F484675
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 885 | 246 | 885 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0105924|Ga0466966_0105924_976_1455 |
| Length | 159 |
| Sequence | MRRSVLLISAAGLLASAASAQLPGLRRYTPADNATQQANGKQQGPVPVGIDALRADFAAQAGGTTVYFGNGSSVLAPPARMTLAAQAAWLRRHPEVAVKIEGYGDGGDTRDHALAVGARRAEEARDYLVLLGVPAAQVSITSWGRERPGLGRAVTLLVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 185 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 186 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 187 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 188 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 189 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 230 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 231 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 232 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 233 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 236 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 237 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 238 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 239 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 240 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 241 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 243 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 244 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 245 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 246 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 5.2 |
| Rhizosphere | 94.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10012071 | 3300001990 | Bacteria | 2820 |
| 2 | JGI24743J22301_10009435 | 3300001991 | Bacteria | 1729 |
| 3 | JGI24735J21928_10124451 | 3300002067 | Bacteria | 743 |
| 4 | JGI24744J21845_10000021 | 3300002077 | Bacteria | 18312 |
| 5 | JGI24034J26672_10004989 | 3300002239 | Bacteria | 1894 |
| 6 | JGI24751J29686_10029682 | 3300002459 | Bacteria | 1135 |
| 7 | rootH2_10129989 | 3300003320 | Bacteria | 1113 |
| 8 | rootH1_10057877 | 3300003323 | Bacteria | 1269 |
| 9 | Ga0070658_10041477 | 3300005327 | Bacteria | 3713 |
| 10 | Ga0070658_10072568 | 3300005327 | Bacteria | 2821 |
| 11 | Ga0070658_10148511 | 3300005327 | Bacteria | 1961 |
| 12 | Ga0070658_10311372 | 3300005327 | Bacteria | 1343 |
| 13 | Ga0070658_10410330 | 3300005327 | Bacteria | 1164 |
| 14 | Ga0070658_10539273 | 3300005327 | Bacteria | 1009 |
| 15 | Ga0070658_11129490 | 3300005327 | Bacteria | 681 |
| 16 | Ga0070658_11410324 | 3300005327 | Bacteria | 604 |
| 17 | Ga0070676_10060754 | 3300005328 | Bacteria | 2245 |
| 18 | Ga0070676_10085256 | 3300005328 | Bacteria | 1924 |
| 19 | Ga0070676_10494197 | 3300005328 | Bacteria | 867 |
| 20 | Ga0070683_100004824 | 3300005329 | Bacteria | 11168 |
| 21 | Ga0070683_100050548 | 3300005329 | Bacteria | 3849 |
| 22 | Ga0070683_100086884 | 3300005329 | Bacteria | 2932 |
| 23 | Ga0070683_100607702 | 3300005329 | Bacteria | 1047 |
| 24 | Ga0070690_100022321 | 3300005330 | Bacteria | 3871 |
| 25 | Ga0070690_100023448 | 3300005330 | Bacteria | 3784 |
| 26 | Ga0070690_100240527 | 3300005330 | Bacteria | 1276 |
| 27 | Ga0070690_100793039 | 3300005330 | Bacteria | 734 |
| 28 | Ga0070670_100002043 | 3300005331 | Bacteria | 16511 |
| 29 | Ga0070670_100002145 | 3300005331 | Bacteria | 16197 |
| 30 | Ga0070670_100016978 | 3300005331 | Bacteria | 6249 |
| 31 | Ga0070670_100151347 | 3300005331 | Bacteria | 2008 |
| 32 | Ga0070670_100159440 | 3300005331 | Unclassified | 1955 |
| 33 | Ga0070670_100171378 | 3300005331 | Bacteria | 1882 |
| 34 | Ga0070670_100268635 | 3300005331 | Bacteria | 1488 |
| 35 | Ga0070670_100909132 | 3300005331 | Bacteria | 798 |
| 36 | Ga0070677_10018338 | 3300005333 | Bacteria | 2519 |
| 37 | Ga0070677_10402896 | 3300005333 | Bacteria | 721 |
| 38 | Ga0070666_10000877 | 3300005335 | Bacteria | 18237 |
| 39 | Ga0070666_10004850 | 3300005335 | Bacteria | 8221 |
| 40 | Ga0070666_10028328 | 3300005335 | Bacteria | 3675 |
| 41 | Ga0070666_10045968 | 3300005335 | Bacteria | 2927 |
| 42 | Ga0070680_100002845 | 3300005336 | Bacteria | 12866 |
| 43 | Ga0070680_100093199 | 3300005336 | Bacteria | 2495 |
| 44 | Ga0070680_100151075 | 3300005336 | Bacteria | 1950 |
| 45 | Ga0070680_100285536 | 3300005336 | Bacteria | 1398 |
| 46 | Ga0070680_100739952 | 3300005336 | Bacteria | 846 |
| 47 | Ga0070682_100024258 | 3300005337 | Bacteria | 3608 |
| 48 | Ga0070682_100223562 | 3300005337 | Bacteria | 1342 |
| 49 | Ga0070682_100790442 | 3300005337 | Bacteria | 770 |
| 50 | Ga0068868_100000540 | 3300005338 | Bacteria | 25382 |
| 51 | Ga0068868_100054365 | 3300005338 | Bacteria | 3155 |
| 52 | Ga0068868_100151402 | 3300005338 | Bacteria | 1910 |
| 53 | Ga0068868_100380073 | 3300005338 | Bacteria | 1215 |
| 54 | Ga0068868_100533013 | 3300005338 | Bacteria | 1032 |
| 55 | Ga0070660_100001061 | 3300005339 | Bacteria | 18495 |
| 56 | Ga0070660_100009593 | 3300005339 | Bacteria | 6816 |
| 57 | Ga0070660_100032137 | 3300005339 | Bacteria | 3948 |
| 58 | Ga0070660_100060950 | 3300005339 | Bacteria | 2929 |
| 59 | Ga0070660_100068844 | 3300005339 | Bacteria | 2759 |
| 60 | Ga0070660_100096401 | 3300005339 | Bacteria | 2339 |
| 61 | Ga0070660_100145188 | 3300005339 | Bacteria | 1905 |
| 62 | Ga0070660_100151237 | 3300005339 | Bacteria | 1866 |
| 63 | Ga0070660_100155061 | 3300005339 | Bacteria | 1843 |
| 64 | Ga0070660_100175854 | 3300005339 | Bacteria | 1731 |
| 65 | Ga0070660_100239239 | 3300005339 | Bacteria | 1478 |
| 66 | Ga0070660_100951722 | 3300005339 | Bacteria | 725 |
| 67 | Ga0070660_101245627 | 3300005339 | Bacteria | 631 |
| 68 | Ga0070689_100131542 | 3300005340 | Bacteria | 2007 |
| 69 | Ga0070691_10002720 | 3300005341 | Bacteria | 7872 |
| 70 | Ga0070687_100465319 | 3300005343 | Bacteria | 844 |
| 71 | Ga0070661_100001787 | 3300005344 | Bacteria | 14912 |
| 72 | Ga0070661_100008568 | 3300005344 | Bacteria | 7072 |
| 73 | Ga0070661_100022428 | 3300005344 | Bacteria | 4521 |
| 74 | Ga0070661_100026281 | 3300005344 | Bacteria | 4186 |
| 75 | Ga0070661_100034430 | 3300005344 | Bacteria | 3672 |
| 76 | Ga0070661_100084876 | 3300005344 | Bacteria | 2339 |
| 77 | Ga0070661_100096580 | 3300005344 | Bacteria | 2193 |
| 78 | Ga0070661_100107317 | 3300005344 | Bacteria | 2082 |
| 79 | Ga0070661_100358954 | 3300005344 | Unclassified | 1145 |
| 80 | Ga0070661_100371003 | 3300005344 | Bacteria | 1126 |
| 81 | Ga0070692_10279000 | 3300005345 | Bacteria | 1012 |
| 82 | Ga0070669_100178122 | 3300005353 | Bacteria | 1661 |
| 83 | Ga0070669_100252359 | 3300005353 | Bacteria | 1405 |
| 84 | Ga0070675_100022113 | 3300005354 | Bacteria | 5081 |
| 85 | Ga0070675_100089053 | 3300005354 | Bacteria | 2583 |
| 86 | Ga0070675_100586772 | 3300005354 | Bacteria | 1010 |
| 87 | Ga0070675_101746403 | 3300005354 | Bacteria | 574 |
| 88 | Ga0070671_100003631 | 3300005355 | Bacteria | 12078 |
| 89 | Ga0070671_100004155 | 3300005355 | Bacteria | 11437 |
| 90 | Ga0070671_100008614 | 3300005355 | Bacteria | 8177 |
| 91 | Ga0070671_100009032 | 3300005355 | Bacteria | 7996 |
| 92 | Ga0070671_100015111 | 3300005355 | Bacteria | 6235 |
| 93 | Ga0070671_100061193 | 3300005355 | Bacteria | 3135 |
| 94 | Ga0070671_100091963 | 3300005355 | Bacteria | 2541 |
| 95 | Ga0070671_100160288 | 3300005355 | Bacteria | 1902 |
| 96 | Ga0070671_100855138 | 3300005355 | Bacteria | 793 |
| 97 | Ga0070674_100009512 | 3300005356 | Bacteria | 5821 |
| 98 | Ga0070674_100011429 | 3300005356 | Bacteria | 5408 |
| 99 | Ga0070674_100072363 | 3300005356 | Bacteria | 2441 |
| 100 | Ga0070674_100089221 | 3300005356 | Bacteria | 2221 |
| 101 | Ga0070674_100754886 | 3300005356 | Bacteria | 836 |
| 102 | Ga0070674_100899984 | 3300005356 | Bacteria | 771 |
| 103 | Ga0070673_100008965 | 3300005364 | Bacteria | 6690 |
| 104 | Ga0070673_100028107 | 3300005364 | Bacteria | 4178 |
| 105 | Ga0070673_100146154 | 3300005364 | Bacteria | 1999 |
| 106 | Ga0070673_100869071 | 3300005364 | Bacteria | 835 |
| 107 | Ga0070673_101076417 | 3300005364 | Bacteria | 750 |
| 108 | Ga0070659_100002156 | 3300005366 | Bacteria | 14026 |
| 109 | Ga0070659_100012198 | 3300005366 | Bacteria | 6370 |
| 110 | Ga0070659_100016639 | 3300005366 | Bacteria | 5523 |
| 111 | Ga0070659_100024356 | 3300005366 | Bacteria | 4640 |
| 112 | Ga0070659_100066061 | 3300005366 | Bacteria | 2866 |
| 113 | Ga0070659_100084675 | 3300005366 | Bacteria | 2535 |
| 114 | Ga0070659_100198738 | 3300005366 | Bacteria | 1650 |
| 115 | Ga0070659_100547383 | 3300005366 | Bacteria | 990 |
| 116 | Ga0070659_101347466 | 3300005366 | Bacteria | 633 |
| 117 | Ga0070667_100001880 | 3300005367 | Bacteria | 18647 |
| 118 | Ga0070667_100004036 | 3300005367 | Bacteria | 12418 |
| 119 | Ga0070667_100042051 | 3300005367 | Bacteria | 3833 |
| 120 | Ga0070667_100106767 | 3300005367 | Bacteria | 2424 |
| 121 | Ga0070667_100208062 | 3300005367 | Bacteria | 1738 |
| 122 | Ga0070667_100327653 | 3300005367 | Bacteria | 1383 |
| 123 | Ga0070667_101831747 | 3300005367 | Bacteria | 571 |
| 124 | Ga0070709_10665003 | 3300005434 | Bacteria | 808 |
| 125 | Ga0070714_100022207 | 3300005435 | Bacteria | 5202 |
| 126 | Ga0070714_100028449 | 3300005435 | Bacteria | 4638 |
| 127 | Ga0070714_100133863 | 3300005435 | Bacteria | 2217 |
| 128 | Ga0070714_100318947 | 3300005435 | Bacteria | 1453 |
| 129 | Ga0070713_100079950 | 3300005436 | Bacteria | 2786 |
| 130 | Ga0070713_100168117 | 3300005436 | Bacteria | 1962 |
| 131 | Ga0070713_100319514 | 3300005436 | Bacteria | 1433 |
| 132 | Ga0070713_102023214 | 3300005436 | Bacteria | 559 |
| 133 | Ga0070663_100016307 | 3300005455 | Bacteria | 4822 |
| 134 | Ga0070663_100032252 | 3300005455 | Bacteria | 3609 |
| 135 | Ga0070663_100057503 | 3300005455 | Bacteria | 2790 |
| 136 | Ga0070663_100071942 | 3300005455 | Bacteria | 2518 |
| 137 | Ga0070663_100108379 | 3300005455 | Bacteria | 2083 |
| 138 | Ga0070663_100126921 | 3300005455 | Bacteria | 1933 |
| 139 | Ga0070663_100169718 | 3300005455 | Bacteria | 1685 |
| 140 | Ga0070663_100230312 | 3300005455 | Bacteria | 1459 |
| 141 | Ga0070678_100002062 | 3300005456 | Bacteria | 10889 |
| 142 | Ga0070678_100012893 | 3300005456 | Bacteria | 5217 |
| 143 | Ga0070678_100023912 | 3300005456 | Bacteria | 4081 |
| 144 | Ga0070678_100214885 | 3300005456 | Bacteria | 1595 |
| 145 | Ga0070678_101515479 | 3300005456 | Unclassified | 628 |
| 146 | Ga0070662_100001323 | 3300005457 | Bacteria | 15219 |
| 147 | Ga0070662_100006647 | 3300005457 | Bacteria | 7467 |
| 148 | Ga0070662_100018683 | 3300005457 | Bacteria | 4693 |
| 149 | Ga0070662_100124332 | 3300005457 | Bacteria | 1981 |
| 150 | Ga0070662_100139100 | 3300005457 | Bacteria | 1880 |
| 151 | Ga0070662_100149183 | 3300005457 | Bacteria | 1819 |
| 152 | Ga0070662_100250395 | 3300005457 | Bacteria | 1424 |
| 153 | Ga0070662_100430257 | 3300005457 | Bacteria | 1093 |
| 154 | Ga0070662_100530355 | 3300005457 | Bacteria | 985 |
| 155 | Ga0070662_101461638 | 3300005457 | Bacteria | 589 |
| 156 | Ga0070681_10028705 | 3300005458 | Bacteria | 5593 |
| 157 | Ga0070681_10071742 | 3300005458 | Bacteria | 3428 |
| 158 | Ga0070681_10143556 | 3300005458 | Bacteria | 2316 |
| 159 | Ga0070681_10343395 | 3300005458 | Bacteria | 1403 |
| 160 | Ga0068867_100262102 | 3300005459 | Bacteria | 1409 |
| 161 | Ga0068867_100323444 | 3300005459 | Bacteria | 1278 |
| 162 | Ga0068867_100740138 | 3300005459 | Bacteria | 871 |
| 163 | Ga0068867_101016412 | 3300005459 | Unclassified | 752 |
| 164 | Ga0070685_10029982 | 3300005466 | Bacteria | 3026 |
| 165 | Ga0070685_10157102 | 3300005466 | Bacteria | 1446 |
| 166 | Ga0070685_10920050 | 3300005466 | Unclassified | 652 |
| 167 | Ga0070679_100026734 | 3300005530 | Bacteria | 5674 |
| 168 | Ga0070679_100033833 | 3300005530 | Bacteria | 5061 |
| 169 | Ga0070679_100165095 | 3300005530 | Bacteria | 2188 |
| 170 | Ga0070679_100738838 | 3300005530 | Bacteria | 927 |
| 171 | Ga0070684_100003373 | 3300005535 | Bacteria | 11965 |
| 172 | Ga0070684_100005950 | 3300005535 | Bacteria | 9394 |
| 173 | Ga0070684_100406222 | 3300005535 | Bacteria | 1256 |
| 174 | Ga0070684_101445390 | 3300005535 | Bacteria | 648 |
| 175 | Ga0068853_100103745 | 3300005539 | Bacteria | 2517 |
| 176 | Ga0068853_100150264 | 3300005539 | Bacteria | 2096 |
| 177 | Ga0068853_100289616 | 3300005539 | Bacteria | 1511 |
| 178 | Ga0068853_100316992 | 3300005539 | Bacteria | 1445 |
| 179 | Ga0068853_100373494 | 3300005539 | Bacteria | 1331 |
| 180 | Ga0068853_100385497 | 3300005539 | Bacteria | 1309 |
| 181 | Ga0068853_100454856 | 3300005539 | Bacteria | 1204 |
| 182 | Ga0068853_100504952 | 3300005539 | Bacteria | 1142 |
| 183 | Ga0068853_101204120 | 3300005539 | Bacteria | 731 |
| 184 | Ga0068853_101520060 | 3300005539 | Bacteria | 648 |
| 185 | Ga0070672_100012992 | 3300005543 | Bacteria | 5868 |
| 186 | Ga0070672_100037701 | 3300005543 | Bacteria | 3689 |
| 187 | Ga0070672_100047548 | 3300005543 | Bacteria | 3330 |
| 188 | Ga0070672_100062807 | 3300005543 | Bacteria | 2932 |
| 189 | Ga0070672_100193546 | 3300005543 | Bacteria | 1699 |
| 190 | Ga0070672_100399319 | 3300005543 | Unclassified | 1178 |
| 191 | Ga0070686_100047912 | 3300005544 | Bacteria | 2705 |
| 192 | Ga0070693_100141298 | 3300005547 | Bacteria | 1516 |
| 193 | Ga0070665_100050630 | 3300005548 | Bacteria | 4168 |
| 194 | Ga0070665_100105181 | 3300005548 | Bacteria | 2824 |
| 195 | Ga0068855_100014603 | 3300005563 | Bacteria | 9459 |
| 196 | Ga0068855_100060002 | 3300005563 | Bacteria | 4449 |
| 197 | Ga0068855_100166060 | 3300005563 | Bacteria | 2502 |
| 198 | Ga0068855_100225252 | 3300005563 | Bacteria | 2101 |
| 199 | Ga0068855_100723041 | 3300005563 | Bacteria | 1064 |
| 200 | Ga0068855_100924204 | 3300005563 | Bacteria | 920 |
| 201 | Ga0068855_101245710 | 3300005563 | Unclassified | 772 |
| 202 | Ga0068855_101467440 | 3300005563 | Unclassified | 701 |
| 203 | Ga0070664_100004583 | 3300005564 | Bacteria | 11091 |
| 204 | Ga0070664_100005728 | 3300005564 | Bacteria | 10014 |
| 205 | Ga0070664_100013554 | 3300005564 | Bacteria | 6642 |
| 206 | Ga0070664_100020711 | 3300005564 | Bacteria | 5416 |
| 207 | Ga0070664_100035241 | 3300005564 | Bacteria | 4201 |
| 208 | Ga0070664_100045232 | 3300005564 | Bacteria | 3718 |
| 209 | Ga0070664_100148055 | 3300005564 | Bacteria | 2071 |
| 210 | Ga0070664_100538408 | 3300005564 | Unclassified | 1079 |
| 211 | Ga0068857_100012718 | 3300005577 | Bacteria | 7336 |
| 212 | Ga0068857_100031092 | 3300005577 | Bacteria | 4718 |
| 213 | Ga0068857_100171813 | 3300005577 | Bacteria | 1970 |
| 214 | Ga0068857_100212268 | 3300005577 | Bacteria | 1767 |
| 215 | Ga0068857_100311046 | 3300005577 | Bacteria | 1453 |
| 216 | Ga0068857_100314305 | 3300005577 | Bacteria | 1446 |
| 217 | Ga0068857_101783223 | 3300005577 | Bacteria | 602 |
| 218 | Ga0068854_100009843 | 3300005578 | Bacteria | 6182 |
| 219 | Ga0068854_100018356 | 3300005578 | Bacteria | 4695 |
| 220 | Ga0068854_100052082 | 3300005578 | Bacteria | 2934 |
| 221 | Ga0068854_100185912 | 3300005578 | Bacteria | 1626 |
| 222 | Ga0068854_100228820 | 3300005578 | Bacteria | 1475 |
| 223 | Ga0068854_100357226 | 3300005578 | Bacteria | 1198 |
| 224 | Ga0068854_100390911 | 3300005578 | Bacteria | 1148 |
| 225 | Ga0068856_100042934 | 3300005614 | Bacteria | 4449 |
| 226 | Ga0068856_100248319 | 3300005614 | Bacteria | 1794 |
| 227 | Ga0068856_100424438 | 3300005614 | Bacteria | 1350 |
| 228 | Ga0068856_101147068 | 3300005614 | Bacteria | 794 |
| 229 | Ga0070702_100111413 | 3300005615 | Bacteria | 1697 |
| 230 | Ga0068852_100007881 | 3300005616 | Bacteria | 7798 |
| 231 | Ga0068852_100038865 | 3300005616 | Bacteria | 4003 |
| 232 | Ga0068852_100041508 | 3300005616 | Bacteria | 3888 |
| 233 | Ga0068852_100081641 | 3300005616 | Bacteria | 2870 |
| 234 | Ga0068852_100181379 | 3300005616 | Bacteria | 1980 |
| 235 | Ga0068852_100191532 | 3300005616 | Bacteria | 1930 |
| 236 | Ga0068852_100267084 | 3300005616 | Bacteria | 1645 |
| 237 | Ga0068852_100348263 | 3300005616 | Bacteria | 1446 |
| 238 | Ga0068852_100494211 | 3300005616 | Bacteria | 1217 |
| 239 | Ga0068852_100618103 | 3300005616 | Bacteria | 1089 |
| 240 | Ga0068852_100764701 | 3300005616 | Bacteria | 979 |
| 241 | Ga0068852_100886851 | 3300005616 | Bacteria | 909 |
| 242 | Ga0068852_101154267 | 3300005616 | Unclassified | 795 |
| 243 | Ga0068852_101168425 | 3300005616 | Bacteria | 790 |
| 244 | Ga0068859_100039867 | 3300005617 | Bacteria | 4713 |
| 245 | Ga0068859_100250995 | 3300005617 | Bacteria | 1860 |
| 246 | Ga0068864_100001952 | 3300005618 | Bacteria | 16953 |
| 247 | Ga0068864_100008756 | 3300005618 | Bacteria | 8343 |
| 248 | Ga0068864_100018445 | 3300005618 | Bacteria | 5830 |
| 249 | Ga0068864_100065886 | 3300005618 | Bacteria | 3142 |
| 250 | Ga0068864_100267979 | 3300005618 | Bacteria | 1590 |
| 251 | Ga0068866_10034977 | 3300005718 | Bacteria | 2451 |
| 252 | Ga0068866_10052426 | 3300005718 | Bacteria | 2082 |
| 253 | Ga0068866_10095958 | 3300005718 | Bacteria | 1625 |
| 254 | Ga0068861_100135833 | 3300005719 | Bacteria | 2001 |
| 255 | Ga0068861_100624015 | 3300005719 | Bacteria | 992 |
| 256 | Ga0068851_10075198 | 3300005834 | Bacteria | 1755 |
| 257 | Ga0068851_10164604 | 3300005834 | Bacteria | 1220 |
| 258 | Ga0068851_10391682 | 3300005834 | Bacteria | 816 |
| 259 | Ga0068851_10453959 | 3300005834 | Bacteria | 762 |
| 260 | Ga0068870_10247491 | 3300005840 | Bacteria | 1104 |
| 261 | Ga0068863_100020336 | 3300005841 | Bacteria | 6347 |
| 262 | Ga0068863_100156718 | 3300005841 | Bacteria | 2180 |
| 263 | Ga0068863_100327710 | 3300005841 | Bacteria | 1488 |
| 264 | Ga0068858_100015586 | 3300005842 | Bacteria | 7149 |
| 265 | Ga0068858_100017967 | 3300005842 | Bacteria | 6623 |
| 266 | Ga0068860_100193218 | 3300005843 | Bacteria | 1970 |
| 267 | Ga0068860_102164779 | 3300005843 | Unclassified | 577 |
| 268 | Ga0068862_100256225 | 3300005844 | Bacteria | 1596 |
| 269 | Ga0070717_10034526 | 3300006028 | Bacteria | 4089 |
| 270 | Ga0070717_10180121 | 3300006028 | Bacteria | 1841 |
| 271 | Ga0070716_100025494 | 3300006173 | Bacteria | 3155 |
| 272 | Ga0070716_100238537 | 3300006173 | Bacteria | 1232 |
| 273 | Ga0070712_100028025 | 3300006175 | Bacteria | 3764 |
| 274 | Ga0075366_10142042 | 3300006195 | Bacteria | 1452 |
| 275 | Ga0097621_100098106 | 3300006237 | Bacteria | 2461 |
| 276 | Ga0097621_100240914 | 3300006237 | Bacteria | 1581 |
| 277 | Ga0097621_100312849 | 3300006237 | Bacteria | 1389 |
| 278 | Ga0068871_100024968 | 3300006358 | Bacteria | 4643 |
| 279 | Ga0068871_100264376 | 3300006358 | Bacteria | 1501 |
| 280 | Ga0068871_100674063 | 3300006358 | Bacteria | 946 |
| 281 | Ga0068865_100028753 | 3300006881 | Bacteria | 3682 |
| 282 | Ga0068865_100124950 | 3300006881 | Bacteria | 1919 |
| 283 | Ga0068865_100390299 | 3300006881 | Bacteria | 1138 |
| 284 | Ga0097620_100039868 | 3300006931 | Bacteria | 4713 |
| 285 | Ga0097620_100250982 | 3300006931 | Bacteria | 1860 |
| 286 | Ga0105240_10019380 | 3300009093 | Bacteria | 9089 |
| 287 | Ga0105240_10329832 | 3300009093 | Bacteria | 1737 |
| 288 | Ga0105240_10357186 | 3300009093 | Bacteria | 1656 |
| 289 | Ga0105245_10153409 | 3300009098 | Bacteria | 2180 |
| 290 | Ga0105245_10181861 | 3300009098 | Bacteria | 2009 |
| 291 | Ga0105245_10338393 | 3300009098 | Bacteria | 1487 |
| 292 | Ga0105245_10455925 | 3300009098 | Bacteria | 1288 |
| 293 | Ga0105243_10060153 | 3300009148 | Bacteria | 3034 |
| 294 | Ga0105243_10123153 | 3300009148 | Bacteria | 2189 |
| 295 | Ga0105241_10034765 | 3300009174 | Bacteria | 3789 |
| 296 | Ga0105242_10243417 | 3300009176 | Bacteria | 1618 |
| 297 | Ga0105242_10679719 | 3300009176 | Bacteria | 1004 |
| 298 | Ga0105242_11408460 | 3300009176 | Bacteria | 725 |
| 299 | Ga0105248_10002275 | 3300009177 | Bacteria | 21260 |
| 300 | Ga0105248_10002500 | 3300009177 | Bacteria | 20447 |
| 301 | Ga0105248_10004589 | 3300009177 | Bacteria | 15299 |
| 302 | Ga0105248_10039061 | 3300009177 | Bacteria | 5315 |
| 303 | Ga0105248_10112061 | 3300009177 | Bacteria | 3077 |
| 304 | Ga0105248_10248477 | 3300009177 | Bacteria | 2002 |
| 305 | Ga0105248_10297792 | 3300009177 | Bacteria | 1816 |
| 306 | Ga0105248_10468777 | 3300009177 | Bacteria | 1420 |
| 307 | Ga0105248_11718686 | 3300009177 | Bacteria | 711 |
| 308 | Ga0105248_11937777 | 3300009177 | Bacteria | 669 |
| 309 | Ga0105237_10013446 | 3300009545 | Bacteria | 8583 |
| 310 | Ga0105238_10023266 | 3300009551 | Bacteria | 6316 |
| 311 | Ga0105238_10181661 | 3300009551 | Bacteria | 2080 |
| 312 | Ga0105238_10205934 | 3300009551 | Bacteria | 1943 |
| 313 | Ga0105238_10395057 | 3300009551 | Bacteria | 1375 |
| 314 | Ga0105238_11300184 | 3300009551 | Bacteria | 753 |
| 315 | Ga0105239_10338501 | 3300010375 | Bacteria | 1698 |
| 316 | Ga0157373_10007319 | 3300013100 | Bacteria | 8220 |
| 317 | Ga0157373_10051084 | 3300013100 | Bacteria | 2944 |
| 318 | Ga0157373_10066196 | 3300013100 | Bacteria | 2556 |
| 319 | Ga0157373_10082890 | 3300013100 | Bacteria | 2260 |
| 320 | Ga0157373_10092370 | 3300013100 | Bacteria | 2131 |
| 321 | Ga0157373_10132984 | 3300013100 | Bacteria | 1749 |
| 322 | Ga0157373_10474639 | 3300013100 | Bacteria | 902 |
| 323 | Ga0157373_10489811 | 3300013100 | Bacteria | 887 |
| 324 | Ga0157371_10029991 | 3300013102 | Bacteria | 3926 |
| 325 | Ga0157371_10056851 | 3300013102 | Bacteria | 2775 |
| 326 | Ga0157371_10096631 | 3300013102 | Bacteria | 2093 |
| 327 | Ga0157371_11318291 | 3300013102 | Unclassified | 559 |
| 328 | Ga0157370_10000497 | 3300013104 | Bacteria | 48916 |
| 329 | Ga0157370_10032144 | 3300013104 | Bacteria | 5126 |
| 330 | Ga0157370_10051504 | 3300013104 | Bacteria | 3933 |
| 331 | Ga0157370_10097694 | 3300013104 | Bacteria | 2755 |
| 332 | Ga0157370_10161493 | 3300013104 | Bacteria | 2084 |
| 333 | Ga0157370_10320549 | 3300013104 | Bacteria | 1429 |
| 334 | Ga0157370_10356717 | 3300013104 | Bacteria | 1347 |
| 335 | Ga0157370_10553265 | 3300013104 | Bacteria | 1055 |
| 336 | Ga0157370_11046511 | 3300013104 | Bacteria | 738 |
| 337 | Ga0157370_11372224 | 3300013104 | Bacteria | 636 |
| 338 | Ga0157369_10112222 | 3300013105 | Bacteria | 2896 |
| 339 | Ga0157369_10152251 | 3300013105 | Bacteria | 2444 |
| 340 | Ga0157369_10177092 | 3300013105 | Bacteria | 2245 |
| 341 | Ga0157369_10330557 | 3300013105 | Bacteria | 1584 |
| 342 | Ga0157369_10439559 | 3300013105 | Bacteria | 1351 |
| 343 | Ga0157369_11953484 | 3300013105 | Unclassified | 595 |
| 344 | Ga0157374_10006812 | 3300013296 | Bacteria | 9720 |
| 345 | Ga0157378_10063734 | 3300013297 | Bacteria | 3294 |
| 346 | Ga0157378_10378559 | 3300013297 | Bacteria | 1389 |
| 347 | Ga0157378_10788027 | 3300013297 | Bacteria | 976 |
| 348 | Ga0157378_11794056 | 3300013297 | Bacteria | 661 |
| 349 | Ga0157378_12374034 | 3300013297 | Unclassified | 582 |
| 350 | Ga0163162_10008116 | 3300013306 | Bacteria | 10244 |
| 351 | Ga0163162_10277612 | 3300013306 | Unclassified | 1808 |
| 352 | Ga0163162_11968195 | 3300013306 | Bacteria | 669 |
| 353 | Ga0157372_10052507 | 3300013307 | Bacteria | 4540 |
| 354 | Ga0157372_10237916 | 3300013307 | Bacteria | 2112 |
| 355 | Ga0157372_10320909 | 3300013307 | Bacteria | 1803 |
| 356 | Ga0157372_10454270 | 3300013307 | Bacteria | 1493 |
| 357 | Ga0157372_10629150 | 3300013307 | Bacteria | 1250 |
| 358 | Ga0157372_11503142 | 3300013307 | Bacteria | 776 |
| 359 | Ga0157372_11723683 | 3300013307 | Unclassified | 721 |
| 360 | Ga0157375_10002069 | 3300013308 | Bacteria | 17350 |
| 361 | Ga0157375_10054020 | 3300013308 | Bacteria | 3955 |
| 362 | Ga0157375_10272296 | 3300013308 | Bacteria | 1855 |
| 363 | Ga0157375_10585388 | 3300013308 | Bacteria | 1276 |
| 364 | Ga0157375_11427103 | 3300013308 | Unclassified | 816 |
| 365 | Ga0163163_10005023 | 3300014325 | Bacteria | 11402 |
| 366 | Ga0163163_10021041 | 3300014325 | Bacteria | 6153 |
| 367 | Ga0163163_10382065 | 3300014325 | Bacteria | 1466 |
| 368 | Ga0157380_10492898 | 3300014326 | Bacteria | 1188 |
| 369 | Ga0157380_11328287 | 3300014326 | Bacteria | 767 |
| 370 | Ga0157379_10033250 | 3300014968 | Bacteria | 4599 |
| 371 | Ga0157379_10226747 | 3300014968 | Bacteria | 1693 |
| 372 | Ga0157376_10274911 | 3300014969 | Bacteria | 1584 |
| 373 | Ga0163161_10030131 | 3300017792 | Bacteria | 3860 |
| 374 | Ga0206356_11732949 | 3300020070 | Bacteria | 2515 |
| 375 | Ga0206353_10506929 | 3300020082 | Bacteria | 740 |
| 376 | Ga0206353_11527701 | 3300020082 | Bacteria | 743 |
| 377 | Ga0213876_10073437 | 3300021384 | Bacteria | 1806 |
| 378 | Ga0207697_10213914 | 3300025315 | Bacteria | 850 |
| 379 | Ga0207656_10044703 | 3300025321 | Bacteria | 1892 |
| 380 | Ga0207656_10086815 | 3300025321 | Bacteria | 1414 |
| 381 | Ga0207656_10155705 | 3300025321 | Bacteria | 1084 |
| 382 | Ga0207656_10404974 | 3300025321 | Unclassified | 686 |
| 383 | Ga0207682_10015022 | 3300025893 | Bacteria | 3015 |
| 384 | Ga0207682_10024752 | 3300025893 | Bacteria | 2379 |
| 385 | Ga0207682_10156195 | 3300025893 | Unclassified | 1031 |
| 386 | Ga0207642_10025501 | 3300025899 | Bacteria | 2393 |
| 387 | Ga0207642_10909223 | 3300025899 | Unclassified | 564 |
| 388 | Ga0207688_10204756 | 3300025901 | Bacteria | 1184 |
| 389 | Ga0207688_10801516 | 3300025901 | Unclassified | 597 |
| 390 | Ga0207680_10002816 | 3300025903 | Bacteria | 8144 |
| 391 | Ga0207680_10022081 | 3300025903 | Bacteria | 3456 |
| 392 | Ga0207680_10054410 | 3300025903 | Bacteria | 2407 |
| 393 | Ga0207647_10009032 | 3300025904 | Bacteria | 7098 |
| 394 | Ga0207647_10055492 | 3300025904 | Bacteria | 2434 |
| 395 | Ga0207647_10055785 | 3300025904 | Bacteria | 2427 |
| 396 | Ga0207647_10085192 | 3300025904 | Bacteria | 1890 |
| 397 | Ga0207647_10214681 | 3300025904 | Bacteria | 1110 |
| 398 | Ga0207647_10308294 | 3300025904 | Bacteria | 900 |
| 399 | Ga0207699_10084550 | 3300025906 | Bacteria | 1976 |
| 400 | Ga0207645_10080255 | 3300025907 | Bacteria | 2091 |
| 401 | Ga0207645_10116468 | 3300025907 | Bacteria | 1733 |
| 402 | Ga0207643_10119506 | 3300025908 | Bacteria | 1560 |
| 403 | Ga0207705_10000123 | 3300025909 | Bacteria | 85382 |
| 404 | Ga0207705_10003112 | 3300025909 | Bacteria | 12660 |
| 405 | Ga0207705_10005892 | 3300025909 | Bacteria | 9112 |
| 406 | Ga0207705_10023003 | 3300025909 | Bacteria | 4445 |
| 407 | Ga0207705_10145749 | 3300025909 | Bacteria | 1771 |
| 408 | Ga0207705_10334958 | 3300025909 | Bacteria | 1164 |
| 409 | Ga0207705_10468713 | 3300025909 | Bacteria | 977 |
| 410 | Ga0207707_10267597 | 3300025912 | Bacteria | 1482 |
| 411 | Ga0207707_10536319 | 3300025912 | Bacteria | 995 |
| 412 | Ga0207695_10019756 | 3300025913 | Bacteria | 7745 |
| 413 | Ga0207671_10040892 | 3300025914 | Bacteria | 3431 |
| 414 | Ga0207693_10006527 | 3300025915 | Bacteria | 9654 |
| 415 | Ga0207663_11646690 | 3300025916 | Unclassified | 516 |
| 416 | Ga0207660_10004906 | 3300025917 | Bacteria | 8711 |
| 417 | Ga0207660_10287443 | 3300025917 | Bacteria | 1307 |
| 418 | Ga0207660_10563670 | 3300025917 | Bacteria | 927 |
| 419 | Ga0207660_10626903 | 3300025917 | Bacteria | 876 |
| 420 | Ga0207662_10137730 | 3300025918 | Bacteria | 1544 |
| 421 | Ga0207662_10207514 | 3300025918 | Bacteria | 1271 |
| 422 | Ga0207657_10000650 | 3300025919 | Bacteria | 36973 |
| 423 | Ga0207657_10015919 | 3300025919 | Bacteria | 7265 |
| 424 | Ga0207657_10021597 | 3300025919 | Bacteria | 6052 |
| 425 | Ga0207657_10036095 | 3300025919 | Bacteria | 4426 |
| 426 | Ga0207657_10037057 | 3300025919 | Bacteria | 4360 |
| 427 | Ga0207657_10043151 | 3300025919 | Bacteria | 3975 |
| 428 | Ga0207657_10046829 | 3300025919 | Bacteria | 3786 |
| 429 | Ga0207657_10064016 | 3300025919 | Bacteria | 3141 |
| 430 | Ga0207657_10120974 | 3300025919 | Bacteria | 2154 |
| 431 | Ga0207657_10142002 | 3300025919 | Bacteria | 1961 |
| 432 | Ga0207657_10156314 | 3300025919 | Bacteria | 1854 |
| 433 | Ga0207657_10251239 | 3300025919 | Bacteria | 1409 |
| 434 | Ga0207657_10459006 | 3300025919 | Bacteria | 999 |
| 435 | Ga0207657_10985601 | 3300025919 | Bacteria | 647 |
| 436 | Ga0207657_11377829 | 3300025919 | Unclassified | 530 |
| 437 | Ga0207649_10006477 | 3300025920 | Bacteria | 6358 |
| 438 | Ga0207649_10007819 | 3300025920 | Bacteria | 5817 |
| 439 | Ga0207649_10012717 | 3300025920 | Bacteria | 4678 |
| 440 | Ga0207649_10028634 | 3300025920 | Bacteria | 3281 |
| 441 | Ga0207649_10061755 | 3300025920 | Bacteria | 2360 |
| 442 | Ga0207649_10136418 | 3300025920 | Bacteria | 1673 |
| 443 | Ga0207649_10192176 | 3300025920 | Bacteria | 1436 |
| 444 | Ga0207649_10205728 | 3300025920 | Bacteria | 1393 |
| 445 | Ga0207649_10628796 | 3300025920 | Bacteria | 828 |
| 446 | Ga0207649_10742575 | 3300025920 | Bacteria | 763 |
| 447 | Ga0207649_10759833 | 3300025920 | Unclassified | 755 |
| 448 | Ga0207649_11067846 | 3300025920 | Bacteria | 636 |
| 449 | Ga0207652_10000034 | 3300025921 | Bacteria | 138571 |
| 450 | Ga0207652_10103873 | 3300025921 | Bacteria | 2513 |
| 451 | Ga0207652_10227372 | 3300025921 | Bacteria | 1682 |
| 452 | Ga0207652_10324329 | 3300025921 | Bacteria | 1390 |
| 453 | Ga0207652_10598662 | 3300025921 | Bacteria | 989 |
| 454 | Ga0207681_10068097 | 3300025923 | Bacteria | 2471 |
| 455 | Ga0207694_10651681 | 3300025924 | Bacteria | 887 |
| 456 | Ga0207650_10001872 | 3300025925 | Bacteria | 14855 |
| 457 | Ga0207650_10007236 | 3300025925 | Bacteria | 7559 |
| 458 | Ga0207650_10163307 | 3300025925 | Bacteria | 1766 |
| 459 | Ga0207650_10378579 | 3300025925 | Bacteria | 1168 |
| 460 | Ga0207650_10452711 | 3300025925 | Bacteria | 1068 |
| 461 | Ga0207650_10721750 | 3300025925 | Bacteria | 842 |
| 462 | Ga0207650_10889204 | 3300025925 | Unclassified | 756 |
| 463 | Ga0207659_10122238 | 3300025926 | Bacteria | 1996 |
| 464 | Ga0207659_11313156 | 3300025926 | Bacteria | 621 |
| 465 | Ga0207687_10103334 | 3300025927 | Bacteria | 2101 |
| 466 | Ga0207687_10126363 | 3300025927 | Bacteria | 1920 |
| 467 | Ga0207687_10224950 | 3300025927 | Bacteria | 1479 |
| 468 | Ga0207700_10193889 | 3300025928 | Bacteria | 1708 |
| 469 | Ga0207700_10239641 | 3300025928 | Bacteria | 1545 |
| 470 | Ga0207664_10043401 | 3300025929 | Bacteria | 3516 |
| 471 | Ga0207664_10122032 | 3300025929 | Bacteria | 2182 |
| 472 | Ga0207664_10334196 | 3300025929 | Bacteria | 1339 |
| 473 | Ga0207664_10428650 | 3300025929 | Bacteria | 1179 |
| 474 | Ga0207644_10000773 | 3300025931 | Bacteria | 20259 |
| 475 | Ga0207644_10000847 | 3300025931 | Bacteria | 19396 |
| 476 | Ga0207644_10000998 | 3300025931 | Bacteria | 18072 |
| 477 | Ga0207644_10017928 | 3300025931 | Bacteria | 4787 |
| 478 | Ga0207644_10038435 | 3300025931 | Bacteria | 3371 |
| 479 | Ga0207644_10313397 | 3300025931 | Bacteria | 1267 |
| 480 | Ga0207644_10321703 | 3300025931 | Bacteria | 1251 |
| 481 | Ga0207644_10447389 | 3300025931 | Bacteria | 1061 |
| 482 | Ga0207644_10544825 | 3300025931 | Bacteria | 960 |
| 483 | Ga0207690_10006143 | 3300025932 | Bacteria | 7116 |
| 484 | Ga0207690_10011654 | 3300025932 | Bacteria | 5255 |
| 485 | Ga0207690_10020356 | 3300025932 | Bacteria | 4098 |
| 486 | Ga0207690_10025092 | 3300025932 | Bacteria | 3739 |
| 487 | Ga0207690_10152901 | 3300025932 | Bacteria | 1712 |
| 488 | Ga0207690_10292578 | 3300025932 | Bacteria | 1272 |
| 489 | Ga0207690_10406564 | 3300025932 | Bacteria | 1086 |
| 490 | Ga0207690_10651968 | 3300025932 | Unclassified | 863 |
| 491 | Ga0207690_10970886 | 3300025932 | Bacteria | 706 |
| 492 | Ga0207706_10000253 | 3300025933 | Bacteria | 58135 |
| 493 | Ga0207706_10003262 | 3300025933 | Bacteria | 15536 |
| 494 | Ga0207706_10004173 | 3300025933 | Bacteria | 13606 |
| 495 | Ga0207706_10005402 | 3300025933 | Bacteria | 11912 |
| 496 | Ga0207706_10035503 | 3300025933 | Bacteria | 4431 |
| 497 | Ga0207706_10047951 | 3300025933 | Bacteria | 3778 |
| 498 | Ga0207706_10120757 | 3300025933 | Bacteria | 2304 |
| 499 | Ga0207706_10292083 | 3300025933 | Bacteria | 1421 |
| 500 | Ga0207706_10610403 | 3300025933 | Bacteria | 936 |
| 501 | Ga0207706_10753964 | 3300025933 | Bacteria | 829 |
| 502 | Ga0207709_10204147 | 3300025935 | Bacteria | 1414 |
| 503 | Ga0207670_10106352 | 3300025936 | Bacteria | 2013 |
| 504 | Ga0207669_10006240 | 3300025937 | Bacteria | 5431 |
| 505 | Ga0207669_10014692 | 3300025937 | Bacteria | 3931 |
| 506 | Ga0207669_10164671 | 3300025937 | Bacteria | 1571 |
| 507 | Ga0207669_10321025 | 3300025937 | Bacteria | 1185 |
| 508 | Ga0207704_10143493 | 3300025938 | Bacteria | 1674 |
| 509 | Ga0207704_10967718 | 3300025938 | Bacteria | 718 |
| 510 | Ga0207665_10021532 | 3300025939 | Bacteria | 4240 |
| 511 | Ga0207665_10040756 | 3300025939 | Bacteria | 3100 |
| 512 | Ga0207691_10007401 | 3300025940 | Bacteria | 10572 |
| 513 | Ga0207691_10040509 | 3300025940 | Bacteria | 4303 |
| 514 | Ga0207691_10075315 | 3300025940 | Bacteria | 3043 |
| 515 | Ga0207691_10110488 | 3300025940 | Bacteria | 2445 |
| 516 | Ga0207691_10114746 | 3300025940 | Bacteria | 2393 |
| 517 | Ga0207691_10435378 | 3300025940 | Bacteria | 1117 |
| 518 | Ga0207711_10000309 | 3300025941 | Bacteria | 52342 |
| 519 | Ga0207711_10002790 | 3300025941 | Bacteria | 15368 |
| 520 | Ga0207711_10005331 | 3300025941 | Bacteria | 10903 |
| 521 | Ga0207711_10033742 | 3300025941 | Bacteria | 4332 |
| 522 | Ga0207711_10226322 | 3300025941 | Bacteria | 1712 |
| 523 | Ga0207711_10485016 | 3300025941 | Bacteria | 1152 |
| 524 | Ga0207711_10519447 | 3300025941 | Bacteria | 1110 |
| 525 | Ga0207661_10015802 | 3300025944 | Bacteria | 5560 |
| 526 | Ga0207661_10099438 | 3300025944 | Bacteria | 2439 |
| 527 | Ga0207661_10379087 | 3300025944 | Bacteria | 1280 |
| 528 | Ga0207661_11323335 | 3300025944 | Bacteria | 662 |
| 529 | Ga0207679_10006100 | 3300025945 | Bacteria | 7603 |
| 530 | Ga0207679_10007359 | 3300025945 | Bacteria | 6981 |
| 531 | Ga0207679_10011664 | 3300025945 | Bacteria | 5704 |
| 532 | Ga0207679_10060515 | 3300025945 | Bacteria | 2814 |
| 533 | Ga0207679_10062443 | 3300025945 | Bacteria | 2776 |
| 534 | Ga0207679_10097866 | 3300025945 | Bacteria | 2286 |
| 535 | Ga0207679_10456368 | 3300025945 | Unclassified | 1134 |
| 536 | Ga0207679_11605049 | 3300025945 | Unclassified | 596 |
| 537 | Ga0207679_11784370 | 3300025945 | Unclassified | 562 |
| 538 | Ga0207667_10036894 | 3300025949 | Bacteria | 5232 |
| 539 | Ga0207667_10080700 | 3300025949 | Bacteria | 3370 |
| 540 | Ga0207667_10096314 | 3300025949 | Bacteria | 3054 |
| 541 | Ga0207667_10169314 | 3300025949 | Bacteria | 2245 |
| 542 | Ga0207667_10429502 | 3300025949 | Bacteria | 1344 |
| 543 | Ga0207667_10583559 | 3300025949 | Bacteria | 1128 |
| 544 | Ga0207667_10761332 | 3300025949 | Bacteria | 967 |
| 545 | Ga0207667_10911560 | 3300025949 | Bacteria | 870 |
| 546 | Ga0207667_11347496 | 3300025949 | Unclassified | 689 |
| 547 | Ga0207667_11386711 | 3300025949 | Bacteria | 677 |
| 548 | Ga0207651_10006825 | 3300025960 | Bacteria | 6021 |
| 549 | Ga0207651_10024726 | 3300025960 | Bacteria | 3720 |
| 550 | Ga0207651_10058746 | 3300025960 | Bacteria | 2659 |
| 551 | Ga0207651_10063600 | 3300025960 | Bacteria | 2577 |
| 552 | Ga0207651_10100537 | 3300025960 | Bacteria | 2144 |
| 553 | Ga0207651_10476137 | 3300025960 | Bacteria | 1075 |
| 554 | Ga0207651_11771814 | 3300025960 | Unclassified | 556 |
| 555 | Ga0207640_10003637 | 3300025981 | Bacteria | 8317 |
| 556 | Ga0207640_10045020 | 3300025981 | Bacteria | 2831 |
| 557 | Ga0207640_10085859 | 3300025981 | Bacteria | 2165 |
| 558 | Ga0207640_10201935 | 3300025981 | Bacteria | 1507 |
| 559 | Ga0207640_10466978 | 3300025981 | Bacteria | 1044 |
| 560 | Ga0207640_10517459 | 3300025981 | Bacteria | 997 |
| 561 | Ga0207640_11036455 | 3300025981 | Bacteria | 723 |
| 562 | Ga0207640_11247253 | 3300025981 | Bacteria | 662 |
| 563 | Ga0207658_10005278 | 3300025986 | Bacteria | 8888 |
| 564 | Ga0207658_10007111 | 3300025986 | Bacteria | 7623 |
| 565 | Ga0207658_10246860 | 3300025986 | Bacteria | 1515 |
| 566 | Ga0207658_11465508 | 3300025986 | Bacteria | 624 |
| 567 | Ga0207677_10004742 | 3300026023 | Bacteria | 7330 |
| 568 | Ga0207677_10005621 | 3300026023 | Bacteria | 6813 |
| 569 | Ga0207677_10006993 | 3300026023 | Bacteria | 6208 |
| 570 | Ga0207677_10114783 | 3300026023 | Bacteria | 2013 |
| 571 | Ga0207677_10396494 | 3300026023 | Bacteria | 1169 |
| 572 | Ga0207677_10415148 | 3300026023 | Bacteria | 1145 |
| 573 | Ga0207703_10001905 | 3300026035 | Bacteria | 18500 |
| 574 | Ga0207703_10003444 | 3300026035 | Bacteria | 13265 |
| 575 | Ga0207639_10017111 | 3300026041 | Bacteria | 5136 |
| 576 | Ga0207639_10353310 | 3300026041 | Bacteria | 1313 |
| 577 | Ga0207639_10546463 | 3300026041 | Bacteria | 1063 |
| 578 | Ga0207639_10964253 | 3300026041 | Bacteria | 798 |
| 579 | Ga0207678_10000530 | 3300026067 | Bacteria | 34763 |
| 580 | Ga0207678_10033261 | 3300026067 | Bacteria | 4493 |
| 581 | Ga0207678_10043209 | 3300026067 | Bacteria | 3901 |
| 582 | Ga0207678_10057296 | 3300026067 | Bacteria | 3353 |
| 583 | Ga0207678_10107410 | 3300026067 | Bacteria | 2381 |
| 584 | Ga0207678_10125462 | 3300026067 | Bacteria | 2190 |
| 585 | Ga0207702_10018250 | 3300026078 | Bacteria | 5803 |
| 586 | Ga0207702_10022150 | 3300026078 | Bacteria | 5266 |
| 587 | Ga0207702_10022741 | 3300026078 | Bacteria | 5200 |
| 588 | Ga0207702_10080338 | 3300026078 | Bacteria | 2829 |
| 589 | Ga0207702_10097461 | 3300026078 | Bacteria | 2588 |
| 590 | Ga0207702_10415644 | 3300026078 | Bacteria | 1300 |
| 591 | Ga0207641_10004961 | 3300026088 | Bacteria | 11414 |
| 592 | Ga0207641_10035112 | 3300026088 | Bacteria | 4175 |
| 593 | Ga0207641_10035960 | 3300026088 | Bacteria | 4131 |
| 594 | Ga0207641_10944613 | 3300026088 | Bacteria | 857 |
| 595 | Ga0207648_10008589 | 3300026089 | Bacteria | 9879 |
| 596 | Ga0207648_10010729 | 3300026089 | Bacteria | 8661 |
| 597 | Ga0207648_10017417 | 3300026089 | Bacteria | 6539 |
| 598 | Ga0207648_10196909 | 3300026089 | Bacteria | 1787 |
| 599 | Ga0207676_10002086 | 3300026095 | Bacteria | 14504 |
| 600 | Ga0207676_10050546 | 3300026095 | Bacteria | 3241 |
| 601 | Ga0207676_10058420 | 3300026095 | Unclassified | 3042 |
| 602 | Ga0207676_10168808 | 3300026095 | Bacteria | 1904 |
| 603 | Ga0207676_10388761 | 3300026095 | Bacteria | 1300 |
| 604 | Ga0207676_10437349 | 3300026095 | Bacteria | 1230 |
| 605 | Ga0207674_10000086 | 3300026116 | Bacteria | 100722 |
| 606 | Ga0207674_10009133 | 3300026116 | Bacteria | 11375 |
| 607 | Ga0207674_10024503 | 3300026116 | Bacteria | 6447 |
| 608 | Ga0207674_10025828 | 3300026116 | Bacteria | 6253 |
| 609 | Ga0207674_10104762 | 3300026116 | Bacteria | 2807 |
| 610 | Ga0207674_10890687 | 3300026116 | Bacteria | 858 |
| 611 | Ga0207675_100406877 | 3300026118 | Bacteria | 1342 |
| 612 | Ga0207683_10001185 | 3300026121 | Bacteria | 23609 |
| 613 | Ga0207683_10002289 | 3300026121 | Bacteria | 16796 |
| 614 | Ga0207683_10012568 | 3300026121 | Bacteria | 7223 |
| 615 | Ga0207683_10025482 | 3300026121 | Bacteria | 5102 |
| 616 | Ga0207683_10064773 | 3300026121 | Bacteria | 3221 |
| 617 | Ga0207683_10751853 | 3300026121 | Bacteria | 904 |
| 618 | Ga0207698_10022715 | 3300026142 | Bacteria | 4367 |
| 619 | Ga0207698_10035892 | 3300026142 | Bacteria | 3632 |
| 620 | Ga0207698_10059285 | 3300026142 | Bacteria | 2971 |
| 621 | Ga0207698_10082423 | 3300026142 | Bacteria | 2600 |
| 622 | Ga0207698_10204728 | 3300026142 | Bacteria | 1770 |
| 623 | Ga0207698_10224844 | 3300026142 | Bacteria | 1699 |
| 624 | Ga0207698_10246853 | 3300026142 | Bacteria | 1631 |
| 625 | Ga0207698_10365760 | 3300026142 | Bacteria | 1367 |
| 626 | Ga0207698_10424980 | 3300026142 | Bacteria | 1276 |
| 627 | Ga0207698_10478920 | 3300026142 | Bacteria | 1207 |
| 628 | Ga0207698_10990117 | 3300026142 | Unclassified | 851 |
| 629 | Ga0207698_11834691 | 3300026142 | Unclassified | 621 |
| 630 | Ga0268266_10008034 | 3300028379 | Bacteria | 9427 |
| 631 | Ga0268264_10163145 | 3300028381 | Bacteria | 2009 |
| 632 | Ga0307408_100056776 | 3300031548 | Bacteria | 2839 |
| 633 | Ga0307408_100706062 | 3300031548 | Bacteria | 907 |
| 634 | Ga0307405_10510980 | 3300031731 | Unclassified | 965 |
| 635 | Ga0307413_10069858 | 3300031824 | Bacteria | 2205 |
| 636 | Ga0307410_10046796 | 3300031852 | Bacteria | 2887 |
| 637 | Ga0307410_10874639 | 3300031852 | Unclassified | 768 |
| 638 | Ga0307407_10082799 | 3300031903 | Bacteria | 1945 |
| 639 | Ga0307409_100043042 | 3300031995 | Bacteria | 3386 |
| 640 | Ga0307416_100002017 | 3300032002 | Bacteria | 11409 |
| 641 | Ga0307416_100002746 | 3300032002 | Bacteria | 10214 |
| 642 | Ga0307414_11242895 | 3300032004 | Bacteria | 690 |
| 643 | Ga0307411_10026993 | 3300032005 | Bacteria | 3466 |
| 644 | Ga0307411_10421695 | 3300032005 | Bacteria | 1109 |
| 645 | Ga0307415_100004978 | 3300032126 | Bacteria | 6990 |
| 646 | Ga0373950_0120368 | 3300034818 | Bacteria | 580 |
| 647 | Ga0373928_0120946 | 3300035084 | Bacteria | 702 |
| 648 | Ga0373944_0086944 | 3300035089 | Bacteria | 1040 |
| 649 | Ga0373949_0063813 | 3300035090 | Bacteria | 953 |
| 650 | Ga0373923_0258160 | 3300035111 | Bacteria | 817 |
| 651 | Ga0373943_0004797 | 3300035170 | Bacteria | 6108 |
| 652 | Ga0373943_0209055 | 3300035170 | Bacteria | 1083 |
| 653 | Ga0373946_0082908 | 3300035171 | Bacteria | 1407 |
| 654 | Ga0373955_0385931 | 3300035172 | Unclassified | 850 |
| 655 | Ga0373931_0099681 | 3300035691 | Bacteria | 1632 |
| 656 | Ga0373931_1103842 | 3300035691 | Bacteria | 540 |
| 657 | Ga0373947_0025983 | 3300035725 | Bacteria | 3417 |
| 658 | Ga0373925_0068548 | 3300037068 | Bacteria | 2678 |
| 659 | Ga0373925_0222599 | 3300037068 | Bacteria | 1507 |
| 660 | Ga0395899_0000255 | 3300037312 | Bacteria | 70382 |
| 661 | Ga0395899_0009306 | 3300037312 | Bacteria | 7544 |
| 662 | Ga0395899_0020860 | 3300037312 | Bacteria | 4969 |
| 663 | Ga0395899_0038215 | 3300037312 | Bacteria | 3596 |
| 664 | Ga0395899_0056093 | 3300037312 | Bacteria | 2912 |
| 665 | Ga0395899_0081969 | 3300037312 | Bacteria | 2346 |
| 666 | Ga0395899_0211484 | 3300037312 | Bacteria | 1347 |
| 667 | Ga0395899_0287474 | 3300037312 | Bacteria | 1116 |
| 668 | Ga0395899_0306530 | 3300037312 | Unclassified | 1073 |
| 669 | Ga0395899_0420078 | 3300037312 | Bacteria | 881 |
| 670 | Ga0395899_0452383 | 3300037312 | Bacteria | 840 |
| 671 | Ga0395899_0661515 | 3300037312 | Unclassified | 659 |
| 672 | Ga0395900_0000308 | 3300037418 | Bacteria | 72664 |
| 673 | Ga0395900_0011396 | 3300037418 | Bacteria | 9100 |
| 674 | Ga0395900_0012634 | 3300037418 | Bacteria | 8634 |
| 675 | Ga0395900_0019379 | 3300037418 | Bacteria | 6938 |
| 676 | Ga0395900_0080496 | 3300037418 | Bacteria | 3347 |
| 677 | Ga0395900_0081843 | 3300037418 | Bacteria | 3316 |
| 678 | Ga0395900_0118874 | 3300037418 | Bacteria | 2712 |
| 679 | Ga0395900_0126528 | 3300037418 | Bacteria | 2621 |
| 680 | Ga0395900_0137487 | 3300037418 | Bacteria | 2503 |
| 681 | Ga0395900_0153361 | 3300037418 | Bacteria | 2353 |
| 682 | Ga0395900_0189105 | 3300037418 | Bacteria | 2089 |
| 683 | Ga0395900_0204595 | 3300037418 | Bacteria | 1995 |
| 684 | Ga0395900_0214952 | 3300037418 | Bacteria | 1940 |
| 685 | Ga0395900_0293854 | 3300037418 | Bacteria | 1613 |
| 686 | Ga0395900_0317181 | 3300037418 | Bacteria | 1540 |
| 687 | Ga0395900_0323222 | 3300037418 | Bacteria | 1522 |
| 688 | Ga0395900_0323229 | 3300037418 | Bacteria | 1522 |
| 689 | Ga0395900_0368083 | 3300037418 | Bacteria | 1407 |
| 690 | Ga0395900_0381843 | 3300037418 | Bacteria | 1376 |
| 691 | Ga0395900_0449256 | 3300037418 | Bacteria | 1245 |
| 692 | Ga0395900_0588982 | 3300037418 | Bacteria | 1053 |
| 693 | Ga0395900_0686171 | 3300037418 | Bacteria | 958 |
| 694 | Ga0395900_0725241 | 3300037418 | Bacteria | 926 |
| 695 | Ga0395900_0905058 | 3300037418 | Bacteria | 805 |
| 696 | Ga0395898_0000054 | 3300037466 | Bacteria | 279561 |
| 697 | Ga0395898_0008175 | 3300037466 | Bacteria | 11074 |
| 698 | Ga0395898_0018525 | 3300037466 | Bacteria | 7095 |
| 699 | Ga0395898_0026840 | 3300037466 | Bacteria | 5788 |
| 700 | Ga0395898_0034536 | 3300037466 | Bacteria | 5039 |
| 701 | Ga0395898_0047061 | 3300037466 | Bacteria | 4234 |
| 702 | Ga0395898_0091847 | 3300037466 | Bacteria | 2920 |
| 703 | Ga0395898_0123811 | 3300037466 | Bacteria | 2477 |
| 704 | Ga0395898_0128079 | 3300037466 | Bacteria | 2432 |
| 705 | Ga0395898_0242745 | 3300037466 | Bacteria | 1718 |
| 706 | Ga0395898_0303648 | 3300037466 | Bacteria | 1522 |
| 707 | Ga0395898_0303649 | 3300037466 | Bacteria | 1522 |
| 708 | Ga0395898_0361511 | 3300037466 | Bacteria | 1384 |
| 709 | Ga0395898_0808648 | 3300037466 | Bacteria | 877 |
| 710 | Ga0395898_1233077 | 3300037466 | Bacteria | 678 |
| 711 | Ga0395898_1822060 | 3300037466 | Bacteria | 529 |
| 712 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 713 | Ga0395905_0002249 | 3300037471 | Bacteria | 21706 |
| 714 | Ga0395905_0005968 | 3300037471 | Bacteria | 12337 |
| 715 | Ga0395905_0009874 | 3300037471 | Bacteria | 9303 |
| 716 | Ga0395905_0010554 | 3300037471 | Bacteria | 8972 |
| 717 | Ga0395905_0011035 | 3300037471 | Bacteria | 8743 |
| 718 | Ga0395905_0021518 | 3300037471 | Bacteria | 6098 |
| 719 | Ga0395905_0021725 | 3300037471 | Bacteria | 6071 |
| 720 | Ga0395905_0026175 | 3300037471 | Bacteria | 5501 |
| 721 | Ga0395905_0026664 | 3300037471 | Bacteria | 5448 |
| 722 | Ga0395905_0036630 | 3300037471 | Bacteria | 4608 |
| 723 | Ga0395905_0045091 | 3300037471 | Bacteria | 4136 |
| 724 | Ga0395905_0045341 | 3300037471 | Bacteria | 4123 |
| 725 | Ga0395905_0055546 | 3300037471 | Bacteria | 3705 |
| 726 | Ga0395905_0058111 | 3300037471 | Bacteria | 3617 |
| 727 | Ga0395905_0067879 | 3300037471 | Bacteria | 3340 |
| 728 | Ga0395905_0091715 | 3300037471 | Bacteria | 2848 |
| 729 | Ga0395905_0112437 | 3300037471 | Bacteria | 2558 |
| 730 | Ga0395905_0276305 | 3300037471 | Bacteria | 1565 |
| 731 | Ga0395905_0278202 | 3300037471 | Bacteria | 1559 |
| 732 | Ga0395905_0283029 | 3300037471 | Bacteria | 1544 |
| 733 | Ga0395905_0386088 | 3300037471 | Bacteria | 1294 |
| 734 | Ga0395905_0509713 | 3300037471 | Bacteria | 1103 |
| 735 | Ga0395905_0600350 | 3300037471 | Bacteria | 1002 |
| 736 | Ga0395905_0603453 | 3300037471 | Unclassified | 999 |
| 737 | Ga0395905_0610706 | 3300037471 | Bacteria | 992 |
| 738 | Ga0395905_0781879 | 3300037471 | Bacteria | 857 |
| 739 | Ga0395905_0838057 | 3300037471 | Bacteria | 822 |
| 740 | Ga0395905_0876684 | 3300037471 | Bacteria | 800 |
| 741 | Ga0395905_0995150 | 3300037471 | Bacteria | 741 |
| 742 | Ga0395905_1220789 | 3300037471 | Bacteria | 655 |
| 743 | Ga0395905_1319058 | 3300037471 | Unclassified | 625 |
| 744 | Ga0395901_0002475 | 3300038443 | Bacteria | 18743 |
| 745 | Ga0395901_0004565 | 3300038443 | Bacteria | 13977 |
| 746 | Ga0395901_0008267 | 3300038443 | Bacteria | 10510 |
| 747 | Ga0395901_0022105 | 3300038443 | Bacteria | 6516 |
| 748 | Ga0395901_0036955 | 3300038443 | Bacteria | 5050 |
| 749 | Ga0395901_0049587 | 3300038443 | Bacteria | 4362 |
| 750 | Ga0395901_0052535 | 3300038443 | Bacteria | 4235 |
| 751 | Ga0395901_0068543 | 3300038443 | Bacteria | 3695 |
| 752 | Ga0395901_0073246 | 3300038443 | Bacteria | 3572 |
| 753 | Ga0395901_0076098 | 3300038443 | Bacteria | 3502 |
| 754 | Ga0395901_0210633 | 3300038443 | Bacteria | 2034 |
| 755 | Ga0395901_0214910 | 3300038443 | Bacteria | 2011 |
| 756 | Ga0395901_0350897 | 3300038443 | Bacteria | 1522 |
| 757 | Ga0395901_0388010 | 3300038443 | Bacteria | 1436 |
| 758 | Ga0395901_0402786 | 3300038443 | Bacteria | 1405 |
| 759 | Ga0395901_0420516 | 3300038443 | Bacteria | 1370 |
| 760 | Ga0395901_0511986 | 3300038443 | Bacteria | 1220 |
| 761 | Ga0395901_0578870 | 3300038443 | Bacteria | 1134 |
| 762 | Ga0395901_0603133 | 3300038443 | Bacteria | 1107 |
| 763 | Ga0395901_0628802 | 3300038443 | Bacteria | 1079 |
| 764 | Ga0395901_0697125 | 3300038443 | Bacteria | 1013 |
| 765 | Ga0395901_0846411 | 3300038443 | Bacteria | 900 |
| 766 | Ga0395901_0886204 | 3300038443 | Bacteria | 875 |
| 767 | Ga0395901_1085758 | 3300038443 | Bacteria | 771 |
| 768 | Ga0395901_1313847 | 3300038443 | Bacteria | 684 |
| 769 | Ga0436365_0334369 | 3300039437 | Bacteria | 4991 |
| 770 | Ga0439448_0006381 | 3300042005 | Bacteria | 3390 |
| 771 | Ga0439432_037635 | 3300042006 | Bacteria | 1543 |
| 772 | Ga0439449_0159720 | 3300042007 | Bacteria | 841 |
| 773 | Ga0439455_0005339 | 3300042012 | Bacteria | 2604 |
| 774 | Ga0439455_0005956 | 3300042012 | Bacteria | 2505 |
| 775 | Ga0439458_0000012 | 3300042157 | Bacteria | 27891 |
| 776 | Ga0466972_0038303 | 3300044658 | Bacteria | 2342 |
| 777 | Ga0466972_0174509 | 3300044658 | Bacteria | 1008 |
| 778 | Ga0466966_0006878 | 3300044684 | Bacteria | 7534 |
| 779 | Ga0466966_0097376 | 3300044684 | Bacteria | 1822 |
| 780 | Ga0466966_0105924 | 3300044684 | Bacteria | 1735 |
| 781 | Ga0466966_0447923 | 3300044684 | Bacteria | 776 |
| 782 | Ga0466966_0583167 | 3300044684 | Bacteria | 673 |
| 783 | Ga0466966_0695116 | 3300044684 | Bacteria | 613 |
| 784 | Ga0466966_0852026 | 3300044684 | Unclassified | 549 |
| 785 | Ga0466961_0078955 | 3300044693 | Bacteria | 2084 |
| 786 | Ga0466963_0048814 | 3300044694 | Bacteria | 2798 |
| 787 | Ga0466963_0212030 | 3300044694 | Bacteria | 1355 |
| 788 | Ga0466963_0333472 | 3300044694 | Bacteria | 1068 |
| 789 | Ga0466963_0625644 | 3300044694 | Bacteria | 760 |
| 790 | Ga0466964_0010281 | 3300044706 | Bacteria | 3529 |
| 791 | Ga0466971_0018338 | 3300044719 | Bacteria | 3099 |
| 792 | Ga0466970_0048727 | 3300044765 | Bacteria | 2259 |
| 793 | Ga0466970_0077358 | 3300044765 | Bacteria | 1793 |
| 794 | Ga0466970_0530737 | 3300044765 | Unclassified | 679 |
| 795 | Ga0466957_0065599 | 3300044842 | Bacteria | 2236 |
| 796 | Ga0466957_0649881 | 3300044842 | Bacteria | 741 |
| 797 | Ga0466960_0026401 | 3300044901 | Bacteria | 2638 |
| 798 | Ga0466959_0030940 | 3300045049 | Bacteria | 3963 |
| 799 | Ga0466959_0106087 | 3300045049 | Bacteria | 2009 |
| 800 | Ga0466959_0360371 | 3300045049 | Unclassified | 991 |
| 801 | Ga0466959_0369563 | 3300045049 | Bacteria | 977 |
| 802 | Ga0466958_0003925 | 3300045836 | Bacteria | 7796 |
| 803 | Ga0466958_0015665 | 3300045836 | Bacteria | 4350 |
| 804 | Ga0466958_0165117 | 3300045836 | Bacteria | 1400 |
| 805 | Ga0466958_1044708 | 3300045836 | Bacteria | 533 |
| 806 | Ga0466967_0422698 | 3300045976 | Bacteria | 1299 |
| 807 | Ga0466967_0694958 | 3300045976 | Bacteria | 1007 |
| 808 | Ga0466967_0782641 | 3300045976 | Bacteria | 947 |
| 809 | Ga0495629_0224959 | 3300046459 | Bacteria | 1294 |
| 810 | Ga0495639_0430492 | 3300046475 | Unclassified | 669 |
| 811 | Ga0495643_0145691 | 3300046522 | Bacteria | 1177 |
| 812 | Ga0495663_0192840 | 3300046525 | Bacteria | 709 |
| 813 | Ga0495598_0000260 | 3300046537 | Bacteria | 9513 |
| 814 | Ga0495621_0000141 | 3300046539 | Bacteria | 15332 |
| 815 | Ga0495621_0258039 | 3300046539 | Bacteria | 713 |
| 816 | Ga0495669_0273968 | 3300046684 | Bacteria | 811 |
| 817 | Ga0495670_0001090 | 3300046691 | Bacteria | 13174 |
| 818 | Ga0495600_0601471 | 3300046809 | Unclassified | 668 |
| 819 | Ga0496100_0011309 | 3300048903 | Bacteria | 5079 |
| 820 | Ga0496100_0180754 | 3300048903 | Bacteria | 1525 |
| 821 | Ga0496101_0001753 | 3300048904 | Bacteria | 13007 |
| 822 | Ga0496101_0060013 | 3300048904 | Bacteria | 2758 |
| 823 | Ga0496101_0420496 | 3300048904 | Unclassified | 1053 |
| 824 | Ga0496101_0490997 | 3300048904 | Bacteria | 970 |
| 825 | Ga0496102_0048281 | 3300048905 | Bacteria | 3870 |
| 826 | Ga0496102_0068861 | 3300048905 | Bacteria | 3248 |
| 827 | Ga0496102_0450043 | 3300048905 | Unclassified | 1208 |
| 828 | Ga0496102_0756720 | 3300048905 | Bacteria | 894 |
| 829 | Ga0496103_0016593 | 3300048906 | Bacteria | 4395 |
| 830 | Ga0496103_0080909 | 3300048906 | Bacteria | 2043 |
| 831 | Ga0496103_0483535 | 3300048906 | Bacteria | 793 |
| 832 | Ga0496104_0253425 | 3300048907 | Bacteria | 1673 |
| 833 | Ga0496105_0094720 | 3300048908 | Bacteria | 2466 |
| 834 | Ga0496106_0035893 | 3300048909 | Bacteria | 3708 |
| 835 | Ga0496106_0059332 | 3300048909 | Bacteria | 2898 |
| 836 | Ga0496106_0406801 | 3300048909 | Bacteria | 1094 |
| 837 | Ga0496106_0481769 | 3300048909 | Bacteria | 997 |
| 838 | Ga0496106_0900057 | 3300048909 | Bacteria | 699 |
| 839 | Ga0496107_0016637 | 3300048910 | Bacteria | 5167 |
| 840 | Ga0496107_0340199 | 3300048910 | Bacteria | 1116 |
| 841 | Ga0496108_0001744 | 3300048911 | Bacteria | 17271 |
| 842 | Ga0496108_0002538 | 3300048911 | Bacteria | 14612 |
| 843 | Ga0496108_0013638 | 3300048911 | Bacteria | 6634 |
| 844 | Ga0496108_0580004 | 3300048911 | Bacteria | 978 |
| 845 | Ga0496109_0012585 | 3300048912 | Bacteria | 7305 |
| 846 | Ga0496109_0019207 | 3300048912 | Bacteria | 6020 |
| 847 | Ga0496110_0002765 | 3300048913 | Bacteria | 13248 |
| 848 | Ga0496110_0013487 | 3300048913 | Bacteria | 6759 |
| 849 | Ga0496111_0026521 | 3300048914 | Bacteria | 4093 |
| 850 | Ga0496111_0118118 | 3300048914 | Bacteria | 1957 |
| 851 | Ga0496112_0006596 | 3300048915 | Bacteria | 10213 |
| 852 | Ga0496112_0015341 | 3300048915 | Bacteria | 7144 |
| 853 | Ga0496112_0015503 | 3300048915 | Bacteria | 7116 |
| 854 | Ga0496112_0083338 | 3300048915 | Bacteria | 3162 |
| 855 | Ga0496112_0111255 | 3300048915 | Bacteria | 2709 |
| 856 | Ga0496112_0143170 | 3300048915 | Bacteria | 2360 |
| 857 | Ga0496113_0007832 | 3300048916 | Bacteria | 6904 |
| 858 | Ga0496113_0009435 | 3300048916 | Bacteria | 6401 |
| 859 | Ga0496113_0017930 | 3300048916 | Bacteria | 4923 |
| 860 | Ga0496113_0047337 | 3300048916 | Unclassified | 3195 |
| 861 | Ga0496113_0497700 | 3300048916 | Bacteria | 979 |
| 862 | Ga0496114_0000016 | 3300048917 | Bacteria | 274656 |
| 863 | Ga0496114_0018758 | 3300048917 | Bacteria | 5599 |
| 864 | Ga0496115_0445548 | 3300048918 | Bacteria | 1046 |
| 865 | Ga0501067_0007369 | 3300049583 | Bacteria | 6111 |
| 866 | Ga0501068_0480315 | 3300049584 | Bacteria | 805 |
| 867 | Ga0501069_0124363 | 3300049585 | Bacteria | 1474 |
| 868 | Ga0501209_005570 | 3300049656 | Bacteria | 2284 |
| 869 | Ga0501211_021198 | 3300049658 | Bacteria | 684 |
| 870 | Ga0501216_019369 | 3300049660 | Bacteria | 1180 |
| 871 | Ga0501217_084876 | 3300049661 | Bacteria | 882 |
| 872 | Ga0501233_022828 | 3300049668 | Bacteria | 1355 |
| 873 | Ga0501235_009855 | 3300049669 | Bacteria | 2089 |
| 874 | Ga0501242_005751 | 3300049674 | Bacteria | 1403 |
| 875 | Ga0501243_019493 | 3300049675 | Bacteria | 1112 |
| 876 | Ga0501249_008573 | 3300049679 | Bacteria | 2122 |
| 877 | Ga0501252_023175 | 3300049682 | Bacteria | 824 |
| 878 | Ga0501221_005493 | 3300049704 | Bacteria | 2120 |
| 879 | Ga0501229_009596 | 3300049706 | Bacteria | 1217 |
| 880 | Ga0501234_003160 | 3300049707 | Bacteria | 2591 |
| 881 | Ga0501262_080626 | 3300049759 | Unclassified | 544 |
| 882 | Ga0501266_093433 | 3300049763 | Unclassified | 525 |
| 883 | Ga0501268_000552 | 3300049765 | Bacteria | 4122 |
| 884 | Ga0501212_008763 | 3300049851 | Bacteria | 1413 |
| 885 | Ga0495595_0136359 | 3300053084 | Bacteria | 1202 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0661515 | Ga0395899_0661515_113_574 | 129 |
| 2 | 3300037418 | Ga0395900_0293854 | Ga0395900_0293854_868_1329 | 129 |
| 3 | 3300045976 | Ga0466967_0694958 | Ga0466967_0694958_157_639 | 131 |
| 4 | 3300005364 | Ga0070673_100869071 | Ga0070673_1008690712 | 133 |
| 5 | 3300013104 | Ga0157370_10356717 | Ga0157370_103567171 | 133 |
| 6 | 3300045976 | Ga0466967_0782641 | Ga0466967_0782641_23_454 | 133 |
| 7 | 3300005435 | Ga0070714_100133863 | Ga0070714_1001338633 | 134 |
| 8 | 3300005458 | Ga0070681_10343395 | Ga0070681_103433953 | 134 |
| 9 | 3300005535 | Ga0070684_101445390 | Ga0070684_1014453901 | 134 |
| 10 | 3300005563 | Ga0068855_100225252 | Ga0068855_1002252522 | 134 |
| 11 | 3300013100 | Ga0157373_10082890 | Ga0157373_100828903 | 134 |
| 12 | 3300013104 | Ga0157370_11046511 | Ga0157370_110465112 | 134 |
| 13 | 3300020082 | Ga0206353_10506929 | Ga0206353_105069291 | 134 |
| 14 | 3300025912 | Ga0207707_10536319 | Ga0207707_105363192 | 134 |
| 15 | 3300025920 | Ga0207649_10061755 | Ga0207649_100617552 | 134 |
| 16 | 3300025929 | Ga0207664_10428650 | Ga0207664_104286502 | 134 |
| 17 | 3300025949 | Ga0207667_10169314 | Ga0207667_101693143 | 134 |
| 18 | 3300037418 | Ga0395900_0368083 | Ga0395900_0368083_798_1271 | 134 |
| 19 | 3300037418 | Ga0395900_0449256 | Ga0395900_0449256_606_1076 | 134 |
| 20 | 3300037471 | Ga0395905_0283029 | Ga0395905_0283029_886_1356 | 134 |
| 21 | 3300037471 | Ga0395905_0386088 | Ga0395905_0386088_81_554 | 134 |
| 22 | 3300037471 | Ga0395905_0995150 | Ga0395905_0995150_190_663 | 134 |
| 23 | 3300037471 | Ga0395905_1319058 | Ga0395905_1319058_79_552 | 134 |
| 24 | 3300038443 | Ga0395901_1085758 | Ga0395901_1085758_137_610 | 134 |
| 25 | 3300005335 | Ga0070666_10028328 | Ga0070666_100283284 | 135 |
| 26 | 3300005338 | Ga0068868_100380073 | Ga0068868_1003800732 | 135 |
| 27 | 3300005367 | Ga0070667_100208062 | Ga0070667_1002080623 | 135 |
| 28 | 3300013308 | Ga0157375_11427103 | Ga0157375_114271031 | 135 |
| 29 | 3300025903 | Ga0207680_10054410 | Ga0207680_100544102 | 135 |
| 30 | 3300025960 | Ga0207651_10476137 | Ga0207651_104761372 | 135 |
| 31 | 3300048917 | Ga0496114_0000016 | Ga0496114_0000016_259264_259713 | 135 |
| 32 | 3300005436 | Ga0070713_102023214 | Ga0070713_1020232141 | 136 |
| 33 | 3300009093 | Ga0105240_10357186 | Ga0105240_103571862 | 136 |
| 34 | 3300025904 | Ga0207647_10085192 | Ga0207647_100851921 | 136 |
| 35 | 3300044765 | Ga0466970_0048727 | Ga0466970_0048727_1201_1641 | 136 |
| 36 | 3300005355 | Ga0070671_100091963 | Ga0070671_1000919632 | 137 |
| 37 | 3300013297 | Ga0157378_10788027 | Ga0157378_107880272 | 137 |
| 38 | 3300025931 | Ga0207644_10321703 | Ga0207644_103217033 | 137 |
| 39 | 3300044684 | Ga0466966_0006878 | Ga0466966_0006878_1366_1824 | 139 |
| 40 | 3300045049 | Ga0466959_0030940 | Ga0466959_0030940_2309_2767 | 139 |
| 41 | 3300044694 | Ga0466963_0625644 | Ga0466963_0625644_258_725 | 140 |
| 42 | 3300002239 | JGI24034J26672_10004989 | JGI24034J26672_100049892 | 143 |
| 43 | 3300005330 | Ga0070690_100240527 | Ga0070690_1002405272 | 143 |
| 44 | 3300005331 | Ga0070670_100002043 | Ga0070670_10000204315 | 143 |
| 45 | 3300005333 | Ga0070677_10402896 | Ga0070677_104028962 | 143 |
| 46 | 3300005335 | Ga0070666_10000877 | Ga0070666_1000087716 | 143 |
| 47 | 3300005338 | Ga0068868_100054365 | Ga0068868_1000543653 | 143 |
| 48 | 3300005344 | Ga0070661_100022428 | Ga0070661_1000224282 | 143 |
| 49 | 3300005354 | Ga0070675_100022113 | Ga0070675_1000221136 | 143 |
| 50 | 3300005355 | Ga0070671_100015111 | Ga0070671_1000151114 | 143 |
| 51 | 3300005364 | Ga0070673_100008965 | Ga0070673_1000089654 | 143 |
| 52 | 3300005367 | Ga0070667_100004036 | Ga0070667_1000040367 | 143 |
| 53 | 3300005367 | Ga0070667_100327653 | Ga0070667_1003276532 | 143 |
| 54 | 3300005456 | Ga0070678_100002062 | Ga0070678_1000020626 | 143 |
| 55 | 3300005456 | Ga0070678_101515479 | Ga0070678_1015154791 | 143 |
| 56 | 3300005457 | Ga0070662_100001323 | Ga0070662_10000132314 | 143 |
| 57 | 3300005466 | Ga0070685_10029982 | Ga0070685_100299823 | 143 |
| 58 | 3300005548 | Ga0070665_100050630 | Ga0070665_1000506302 | 143 |
| 59 | 3300005564 | Ga0070664_100004583 | Ga0070664_10000458310 | 143 |
| 60 | 3300005616 | Ga0068852_100007881 | Ga0068852_1000078812 | 143 |
| 61 | 3300005617 | Ga0068859_100250995 | Ga0068859_1002509952 | 143 |
| 62 | 3300005618 | Ga0068864_100008756 | Ga0068864_1000087564 | 143 |
| 63 | 3300005841 | Ga0068863_100020336 | Ga0068863_1000203367 | 143 |
| 64 | 3300005842 | Ga0068858_100015586 | Ga0068858_1000155862 | 143 |
| 65 | 3300006237 | Ga0097621_100098106 | Ga0097621_1000981062 | 143 |
| 66 | 3300006237 | Ga0097621_100240914 | Ga0097621_1002409142 | 143 |
| 67 | 3300006358 | Ga0068871_100024968 | Ga0068871_1000249685 | 143 |
| 68 | 3300006931 | Ga0097620_100250982 | Ga0097620_1002509824 | 143 |
| 69 | 3300009177 | Ga0105248_10004589 | Ga0105248_100045897 | 143 |
| 70 | 3300009177 | Ga0105248_10039061 | Ga0105248_100390615 | 143 |
| 71 | 3300009177 | Ga0105248_11718686 | Ga0105248_117186862 | 143 |
| 72 | 3300009551 | Ga0105238_11300184 | Ga0105238_113001842 | 143 |
| 73 | 3300013105 | Ga0157369_10177092 | Ga0157369_101770922 | 143 |
| 74 | 3300013296 | Ga0157374_10006812 | Ga0157374_1000681210 | 143 |
| 75 | 3300013306 | Ga0163162_10008116 | Ga0163162_100081164 | 143 |
| 76 | 3300013307 | Ga0157372_11723683 | Ga0157372_117236832 | 143 |
| 77 | 3300013308 | Ga0157375_10002069 | Ga0157375_1000206910 | 143 |
| 78 | 3300014325 | Ga0163163_10005023 | Ga0163163_100050238 | 143 |
| 79 | 3300025893 | Ga0207682_10156195 | Ga0207682_101561952 | 143 |
| 80 | 3300025903 | Ga0207680_10002816 | Ga0207680_100028163 | 143 |
| 81 | 3300025920 | Ga0207649_10006477 | Ga0207649_100064772 | 143 |
| 82 | 3300025925 | Ga0207650_10001872 | Ga0207650_100018727 | 143 |
| 83 | 3300025931 | Ga0207644_10000847 | Ga0207644_1000084714 | 143 |
| 84 | 3300025931 | Ga0207644_10313397 | Ga0207644_103133972 | 143 |
| 85 | 3300025933 | Ga0207706_10000253 | Ga0207706_1000025324 | 143 |
| 86 | 3300025941 | Ga0207711_10002790 | Ga0207711_1000279012 | 143 |
| 87 | 3300025941 | Ga0207711_10033742 | Ga0207711_100337424 | 143 |
| 88 | 3300025945 | Ga0207679_10011664 | Ga0207679_100116644 | 143 |
| 89 | 3300025949 | Ga0207667_10096314 | Ga0207667_100963144 | 143 |
| 90 | 3300025949 | Ga0207667_10583559 | Ga0207667_105835592 | 143 |
| 91 | 3300025960 | Ga0207651_10006825 | Ga0207651_100068255 | 143 |
| 92 | 3300025981 | Ga0207640_10201935 | Ga0207640_102019351 | 143 |
| 93 | 3300025986 | Ga0207658_10007111 | Ga0207658_100071118 | 143 |
| 94 | 3300026023 | Ga0207677_10006993 | Ga0207677_100069936 | 143 |
| 95 | 3300026035 | Ga0207703_10003444 | Ga0207703_100034447 | 143 |
| 96 | 3300026078 | Ga0207702_10415644 | Ga0207702_104156442 | 143 |
| 97 | 3300026088 | Ga0207641_10004961 | Ga0207641_1000496110 | 143 |
| 98 | 3300026095 | Ga0207676_10002086 | Ga0207676_100020864 | 143 |
| 99 | 3300026121 | Ga0207683_10001185 | Ga0207683_1000118520 | 143 |
| 100 | 3300026142 | Ga0207698_10035892 | Ga0207698_100358922 | 143 |
| 101 | 3300028379 | Ga0268266_10008034 | Ga0268266_1000803412 | 143 |
| 102 | 3300037312 | Ga0395899_0452383 | Ga0395899_0452383_320_793 | 143 |
| 103 | 3300037418 | Ga0395900_0317181 | Ga0395900_0317181_40_471 | 143 |
| 104 | 3300037418 | Ga0395900_0588982 | Ga0395900_0588982_74_547 | 143 |
| 105 | 3300037471 | Ga0395905_0021518 | Ga0395905_0021518_1034_1465 | 143 |
| 106 | 3300037471 | Ga0395905_0610706 | Ga0395905_0610706_158_631 | 143 |
| 107 | 3300038443 | Ga0395901_0388010 | Ga0395901_0388010_369_800 | 143 |
| 108 | 3300044684 | Ga0466966_0852026 | Ga0466966_0852026_59_526 | 143 |
| 109 | 3300045836 | Ga0466958_1044708 | Ga0466958_1044708_55_510 | 143 |
| 110 | 3300046459 | Ga0495629_0224959 | Ga0495629_0224959_137_574 | 143 |
| 111 | 3300046475 | Ga0495639_0430492 | Ga0495639_0430492_18_455 | 143 |
| 112 | 3300048903 | Ga0496100_0180754 | Ga0496100_0180754_301_738 | 143 |
| 113 | 3300048904 | Ga0496101_0060013 | Ga0496101_0060013_1852_2289 | 143 |
| 114 | 3300048904 | Ga0496101_0420496 | Ga0496101_0420496_185_622 | 143 |
| 115 | 3300048905 | Ga0496102_0068861 | Ga0496102_0068861_514_951 | 143 |
| 116 | 3300048906 | Ga0496103_0080909 | Ga0496103_0080909_1288_1725 | 143 |
| 117 | 3300048907 | Ga0496104_0253425 | Ga0496104_0253425_666_1103 | 143 |
| 118 | 3300048909 | Ga0496106_0059332 | Ga0496106_0059332_1709_2146 | 143 |
| 119 | 3300048910 | Ga0496107_0340199 | Ga0496107_0340199_49_486 | 143 |
| 120 | 3300048911 | Ga0496108_0001744 | Ga0496108_0001744_3367_3804 | 143 |
| 121 | 3300048912 | Ga0496109_0012585 | Ga0496109_0012585_1790_2227 | 143 |
| 122 | 3300048913 | Ga0496110_0002765 | Ga0496110_0002765_5079_5516 | 143 |
| 123 | 3300048914 | Ga0496111_0026521 | Ga0496111_0026521_1730_2167 | 143 |
| 124 | 3300048915 | Ga0496112_0015341 | Ga0496112_0015341_2328_2765 | 143 |
| 125 | 3300048915 | Ga0496112_0111255 | Ga0496112_0111255_695_1135 | 143 |
| 126 | 3300048916 | Ga0496113_0007832 | Ga0496113_0007832_2413_2850 | 143 |
| 127 | 3300048916 | Ga0496113_0497700 | Ga0496113_0497700_446_886 | 143 |
| 128 | 3300048917 | Ga0496114_0018758 | Ga0496114_0018758_2834_3271 | 143 |
| 129 | 3300048918 | Ga0496115_0445548 | Ga0496115_0445548_53_490 | 143 |
| 130 | 3300005331 | Ga0070670_100159440 | Ga0070670_1001594402 | 144 |
| 131 | 3300005344 | Ga0070661_100358954 | Ga0070661_1003589542 | 144 |
| 132 | 3300005354 | Ga0070675_101746403 | Ga0070675_1017464031 | 144 |
| 133 | 3300005355 | Ga0070671_100003631 | Ga0070671_10000363112 | 144 |
| 134 | 3300005355 | Ga0070671_100004155 | Ga0070671_10000415514 | 144 |
| 135 | 3300005355 | Ga0070671_100009032 | Ga0070671_1000090322 | 144 |
| 136 | 3300005364 | Ga0070673_100146154 | Ga0070673_1001461542 | 144 |
| 137 | 3300005367 | Ga0070667_101831747 | Ga0070667_1018317471 | 144 |
| 138 | 3300005435 | Ga0070714_100022207 | Ga0070714_1000222073 | 144 |
| 139 | 3300005436 | Ga0070713_100319514 | Ga0070713_1003195143 | 144 |
| 140 | 3300005456 | Ga0070678_100012893 | Ga0070678_1000128936 | 144 |
| 141 | 3300005457 | Ga0070662_100006647 | Ga0070662_1000066476 | 144 |
| 142 | 3300005543 | Ga0070672_100193546 | Ga0070672_1001935462 | 144 |
| 143 | 3300005543 | Ga0070672_100399319 | Ga0070672_1003993192 | 144 |
| 144 | 3300005564 | Ga0070664_100538408 | Ga0070664_1005384082 | 144 |
| 145 | 3300005616 | Ga0068852_100191532 | Ga0068852_1001915323 | 144 |
| 146 | 3300005618 | Ga0068864_100001952 | Ga0068864_10000195215 | 144 |
| 147 | 3300009177 | Ga0105248_10002500 | Ga0105248_1000250011 | 144 |
| 148 | 3300009177 | Ga0105248_10112061 | Ga0105248_101120613 | 144 |
| 149 | 3300013306 | Ga0163162_10277612 | Ga0163162_102776122 | 144 |
| 150 | 3300025903 | Ga0207680_10022081 | Ga0207680_100220812 | 144 |
| 151 | 3300025920 | Ga0207649_10628796 | Ga0207649_106287962 | 144 |
| 152 | 3300025925 | Ga0207650_10378579 | Ga0207650_103785792 | 144 |
| 153 | 3300025926 | Ga0207659_11313156 | Ga0207659_113131562 | 144 |
| 154 | 3300025928 | Ga0207700_10193889 | Ga0207700_101938893 | 144 |
| 155 | 3300025931 | Ga0207644_10000773 | Ga0207644_1000077315 | 144 |
| 156 | 3300025931 | Ga0207644_10000998 | Ga0207644_100009982 | 144 |
| 157 | 3300025932 | Ga0207690_10651968 | Ga0207690_106519682 | 144 |
| 158 | 3300025933 | Ga0207706_10005402 | Ga0207706_1000540215 | 144 |
| 159 | 3300025940 | Ga0207691_10040509 | Ga0207691_100405095 | 144 |
| 160 | 3300025940 | Ga0207691_10435378 | Ga0207691_104353782 | 144 |
| 161 | 3300025941 | Ga0207711_10005331 | Ga0207711_1000533111 | 144 |
| 162 | 3300025944 | Ga0207661_11323335 | Ga0207661_113233351 | 144 |
| 163 | 3300025945 | Ga0207679_10456368 | Ga0207679_104563682 | 144 |
| 164 | 3300025960 | Ga0207651_10100537 | Ga0207651_101005373 | 144 |
| 165 | 3300025986 | Ga0207658_11465508 | Ga0207658_114655081 | 144 |
| 166 | 3300026088 | Ga0207641_10944613 | Ga0207641_109446132 | 144 |
| 167 | 3300026095 | Ga0207676_10058420 | Ga0207676_100584203 | 144 |
| 168 | 3300026121 | Ga0207683_10002289 | Ga0207683_1000228913 | 144 |
| 169 | 3300026142 | Ga0207698_10059285 | Ga0207698_100592852 | 144 |
| 170 | 3300037418 | Ga0395900_0011396 | Ga0395900_0011396_4437_4889 | 144 |
| 171 | 3300037418 | Ga0395900_0204595 | Ga0395900_0204595_708_1145 | 144 |
| 172 | 3300037466 | Ga0395898_0047061 | Ga0395898_0047061_2947_3384 | 144 |
| 173 | 3300037466 | Ga0395898_0123811 | Ga0395898_0123811_186_638 | 144 |
| 174 | 3300037471 | Ga0395905_0009874 | Ga0395905_0009874_8486_8938 | 144 |
| 175 | 3300037471 | Ga0395905_0045341 | Ga0395905_0045341_282_719 | 144 |
| 176 | 3300038443 | Ga0395901_0049587 | Ga0395901_0049587_3075_3512 | 144 |
| 177 | 3300038443 | Ga0395901_0402786 | Ga0395901_0402786_107_559 | 144 |
| 178 | 3300048904 | Ga0496101_0490997 | Ga0496101_0490997_264_707 | 144 |
| 179 | 3300048905 | Ga0496102_0450043 | Ga0496102_0450043_170_610 | 144 |
| 180 | 3300048909 | Ga0496106_0406801 | Ga0496106_0406801_295_738 | 144 |
| 181 | 3300048911 | Ga0496108_0013638 | Ga0496108_0013638_5882_6322 | 144 |
| 182 | 3300048912 | Ga0496109_0019207 | Ga0496109_0019207_931_1371 | 144 |
| 183 | 3300048915 | Ga0496112_0006596 | Ga0496112_0006596_1728_2168 | 144 |
| 184 | 3300048916 | Ga0496113_0047337 | Ga0496113_0047337_738_1178 | 144 |
| 185 | 3300003320 | rootH2_10129989 | rootH2_101299892 | 145 |
| 186 | 3300003323 | rootH1_10057877 | rootH1_100578773 | 145 |
| 187 | 3300005327 | Ga0070658_10410330 | Ga0070658_104103302 | 145 |
| 188 | 3300005327 | Ga0070658_10539273 | Ga0070658_105392732 | 145 |
| 189 | 3300005327 | Ga0070658_11129490 | Ga0070658_111294902 | 145 |
| 190 | 3300005327 | Ga0070658_11410324 | Ga0070658_114103241 | 145 |
| 191 | 3300005328 | Ga0070676_10060754 | Ga0070676_100607542 | 145 |
| 192 | 3300005329 | Ga0070683_100607702 | Ga0070683_1006077022 | 145 |
| 193 | 3300005331 | Ga0070670_100002145 | Ga0070670_1000021454 | 145 |
| 194 | 3300005336 | Ga0070680_100151075 | Ga0070680_1001510753 | 145 |
| 195 | 3300005336 | Ga0070680_100285536 | Ga0070680_1002855362 | 145 |
| 196 | 3300005339 | Ga0070660_100032137 | Ga0070660_1000321373 | 145 |
| 197 | 3300005339 | Ga0070660_100068844 | Ga0070660_1000688444 | 145 |
| 198 | 3300005339 | Ga0070660_100155061 | Ga0070660_1001550612 | 145 |
| 199 | 3300005339 | Ga0070660_100175854 | Ga0070660_1001758541 | 145 |
| 200 | 3300005344 | Ga0070661_100001787 | Ga0070661_1000017879 | 145 |
| 201 | 3300005344 | Ga0070661_100008568 | Ga0070661_1000085688 | 145 |
| 202 | 3300005344 | Ga0070661_100034430 | Ga0070661_1000344302 | 145 |
| 203 | 3300005356 | Ga0070674_100899984 | Ga0070674_1008999842 | 145 |
| 204 | 3300005366 | Ga0070659_100016639 | Ga0070659_1000166397 | 145 |
| 205 | 3300005366 | Ga0070659_100547383 | Ga0070659_1005473832 | 145 |
| 206 | 3300005366 | Ga0070659_101347466 | Ga0070659_1013474661 | 145 |
| 207 | 3300005435 | Ga0070714_100028449 | Ga0070714_1000284492 | 145 |
| 208 | 3300005436 | Ga0070713_100079950 | Ga0070713_1000799502 | 145 |
| 209 | 3300005455 | Ga0070663_100071942 | Ga0070663_1000719422 | 145 |
| 210 | 3300005455 | Ga0070663_100108379 | Ga0070663_1001083792 | 145 |
| 211 | 3300005457 | Ga0070662_100149183 | Ga0070662_1001491831 | 145 |
| 212 | 3300005457 | Ga0070662_100250395 | Ga0070662_1002503952 | 145 |
| 213 | 3300005457 | Ga0070662_100430257 | Ga0070662_1004302572 | 145 |
| 214 | 3300005457 | Ga0070662_100530355 | Ga0070662_1005303552 | 145 |
| 215 | 3300005457 | Ga0070662_101461638 | Ga0070662_1014616381 | 145 |
| 216 | 3300005458 | Ga0070681_10143556 | Ga0070681_101435562 | 145 |
| 217 | 3300005459 | Ga0068867_100262102 | Ga0068867_1002621022 | 145 |
| 218 | 3300005530 | Ga0070679_100033833 | Ga0070679_1000338336 | 145 |
| 219 | 3300005539 | Ga0068853_100385497 | Ga0068853_1003854973 | 145 |
| 220 | 3300005539 | Ga0068853_100454856 | Ga0068853_1004548561 | 145 |
| 221 | 3300005539 | Ga0068853_101204120 | Ga0068853_1012041202 | 145 |
| 222 | 3300005543 | Ga0070672_100037701 | Ga0070672_1000377015 | 145 |
| 223 | 3300005563 | Ga0068855_100166060 | Ga0068855_1001660604 | 145 |
| 224 | 3300005564 | Ga0070664_100005728 | Ga0070664_1000057287 | 145 |
| 225 | 3300005564 | Ga0070664_100013554 | Ga0070664_1000135544 | 145 |
| 226 | 3300005577 | Ga0068857_100171813 | Ga0068857_1001718134 | 145 |
| 227 | 3300005577 | Ga0068857_100212268 | Ga0068857_1002122682 | 145 |
| 228 | 3300005578 | Ga0068854_100009843 | Ga0068854_1000098436 | 145 |
| 229 | 3300005578 | Ga0068854_100185912 | Ga0068854_1001859122 | 145 |
| 230 | 3300005614 | Ga0068856_101147068 | Ga0068856_1011470682 | 145 |
| 231 | 3300005616 | Ga0068852_100181379 | Ga0068852_1001813793 | 145 |
| 232 | 3300005616 | Ga0068852_100348263 | Ga0068852_1003482632 | 145 |
| 233 | 3300005616 | Ga0068852_100618103 | Ga0068852_1006181032 | 145 |
| 234 | 3300005616 | Ga0068852_100886851 | Ga0068852_1008868512 | 145 |
| 235 | 3300005618 | Ga0068864_100018445 | Ga0068864_1000184455 | 145 |
| 236 | 3300006028 | Ga0070717_10034526 | Ga0070717_100345263 | 145 |
| 237 | 3300006173 | Ga0070716_100025494 | Ga0070716_1000254943 | 145 |
| 238 | 3300009551 | Ga0105238_10181661 | Ga0105238_101816613 | 145 |
| 239 | 3300009551 | Ga0105238_10395057 | Ga0105238_103950571 | 145 |
| 240 | 3300013100 | Ga0157373_10132984 | Ga0157373_101329842 | 145 |
| 241 | 3300013102 | Ga0157371_10096631 | Ga0157371_100966312 | 145 |
| 242 | 3300013102 | Ga0157371_11318291 | Ga0157371_113182911 | 145 |
| 243 | 3300013104 | Ga0157370_10097694 | Ga0157370_100976943 | 145 |
| 244 | 3300013104 | Ga0157370_10553265 | Ga0157370_105532652 | 145 |
| 245 | 3300013105 | Ga0157369_10112222 | Ga0157369_101122223 | 145 |
| 246 | 3300013297 | Ga0157378_10378559 | Ga0157378_103785592 | 145 |
| 247 | 3300013307 | Ga0157372_10320909 | Ga0157372_103209093 | 145 |
| 248 | 3300013307 | Ga0157372_10629150 | Ga0157372_106291503 | 145 |
| 249 | 3300013307 | Ga0157372_11503142 | Ga0157372_115031422 | 145 |
| 250 | 3300025893 | Ga0207682_10024752 | Ga0207682_100247522 | 145 |
| 251 | 3300025901 | Ga0207688_10801516 | Ga0207688_108015162 | 145 |
| 252 | 3300025904 | Ga0207647_10214681 | Ga0207647_102146813 | 145 |
| 253 | 3300025909 | Ga0207705_10005892 | Ga0207705_100058922 | 145 |
| 254 | 3300025917 | Ga0207660_10563670 | Ga0207660_105636702 | 145 |
| 255 | 3300025919 | Ga0207657_10037057 | Ga0207657_100370574 | 145 |
| 256 | 3300025919 | Ga0207657_10046829 | Ga0207657_100468292 | 145 |
| 257 | 3300025919 | Ga0207657_10064016 | Ga0207657_100640164 | 145 |
| 258 | 3300025919 | Ga0207657_10251239 | Ga0207657_102512392 | 145 |
| 259 | 3300025919 | Ga0207657_10985601 | Ga0207657_109856011 | 145 |
| 260 | 3300025920 | Ga0207649_10007819 | Ga0207649_100078195 | 145 |
| 261 | 3300025920 | Ga0207649_10028634 | Ga0207649_100286342 | 145 |
| 262 | 3300025920 | Ga0207649_10742575 | Ga0207649_107425752 | 145 |
| 263 | 3300025921 | Ga0207652_10103873 | Ga0207652_101038732 | 145 |
| 264 | 3300025925 | Ga0207650_10007236 | Ga0207650_100072363 | 145 |
| 265 | 3300025928 | Ga0207700_10239641 | Ga0207700_102396413 | 145 |
| 266 | 3300025929 | Ga0207664_10043401 | Ga0207664_100434016 | 145 |
| 267 | 3300025932 | Ga0207690_10970886 | Ga0207690_109708861 | 145 |
| 268 | 3300025933 | Ga0207706_10120757 | Ga0207706_101207572 | 145 |
| 269 | 3300025933 | Ga0207706_10292083 | Ga0207706_102920832 | 145 |
| 270 | 3300025933 | Ga0207706_10753964 | Ga0207706_107539642 | 145 |
| 271 | 3300025937 | Ga0207669_10014692 | Ga0207669_100146925 | 145 |
| 272 | 3300025939 | Ga0207665_10040756 | Ga0207665_100407562 | 145 |
| 273 | 3300025945 | Ga0207679_10006100 | Ga0207679_100061004 | 145 |
| 274 | 3300025945 | Ga0207679_10007359 | Ga0207679_100073598 | 145 |
| 275 | 3300025945 | Ga0207679_11605049 | Ga0207679_116050491 | 145 |
| 276 | 3300025949 | Ga0207667_10429502 | Ga0207667_104295022 | 145 |
| 277 | 3300025981 | Ga0207640_10003637 | Ga0207640_100036378 | 145 |
| 278 | 3300025981 | Ga0207640_11247253 | Ga0207640_112472531 | 145 |
| 279 | 3300026041 | Ga0207639_10353310 | Ga0207639_103533101 | 145 |
| 280 | 3300026041 | Ga0207639_10964253 | Ga0207639_109642532 | 145 |
| 281 | 3300026067 | Ga0207678_10033261 | Ga0207678_100332614 | 145 |
| 282 | 3300026067 | Ga0207678_10125462 | Ga0207678_101254624 | 145 |
| 283 | 3300026089 | Ga0207648_10010729 | Ga0207648_100107298 | 145 |
| 284 | 3300026095 | Ga0207676_10050546 | Ga0207676_100505464 | 145 |
| 285 | 3300026116 | Ga0207674_10024503 | Ga0207674_100245037 | 145 |
| 286 | 3300026116 | Ga0207674_10890687 | Ga0207674_108906871 | 145 |
| 287 | 3300026121 | Ga0207683_10064773 | Ga0207683_100647734 | 145 |
| 288 | 3300026121 | Ga0207683_10751853 | Ga0207683_107518532 | 145 |
| 289 | 3300026142 | Ga0207698_10204728 | Ga0207698_102047282 | 145 |
| 290 | 3300026142 | Ga0207698_10246853 | Ga0207698_102468532 | 145 |
| 291 | 3300026142 | Ga0207698_10424980 | Ga0207698_104249802 | 145 |
| 292 | 3300031548 | Ga0307408_100056776 | Ga0307408_1000567763 | 145 |
| 293 | 3300031548 | Ga0307408_100706062 | Ga0307408_1007060622 | 145 |
| 294 | 3300031824 | Ga0307413_10069858 | Ga0307413_100698582 | 145 |
| 295 | 3300031852 | Ga0307410_10046796 | Ga0307410_100467963 | 145 |
| 296 | 3300031852 | Ga0307410_10874639 | Ga0307410_108746392 | 145 |
| 297 | 3300031903 | Ga0307407_10082799 | Ga0307407_100827992 | 145 |
| 298 | 3300031995 | Ga0307409_100043042 | Ga0307409_1000430426 | 145 |
| 299 | 3300032002 | Ga0307416_100002017 | Ga0307416_10000201712 | 145 |
| 300 | 3300032002 | Ga0307416_100002746 | Ga0307416_10000274612 | 145 |
| 301 | 3300032004 | Ga0307414_11242895 | Ga0307414_112428952 | 145 |
| 302 | 3300032005 | Ga0307411_10026993 | Ga0307411_100269933 | 145 |
| 303 | 3300032005 | Ga0307411_10421695 | Ga0307411_104216953 | 145 |
| 304 | 3300034818 | Ga0373950_0120368 | Ga0373950_0120368_89_535 | 145 |
| 305 | 3300035170 | Ga0373943_0004797 | Ga0373943_0004797_5532_5990 | 145 |
| 306 | 3300035171 | Ga0373946_0082908 | Ga0373946_0082908_69_527 | 145 |
| 307 | 3300035691 | Ga0373931_1103842 | Ga0373931_1103842_36_494 | 145 |
| 308 | 3300035725 | Ga0373947_0025983 | Ga0373947_0025983_2760_3218 | 145 |
| 309 | 3300037068 | Ga0373925_0068548 | Ga0373925_0068548_1126_1584 | 145 |
| 310 | 3300037418 | Ga0395900_0725241 | Ga0395900_0725241_315_773 | 145 |
| 311 | 3300037471 | Ga0395905_0002249 | Ga0395905_0002249_2508_2954 | 145 |
| 312 | 3300042006 | Ga0439432_037635 | Ga0439432_037635_537_983 | 145 |
| 313 | 3300042007 | Ga0439449_0159720 | Ga0439449_0159720_313_759 | 145 |
| 314 | 3300048905 | Ga0496102_0756720 | Ga0496102_0756720_250_708 | 145 |
| 315 | 3300048906 | Ga0496103_0483535 | Ga0496103_0483535_218_676 | 145 |
| 316 | 3300049656 | Ga0501209_005570 | Ga0501209_005570_1814_2260 | 145 |
| 317 | 3300049658 | Ga0501211_021198 | Ga0501211_021198_50_496 | 145 |
| 318 | 3300049660 | Ga0501216_019369 | Ga0501216_019369_410_856 | 145 |
| 319 | 3300049661 | Ga0501217_084876 | Ga0501217_084876_136_582 | 145 |
| 320 | 3300049668 | Ga0501233_022828 | Ga0501233_022828_80_526 | 145 |
| 321 | 3300049669 | Ga0501235_009855 | Ga0501235_009855_80_526 | 145 |
| 322 | 3300049674 | Ga0501242_005751 | Ga0501242_005751_569_1015 | 145 |
| 323 | 3300049675 | Ga0501243_019493 | Ga0501243_019493_295_741 | 145 |
| 324 | 3300049679 | Ga0501249_008573 | Ga0501249_008573_1192_1638 | 145 |
| 325 | 3300049682 | Ga0501252_023175 | Ga0501252_023175_367_813 | 145 |
| 326 | 3300049704 | Ga0501221_005493 | Ga0501221_005493_82_528 | 145 |
| 327 | 3300049706 | Ga0501229_009596 | Ga0501229_009596_164_610 | 145 |
| 328 | 3300049707 | Ga0501234_003160 | Ga0501234_003160_1721_2167 | 145 |
| 329 | 3300049759 | Ga0501262_080626 | Ga0501262_080626_19_465 | 145 |
| 330 | 3300049763 | Ga0501266_093433 | Ga0501266_093433_35_481 | 145 |
| 331 | 3300049765 | Ga0501268_000552 | Ga0501268_000552_2759_3205 | 145 |
| 332 | 3300049851 | Ga0501212_008763 | Ga0501212_008763_250_696 | 145 |
| 333 | 3300001991 | JGI24743J22301_10009435 | JGI24743J22301_100094353 | 146 |
| 334 | 3300002077 | JGI24744J21845_10000021 | JGI24744J21845_100000216 | 146 |
| 335 | 3300005327 | Ga0070658_10041477 | Ga0070658_100414776 | 146 |
| 336 | 3300005327 | Ga0070658_10072568 | Ga0070658_100725683 | 146 |
| 337 | 3300005327 | Ga0070658_10148511 | Ga0070658_101485112 | 146 |
| 338 | 3300005327 | Ga0070658_10311372 | Ga0070658_103113723 | 146 |
| 339 | 3300005328 | Ga0070676_10085256 | Ga0070676_100852562 | 146 |
| 340 | 3300005328 | Ga0070676_10494197 | Ga0070676_104941972 | 146 |
| 341 | 3300005329 | Ga0070683_100004824 | Ga0070683_1000048249 | 146 |
| 342 | 3300005329 | Ga0070683_100086884 | Ga0070683_1000868843 | 146 |
| 343 | 3300005330 | Ga0070690_100022321 | Ga0070690_1000223216 | 146 |
| 344 | 3300005330 | Ga0070690_100023448 | Ga0070690_1000234484 | 146 |
| 345 | 3300005330 | Ga0070690_100793039 | Ga0070690_1007930392 | 146 |
| 346 | 3300005331 | Ga0070670_100016978 | Ga0070670_1000169787 | 146 |
| 347 | 3300005331 | Ga0070670_100151347 | Ga0070670_1001513472 | 146 |
| 348 | 3300005331 | Ga0070670_100171378 | Ga0070670_1001713782 | 146 |
| 349 | 3300005331 | Ga0070670_100268635 | Ga0070670_1002686352 | 146 |
| 350 | 3300005333 | Ga0070677_10018338 | Ga0070677_100183382 | 146 |
| 351 | 3300005335 | Ga0070666_10004850 | Ga0070666_100048506 | 146 |
| 352 | 3300005335 | Ga0070666_10045968 | Ga0070666_100459683 | 146 |
| 353 | 3300005336 | Ga0070680_100002845 | Ga0070680_10000284511 | 146 |
| 354 | 3300005336 | Ga0070680_100739952 | Ga0070680_1007399522 | 146 |
| 355 | 3300005337 | Ga0070682_100024258 | Ga0070682_1000242583 | 146 |
| 356 | 3300005337 | Ga0070682_100223562 | Ga0070682_1002235622 | 146 |
| 357 | 3300005337 | Ga0070682_100790442 | Ga0070682_1007904421 | 146 |
| 358 | 3300005338 | Ga0068868_100000540 | Ga0068868_10000054025 | 146 |
| 359 | 3300005338 | Ga0068868_100151402 | Ga0068868_1001514023 | 146 |
| 360 | 3300005338 | Ga0068868_100533013 | Ga0068868_1005330132 | 146 |
| 361 | 3300005339 | Ga0070660_100009593 | Ga0070660_1000095933 | 146 |
| 362 | 3300005339 | Ga0070660_100060950 | Ga0070660_1000609501 | 146 |
| 363 | 3300005339 | Ga0070660_100145188 | Ga0070660_1001451881 | 146 |
| 364 | 3300005339 | Ga0070660_100151237 | Ga0070660_1001512372 | 146 |
| 365 | 3300005339 | Ga0070660_100239239 | Ga0070660_1002392392 | 146 |
| 366 | 3300005339 | Ga0070660_100951722 | Ga0070660_1009517221 | 146 |
| 367 | 3300005340 | Ga0070689_100131542 | Ga0070689_1001315423 | 146 |
| 368 | 3300005341 | Ga0070691_10002720 | Ga0070691_100027206 | 146 |
| 369 | 3300005343 | Ga0070687_100465319 | Ga0070687_1004653192 | 146 |
| 370 | 3300005344 | Ga0070661_100026281 | Ga0070661_1000262812 | 146 |
| 371 | 3300005344 | Ga0070661_100084876 | Ga0070661_1000848763 | 146 |
| 372 | 3300005344 | Ga0070661_100096580 | Ga0070661_1000965803 | 146 |
| 373 | 3300005344 | Ga0070661_100107317 | Ga0070661_1001073173 | 146 |
| 374 | 3300005344 | Ga0070661_100371003 | Ga0070661_1003710032 | 146 |
| 375 | 3300005345 | Ga0070692_10279000 | Ga0070692_102790002 | 146 |
| 376 | 3300005353 | Ga0070669_100252359 | Ga0070669_1002523592 | 146 |
| 377 | 3300005354 | Ga0070675_100089053 | Ga0070675_1000890532 | 146 |
| 378 | 3300005354 | Ga0070675_100586772 | Ga0070675_1005867722 | 146 |
| 379 | 3300005355 | Ga0070671_100008614 | Ga0070671_1000086145 | 146 |
| 380 | 3300005355 | Ga0070671_100061193 | Ga0070671_1000611933 | 146 |
| 381 | 3300005355 | Ga0070671_100855138 | Ga0070671_1008551382 | 146 |
| 382 | 3300005356 | Ga0070674_100009512 | Ga0070674_1000095122 | 146 |
| 383 | 3300005356 | Ga0070674_100011429 | Ga0070674_1000114293 | 146 |
| 384 | 3300005356 | Ga0070674_100072363 | Ga0070674_1000723634 | 146 |
| 385 | 3300005356 | Ga0070674_100089221 | Ga0070674_1000892213 | 146 |
| 386 | 3300005364 | Ga0070673_100028107 | Ga0070673_1000281074 | 146 |
| 387 | 3300005364 | Ga0070673_101076417 | Ga0070673_1010764171 | 146 |
| 388 | 3300005366 | Ga0070659_100012198 | Ga0070659_1000121987 | 146 |
| 389 | 3300005366 | Ga0070659_100024356 | Ga0070659_1000243564 | 146 |
| 390 | 3300005366 | Ga0070659_100084675 | Ga0070659_1000846752 | 146 |
| 391 | 3300005366 | Ga0070659_100198738 | Ga0070659_1001987383 | 146 |
| 392 | 3300005367 | Ga0070667_100001880 | Ga0070667_1000018806 | 146 |
| 393 | 3300005367 | Ga0070667_100042051 | Ga0070667_1000420512 | 146 |
| 394 | 3300005434 | Ga0070709_10665003 | Ga0070709_106650031 | 146 |
| 395 | 3300005435 | Ga0070714_100318947 | Ga0070714_1003189472 | 146 |
| 396 | 3300005436 | Ga0070713_100168117 | Ga0070713_1001681172 | 146 |
| 397 | 3300005455 | Ga0070663_100016307 | Ga0070663_1000163074 | 146 |
| 398 | 3300005455 | Ga0070663_100032252 | Ga0070663_1000322522 | 146 |
| 399 | 3300005455 | Ga0070663_100057503 | Ga0070663_1000575033 | 146 |
| 400 | 3300005455 | Ga0070663_100169718 | Ga0070663_1001697182 | 146 |
| 401 | 3300005455 | Ga0070663_100230312 | Ga0070663_1002303122 | 146 |
| 402 | 3300005456 | Ga0070678_100214885 | Ga0070678_1002148852 | 146 |
| 403 | 3300005457 | Ga0070662_100018683 | Ga0070662_1000186836 | 146 |
| 404 | 3300005457 | Ga0070662_100124332 | Ga0070662_1001243323 | 146 |
| 405 | 3300005458 | Ga0070681_10071742 | Ga0070681_100717424 | 146 |
| 406 | 3300005459 | Ga0068867_100323444 | Ga0068867_1003234442 | 146 |
| 407 | 3300005459 | Ga0068867_100740138 | Ga0068867_1007401382 | 146 |
| 408 | 3300005459 | Ga0068867_101016412 | Ga0068867_1010164121 | 146 |
| 409 | 3300005466 | Ga0070685_10157102 | Ga0070685_101571022 | 146 |
| 410 | 3300005466 | Ga0070685_10920050 | Ga0070685_109200502 | 146 |
| 411 | 3300005530 | Ga0070679_100165095 | Ga0070679_1001650951 | 146 |
| 412 | 3300005530 | Ga0070679_100738838 | Ga0070679_1007388382 | 146 |
| 413 | 3300005535 | Ga0070684_100003373 | Ga0070684_1000033737 | 146 |
| 414 | 3300005535 | Ga0070684_100005950 | Ga0070684_1000059504 | 146 |
| 415 | 3300005539 | Ga0068853_100150264 | Ga0068853_1001502641 | 146 |
| 416 | 3300005539 | Ga0068853_100289616 | Ga0068853_1002896163 | 146 |
| 417 | 3300005539 | Ga0068853_100316992 | Ga0068853_1003169922 | 146 |
| 418 | 3300005539 | Ga0068853_100373494 | Ga0068853_1003734943 | 146 |
| 419 | 3300005539 | Ga0068853_100504952 | Ga0068853_1005049522 | 146 |
| 420 | 3300005539 | Ga0068853_101520060 | Ga0068853_1015200601 | 146 |
| 421 | 3300005543 | Ga0070672_100012992 | Ga0070672_1000129926 | 146 |
| 422 | 3300005543 | Ga0070672_100062807 | Ga0070672_1000628073 | 146 |
| 423 | 3300005544 | Ga0070686_100047912 | Ga0070686_1000479123 | 146 |
| 424 | 3300005547 | Ga0070693_100141298 | Ga0070693_1001412982 | 146 |
| 425 | 3300005548 | Ga0070665_100105181 | Ga0070665_1001051814 | 146 |
| 426 | 3300005563 | Ga0068855_100060002 | Ga0068855_1000600024 | 146 |
| 427 | 3300005563 | Ga0068855_100723041 | Ga0068855_1007230412 | 146 |
| 428 | 3300005563 | Ga0068855_100924204 | Ga0068855_1009242042 | 146 |
| 429 | 3300005563 | Ga0068855_101245710 | Ga0068855_1012457102 | 146 |
| 430 | 3300005564 | Ga0070664_100020711 | Ga0070664_1000207116 | 146 |
| 431 | 3300005564 | Ga0070664_100035241 | Ga0070664_1000352416 | 146 |
| 432 | 3300005564 | Ga0070664_100045232 | Ga0070664_1000452322 | 146 |
| 433 | 3300005564 | Ga0070664_100148055 | Ga0070664_1001480553 | 146 |
| 434 | 3300005577 | Ga0068857_100012718 | Ga0068857_1000127187 | 146 |
| 435 | 3300005577 | Ga0068857_100311046 | Ga0068857_1003110463 | 146 |
| 436 | 3300005577 | Ga0068857_100314305 | Ga0068857_1003143052 | 146 |
| 437 | 3300005578 | Ga0068854_100018356 | Ga0068854_1000183565 | 146 |
| 438 | 3300005578 | Ga0068854_100052082 | Ga0068854_1000520821 | 146 |
| 439 | 3300005578 | Ga0068854_100357226 | Ga0068854_1003572262 | 146 |
| 440 | 3300005578 | Ga0068854_100390911 | Ga0068854_1003909112 | 146 |
| 441 | 3300005614 | Ga0068856_100042934 | Ga0068856_1000429344 | 146 |
| 442 | 3300005614 | Ga0068856_100248319 | Ga0068856_1002483192 | 146 |
| 443 | 3300005615 | Ga0070702_100111413 | Ga0070702_1001114133 | 146 |
| 444 | 3300005616 | Ga0068852_100038865 | Ga0068852_1000388652 | 146 |
| 445 | 3300005616 | Ga0068852_100041508 | Ga0068852_1000415083 | 146 |
| 446 | 3300005616 | Ga0068852_100081641 | Ga0068852_1000816414 | 146 |
| 447 | 3300005616 | Ga0068852_100267084 | Ga0068852_1002670842 | 146 |
| 448 | 3300005616 | Ga0068852_100494211 | Ga0068852_1004942112 | 146 |
| 449 | 3300005616 | Ga0068852_100764701 | Ga0068852_1007647013 | 146 |
| 450 | 3300005616 | Ga0068852_101168425 | Ga0068852_1011684252 | 146 |
| 451 | 3300005617 | Ga0068859_100039867 | Ga0068859_1000398676 | 146 |
| 452 | 3300005618 | Ga0068864_100065886 | Ga0068864_1000658861 | 146 |
| 453 | 3300005718 | Ga0068866_10034977 | Ga0068866_100349772 | 146 |
| 454 | 3300005718 | Ga0068866_10052426 | Ga0068866_100524262 | 146 |
| 455 | 3300005719 | Ga0068861_100135833 | Ga0068861_1001358332 | 146 |
| 456 | 3300005719 | Ga0068861_100624015 | Ga0068861_1006240152 | 146 |
| 457 | 3300005834 | Ga0068851_10075198 | Ga0068851_100751983 | 146 |
| 458 | 3300005834 | Ga0068851_10164604 | Ga0068851_101646042 | 146 |
| 459 | 3300005834 | Ga0068851_10391682 | Ga0068851_103916822 | 146 |
| 460 | 3300005840 | Ga0068870_10247491 | Ga0068870_102474912 | 146 |
| 461 | 3300005841 | Ga0068863_100327710 | Ga0068863_1003277102 | 146 |
| 462 | 3300005842 | Ga0068858_100017967 | Ga0068858_1000179678 | 146 |
| 463 | 3300005843 | Ga0068860_100193218 | Ga0068860_1001932183 | 146 |
| 464 | 3300005843 | Ga0068860_102164779 | Ga0068860_1021647791 | 146 |
| 465 | 3300006028 | Ga0070717_10180121 | Ga0070717_101801212 | 146 |
| 466 | 3300006173 | Ga0070716_100238537 | Ga0070716_1002385372 | 146 |
| 467 | 3300006175 | Ga0070712_100028025 | Ga0070712_1000280252 | 146 |
| 468 | 3300006237 | Ga0097621_100312849 | Ga0097621_1003128492 | 146 |
| 469 | 3300006358 | Ga0068871_100264376 | Ga0068871_1002643763 | 146 |
| 470 | 3300006358 | Ga0068871_100674063 | Ga0068871_1006740633 | 146 |
| 471 | 3300006881 | Ga0068865_100028753 | Ga0068865_1000287532 | 146 |
| 472 | 3300006881 | Ga0068865_100390299 | Ga0068865_1003902992 | 146 |
| 473 | 3300006931 | Ga0097620_100039868 | Ga0097620_1000398686 | 146 |
| 474 | 3300009093 | Ga0105240_10019380 | Ga0105240_1001938010 | 146 |
| 475 | 3300009093 | Ga0105240_10329832 | Ga0105240_103298323 | 146 |
| 476 | 3300009098 | Ga0105245_10153409 | Ga0105245_101534093 | 146 |
| 477 | 3300009098 | Ga0105245_10181861 | Ga0105245_101818613 | 146 |
| 478 | 3300009098 | Ga0105245_10338393 | Ga0105245_103383932 | 146 |
| 479 | 3300009098 | Ga0105245_10455925 | Ga0105245_104559252 | 146 |
| 480 | 3300009148 | Ga0105243_10060153 | Ga0105243_100601532 | 146 |
| 481 | 3300009148 | Ga0105243_10123153 | Ga0105243_101231533 | 146 |
| 482 | 3300009174 | Ga0105241_10034765 | Ga0105241_100347653 | 146 |
| 483 | 3300009176 | Ga0105242_10243417 | Ga0105242_102434172 | 146 |
| 484 | 3300009176 | Ga0105242_10679719 | Ga0105242_106797192 | 146 |
| 485 | 3300009177 | Ga0105248_10002275 | Ga0105248_1000227522 | 146 |
| 486 | 3300009177 | Ga0105248_10297792 | Ga0105248_102977923 | 146 |
| 487 | 3300009177 | Ga0105248_10468777 | Ga0105248_104687772 | 146 |
| 488 | 3300009177 | Ga0105248_11937777 | Ga0105248_119377771 | 146 |
| 489 | 3300009545 | Ga0105237_10013446 | Ga0105237_1001344611 | 146 |
| 490 | 3300009551 | Ga0105238_10023266 | Ga0105238_100232667 | 146 |
| 491 | 3300009551 | Ga0105238_10205934 | Ga0105238_102059342 | 146 |
| 492 | 3300010375 | Ga0105239_10338501 | Ga0105239_103385012 | 146 |
| 493 | 3300013100 | Ga0157373_10007319 | Ga0157373_100073192 | 146 |
| 494 | 3300013100 | Ga0157373_10051084 | Ga0157373_100510844 | 146 |
| 495 | 3300013100 | Ga0157373_10066196 | Ga0157373_100661963 | 146 |
| 496 | 3300013100 | Ga0157373_10092370 | Ga0157373_100923702 | 146 |
| 497 | 3300013100 | Ga0157373_10489811 | Ga0157373_104898111 | 146 |
| 498 | 3300013102 | Ga0157371_10029991 | Ga0157371_100299915 | 146 |
| 499 | 3300013102 | Ga0157371_10056851 | Ga0157371_100568514 | 146 |
| 500 | 3300013104 | Ga0157370_10000497 | Ga0157370_1000049734 | 146 |
| 501 | 3300013104 | Ga0157370_10032144 | Ga0157370_100321446 | 146 |
| 502 | 3300013104 | Ga0157370_10161493 | Ga0157370_101614932 | 146 |
| 503 | 3300013104 | Ga0157370_10320549 | Ga0157370_103205492 | 146 |
| 504 | 3300013104 | Ga0157370_11372224 | Ga0157370_113722242 | 146 |
| 505 | 3300013105 | Ga0157369_10152251 | Ga0157369_101522514 | 146 |
| 506 | 3300013105 | Ga0157369_10330557 | Ga0157369_103305572 | 146 |
| 507 | 3300013105 | Ga0157369_10439559 | Ga0157369_104395592 | 146 |
| 508 | 3300013297 | Ga0157378_10063734 | Ga0157378_100637344 | 146 |
| 509 | 3300013297 | Ga0157378_11794056 | Ga0157378_117940561 | 146 |
| 510 | 3300013297 | Ga0157378_12374034 | Ga0157378_123740341 | 146 |
| 511 | 3300013306 | Ga0163162_11968195 | Ga0163162_119681951 | 146 |
| 512 | 3300013307 | Ga0157372_10052507 | Ga0157372_100525076 | 146 |
| 513 | 3300013307 | Ga0157372_10454270 | Ga0157372_104542702 | 146 |
| 514 | 3300013308 | Ga0157375_10054020 | Ga0157375_100540203 | 146 |
| 515 | 3300013308 | Ga0157375_10272296 | Ga0157375_102722963 | 146 |
| 516 | 3300013308 | Ga0157375_10585388 | Ga0157375_105853883 | 146 |
| 517 | 3300014325 | Ga0163163_10382065 | Ga0163163_103820652 | 146 |
| 518 | 3300014326 | Ga0157380_10492898 | Ga0157380_104928983 | 146 |
| 519 | 3300014326 | Ga0157380_11328287 | Ga0157380_113282872 | 146 |
| 520 | 3300014968 | Ga0157379_10033250 | Ga0157379_100332506 | 146 |
| 521 | 3300014968 | Ga0157379_10226747 | Ga0157379_102267472 | 146 |
| 522 | 3300014969 | Ga0157376_10274911 | Ga0157376_102749113 | 146 |
| 523 | 3300020070 | Ga0206356_11732949 | Ga0206356_117329492 | 146 |
| 524 | 3300021384 | Ga0213876_10073437 | Ga0213876_100734373 | 146 |
| 525 | 3300025315 | Ga0207697_10213914 | Ga0207697_102139142 | 146 |
| 526 | 3300025321 | Ga0207656_10044703 | Ga0207656_100447033 | 146 |
| 527 | 3300025321 | Ga0207656_10086815 | Ga0207656_100868152 | 146 |
| 528 | 3300025321 | Ga0207656_10155705 | Ga0207656_101557052 | 146 |
| 529 | 3300025893 | Ga0207682_10015022 | Ga0207682_100150223 | 146 |
| 530 | 3300025899 | Ga0207642_10909223 | Ga0207642_109092232 | 146 |
| 531 | 3300025901 | Ga0207688_10204756 | Ga0207688_102047562 | 146 |
| 532 | 3300025904 | Ga0207647_10009032 | Ga0207647_100090323 | 146 |
| 533 | 3300025904 | Ga0207647_10308294 | Ga0207647_103082942 | 146 |
| 534 | 3300025906 | Ga0207699_10084550 | Ga0207699_100845503 | 146 |
| 535 | 3300025907 | Ga0207645_10080255 | Ga0207645_100802553 | 146 |
| 536 | 3300025907 | Ga0207645_10116468 | Ga0207645_101164682 | 146 |
| 537 | 3300025908 | Ga0207643_10119506 | Ga0207643_101195063 | 146 |
| 538 | 3300025909 | Ga0207705_10003112 | Ga0207705_100031127 | 146 |
| 539 | 3300025909 | Ga0207705_10023003 | Ga0207705_100230033 | 146 |
| 540 | 3300025909 | Ga0207705_10145749 | Ga0207705_101457492 | 146 |
| 541 | 3300025909 | Ga0207705_10334958 | Ga0207705_103349581 | 146 |
| 542 | 3300025909 | Ga0207705_10468713 | Ga0207705_104687132 | 146 |
| 543 | 3300025912 | Ga0207707_10267597 | Ga0207707_102675973 | 146 |
| 544 | 3300025913 | Ga0207695_10019756 | Ga0207695_100197565 | 146 |
| 545 | 3300025914 | Ga0207671_10040892 | Ga0207671_100408924 | 146 |
| 546 | 3300025915 | Ga0207693_10006527 | Ga0207693_1000652713 | 146 |
| 547 | 3300025916 | Ga0207663_11646690 | Ga0207663_116466901 | 146 |
| 548 | 3300025917 | Ga0207660_10004906 | Ga0207660_100049067 | 146 |
| 549 | 3300025917 | Ga0207660_10287443 | Ga0207660_102874433 | 146 |
| 550 | 3300025918 | Ga0207662_10137730 | Ga0207662_101377304 | 146 |
| 551 | 3300025918 | Ga0207662_10207514 | Ga0207662_102075141 | 146 |
| 552 | 3300025919 | Ga0207657_10015919 | Ga0207657_100159193 | 146 |
| 553 | 3300025919 | Ga0207657_10021597 | Ga0207657_100215977 | 146 |
| 554 | 3300025919 | Ga0207657_10036095 | Ga0207657_100360953 | 146 |
| 555 | 3300025919 | Ga0207657_10043151 | Ga0207657_100431512 | 146 |
| 556 | 3300025919 | Ga0207657_10142002 | Ga0207657_101420023 | 146 |
| 557 | 3300025919 | Ga0207657_10156314 | Ga0207657_101563143 | 146 |
| 558 | 3300025920 | Ga0207649_10012717 | Ga0207649_100127176 | 146 |
| 559 | 3300025920 | Ga0207649_10136418 | Ga0207649_101364182 | 146 |
| 560 | 3300025920 | Ga0207649_10192176 | Ga0207649_101921762 | 146 |
| 561 | 3300025920 | Ga0207649_10205728 | Ga0207649_102057282 | 146 |
| 562 | 3300025920 | Ga0207649_10759833 | Ga0207649_107598331 | 146 |
| 563 | 3300025920 | Ga0207649_11067846 | Ga0207649_110678462 | 146 |
| 564 | 3300025921 | Ga0207652_10227372 | Ga0207652_102273722 | 146 |
| 565 | 3300025921 | Ga0207652_10324329 | Ga0207652_103243292 | 146 |
| 566 | 3300025921 | Ga0207652_10598662 | Ga0207652_105986622 | 146 |
| 567 | 3300025924 | Ga0207694_10651681 | Ga0207694_106516811 | 146 |
| 568 | 3300025925 | Ga0207650_10163307 | Ga0207650_101633072 | 146 |
| 569 | 3300025925 | Ga0207650_10452711 | Ga0207650_104527112 | 146 |
| 570 | 3300025925 | Ga0207650_10721750 | Ga0207650_107217502 | 146 |
| 571 | 3300025925 | Ga0207650_10889204 | Ga0207650_108892042 | 146 |
| 572 | 3300025926 | Ga0207659_10122238 | Ga0207659_101222383 | 146 |
| 573 | 3300025927 | Ga0207687_10103334 | Ga0207687_101033342 | 146 |
| 574 | 3300025927 | Ga0207687_10126363 | Ga0207687_101263633 | 146 |
| 575 | 3300025927 | Ga0207687_10224950 | Ga0207687_102249503 | 146 |
| 576 | 3300025929 | Ga0207664_10122032 | Ga0207664_101220323 | 146 |
| 577 | 3300025929 | Ga0207664_10334196 | Ga0207664_103341962 | 146 |
| 578 | 3300025931 | Ga0207644_10017928 | Ga0207644_100179286 | 146 |
| 579 | 3300025931 | Ga0207644_10038435 | Ga0207644_100384354 | 146 |
| 580 | 3300025931 | Ga0207644_10447389 | Ga0207644_104473892 | 146 |
| 581 | 3300025932 | Ga0207690_10011654 | Ga0207690_100116543 | 146 |
| 582 | 3300025932 | Ga0207690_10020356 | Ga0207690_100203564 | 146 |
| 583 | 3300025932 | Ga0207690_10152901 | Ga0207690_101529012 | 146 |
| 584 | 3300025932 | Ga0207690_10292578 | Ga0207690_102925782 | 146 |
| 585 | 3300025932 | Ga0207690_10406564 | Ga0207690_104065642 | 146 |
| 586 | 3300025933 | Ga0207706_10004173 | Ga0207706_1000417311 | 146 |
| 587 | 3300025933 | Ga0207706_10035503 | Ga0207706_100355036 | 146 |
| 588 | 3300025933 | Ga0207706_10047951 | Ga0207706_100479513 | 146 |
| 589 | 3300025933 | Ga0207706_10610403 | Ga0207706_106104032 | 146 |
| 590 | 3300025935 | Ga0207709_10204147 | Ga0207709_102041472 | 146 |
| 591 | 3300025936 | Ga0207670_10106352 | Ga0207670_101063523 | 146 |
| 592 | 3300025937 | Ga0207669_10006240 | Ga0207669_100062402 | 146 |
| 593 | 3300025937 | Ga0207669_10164671 | Ga0207669_101646713 | 146 |
| 594 | 3300025938 | Ga0207704_10143493 | Ga0207704_101434933 | 146 |
| 595 | 3300025938 | Ga0207704_10967718 | Ga0207704_109677182 | 146 |
| 596 | 3300025939 | Ga0207665_10021532 | Ga0207665_100215322 | 146 |
| 597 | 3300025940 | Ga0207691_10007401 | Ga0207691_100074019 | 146 |
| 598 | 3300025940 | Ga0207691_10075315 | Ga0207691_100753154 | 146 |
| 599 | 3300025940 | Ga0207691_10110488 | Ga0207691_101104883 | 146 |
| 600 | 3300025941 | Ga0207711_10000309 | Ga0207711_1000030928 | 146 |
| 601 | 3300025941 | Ga0207711_10226322 | Ga0207711_102263223 | 146 |
| 602 | 3300025941 | Ga0207711_10519447 | Ga0207711_105194472 | 146 |
| 603 | 3300025944 | Ga0207661_10015802 | Ga0207661_100158022 | 146 |
| 604 | 3300025944 | Ga0207661_10099438 | Ga0207661_100994383 | 146 |
| 605 | 3300025944 | Ga0207661_10379087 | Ga0207661_103790872 | 146 |
| 606 | 3300025945 | Ga0207679_10060515 | Ga0207679_100605152 | 146 |
| 607 | 3300025945 | Ga0207679_10062443 | Ga0207679_100624432 | 146 |
| 608 | 3300025945 | Ga0207679_10097866 | Ga0207679_100978663 | 146 |
| 609 | 3300025945 | Ga0207679_11784370 | Ga0207679_117843701 | 146 |
| 610 | 3300025949 | Ga0207667_10080700 | Ga0207667_100807004 | 146 |
| 611 | 3300025949 | Ga0207667_10761332 | Ga0207667_107613322 | 146 |
| 612 | 3300025949 | Ga0207667_10911560 | Ga0207667_109115602 | 146 |
| 613 | 3300025949 | Ga0207667_11347496 | Ga0207667_113474961 | 146 |
| 614 | 3300025960 | Ga0207651_10024726 | Ga0207651_100247263 | 146 |
| 615 | 3300025960 | Ga0207651_10058746 | Ga0207651_100587464 | 146 |
| 616 | 3300025960 | Ga0207651_10063600 | Ga0207651_100636002 | 146 |
| 617 | 3300025960 | Ga0207651_11771814 | Ga0207651_117718141 | 146 |
| 618 | 3300025981 | Ga0207640_10045020 | Ga0207640_100450204 | 146 |
| 619 | 3300025981 | Ga0207640_10085859 | Ga0207640_100858593 | 146 |
| 620 | 3300025981 | Ga0207640_11036455 | Ga0207640_110364552 | 146 |
| 621 | 3300025986 | Ga0207658_10005278 | Ga0207658_100052788 | 146 |
| 622 | 3300025986 | Ga0207658_10246860 | Ga0207658_102468602 | 146 |
| 623 | 3300026023 | Ga0207677_10004742 | Ga0207677_100047426 | 146 |
| 624 | 3300026023 | Ga0207677_10005621 | Ga0207677_100056219 | 146 |
| 625 | 3300026023 | Ga0207677_10114783 | Ga0207677_101147831 | 146 |
| 626 | 3300026023 | Ga0207677_10396494 | Ga0207677_103964941 | 146 |
| 627 | 3300026035 | Ga0207703_10001905 | Ga0207703_1000190520 | 146 |
| 628 | 3300026041 | Ga0207639_10017111 | Ga0207639_100171114 | 146 |
| 629 | 3300026041 | Ga0207639_10546463 | Ga0207639_105464632 | 146 |
| 630 | 3300026067 | Ga0207678_10043209 | Ga0207678_100432092 | 146 |
| 631 | 3300026067 | Ga0207678_10057296 | Ga0207678_100572963 | 146 |
| 632 | 3300026067 | Ga0207678_10107410 | Ga0207678_101074102 | 146 |
| 633 | 3300026078 | Ga0207702_10018250 | Ga0207702_100182504 | 146 |
| 634 | 3300026078 | Ga0207702_10022150 | Ga0207702_100221506 | 146 |
| 635 | 3300026078 | Ga0207702_10080338 | Ga0207702_100803383 | 146 |
| 636 | 3300026078 | Ga0207702_10097461 | Ga0207702_100974612 | 146 |
| 637 | 3300026088 | Ga0207641_10035960 | Ga0207641_100359603 | 146 |
| 638 | 3300026089 | Ga0207648_10008589 | Ga0207648_100085896 | 146 |
| 639 | 3300026089 | Ga0207648_10017417 | Ga0207648_100174173 | 146 |
| 640 | 3300026089 | Ga0207648_10196909 | Ga0207648_101969092 | 146 |
| 641 | 3300026095 | Ga0207676_10168808 | Ga0207676_101688082 | 146 |
| 642 | 3300026095 | Ga0207676_10388761 | Ga0207676_103887612 | 146 |
| 643 | 3300026116 | Ga0207674_10009133 | Ga0207674_100091337 | 146 |
| 644 | 3300026116 | Ga0207674_10025828 | Ga0207674_100258283 | 146 |
| 645 | 3300026116 | Ga0207674_10104762 | Ga0207674_101047623 | 146 |
| 646 | 3300026118 | Ga0207675_100406877 | Ga0207675_1004068772 | 146 |
| 647 | 3300026121 | Ga0207683_10025482 | Ga0207683_100254823 | 146 |
| 648 | 3300026142 | Ga0207698_10022715 | Ga0207698_100227154 | 146 |
| 649 | 3300026142 | Ga0207698_10082423 | Ga0207698_100824232 | 146 |
| 650 | 3300026142 | Ga0207698_10224844 | Ga0207698_102248442 | 146 |
| 651 | 3300026142 | Ga0207698_10365760 | Ga0207698_103657602 | 146 |
| 652 | 3300026142 | Ga0207698_10990117 | Ga0207698_109901171 | 146 |
| 653 | 3300028381 | Ga0268264_10163145 | Ga0268264_101631451 | 146 |
| 654 | 3300035084 | Ga0373928_0120946 | Ga0373928_0120946_203_649 | 146 |
| 655 | 3300035089 | Ga0373944_0086944 | Ga0373944_0086944_375_824 | 146 |
| 656 | 3300035090 | Ga0373949_0063813 | Ga0373949_0063813_73_519 | 146 |
| 657 | 3300035111 | Ga0373923_0258160 | Ga0373923_0258160_252_701 | 146 |
| 658 | 3300035170 | Ga0373943_0209055 | Ga0373943_0209055_69_518 | 146 |
| 659 | 3300035172 | Ga0373955_0385931 | Ga0373955_0385931_343_792 | 146 |
| 660 | 3300035691 | Ga0373931_0099681 | Ga0373931_0099681_538_984 | 146 |
| 661 | 3300037068 | Ga0373925_0222599 | Ga0373925_0222599_609_1058 | 146 |
| 662 | 3300037312 | Ga0395899_0020860 | Ga0395899_0020860_120_575 | 146 |
| 663 | 3300037312 | Ga0395899_0038215 | Ga0395899_0038215_592_1035 | 146 |
| 664 | 3300037312 | Ga0395899_0211484 | Ga0395899_0211484_758_1213 | 146 |
| 665 | 3300037312 | Ga0395899_0287474 | Ga0395899_0287474_201_656 | 146 |
| 666 | 3300037312 | Ga0395899_0420078 | Ga0395899_0420078_313_765 | 146 |
| 667 | 3300037418 | Ga0395900_0012634 | Ga0395900_0012634_466_909 | 146 |
| 668 | 3300037418 | Ga0395900_0081843 | Ga0395900_0081843_137_592 | 146 |
| 669 | 3300037418 | Ga0395900_0118874 | Ga0395900_0118874_1419_1874 | 146 |
| 670 | 3300037418 | Ga0395900_0137487 | Ga0395900_0137487_1338_1790 | 146 |
| 671 | 3300037418 | Ga0395900_0323222 | Ga0395900_0323222_385_828 | 146 |
| 672 | 3300037418 | Ga0395900_0323229 | Ga0395900_0323229_385_828 | 146 |
| 673 | 3300037418 | Ga0395900_0381843 | Ga0395900_0381843_164_619 | 146 |
| 674 | 3300037418 | Ga0395900_0905058 | Ga0395900_0905058_137_592 | 146 |
| 675 | 3300037466 | Ga0395898_0018525 | Ga0395898_0018525_4471_4914 | 146 |
| 676 | 3300037466 | Ga0395898_0128079 | Ga0395898_0128079_306_749 | 146 |
| 677 | 3300037466 | Ga0395898_0303648 | Ga0395898_0303648_385_828 | 146 |
| 678 | 3300037466 | Ga0395898_0303649 | Ga0395898_0303649_385_828 | 146 |
| 679 | 3300037466 | Ga0395898_0808648 | Ga0395898_0808648_136_591 | 146 |
| 680 | 3300037466 | Ga0395898_1233077 | Ga0395898_1233077_188_643 | 146 |
| 681 | 3300037466 | Ga0395898_1822060 | Ga0395898_1822060_13_468 | 146 |
| 682 | 3300037471 | Ga0395905_0036630 | Ga0395905_0036630_3886_4329 | 146 |
| 683 | 3300037471 | Ga0395905_0055546 | Ga0395905_0055546_1527_1970 | 146 |
| 684 | 3300037471 | Ga0395905_0067879 | Ga0395905_0067879_1466_1918 | 146 |
| 685 | 3300037471 | Ga0395905_0091715 | Ga0395905_0091715_1420_1875 | 146 |
| 686 | 3300037471 | Ga0395905_0278202 | Ga0395905_0278202_948_1403 | 146 |
| 687 | 3300037471 | Ga0395905_0781879 | Ga0395905_0781879_156_611 | 146 |
| 688 | 3300037471 | Ga0395905_0838057 | Ga0395905_0838057_102_557 | 146 |
| 689 | 3300037471 | Ga0395905_0876684 | Ga0395905_0876684_137_592 | 146 |
| 690 | 3300037471 | Ga0395905_1220789 | Ga0395905_1220789_153_608 | 146 |
| 691 | 3300038443 | Ga0395901_0022105 | Ga0395901_0022105_1592_2035 | 146 |
| 692 | 3300038443 | Ga0395901_0068543 | Ga0395901_0068543_114_569 | 146 |
| 693 | 3300038443 | Ga0395901_0076098 | Ga0395901_0076098_1459_1899 | 146 |
| 694 | 3300038443 | Ga0395901_0350897 | Ga0395901_0350897_385_828 | 146 |
| 695 | 3300038443 | Ga0395901_0420516 | Ga0395901_0420516_205_660 | 146 |
| 696 | 3300038443 | Ga0395901_0511986 | Ga0395901_0511986_393_836 | 146 |
| 697 | 3300038443 | Ga0395901_0578870 | Ga0395901_0578870_479_934 | 146 |
| 698 | 3300038443 | Ga0395901_0886204 | Ga0395901_0886204_229_681 | 146 |
| 699 | 3300038443 | Ga0395901_1313847 | Ga0395901_1313847_162_617 | 146 |
| 700 | 3300039437 | Ga0436365_0334369 | Ga0436365_0334369_3434_3889 | 146 |
| 701 | 3300044658 | Ga0466972_0038303 | Ga0466972_0038303_1353_1820 | 146 |
| 702 | 3300044658 | Ga0466972_0174509 | Ga0466972_0174509_38_484 | 146 |
| 703 | 3300044684 | Ga0466966_0097376 | Ga0466966_0097376_230_697 | 146 |
| 704 | 3300044684 | Ga0466966_0105924 | Ga0466966_0105924_976_1455 | 146 |
| 705 | 3300044684 | Ga0466966_0447923 | Ga0466966_0447923_315_764 | 146 |
| 706 | 3300044684 | Ga0466966_0583167 | Ga0466966_0583167_181_648 | 146 |
| 707 | 3300044684 | Ga0466966_0695116 | Ga0466966_0695116_94_561 | 146 |
| 708 | 3300044693 | Ga0466961_0078955 | Ga0466961_0078955_1266_1733 | 146 |
| 709 | 3300044694 | Ga0466963_0048814 | Ga0466963_0048814_816_1292 | 146 |
| 710 | 3300044694 | Ga0466963_0212030 | Ga0466963_0212030_176_619 | 146 |
| 711 | 3300044694 | Ga0466963_0333472 | Ga0466963_0333472_552_1019 | 146 |
| 712 | 3300044706 | Ga0466964_0010281 | Ga0466964_0010281_835_1302 | 146 |
| 713 | 3300044719 | Ga0466971_0018338 | Ga0466971_0018338_868_1311 | 146 |
| 714 | 3300044765 | Ga0466970_0077358 | Ga0466970_0077358_853_1320 | 146 |
| 715 | 3300044765 | Ga0466970_0530737 | Ga0466970_0530737_138_605 | 146 |
| 716 | 3300044842 | Ga0466957_0065599 | Ga0466957_0065599_784_1227 | 146 |
| 717 | 3300044842 | Ga0466957_0649881 | Ga0466957_0649881_102_563 | 146 |
| 718 | 3300044901 | Ga0466960_0026401 | Ga0466960_0026401_1138_1584 | 146 |
| 719 | 3300045049 | Ga0466959_0106087 | Ga0466959_0106087_1050_1517 | 146 |
| 720 | 3300045049 | Ga0466959_0360371 | Ga0466959_0360371_368_835 | 146 |
| 721 | 3300045049 | Ga0466959_0369563 | Ga0466959_0369563_313_756 | 146 |
| 722 | 3300045836 | Ga0466958_0003925 | Ga0466958_0003925_7175_7618 | 146 |
| 723 | 3300045836 | Ga0466958_0015665 | Ga0466958_0015665_3067_3534 | 146 |
| 724 | 3300045836 | Ga0466958_0165117 | Ga0466958_0165117_644_1120 | 146 |
| 725 | 3300045976 | Ga0466967_0422698 | Ga0466967_0422698_105_548 | 146 |
| 726 | 3300046525 | Ga0495663_0192840 | Ga0495663_0192840_197_649 | 146 |
| 727 | 3300046537 | Ga0495598_0000260 | Ga0495598_0000260_3359_3808 | 146 |
| 728 | 3300046539 | Ga0495621_0000141 | Ga0495621_0000141_5690_6139 | 146 |
| 729 | 3300046684 | Ga0495669_0273968 | Ga0495669_0273968_162_614 | 146 |
| 730 | 3300046691 | Ga0495670_0001090 | Ga0495670_0001090_8266_8715 | 146 |
| 731 | 3300046809 | Ga0495600_0601471 | Ga0495600_0601471_152_601 | 146 |
| 732 | 3300048903 | Ga0496100_0011309 | Ga0496100_0011309_1468_1914 | 146 |
| 733 | 3300048904 | Ga0496101_0001753 | Ga0496101_0001753_176_622 | 146 |
| 734 | 3300048905 | Ga0496102_0048281 | Ga0496102_0048281_693_1139 | 146 |
| 735 | 3300048906 | Ga0496103_0016593 | Ga0496103_0016593_3898_4344 | 146 |
| 736 | 3300048908 | Ga0496105_0094720 | Ga0496105_0094720_638_1084 | 146 |
| 737 | 3300048909 | Ga0496106_0035893 | Ga0496106_0035893_2138_2584 | 146 |
| 738 | 3300048909 | Ga0496106_0481769 | Ga0496106_0481769_498_953 | 146 |
| 739 | 3300048909 | Ga0496106_0900057 | Ga0496106_0900057_67_513 | 146 |
| 740 | 3300048910 | Ga0496107_0016637 | Ga0496107_0016637_2731_3177 | 146 |
| 741 | 3300048911 | Ga0496108_0002538 | Ga0496108_0002538_8046_8492 | 146 |
| 742 | 3300048911 | Ga0496108_0580004 | Ga0496108_0580004_270_716 | 146 |
| 743 | 3300048913 | Ga0496110_0013487 | Ga0496110_0013487_4815_5261 | 146 |
| 744 | 3300048914 | Ga0496111_0118118 | Ga0496111_0118118_1076_1522 | 146 |
| 745 | 3300048915 | Ga0496112_0015503 | Ga0496112_0015503_4806_5252 | 146 |
| 746 | 3300048915 | Ga0496112_0143170 | Ga0496112_0143170_622_1068 | 146 |
| 747 | 3300048916 | Ga0496113_0009435 | Ga0496113_0009435_4608_5054 | 146 |
| 748 | 3300049583 | Ga0501067_0007369 | Ga0501067_0007369_1966_2418 | 146 |
| 749 | 3300049584 | Ga0501068_0480315 | Ga0501068_0480315_238_690 | 146 |
| 750 | 3300049585 | Ga0501069_0124363 | Ga0501069_0124363_888_1340 | 146 |
| 751 | 3300053084 | Ga0495595_0136359 | Ga0495595_0136359_721_1170 | 146 |
| 752 | 3300002067 | JGI24735J21928_10124451 | JGI24735J21928_101244512 | 147 |
| 753 | 3300005329 | Ga0070683_100050548 | Ga0070683_1000505483 | 147 |
| 754 | 3300005331 | Ga0070670_100909132 | Ga0070670_1009091322 | 147 |
| 755 | 3300005336 | Ga0070680_100093199 | Ga0070680_1000931992 | 147 |
| 756 | 3300005339 | Ga0070660_100001061 | Ga0070660_10000106119 | 147 |
| 757 | 3300005339 | Ga0070660_101245627 | Ga0070660_1012456271 | 147 |
| 758 | 3300005355 | Ga0070671_100160288 | Ga0070671_1001602883 | 147 |
| 759 | 3300005356 | Ga0070674_100754886 | Ga0070674_1007548862 | 147 |
| 760 | 3300005367 | Ga0070667_100106767 | Ga0070667_1001067673 | 147 |
| 761 | 3300005455 | Ga0070663_100126921 | Ga0070663_1001269212 | 147 |
| 762 | 3300005456 | Ga0070678_100023912 | Ga0070678_1000239122 | 147 |
| 763 | 3300005457 | Ga0070662_100139100 | Ga0070662_1001391003 | 147 |
| 764 | 3300005458 | Ga0070681_10028705 | Ga0070681_100287056 | 147 |
| 765 | 3300005530 | Ga0070679_100026734 | Ga0070679_1000267347 | 147 |
| 766 | 3300005535 | Ga0070684_100406222 | Ga0070684_1004062222 | 147 |
| 767 | 3300005543 | Ga0070672_100047548 | Ga0070672_1000475482 | 147 |
| 768 | 3300005563 | Ga0068855_100014603 | Ga0068855_10001460312 | 147 |
| 769 | 3300005577 | Ga0068857_101783223 | Ga0068857_1017832231 | 147 |
| 770 | 3300005578 | Ga0068854_100228820 | Ga0068854_1002288203 | 147 |
| 771 | 3300005614 | Ga0068856_100424438 | Ga0068856_1004244382 | 147 |
| 772 | 3300005616 | Ga0068852_101154267 | Ga0068852_1011542671 | 147 |
| 773 | 3300005718 | Ga0068866_10095958 | Ga0068866_100959582 | 147 |
| 774 | 3300005834 | Ga0068851_10453959 | Ga0068851_104539592 | 147 |
| 775 | 3300006881 | Ga0068865_100124950 | Ga0068865_1001249503 | 147 |
| 776 | 3300009177 | Ga0105248_10248477 | Ga0105248_102484773 | 147 |
| 777 | 3300013100 | Ga0157373_10474639 | Ga0157373_104746392 | 147 |
| 778 | 3300013104 | Ga0157370_10051504 | Ga0157370_100515043 | 147 |
| 779 | 3300013105 | Ga0157369_11953484 | Ga0157369_119534841 | 147 |
| 780 | 3300017792 | Ga0163161_10030131 | Ga0163161_100301312 | 147 |
| 781 | 3300020082 | Ga0206353_11527701 | Ga0206353_115277012 | 147 |
| 782 | 3300025321 | Ga0207656_10404974 | Ga0207656_104049741 | 147 |
| 783 | 3300025899 | Ga0207642_10025501 | Ga0207642_100255012 | 147 |
| 784 | 3300025904 | Ga0207647_10055492 | Ga0207647_100554922 | 147 |
| 785 | 3300025909 | Ga0207705_10000123 | Ga0207705_1000012332 | 147 |
| 786 | 3300025917 | Ga0207660_10626903 | Ga0207660_106269032 | 147 |
| 787 | 3300025919 | Ga0207657_10000650 | Ga0207657_1000065024 | 147 |
| 788 | 3300025919 | Ga0207657_11377829 | Ga0207657_113778291 | 147 |
| 789 | 3300025921 | Ga0207652_10000034 | Ga0207652_1000003482 | 147 |
| 790 | 3300025931 | Ga0207644_10544825 | Ga0207644_105448252 | 147 |
| 791 | 3300025933 | Ga0207706_10003262 | Ga0207706_1000326211 | 147 |
| 792 | 3300025937 | Ga0207669_10321025 | Ga0207669_103210252 | 147 |
| 793 | 3300025940 | Ga0207691_10114746 | Ga0207691_101147463 | 147 |
| 794 | 3300025941 | Ga0207711_10485016 | Ga0207711_104850162 | 147 |
| 795 | 3300025949 | Ga0207667_10036894 | Ga0207667_100368947 | 147 |
| 796 | 3300025981 | Ga0207640_10517459 | Ga0207640_105174592 | 147 |
| 797 | 3300026067 | Ga0207678_10000530 | Ga0207678_100005303 | 147 |
| 798 | 3300026078 | Ga0207702_10022741 | Ga0207702_100227416 | 147 |
| 799 | 3300026121 | Ga0207683_10012568 | Ga0207683_100125683 | 147 |
| 800 | 3300026142 | Ga0207698_10478920 | Ga0207698_104789202 | 147 |
| 801 | 3300026142 | Ga0207698_11834691 | Ga0207698_118346911 | 147 |
| 802 | 3300031731 | Ga0307405_10510980 | Ga0307405_105109802 | 147 |
| 803 | 3300032126 | Ga0307415_100004978 | Ga0307415_1000049785 | 147 |
| 804 | 3300037312 | Ga0395899_0000255 | Ga0395899_0000255_26231_26683 | 147 |
| 805 | 3300037312 | Ga0395899_0056093 | Ga0395899_0056093_820_1272 | 147 |
| 806 | 3300037312 | Ga0395899_0081969 | Ga0395899_0081969_1314_1766 | 147 |
| 807 | 3300037418 | Ga0395900_0000308 | Ga0395900_0000308_56685_57137 | 147 |
| 808 | 3300037418 | Ga0395900_0019379 | Ga0395900_0019379_477_929 | 147 |
| 809 | 3300037418 | Ga0395900_0153361 | Ga0395900_0153361_365_817 | 147 |
| 810 | 3300037418 | Ga0395900_0686171 | Ga0395900_0686171_123_575 | 147 |
| 811 | 3300037466 | Ga0395898_0000054 | Ga0395898_0000054_11771_12223 | 147 |
| 812 | 3300037466 | Ga0395898_0008175 | Ga0395898_0008175_1582_2034 | 147 |
| 813 | 3300037471 | Ga0395905_0000005 | Ga0395905_0000005_530458_530910 | 147 |
| 814 | 3300037471 | Ga0395905_0010554 | Ga0395905_0010554_6114_6566 | 147 |
| 815 | 3300037471 | Ga0395905_0058111 | Ga0395905_0058111_2286_2738 | 147 |
| 816 | 3300037471 | Ga0395905_0276305 | Ga0395905_0276305_123_575 | 147 |
| 817 | 3300038443 | Ga0395901_0002475 | Ga0395901_0002475_6118_6570 | 147 |
| 818 | 3300038443 | Ga0395901_0008267 | Ga0395901_0008267_180_632 | 147 |
| 819 | 3300046539 | Ga0495621_0258039 | Ga0495621_0258039_169_621 | 147 |
| 820 | 3300048915 | Ga0496112_0083338 | Ga0496112_0083338_1637_2089 | 147 |
| 821 | 3300048916 | Ga0496113_0017930 | Ga0496113_0017930_4071_4523 | 147 |
| 822 | 3300001990 | JGI24737J22298_10012071 | JGI24737J22298_100120712 | 150 |
| 823 | 3300002459 | JGI24751J29686_10029682 | JGI24751J29686_100296822 | 150 |
| 824 | 3300005339 | Ga0070660_100096401 | Ga0070660_1000964013 | 150 |
| 825 | 3300005353 | Ga0070669_100178122 | Ga0070669_1001781222 | 150 |
| 826 | 3300005366 | Ga0070659_100002156 | Ga0070659_1000021564 | 150 |
| 827 | 3300005366 | Ga0070659_100066061 | Ga0070659_1000660613 | 150 |
| 828 | 3300005539 | Ga0068853_100103745 | Ga0068853_1001037452 | 150 |
| 829 | 3300005563 | Ga0068855_101467440 | Ga0068855_1014674402 | 150 |
| 830 | 3300005577 | Ga0068857_100031092 | Ga0068857_1000310926 | 150 |
| 831 | 3300005618 | Ga0068864_100267979 | Ga0068864_1002679792 | 150 |
| 832 | 3300005841 | Ga0068863_100156718 | Ga0068863_1001567182 | 150 |
| 833 | 3300005844 | Ga0068862_100256225 | Ga0068862_1002562252 | 150 |
| 834 | 3300006195 | Ga0075366_10142042 | Ga0075366_101420423 | 150 |
| 835 | 3300009176 | Ga0105242_11408460 | Ga0105242_114084602 | 150 |
| 836 | 3300013307 | Ga0157372_10237916 | Ga0157372_102379162 | 150 |
| 837 | 3300014325 | Ga0163163_10021041 | Ga0163163_100210416 | 150 |
| 838 | 3300025904 | Ga0207647_10055785 | Ga0207647_100557853 | 150 |
| 839 | 3300025919 | Ga0207657_10120974 | Ga0207657_101209742 | 150 |
| 840 | 3300025919 | Ga0207657_10459006 | Ga0207657_104590061 | 150 |
| 841 | 3300025923 | Ga0207681_10068097 | Ga0207681_100680973 | 150 |
| 842 | 3300025932 | Ga0207690_10006143 | Ga0207690_100061434 | 150 |
| 843 | 3300025932 | Ga0207690_10025092 | Ga0207690_100250923 | 150 |
| 844 | 3300025949 | Ga0207667_11386711 | Ga0207667_113867112 | 150 |
| 845 | 3300025981 | Ga0207640_10466978 | Ga0207640_104669783 | 150 |
| 846 | 3300026023 | Ga0207677_10415148 | Ga0207677_104151481 | 150 |
| 847 | 3300026088 | Ga0207641_10035112 | Ga0207641_100351122 | 150 |
| 848 | 3300026095 | Ga0207676_10437349 | Ga0207676_104373492 | 150 |
| 849 | 3300026116 | Ga0207674_10000086 | Ga0207674_10000086107 | 150 |
| 850 | 3300037312 | Ga0395899_0009306 | Ga0395899_0009306_3591_4043 | 150 |
| 851 | 3300037312 | Ga0395899_0306530 | Ga0395899_0306530_61_513 | 150 |
| 852 | 3300037418 | Ga0395900_0080496 | Ga0395900_0080496_2470_2922 | 150 |
| 853 | 3300037418 | Ga0395900_0126528 | Ga0395900_0126528_1195_1647 | 150 |
| 854 | 3300037418 | Ga0395900_0189105 | Ga0395900_0189105_1483_1935 | 150 |
| 855 | 3300037418 | Ga0395900_0214952 | Ga0395900_0214952_407_859 | 150 |
| 856 | 3300037466 | Ga0395898_0026840 | Ga0395898_0026840_2073_2525 | 150 |
| 857 | 3300037466 | Ga0395898_0034536 | Ga0395898_0034536_521_973 | 150 |
| 858 | 3300037466 | Ga0395898_0091847 | Ga0395898_0091847_741_1193 | 150 |
| 859 | 3300037466 | Ga0395898_0242745 | Ga0395898_0242745_1176_1628 | 150 |
| 860 | 3300037466 | Ga0395898_0361511 | Ga0395898_0361511_61_513 | 150 |
| 861 | 3300037471 | Ga0395905_0005968 | Ga0395905_0005968_10562_11014 | 150 |
| 862 | 3300037471 | Ga0395905_0011035 | Ga0395905_0011035_4408_4860 | 150 |
| 863 | 3300037471 | Ga0395905_0021725 | Ga0395905_0021725_5236_5688 | 150 |
| 864 | 3300037471 | Ga0395905_0026175 | Ga0395905_0026175_3129_3581 | 150 |
| 865 | 3300037471 | Ga0395905_0026664 | Ga0395905_0026664_1349_1801 | 150 |
| 866 | 3300037471 | Ga0395905_0045091 | Ga0395905_0045091_1485_1937 | 150 |
| 867 | 3300037471 | Ga0395905_0112437 | Ga0395905_0112437_132_584 | 150 |
| 868 | 3300037471 | Ga0395905_0509713 | Ga0395905_0509713_351_803 | 150 |
| 869 | 3300037471 | Ga0395905_0600350 | Ga0395905_0600350_521_973 | 150 |
| 870 | 3300037471 | Ga0395905_0603453 | Ga0395905_0603453_182_634 | 150 |
| 871 | 3300038443 | Ga0395901_0004565 | Ga0395901_0004565_5244_5696 | 150 |
| 872 | 3300038443 | Ga0395901_0036955 | Ga0395901_0036955_2707_3159 | 150 |
| 873 | 3300038443 | Ga0395901_0052535 | Ga0395901_0052535_3483_3935 | 150 |
| 874 | 3300038443 | Ga0395901_0073246 | Ga0395901_0073246_2026_2478 | 150 |
| 875 | 3300038443 | Ga0395901_0210633 | Ga0395901_0210633_219_671 | 150 |
| 876 | 3300038443 | Ga0395901_0214910 | Ga0395901_0214910_271_723 | 150 |
| 877 | 3300038443 | Ga0395901_0603133 | Ga0395901_0603133_305_757 | 150 |
| 878 | 3300038443 | Ga0395901_0628802 | Ga0395901_0628802_419_871 | 150 |
| 879 | 3300038443 | Ga0395901_0697125 | Ga0395901_0697125_325_777 | 150 |
| 880 | 3300038443 | Ga0395901_0846411 | Ga0395901_0846411_298_750 | 150 |
| 881 | 3300042005 | Ga0439448_0006381 | Ga0439448_0006381_1970_2422 | 150 |
| 882 | 3300042012 | Ga0439455_0005339 | Ga0439455_0005339_1990_2442 | 150 |
| 883 | 3300042012 | Ga0439455_0005956 | Ga0439455_0005956_1451_1903 | 150 |
| 884 | 3300042157 | Ga0439458_0000012 | Ga0439458_0000012_16027_16479 | 150 |
| 885 | 3300046522 | Ga0495643_0145691 | Ga0495643_0145691_669_1121 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6top-assembly4.cif.gz_D | structure of the pore c-terminal domain, a protein of t9ss from porphyromonas gingivalis | 0.9515 | 56 | 139 |
| 5n2c-assembly1.cif.gz_A | crystal structure of the peptidoglycan-associated lipoprotein from burkholderia cenocepacia | 0.9398 | 53 | 150 |
| 4b5c-assembly3.cif.gz_C | crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei | 0.9335 | 53 | 150 |
| 5u1h-assembly3.cif.gz_C | crystal structure of the c-terminal peptidoglycan binding domain of oprf (pa1777) from pseudomonas aeruginosa | 0.9318 | 55 | 149 |
| 5n2c-assembly1.cif.gz_C | crystal structure of the peptidoglycan-associated lipoprotein from burkholderia cenocepacia | 0.9253 | 51 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5u1hB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.9379 | 55 | 149 | 3.30.1330.60 |
| 5n2cC00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.9253 | 51 | 150 | 3.30.1330.60 |
| 3td4B00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.9146 | 55 | 149 | 3.30.1330.60 |
| 1spxA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9123 | 109 | 131 | 3.40.50.720 |
| 3cypB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.9072 | 56 | 150 | 3.30.1330.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538SKS6-F1-model_v4 | OmpA family protein | 0.9635 | 55 | 150 |
GO:0009279
|
| AF-A0A4Q5T8A0-F1-model_v4 | Peptidoglycan-associated lipoprotein Pal | 0.9632 | 45 | 150 |
GO:0009279
GO:0051301 |
| AF-A0A2E6DJF8-F1-model_v4 | deleted | 0.961 | 56 | 150 |
|
| AF-A0A2J6IZ16-F1-model_v4 | OmpA-like domain-containing protein | 0.9608 | 56 | 149 |
GO:0009279
|
| AF-A0A2S5MFN7-F1-model_v4 | Flagellar motor protein MotB | 0.9605 | 43 | 149 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar