960_0026401 Ga0466960_0026401_1138_1584 146
719 3300045049 Ga0466959_0106087 Ga0466959_0106087_1050_1517 146
720 3300045049 Ga0466959_0360371 Ga0466959_0360371_368_835 146
721 3300045049 Ga0466959_0369563 Ga0466959_0369563_313_756 146
722 3300045836 Ga0466958_0003925 Ga0466958_0003925_7175_7618 146
723 3300045836 Ga0466958_0015665 Ga0466958_0015665_3067_3534 146
724 3300045836 Ga0466958_0165117 Ga0466958_0165117_644_1120 146
725 3300045976 Ga0466967_0422698 Ga0466967_0422698_105_548 146
726 3300046525 Ga0495663_0192840 Ga0495663_0192840_197_649 146
727 3300046537 Ga0495598_0000260 Ga0495598_0000260_3359_3808 146
728 3300046539 Ga0495621_0000141 Ga0495621_0000141_5690_6139 146
729 3300046684 Ga0495669_0273968 Ga0495669_0273968_162_614 146
730 3300046691 Ga0495670_0001090 Ga0495670_0001090_8266_8715 146
731 3300046809 Ga0495600_0601471 Ga0495600_0601471_152_601 146
732 3300048903 Ga0496100_0011309 Ga0496100_0011309_1468_1914 146
733 3300048904 Ga0496101_0001753 Ga0496101_0001753_176_622 146
734 3300048905 Ga0496102_0048281 Ga0496102_0048281_693_1139 146
735 3300048906 Ga0496103_0016593 Ga0496103_0016593_3898_4344 146
736 3300048908 Ga0496105_0094720 Ga0496105_0094720_638_1084 146
737 3300048909 Ga0496106_0035893 Ga0496106_0035893_2138_2584 146
738 3300048909 Ga0496106_0481769 Ga0496106_0481769_498_953 146
739 3300048909 Ga0496106_0900057 Ga0496106_0900057_67_513 146
740 3300048910 Ga0496107_0016637 Ga0496107_0016637_2731_3177 146
741 3300048911 Ga0496108_0002538 Ga0496108_0002538_8046_8492 146
742 3300048911 Ga0496108_0580004 Ga0496108_0580004_270_716 146
743 3300048913 Ga0496110_0013487 Ga0496110_0013487_4815_5261 146
744 3300048914 Ga0496111_0118118 Ga0496111_0118118_1076_1522 146
745 3300048915 Ga0496112_0015503 Ga0496112_0015503_4806_5252 146
746 3300048915 Ga0496112_0143170 Ga0496112_0143170_622_1068 146
747 3300048916 Ga0496113_0009435 Ga0496113_0009435_4608_5054 146
748 3300049583 Ga0501067_0007369 Ga0501067_0007369_1966_2418 146
749 3300049584 Ga0501068_0480315 Ga0501068_0480315_238_690 146
750 3300049585 Ga0501069_0124363 Ga0501069_0124363_888_1340 146
751 3300053084 Ga0495595_0136359 Ga0495595_0136359_721_1170 146
752 3300002067 JGI24735J21928_10124451 JGI24735J21928_101244512 147
753 3300005329 Ga0070683_100050548 Ga0070683_1000505483 147
754 3300005331 Ga0070670_100909132 Ga0070670_1009091322 147
755 3300005336 Ga0070680_100093199 Ga0070680_1000931992 147
756 3300005339 Ga0070660_100001061 Ga0070660_10000106119 147
757 3300005339 Ga0070660_101245627 Ga0070660_1012456271 147
758 3300005355 Ga0070671_100160288 Ga0070671_1001602883 147
759 3300005356 Ga0070674_100754886 Ga0070674_1007548862 147
760 3300005367 Ga0070667_100106767 Ga0070667_1001067673 147
761 3300005455 Ga0070663_100126921 Ga0070663_1001269212 147
762 3300005456 Ga0070678_100023912 Ga0070678_1000239122 147
763 3300005457 Ga0070662_100139100 Ga0070662_1001391003 147
764 3300005458 Ga0070681_10028705 Ga0070681_100287056 147
765 3300005530 Ga0070679_100026734 Ga0070679_1000267347 147
766 3300005535 Ga0070684_100406222 Ga0070684_1004062222 147
767 3300005543 Ga0070672_100047548 Ga0070672_1000475482 147
768 3300005563 Ga0068855_100014603 Ga0068855_10001460312 147
769 3300005577 Ga0068857_101783223 Ga0068857_1017832231 147
770 3300005578 Ga0068854_100228820 Ga0068854_1002288203 147
771 3300005614 Ga0068856_100424438 Ga0068856_1004244382 147
772 3300005616 Ga0068852_101154267 Ga0068852_1011542671 147
773 3300005718 Ga0068866_10095958 Ga0068866_100959582 147
774 3300005834 Ga0068851_10453959 Ga0068851_104539592 147
775 3300006881 Ga0068865_100124950 Ga0068865_1001249503 147
776 3300009177 Ga0105248_10248477 Ga0105248_102484773 147
777 3300013100 Ga0157373_10474639 Ga0157373_104746392 147
778 3300013104 Ga0157370_10051504 Ga0157370_100515043 147
779 3300013105 Ga0157369_11953484 Ga0157369_119534841 147
780 3300017792 Ga0163161_10030131 Ga0163161_100301312 147
781 3300020082 Ga0206353_11527701 Ga0206353_115277012 147
782 3300025321 Ga0207656_10404974 Ga0207656_104049741 147
783 3300025899 Ga0207642_10025501 Ga0207642_100255012 147
784 3300025904 Ga0207647_10055492 Ga0207647_100554922 147
785 3300025909 Ga0207705_10000123 Ga0207705_1000012332 147
786 3300025917 Ga0207660_10626903 Ga0207660_106269032 147
787 3300025919 Ga0207657_10000650 Ga0207657_1000065024 147
788 3300025919 Ga0207657_11377829 Ga0207657_113778291 147
789 3300025921 Ga0207652_10000034 Ga0207652_1000003482 147
790 3300025931 Ga0207644_10544825 Ga0207644_105448252 147
791 3300025933 Ga0207706_10003262 Ga0207706_1000326211 147
792 3300025937 Ga0207669_10321025 Ga0207669_103210252 147
793 3300025940 Ga0207691_10114746 Ga0207691_101147463 147
794 3300025941 Ga0207711_10485016 Ga0207711_104850162 147
795 3300025949 Ga0207667_10036894 Ga0207667_100368947 147
796 3300025981 Ga0207640_10517459 Ga0207640_105174592 147
797 3300026067 Ga0207678_10000530 Ga0207678_100005303 147
798 3300026078 Ga0207702_10022741 Ga0207702_100227416 147
799 3300026121 Ga0207683_10012568 Ga0207683_100125683 147
800 3300026142 Ga0207698_10478920 Ga0207698_104789202 147
801 3300026142 Ga0207698_11834691 Ga0207698_118346911 147
802 3300031731 Ga0307405_10510980 Ga0307405_105109802 147
803 3300032126 Ga0307415_100004978 Ga0307415_1000049785 147
804 3300037312 Ga0395899_0000255 Ga0395899_0000255_26231_26683 147
805 3300037312 Ga0395899_0056093 Ga0395899_0056093_820_1272 147
806 3300037312 Ga0395899_0081969 Ga0395899_0081969_1314_1766 147
807 3300037418 Ga0395900_0000308 Ga0395900_0000308_56685_57137 147
808 3300037418 Ga0395900_0019379 Ga0395900_0019379_477_929 147
809 3300037418 Ga0395900_0153361 Ga0395900_0153361_365_817 147
810 3300037418 Ga0395900_0686171 Ga0395900_0686171_123_575 147
811 3300037466 Ga0395898_0000054 Ga0395898_0000054_11771_12223 147
812 3300037466 Ga0395898_0008175 Ga0395898_0008175_1582_2034 147
813 3300037471 Ga0395905_0000005 Ga0395905_0000005_530458_530910 147
814 3300037471 Ga0395905_0010554 Ga0395905_0010554_6114_6566 147
815 3300037471 Ga0395905_0058111 Ga0395905_0058111_2286_2738 147
816 3300037471 Ga0395905_0276305 Ga0395905_0276305_123_575 147
817 3300038443 Ga0395901_0002475 Ga0395901_0002475_6118_6570 147
818 3300038443 Ga0395901_0008267 Ga0395901_0008267_180_632 147
819 3300046539 Ga0495621_0258039 Ga0495621_0258039_169_621 147
820 3300048915 Ga0496112_0083338 Ga0496112_0083338_1637_2089 147
821 3300048916 Ga0496113_0017930 Ga0496113_0017930_4071_4523 147
822 3300001990 JGI24737J22298_10012071 JGI24737J22298_100120712 150
823 3300002459 JGI24751J29686_10029682 JGI24751J29686_100296822 150
824 3300005339 Ga0070660_100096401 Ga0070660_1000964013 150
825 3300005353 Ga0070669_100178122 Ga0070669_1001781222 150
826 3300005366 Ga0070659_100002156 Ga0070659_1000021564 150
827 3300005366 Ga0070659_100066061 Ga0070659_1000660613 150
828 3300005539 Ga0068853_100103745 Ga0068853_1001037452 150
829 3300005563 Ga0068855_101467440 Ga0068855_1014674402 150
830 3300005577 Ga0068857_100031092 Ga0068857_1000310926 150
831 3300005618 Ga0068864_100267979 Ga0068864_1002679792 150
832 3300005841 Ga0068863_100156718 Ga0068863_1001567182 150
833 3300005844 Ga0068862_100256225 Ga0068862_1002562252 150
834 3300006195 Ga0075366_10142042 Ga0075366_101420423 150
835 3300009176 Ga0105242_11408460 Ga0105242_114084602 150
836 3300013307 Ga0157372_10237916 Ga0157372_102379162 150
837 3300014325 Ga0163163_10021041 Ga0163163_100210416 150
838 3300025904 Ga0207647_10055785 Ga0207647_100557853 150
839 3300025919 Ga0207657_10120974 Ga0207657_101209742 150
840 3300025919 Ga0207657_10459006 Ga0207657_104590061 150
841 3300025923 Ga0207681_10068097 Ga0207681_100680973 150
842 3300025932 Ga0207690_10006143 Ga0207690_100061434 150
843 3300025932 Ga0207690_10025092 Ga0207690_100250923 150
844 3300025949 Ga0207667_11386711 Ga0207667_113867112 150
845 3300025981 Ga0207640_10466978 Ga0207640_104669783 150
846 3300026023 Ga0207677_10415148 Ga0207677_104151481 150
847 3300026088 Ga0207641_10035112 Ga0207641_100351122 150
848 3300026095 Ga0207676_10437349 Ga0207676_104373492 150
849 3300026116 Ga0207674_10000086 Ga0207674_10000086107 150
850 3300037312 Ga0395899_0009306 Ga0395899_0009306_3591_4043 150
851 3300037312 Ga0395899_0306530 Ga0395899_0306530_61_513 150
852 3300037418 Ga0395900_0080496 Ga0395900_0080496_2470_2922 150
853 3300037418 Ga0395900_0126528 Ga0395900_0126528_1195_1647 150
854 3300037418 Ga0395900_0189105 Ga0395900_0189105_1483_1935 150
855 3300037418 Ga0395900_0214952 Ga0395900_0214952_407_859 150
856 3300037466 Ga0395898_0026840 Ga0395898_0026840_2073_2525 150
857 3300037466 Ga0395898_0034536 Ga0395898_0034536_521_973 150
858 3300037466 Ga0395898_0091847 Ga0395898_0091847_741_1193 150
859 3300037466 Ga0395898_0242745 Ga0395898_0242745_1176_1628 150
860 3300037466 Ga0395898_0361511 Ga0395898_0361511_61_513 150
861 3300037471 Ga0395905_0005968 Ga0395905_0005968_10562_11014 150
862 3300037471 Ga0395905_0011035 Ga0395905_0011035_4408_4860 150
863 3300037471 Ga0395905_0021725 Ga0395905_0021725_5236_5688 150
864 3300037471 Ga0395905_0026175 Ga0395905_0026175_3129_3581 150
865 3300037471 Ga0395905_0026664 Ga0395905_0026664_1349_1801 150
866 3300037471 Ga0395905_0045091 Ga0395905_0045091_1485_1937 150
867 3300037471 Ga0395905_0112437 Ga0395905_0112437_132_584 150
868 3300037471 Ga0395905_0509713 Ga0395905_0509713_351_803 150
869 3300037471 Ga0395905_0600350 Ga0395905_0600350_521_973 150
870 3300037471 Ga0395905_0603453 Ga0395905_0603453_182_634 150
871 3300038443 Ga0395901_0004565 Ga0395901_0004565_5244_5696 150
872 3300038443 Ga0395901_0036955 Ga0395901_0036955_2707_3159 150
873 3300038443 Ga0395901_0052535 Ga0395901_0052535_3483_3935 150
874 3300038443 Ga0395901_0073246 Ga0395901_0073246_2026_2478 150
875 3300038443 Ga0395901_0210633 Ga0395901_0210633_219_671 150
876 3300038443 Ga0395901_0214910 Ga0395901_0214910_271_723 150
877 3300038443 Ga0395901_0603133 Ga0395901_0603133_305_757 150
878 3300038443 Ga0395901_0628802 Ga0395901_0628802_419_871 150
879 3300038443 Ga0395901_0697125 Ga0395901_0697125_325_777 150
880 3300038443 Ga0395901_0846411 Ga0395901_0846411_298_750 150
881 3300042005 Ga0439448_0006381 Ga0439448_0006381_1970_2422 150
882 3300042012 Ga0439455_0005339 Ga0439455_0005339_1990_2442 150
883 3300042012 Ga0439455_0005956 Ga0439455_0005956_1451_1903 150
884 3300042157 Ga0439458_0000012 Ga0439458_0000012_16027_16479 150
885 3300046522 Ga0495643_0145691 Ga0495643_0145691_669_1121 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00691

OmpA

OmpA family

67

153

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6top-assembly4.cif.gz_D structure of the pore c-terminal domain, a protein of t9ss from porphyromonas gingivalis 0.9515 56 139
5n2c-assembly1.cif.gz_A crystal structure of the peptidoglycan-associated lipoprotein from burkholderia cenocepacia 0.9398 53 150
4b5c-assembly3.cif.gz_C crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei 0.9335 53 150
5u1h-assembly3.cif.gz_C crystal structure of the c-terminal peptidoglycan binding domain of oprf (pa1777) from pseudomonas aeruginosa 0.9318 55 149
5n2c-assembly1.cif.gz_C crystal structure of the peptidoglycan-associated lipoprotein from burkholderia cenocepacia 0.9253 51 150
ID Description Score Start End Superfamily
5u1hB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9379 55 149 3.30.1330.60
5n2cC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9253 51 150 3.30.1330.60
3td4B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9146 55 149 3.30.1330.60
1spxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9123 109 131 3.40.50.720
3cypB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9072 56 150 3.30.1330.60
ID Description Score Start End GO Terms
AF-A0A538SKS6-F1-model_v4 OmpA family protein 0.9635 55 150 GO:0009279
AF-A0A4Q5T8A0-F1-model_v4 Peptidoglycan-associated lipoprotein Pal 0.9632 45 150 GO:0009279
GO:0051301
AF-A0A2E6DJF8-F1-model_v4 deleted 0.961 56 150
AF-A0A2J6IZ16-F1-model_v4 OmpA-like domain-containing protein 0.9608 56 149 GO:0009279
AF-A0A2S5MFN7-F1-model_v4 Flagellar motor protein MotB 0.9605 43 149 GO:0016020

Feature Viewer

pLDDT pTM Quality
84.51 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map