F484690
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 886 | 435 | 1772 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10154911|Ga0081538_101549112 |
| Length | 232 |
| Sequence | VPAGSGPIEYEPSAAVVAVNDDGGVLRPPTPTTMPSRPPPVSLSVTRPEIWPVGASAAGGAAKLSTGLPFLEHMLDQVARHGMLDLEIEAKGDLHIDAHHTVEDIGITLGQAVAKAIGDKAGVRRFGHAYVPLDEALSRVVLDFSGRPGLEYHVKFTRALIGEFDVDLMHEFFQGFVNHAQVTLHIDNLRGDNAHHQCETMFKAFARALRMAAEPDPRAGGAVPSTKGTLQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 189 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 203 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 204 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 205 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 218 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 226 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 234 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 237 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 240 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 241 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 242 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 244 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 245 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 246 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 247 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 250 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 251 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 252 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 253 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 343 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 344 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 345 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 346 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 347 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 348 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 349 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 350 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 351 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 354 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 355 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 379 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 380 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 381 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 389 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 404 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 406 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 408 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 409 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 410 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 411 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 412 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 413 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 414 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 415 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 416 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 417 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 418 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 419 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 420 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 421 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 422 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 423 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 424 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 425 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 426 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 427 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 428 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 429 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 430 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 431 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 432 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 433 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 434 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 435 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.61 |
| Metatranscriptomes | 0.23 |
| Isolates | 3.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.05 |
| Nodule | 0.45 |
| Rhizoplane | 0.79 |
| Rhizosphere | 89.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081538_10154911 | 3300005981 | Bacteria | 1030 |
| 2 | JGI25155J39150_1000252 | 3300002704 | Bacteria | 20486 |
| 3 | JGI25155J39150_1000471 | 3300002704 | Bacteria | 10080 |
| 4 | JGI25156J39149_1000288 | 3300002705 | Bacteria | 33984 |
| 5 | JGI25156J39149_1004072 | 3300002705 | Bacteria | 4562 |
| 6 | JGI25154J39366_1000311 | 3300002738 | Bacteria | 28175 |
| 7 | JGI25154J39366_1000313 | 3300002738 | Bacteria | 28101 |
| 8 | JGI25157J39369_1000171 | 3300002741 | Bacteria | 54600 |
| 9 | JGI25150J39212_1001839 | 3300002774 | Bacteria | 5615 |
| 10 | JGI25151J46595_10051050 | 3300003187 | Bacteria | 1403 |
| 11 | Ga0007417J51691_1079838 | 3300003544 | Bacteria | 770 |
| 12 | Ga0055532_1000044 | 3300003758 | Bacteria | 191110 |
| 13 | Ga0055535_1006487 | 3300003761 | Bacteria | 2358 |
| 14 | Ga0055529_1000015 | 3300003763 | Bacteria | 366950 |
| 15 | Ga0055526_1000007 | 3300003771 | Bacteria | 321998 |
| 16 | Ga0055526_1000037 | 3300003771 | Bacteria | 134834 |
| 17 | Ga0065714_10176867 | 3300005288 | Bacteria | 979 |
| 18 | Ga0065714_10183074 | 3300005288 | Bacteria | 955 |
| 19 | Ga0065707_10028354 | 3300005295 | Bacteria | 1158 |
| 20 | Ga0065707_10093232 | 3300005295 | Bacteria | 3656 |
| 21 | Ga0065707_10146765 | 3300005295 | Bacteria | 1705 |
| 22 | Ga0070676_10100527 | 3300005328 | Bacteria | 1785 |
| 23 | Ga0070690_100000183 | 3300005330 | Bacteria | 32306 |
| 24 | Ga0070690_100028668 | 3300005330 | Bacteria | 3450 |
| 25 | Ga0068869_100000139 | 3300005334 | Bacteria | 35367 |
| 26 | Ga0070666_10261455 | 3300005335 | Bacteria | 1227 |
| 27 | Ga0070680_100000688 | 3300005336 | Bacteria | 23463 |
| 28 | Ga0070680_100328147 | 3300005336 | Bacteria | 1300 |
| 29 | Ga0070680_100435945 | 3300005336 | Bacteria | 1119 |
| 30 | Ga0070682_100059915 | 3300005337 | Bacteria | 2406 |
| 31 | Ga0068868_100000115 | 3300005338 | Bacteria | 50197 |
| 32 | Ga0070689_100001743 | 3300005340 | Bacteria | 13915 |
| 33 | Ga0070689_100052931 | 3300005340 | Bacteria | 3141 |
| 34 | Ga0070689_100463101 | 3300005340 | Bacteria | 1080 |
| 35 | Ga0070691_10008416 | 3300005341 | Bacteria | 4724 |
| 36 | Ga0070691_10163927 | 3300005341 | Bacteria | 1148 |
| 37 | Ga0070687_100000091 | 3300005343 | Bacteria | 29810 |
| 38 | Ga0070687_100057792 | 3300005343 | Bacteria | 2035 |
| 39 | Ga0070687_100064050 | 3300005343 | Bacteria | 1952 |
| 40 | Ga0070687_100099246 | 3300005343 | Bacteria | 1627 |
| 41 | Ga0070692_10304212 | 3300005345 | Bacteria | 974 |
| 42 | Ga0070668_100051434 | 3300005347 | Bacteria | 3174 |
| 43 | Ga0070675_100165495 | 3300005354 | Bacteria | 1904 |
| 44 | Ga0070675_100663011 | 3300005354 | Bacteria | 949 |
| 45 | Ga0070674_100088353 | 3300005356 | Bacteria | 2230 |
| 46 | Ga0070659_100082251 | 3300005366 | Bacteria | 2573 |
| 47 | Ga0070703_10007089 | 3300005406 | Bacteria | 3144 |
| 48 | Ga0070709_10180189 | 3300005434 | Bacteria | 1483 |
| 49 | Ga0070701_10778781 | 3300005438 | Bacteria | 650 |
| 50 | Ga0070705_100000441 | 3300005440 | Bacteria | 23797 |
| 51 | Ga0070705_100100728 | 3300005440 | Bacteria | 1823 |
| 52 | Ga0070705_100441138 | 3300005440 | Bacteria | 974 |
| 53 | Ga0070700_100001332 | 3300005441 | Bacteria | 12264 |
| 54 | Ga0070700_100002644 | 3300005441 | Bacteria | 9169 |
| 55 | Ga0070700_100114033 | 3300005441 | Bacteria | 1801 |
| 56 | Ga0070694_100000133 | 3300005444 | Bacteria | 37050 |
| 57 | Ga0070694_100018018 | 3300005444 | Bacteria | 4474 |
| 58 | Ga0070694_100028039 | 3300005444 | Bacteria | 3661 |
| 59 | Ga0070694_100044368 | 3300005444 | Bacteria | 2975 |
| 60 | Ga0070694_100071913 | 3300005444 | Bacteria | 2385 |
| 61 | Ga0070694_100203836 | 3300005444 | Bacteria | 1476 |
| 62 | Ga0070694_100243243 | 3300005444 | Bacteria | 1358 |
| 63 | Ga0070694_100281743 | 3300005444 | Bacteria | 1267 |
| 64 | Ga0070694_100359985 | 3300005444 | Bacteria | 1129 |
| 65 | Ga0070694_100646632 | 3300005444 | Bacteria | 855 |
| 66 | Ga0070708_100105538 | 3300005445 | Bacteria | 2585 |
| 67 | Ga0070681_10000081 | 3300005458 | Bacteria | 71809 |
| 68 | Ga0070681_10018249 | 3300005458 | Bacteria | 7011 |
| 69 | Ga0070681_10153316 | 3300005458 | Bacteria | 2230 |
| 70 | Ga0070681_10195826 | 3300005458 | Bacteria | 1940 |
| 71 | Ga0068867_100000084 | 3300005459 | Bacteria | 58558 |
| 72 | Ga0068867_100002479 | 3300005459 | Bacteria | 12970 |
| 73 | Ga0070706_100076438 | 3300005467 | Bacteria | 3099 |
| 74 | Ga0070707_100026726 | 3300005468 | Bacteria | 5483 |
| 75 | Ga0070698_101290778 | 3300005471 | Bacteria | 680 |
| 76 | Ga0070699_100050684 | 3300005518 | Bacteria | 3594 |
| 77 | Ga0070679_100042718 | 3300005530 | Bacteria | 4515 |
| 78 | Ga0070679_100155414 | 3300005530 | Bacteria | 2262 |
| 79 | Ga0070684_100202324 | 3300005535 | Bacteria | 1809 |
| 80 | Ga0070697_100000299 | 3300005536 | Bacteria | 39638 |
| 81 | Ga0070697_100004807 | 3300005536 | Bacteria | 10352 |
| 82 | Ga0070697_100211102 | 3300005536 | Bacteria | 1653 |
| 83 | Ga0068853_100058101 | 3300005539 | Bacteria | 3339 |
| 84 | Ga0070672_100504943 | 3300005543 | Bacteria | 1046 |
| 85 | Ga0070686_100000193 | 3300005544 | Bacteria | 42276 |
| 86 | Ga0070686_100139498 | 3300005544 | Bacteria | 1686 |
| 87 | Ga0070686_100242193 | 3300005544 | Bacteria | 1314 |
| 88 | Ga0070695_100000163 | 3300005545 | Bacteria | 31628 |
| 89 | Ga0070695_100006828 | 3300005545 | Bacteria | 6757 |
| 90 | Ga0070695_100027364 | 3300005545 | Bacteria | 3531 |
| 91 | Ga0070695_100087620 | 3300005545 | Bacteria | 2071 |
| 92 | Ga0070695_100098397 | 3300005545 | Bacteria | 1966 |
| 93 | Ga0070695_100110894 | 3300005545 | Bacteria | 1861 |
| 94 | Ga0070696_100000570 | 3300005546 | Bacteria | 23539 |
| 95 | Ga0070696_100004599 | 3300005546 | Bacteria | 9212 |
| 96 | Ga0070696_100013604 | 3300005546 | Bacteria | 5461 |
| 97 | Ga0070696_100215508 | 3300005546 | Bacteria | 1439 |
| 98 | Ga0070693_100000111 | 3300005547 | Bacteria | 36381 |
| 99 | Ga0070704_100000008 | 3300005549 | Bacteria | 71641 |
| 100 | Ga0070704_100182942 | 3300005549 | Bacteria | 1678 |
| 101 | Ga0068855_100000242 | 3300005563 | Bacteria | 68674 |
| 102 | Ga0068855_100152556 | 3300005563 | Bacteria | 2626 |
| 103 | Ga0068855_100211348 | 3300005563 | Bacteria | 2180 |
| 104 | Ga0068854_100006366 | 3300005578 | Bacteria | 7509 |
| 105 | Ga0068856_100160335 | 3300005614 | Bacteria | 2259 |
| 106 | Ga0068856_100423008 | 3300005614 | Bacteria | 1352 |
| 107 | Ga0070702_100000012 | 3300005615 | Bacteria | 58298 |
| 108 | Ga0068852_100269519 | 3300005616 | Bacteria | 1638 |
| 109 | Ga0068852_100756740 | 3300005616 | Bacteria | 984 |
| 110 | Ga0068859_100005212 | 3300005617 | Bacteria | 13208 |
| 111 | Ga0068859_100547586 | 3300005617 | Bacteria | 1252 |
| 112 | Ga0068864_100059830 | 3300005618 | Bacteria | 3297 |
| 113 | Ga0068864_100254119 | 3300005618 | Bacteria | 1633 |
| 114 | Ga0068866_10000109 | 3300005718 | Bacteria | 35401 |
| 115 | Ga0068861_100000814 | 3300005719 | Bacteria | 18847 |
| 116 | Ga0068861_100011165 | 3300005719 | Bacteria | 6236 |
| 117 | Ga0068870_10095558 | 3300005840 | Bacteria | 1670 |
| 118 | Ga0068870_10135470 | 3300005840 | Bacteria | 1435 |
| 119 | Ga0068858_100023814 | 3300005842 | Bacteria | 5705 |
| 120 | Ga0068858_100381916 | 3300005842 | Bacteria | 1352 |
| 121 | Ga0068862_100002876 | 3300005844 | Bacteria | 15079 |
| 122 | Ga0068862_100008234 | 3300005844 | Bacteria | 8625 |
| 123 | Ga0075364_10346816 | 3300006051 | Bacteria | 1012 |
| 124 | Ga0075364_10745886 | 3300006051 | Bacteria | 668 |
| 125 | Ga0070715_10132417 | 3300006163 | Bacteria | 1201 |
| 126 | Ga0070716_100026868 | 3300006173 | Bacteria | 3086 |
| 127 | Ga0070716_100168241 | 3300006173 | Bacteria | 1428 |
| 128 | Ga0070716_100292238 | 3300006173 | Bacteria | 1130 |
| 129 | Ga0070716_100747894 | 3300006173 | Bacteria | 752 |
| 130 | Ga0075362_10008204 | 3300006177 | Bacteria | 3986 |
| 131 | Ga0097621_100003524 | 3300006237 | Bacteria | 10813 |
| 132 | Ga0097621_100028427 | 3300006237 | Bacteria | 4407 |
| 133 | Ga0068871_100000559 | 3300006358 | Bacteria | 25362 |
| 134 | Ga0068871_100014580 | 3300006358 | Bacteria | 5862 |
| 135 | Ga0075428_100033964 | 3300006844 | Bacteria | 5627 |
| 136 | Ga0075428_100664862 | 3300006844 | Bacteria | 1111 |
| 137 | Ga0075430_100006977 | 3300006846 | Bacteria | 9521 |
| 138 | Ga0075430_100977377 | 3300006846 | Bacteria | 697 |
| 139 | Ga0075431_100247744 | 3300006847 | Bacteria | 1811 |
| 140 | Ga0075433_10006494 | 3300006852 | Bacteria | 9246 |
| 141 | Ga0075433_10283872 | 3300006852 | Bacteria | 1466 |
| 142 | Ga0075434_100000079 | 3300006871 | Bacteria | 52051 |
| 143 | Ga0075434_100001287 | 3300006871 | Bacteria | 20920 |
| 144 | Ga0075434_100020461 | 3300006871 | Bacteria | 6420 |
| 145 | Ga0075434_100214916 | 3300006871 | Bacteria | 1943 |
| 146 | Ga0075434_100247060 | 3300006871 | Bacteria | 1804 |
| 147 | Ga0075434_100501681 | 3300006871 | Bacteria | 1234 |
| 148 | Ga0075434_100813005 | 3300006871 | Bacteria | 951 |
| 149 | Ga0075429_100000891 | 3300006880 | Bacteria | 23613 |
| 150 | Ga0075429_100048189 | 3300006880 | Bacteria | 3707 |
| 151 | Ga0075429_100067097 | 3300006880 | Bacteria | 3122 |
| 152 | Ga0068865_100002206 | 3300006881 | Bacteria | 11476 |
| 153 | Ga0068865_100004107 | 3300006881 | Bacteria | 8751 |
| 154 | Ga0075436_100000789 | 3300006914 | Bacteria | 21020 |
| 155 | Ga0075436_100008442 | 3300006914 | Bacteria | 7041 |
| 156 | Ga0075436_100027934 | 3300006914 | Bacteria | 3884 |
| 157 | Ga0075436_100135911 | 3300006914 | Bacteria | 1726 |
| 158 | Ga0075436_100228214 | 3300006914 | Bacteria | 1322 |
| 159 | Ga0075436_100494859 | 3300006914 | Bacteria | 894 |
| 160 | Ga0097620_100005212 | 3300006931 | Bacteria | 13208 |
| 161 | Ga0097620_100547583 | 3300006931 | Bacteria | 1252 |
| 162 | Ga0079104_1011322 | 3300006946 | Bacteria | 2873 |
| 163 | Ga0075435_100000655 | 3300007076 | Bacteria | 21307 |
| 164 | Ga0075435_100003904 | 3300007076 | Bacteria | 10179 |
| 165 | Ga0075435_100010489 | 3300007076 | Bacteria | 6777 |
| 166 | Ga0075435_100083036 | 3300007076 | Bacteria | 2634 |
| 167 | Ga0075435_100095897 | 3300007076 | Bacteria | 2453 |
| 168 | Ga0075435_100222527 | 3300007076 | Bacteria | 1603 |
| 169 | Ga0075435_100271705 | 3300007076 | Bacteria | 1446 |
| 170 | Ga0075435_100468995 | 3300007076 | Bacteria | 1087 |
| 171 | Ga0099794_10121695 | 3300007265 | Bacteria | 1313 |
| 172 | Ga0099795_10055246 | 3300007788 | Bacteria | 1458 |
| 173 | Ga0105244_10000412 | 3300009036 | Bacteria | 39755 |
| 174 | Ga0105244_10041635 | 3300009036 | Bacteria | 2380 |
| 175 | Ga0105244_10304845 | 3300009036 | Bacteria | 737 |
| 176 | Ga0105250_10146464 | 3300009092 | Bacteria | 981 |
| 177 | Ga0105240_10007532 | 3300009093 | Bacteria | 15792 |
| 178 | Ga0105240_10026536 | 3300009093 | Bacteria | 7600 |
| 179 | Ga0105240_10316720 | 3300009093 | Bacteria | 1779 |
| 180 | Ga0111539_10011985 | 3300009094 | Bacteria | 10872 |
| 181 | Ga0111539_10013498 | 3300009094 | Bacteria | 10209 |
| 182 | Ga0111539_10029705 | 3300009094 | Bacteria | 6654 |
| 183 | Ga0111539_10613481 | 3300009094 | Bacteria | 1267 |
| 184 | Ga0105245_10000245 | 3300009098 | Bacteria | 51952 |
| 185 | Ga0105245_10026778 | 3300009098 | Bacteria | 5077 |
| 186 | Ga0114129_10000219 | 3300009147 | Bacteria | 63579 |
| 187 | Ga0114129_10241959 | 3300009147 | Bacteria | 2425 |
| 188 | Ga0114129_10418725 | 3300009147 | Bacteria | 1762 |
| 189 | Ga0114129_11276693 | 3300009147 | Bacteria | 911 |
| 190 | Ga0114129_11552568 | 3300009147 | Bacteria | 812 |
| 191 | Ga0105243_10000279 | 3300009148 | Bacteria | 56997 |
| 192 | Ga0105241_10062959 | 3300009174 | Bacteria | 2860 |
| 193 | Ga0105242_10000480 | 3300009176 | Bacteria | 31755 |
| 194 | Ga0105242_10046492 | 3300009176 | Bacteria | 3521 |
| 195 | Ga0105242_10156759 | 3300009176 | Bacteria | 1989 |
| 196 | Ga0105248_10502895 | 3300009177 | Bacteria | 1366 |
| 197 | Ga0105237_10181974 | 3300009545 | Bacteria | 2102 |
| 198 | Ga0105238_10047036 | 3300009551 | Bacteria | 4351 |
| 199 | Ga0105249_10007151 | 3300009553 | Bacteria | 9742 |
| 200 | Ga0105249_10086025 | 3300009553 | Bacteria | 2931 |
| 201 | Ga0099796_10035086 | 3300010159 | Bacteria | 1661 |
| 202 | Ga0157373_10220548 | 3300013100 | Bacteria | 1338 |
| 203 | Ga0157378_10000294 | 3300013297 | Bacteria | 48405 |
| 204 | Ga0163162_10101727 | 3300013306 | Bacteria | 2966 |
| 205 | Ga0157372_10961460 | 3300013307 | Bacteria | 990 |
| 206 | Ga0163163_11624610 | 3300014325 | Bacteria | 707 |
| 207 | Ga0157380_10284264 | 3300014326 | Bacteria | 1515 |
| 208 | Ga0182008_10000609 | 3300014497 | Bacteria | 26312 |
| 209 | Ga0157377_10004975 | 3300014745 | Bacteria | 6198 |
| 210 | Ga0157379_10029733 | 3300014968 | Bacteria | 4858 |
| 211 | Ga0157379_10169377 | 3300014968 | Bacteria | 1971 |
| 212 | Ga0157376_10002130 | 3300014969 | Bacteria | 13330 |
| 213 | Ga0182006_1000023 | 3300015261 | Bacteria | 275031 |
| 214 | Ga0182006_1000125 | 3300015261 | Bacteria | 82143 |
| 215 | Ga0182006_1009055 | 3300015261 | Bacteria | 4478 |
| 216 | Ga0182007_10000082 | 3300015262 | Bacteria | 71660 |
| 217 | Ga0182005_1000006 | 3300015265 | Bacteria | 515188 |
| 218 | Ga0182005_1000047 | 3300015265 | Bacteria | 126754 |
| 219 | Ga0163161_10013268 | 3300017792 | Bacteria | 5728 |
| 220 | Ga0163161_10070329 | 3300017792 | Bacteria | 2559 |
| 221 | Ga0163161_10607694 | 3300017792 | Bacteria | 902 |
| 222 | Ga0213872_10079118 | 3300021361 | Bacteria | 1477 |
| 223 | Ga0213872_10199498 | 3300021361 | Bacteria | 858 |
| 224 | Ga0209435_100004 | 3300025206 | Bacteria | 633417 |
| 225 | Ga0209435_100168 | 3300025206 | Bacteria | 20495 |
| 226 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 227 | Ga0209437_100207 | 3300025233 | Bacteria | 112147 |
| 228 | Ga0209258_100279 | 3300025242 | Bacteria | 86008 |
| 229 | Ga0207425_1000176 | 3300025245 | Bacteria | 52680 |
| 230 | Ga0209646_1000125 | 3300025246 | Bacteria | 135847 |
| 231 | Ga0209646_1000140 | 3300025246 | Bacteria | 111155 |
| 232 | Ga0209646_1000205 | 3300025246 | Bacteria | 69450 |
| 233 | Ga0209026_1000066 | 3300025250 | Bacteria | 207691 |
| 234 | Ga0209026_1002319 | 3300025250 | Bacteria | 7236 |
| 235 | Ga0209026_1030661 | 3300025250 | Bacteria | 798 |
| 236 | Ga0209148_1013906 | 3300025254 | Bacteria | 1435 |
| 237 | Ga0209759_1000114 | 3300025256 | Bacteria | 142233 |
| 238 | Ga0209759_1000961 | 3300025256 | Bacteria | 20401 |
| 239 | Ga0209233_1020816 | 3300025261 | Bacteria | 1711 |
| 240 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 241 | Ga0209455_1004399 | 3300025272 | Bacteria | 4629 |
| 242 | Ga0209025_1003577 | 3300025294 | Bacteria | 14530 |
| 243 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 244 | Ga0209564_1000042 | 3300025295 | Bacteria | 392805 |
| 245 | Ga0209758_1000433 | 3300025297 | Bacteria | 70750 |
| 246 | Ga0207655_1001385 | 3300025728 | Bacteria | 22650 |
| 247 | Ga0207655_1005830 | 3300025728 | Bacteria | 8274 |
| 248 | Ga0207713_1026364 | 3300025735 | Bacteria | 2665 |
| 249 | Ga0207653_10025685 | 3300025885 | Bacteria | 1884 |
| 250 | Ga0207642_10004540 | 3300025899 | Bacteria | 4484 |
| 251 | Ga0207688_10034174 | 3300025901 | Bacteria | 2814 |
| 252 | Ga0207647_10068324 | 3300025904 | Bacteria | 2151 |
| 253 | Ga0207684_10011988 | 3300025910 | Bacteria | 7549 |
| 254 | Ga0207684_10849722 | 3300025910 | Bacteria | 769 |
| 255 | Ga0207654_10002619 | 3300025911 | Bacteria | 9130 |
| 256 | Ga0207707_10007590 | 3300025912 | Bacteria | 9451 |
| 257 | Ga0207707_10179483 | 3300025912 | Bacteria | 1849 |
| 258 | Ga0207707_10221069 | 3300025912 | Bacteria | 1649 |
| 259 | Ga0207695_10007348 | 3300025913 | Bacteria | 14059 |
| 260 | Ga0207671_10111165 | 3300025914 | Bacteria | 2084 |
| 261 | Ga0207671_10164735 | 3300025914 | Bacteria | 1718 |
| 262 | Ga0207663_10309528 | 3300025916 | Bacteria | 1183 |
| 263 | Ga0207660_10002762 | 3300025917 | Bacteria | 11505 |
| 264 | Ga0207660_10051323 | 3300025917 | Bacteria | 2932 |
| 265 | Ga0207660_10418387 | 3300025917 | Bacteria | 1081 |
| 266 | Ga0207662_10000176 | 3300025918 | Bacteria | 30450 |
| 267 | Ga0207662_10020338 | 3300025918 | Bacteria | 3787 |
| 268 | Ga0207662_10031534 | 3300025918 | Bacteria | 3080 |
| 269 | Ga0207662_10673954 | 3300025918 | Bacteria | 723 |
| 270 | Ga0207652_10005421 | 3300025921 | Bacteria | 10349 |
| 271 | Ga0207652_10096934 | 3300025921 | Bacteria | 2598 |
| 272 | Ga0207646_10022393 | 3300025922 | Bacteria | 5823 |
| 273 | Ga0207646_10034021 | 3300025922 | Bacteria | 4606 |
| 274 | Ga0207681_10074197 | 3300025923 | Bacteria | 2382 |
| 275 | Ga0207694_10509441 | 3300025924 | Bacteria | 1008 |
| 276 | Ga0207659_10008745 | 3300025926 | Bacteria | 6305 |
| 277 | Ga0207659_10430550 | 3300025926 | Bacteria | 1108 |
| 278 | Ga0207659_10854406 | 3300025926 | Bacteria | 782 |
| 279 | Ga0207687_10001352 | 3300025927 | Bacteria | 16793 |
| 280 | Ga0207687_10058530 | 3300025927 | Bacteria | 2711 |
| 281 | Ga0207686_10000627 | 3300025934 | Bacteria | 21927 |
| 282 | Ga0207686_10128102 | 3300025934 | Bacteria | 1737 |
| 283 | Ga0207709_10000549 | 3300025935 | Bacteria | 32146 |
| 284 | Ga0207709_10009164 | 3300025935 | Bacteria | 5452 |
| 285 | Ga0207670_10039886 | 3300025936 | Bacteria | 3078 |
| 286 | Ga0207670_10043125 | 3300025936 | Bacteria | 2977 |
| 287 | Ga0207669_10317121 | 3300025937 | Bacteria | 1191 |
| 288 | Ga0207704_10000329 | 3300025938 | Bacteria | 22100 |
| 289 | Ga0207704_10018414 | 3300025938 | Bacteria | 3645 |
| 290 | Ga0207665_10007215 | 3300025939 | Bacteria | 7354 |
| 291 | Ga0207665_10136089 | 3300025939 | Bacteria | 1748 |
| 292 | Ga0207665_10161652 | 3300025939 | Bacteria | 1611 |
| 293 | Ga0207691_10120139 | 3300025940 | Bacteria | 2330 |
| 294 | Ga0207711_10434006 | 3300025941 | Bacteria | 1222 |
| 295 | Ga0207661_10090479 | 3300025944 | Bacteria | 2548 |
| 296 | Ga0207712_10022192 | 3300025961 | Bacteria | 4177 |
| 297 | Ga0207668_10016248 | 3300025972 | Bacteria | 4642 |
| 298 | Ga0207640_10033700 | 3300025981 | Bacteria | 3189 |
| 299 | Ga0207677_10000669 | 3300026023 | Bacteria | 20376 |
| 300 | Ga0207677_10059997 | 3300026023 | Bacteria | 2627 |
| 301 | Ga0207677_10699518 | 3300026023 | Bacteria | 899 |
| 302 | Ga0207703_10005933 | 3300026035 | Bacteria | 9788 |
| 303 | Ga0207703_10029223 | 3300026035 | Bacteria | 4348 |
| 304 | Ga0207639_10040826 | 3300026041 | Bacteria | 3466 |
| 305 | Ga0207708_10000275 | 3300026075 | Bacteria | 40312 |
| 306 | Ga0207708_10037205 | 3300026075 | Bacteria | 3707 |
| 307 | Ga0207708_10411784 | 3300026075 | Bacteria | 1120 |
| 308 | Ga0207702_10071848 | 3300026078 | Bacteria | 2981 |
| 309 | Ga0207648_10000185 | 3300026089 | Bacteria | 65925 |
| 310 | Ga0207648_10001654 | 3300026089 | Bacteria | 24445 |
| 311 | Ga0207676_10567431 | 3300026095 | Bacteria | 1086 |
| 312 | Ga0207674_10103608 | 3300026116 | Bacteria | 2825 |
| 313 | Ga0207675_100000150 | 3300026118 | Bacteria | 61064 |
| 314 | Ga0207675_100080942 | 3300026118 | Bacteria | 3045 |
| 315 | Ga0207683_10115993 | 3300026121 | Bacteria | 2401 |
| 316 | Ga0207698_10267892 | 3300026142 | Bacteria | 1573 |
| 317 | Ga0207698_10283503 | 3300026142 | Bacteria | 1534 |
| 318 | Ga0209281_1003338 | 3300027111 | Bacteria | 5382 |
| 319 | Ga0209969_1002680 | 3300027360 | Bacteria | 2467 |
| 320 | Ga0209969_1012340 | 3300027360 | Bacteria | 1231 |
| 321 | Ga0209967_1000561 | 3300027364 | Bacteria | 4882 |
| 322 | Ga0209967_1003478 | 3300027364 | Bacteria | 2076 |
| 323 | Ga0210000_1000970 | 3300027462 | Bacteria | 4014 |
| 324 | Ga0210000_1001740 | 3300027462 | Bacteria | 3081 |
| 325 | Ga0209995_1001745 | 3300027471 | Bacteria | 3379 |
| 326 | Ga0209179_1004916 | 3300027512 | Bacteria | 2055 |
| 327 | Ga0209968_1004125 | 3300027526 | Bacteria | 2181 |
| 328 | Ga0209999_1005018 | 3300027543 | Bacteria | 2381 |
| 329 | Ga0209999_1017181 | 3300027543 | Bacteria | 1319 |
| 330 | Ga0209588_1007435 | 3300027671 | Bacteria | 3222 |
| 331 | Ga0209971_1081568 | 3300027682 | Bacteria | 788 |
| 332 | Ga0209966_1004277 | 3300027695 | Bacteria | 2417 |
| 333 | Ga0209974_10016022 | 3300027876 | Bacteria | 2488 |
| 334 | Ga0207428_10000290 | 3300027907 | Bacteria | 67367 |
| 335 | Ga0207428_10025385 | 3300027907 | Bacteria | 4960 |
| 336 | Ga0207428_10047565 | 3300027907 | Bacteria | 3444 |
| 337 | Ga0207428_10063834 | 3300027907 | Bacteria | 2908 |
| 338 | Ga0207428_10496211 | 3300027907 | Bacteria | 887 |
| 339 | Ga0268265_10001010 | 3300028380 | Bacteria | 25458 |
| 340 | Ga0268265_10008669 | 3300028380 | Bacteria | 6873 |
| 341 | Ga0307517_10206767 | 3300028786 | Bacteria | 1217 |
| 342 | Ga0307515_10139635 | 3300028794 | Bacteria | 2608 |
| 343 | Ga0316181_1151886 | 3300030744 | Bacteria | 2785 |
| 344 | Ga0307408_100066343 | 3300031548 | Bacteria | 2650 |
| 345 | Ga0307408_100299524 | 3300031548 | Bacteria | 1346 |
| 346 | Ga0316575_10001586 | 3300031665 | Bacteria | 7394 |
| 347 | Ga0316575_10003078 | 3300031665 | Bacteria | 5693 |
| 348 | Ga0316575_10133838 | 3300031665 | Bacteria | 1018 |
| 349 | Ga0316579_10006383 | 3300031691 | Bacteria | 4814 |
| 350 | Ga0265314_10023239 | 3300031711 | Bacteria | 4732 |
| 351 | Ga0316578_10006914 | 3300031728 | Bacteria | 5642 |
| 352 | Ga0316578_10019153 | 3300031728 | Bacteria | 3761 |
| 353 | Ga0307405_10003031 | 3300031731 | Bacteria | 7608 |
| 354 | Ga0316577_10011728 | 3300031733 | Bacteria | 4754 |
| 355 | Ga0316577_10145427 | 3300031733 | Bacteria | 1336 |
| 356 | Ga0307413_10103949 | 3300031824 | Bacteria | 1884 |
| 357 | Ga0307410_10000539 | 3300031852 | Bacteria | 15527 |
| 358 | Ga0307406_10014860 | 3300031901 | Bacteria | 4488 |
| 359 | Ga0307407_10069599 | 3300031903 | Bacteria | 2089 |
| 360 | Ga0307412_10019535 | 3300031911 | Bacteria | 4106 |
| 361 | Ga0307416_100141028 | 3300032002 | Bacteria | 2190 |
| 362 | Ga0307416_100273486 | 3300032002 | Bacteria | 1660 |
| 363 | Ga0307416_100484985 | 3300032002 | Bacteria | 1297 |
| 364 | Ga0307416_100765238 | 3300032002 | Bacteria | 1059 |
| 365 | Ga0307416_100828917 | 3300032002 | Bacteria | 1022 |
| 366 | Ga0307416_100989201 | 3300032002 | Bacteria | 944 |
| 367 | Ga0307416_101753204 | 3300032002 | Bacteria | 725 |
| 368 | Ga0307411_10062647 | 3300032005 | Bacteria | 2481 |
| 369 | Ga0307411_10648036 | 3300032005 | Bacteria | 914 |
| 370 | Ga0307415_100045681 | 3300032126 | Bacteria | 2938 |
| 371 | Ga0316583_10131148 | 3300032133 | Bacteria | 873 |
| 372 | Ga0316585_10047728 | 3300032137 | Bacteria | 1371 |
| 373 | Ga0316580_10020002 | 3300032139 | Bacteria | 2060 |
| 374 | Ga0316593_10008065 | 3300032168 | Bacteria | 2922 |
| 375 | Ga0373934_0000524 | 3300035086 | Bacteria | 13506 |
| 376 | Ga0373934_0003529 | 3300035086 | Bacteria | 5750 |
| 377 | Ga0373934_0027468 | 3300035086 | Bacteria | 2212 |
| 378 | Ga0373944_0000909 | 3300035089 | Bacteria | 7302 |
| 379 | Ga0373949_0009770 | 3300035090 | Bacteria | 2100 |
| 380 | Ga0373952_0010157 | 3300035092 | Bacteria | 1815 |
| 381 | Ga0373923_0001446 | 3300035111 | Bacteria | 6812 |
| 382 | Ga0373923_0022790 | 3300035111 | Bacteria | 2459 |
| 383 | Ga0373936_0003119 | 3300035113 | Bacteria | 6206 |
| 384 | Ga0373936_0011164 | 3300035113 | Bacteria | 3394 |
| 385 | Ga0373936_0110585 | 3300035113 | Bacteria | 1166 |
| 386 | Ga0373939_0003574 | 3300035114 | Bacteria | 3650 |
| 387 | Ga0373939_0041704 | 3300035114 | Bacteria | 1384 |
| 388 | Ga0373941_0038627 | 3300035115 | Bacteria | 1462 |
| 389 | Ga0373941_0049333 | 3300035115 | Bacteria | 1332 |
| 390 | Ga0373953_0022814 | 3300035117 | Bacteria | 2364 |
| 391 | Ga0373954_0002148 | 3300035118 | Bacteria | 8184 |
| 392 | Ga0373954_0037910 | 3300035118 | Bacteria | 2240 |
| 393 | Ga0373956_0000135 | 3300035119 | Bacteria | 26321 |
| 394 | Ga0373956_0010109 | 3300035119 | Bacteria | 3853 |
| 395 | Ga0373957_0007330 | 3300035120 | Bacteria | 3527 |
| 396 | Ga0373957_0008551 | 3300035120 | Bacteria | 3320 |
| 397 | Ga0373960_0108099 | 3300035121 | Bacteria | 909 |
| 398 | Ga0373960_0108280 | 3300035121 | Bacteria | 909 |
| 399 | Ga0373943_0110815 | 3300035170 | Bacteria | 1447 |
| 400 | Ga0373946_0057881 | 3300035171 | Bacteria | 1640 |
| 401 | Ga0373946_0063474 | 3300035171 | Bacteria | 1577 |
| 402 | Ga0373955_0007893 | 3300035172 | Bacteria | 4913 |
| 403 | Ga0373955_0068738 | 3300035172 | Bacteria | 1975 |
| 404 | Ga0373955_0261814 | 3300035172 | Bacteria | 1038 |
| 405 | Ga0373942_0025084 | 3300035207 | Bacteria | 1534 |
| 406 | Ga0373942_0084666 | 3300035207 | Bacteria | 947 |
| 407 | Ga0373961_0004525 | 3300035241 | Bacteria | 3361 |
| 408 | Ga0373961_0026789 | 3300035241 | Bacteria | 1578 |
| 409 | Ga0373961_0036263 | 3300035241 | Bacteria | 1403 |
| 410 | Ga0373962_0001944 | 3300035242 | Bacteria | 4928 |
| 411 | Ga0316574_0002868 | 3300035398 | Bacteria | 8757 |
| 412 | Ga0316574_0064011 | 3300035398 | Bacteria | 2313 |
| 413 | Ga0316574_0122577 | 3300035398 | Bacteria | 1670 |
| 414 | Ga0373924_0024443 | 3300035410 | Bacteria | 2380 |
| 415 | Ga0373924_0047708 | 3300035410 | Bacteria | 1767 |
| 416 | Ga0373924_0196319 | 3300035410 | Bacteria | 889 |
| 417 | Ga0373924_0269742 | 3300035410 | Bacteria | 754 |
| 418 | Ga0373931_0000163 | 3300035691 | Bacteria | 29108 |
| 419 | Ga0373931_0020082 | 3300035691 | Bacteria | 3340 |
| 420 | Ga0373931_0184591 | 3300035691 | Bacteria | 1237 |
| 421 | Ga0373931_0482561 | 3300035691 | Bacteria | 797 |
| 422 | Ga0373935_0046669 | 3300035692 | Bacteria | 2736 |
| 423 | Ga0373935_0118923 | 3300035692 | Bacteria | 1762 |
| 424 | Ga0373935_0646776 | 3300035692 | Bacteria | 775 |
| 425 | Ga0373927_0018600 | 3300035695 | Bacteria | 4562 |
| 426 | Ga0373933_0002313 | 3300035724 | Bacteria | 10829 |
| 427 | Ga0373933_0008376 | 3300035724 | Bacteria | 5647 |
| 428 | Ga0373933_0070820 | 3300035724 | Bacteria | 2121 |
| 429 | Ga0373933_0627181 | 3300035724 | Bacteria | 706 |
| 430 | Ga0373947_0032914 | 3300035725 | Bacteria | 3057 |
| 431 | Ga0373947_0139496 | 3300035725 | Bacteria | 1554 |
| 432 | Ga0373947_0156143 | 3300035725 | Bacteria | 1473 |
| 433 | Ga0373947_0175104 | 3300035725 | Bacteria | 1394 |
| 434 | Ga0373937_0001313 | 3300036401 | Bacteria | 20818 |
| 435 | Ga0373937_0033470 | 3300036401 | Bacteria | 4667 |
| 436 | Ga0373937_0067095 | 3300036401 | Bacteria | 3305 |
| 437 | Ga0373937_0076864 | 3300036401 | Bacteria | 3084 |
| 438 | Ga0373937_0140242 | 3300036401 | Bacteria | 2261 |
| 439 | Ga0373937_0172469 | 3300036401 | Bacteria | 2029 |
| 440 | Ga0373937_0209683 | 3300036401 | Bacteria | 1833 |
| 441 | Ga0316582_0014225 | 3300036647 | Bacteria | 4508 |
| 442 | Ga0316582_0023391 | 3300036647 | Bacteria | 3682 |
| 443 | Ga0316584_0231204 | 3300036712 | Bacteria | 1355 |
| 444 | Ga0373925_0025897 | 3300037068 | Bacteria | 4288 |
| 445 | Ga0373925_0108840 | 3300037068 | Bacteria | 2139 |
| 446 | Ga0316581_0003333 | 3300037588 | Bacteria | 3987 |
| 447 | Ga0436360_1247629 | 3300039438 | Bacteria | 1429 |
| 448 | Ga0436361_0031960 | 3300039447 | Bacteria | 30752 |
| 449 | Ga0436361_0183378 | 3300039447 | Bacteria | 3080 |
| 450 | Ga0436361_0224368 | 3300039447 | Bacteria | 99317 |
| 451 | Ga0436361_0475359 | 3300039447 | Bacteria | 1987 |
| 452 | Ga0439439_0092299 | 3300041406 | Bacteria | 828 |
| 453 | Ga0439453_0003405 | 3300041408 | Bacteria | 2287 |
| 454 | Ga0439466_0071477 | 3300041411 | Bacteria | 1104 |
| 455 | Ga0451800_1368170 | 3300041459 | Bacteria | 1155 |
| 456 | Ga0451853_2519352 | 3300041512 | Bacteria | 996 |
| 457 | Ga0439441_001220 | 3300042001 | Bacteria | 3280 |
| 458 | Ga0439441_008765 | 3300042001 | Bacteria | 1660 |
| 459 | Ga0439451_010902 | 3300042009 | Bacteria | 1833 |
| 460 | Ga0439454_014529 | 3300042011 | Bacteria | 1093 |
| 461 | Ga0439446_0008714 | 3300042156 | Bacteria | 2700 |
| 462 | Ga0439446_0042915 | 3300042156 | Bacteria | 1336 |
| 463 | Ga0439434_0000867 | 3300042435 | Bacteria | 8710 |
| 464 | Ga0439434_0045763 | 3300042435 | Bacteria | 1350 |
| 465 | Ga0439435_0000145 | 3300042436 | Bacteria | 9631 |
| 466 | Ga0439435_0002402 | 3300042436 | Bacteria | 3709 |
| 467 | Ga0439435_0024654 | 3300042436 | Bacteria | 1589 |
| 468 | Ga0439444_0016130 | 3300042437 | Bacteria | 1268 |
| 469 | Ga0439460_0000484 | 3300042461 | Bacteria | 8608 |
| 470 | Ga0439460_0070741 | 3300042461 | Bacteria | 1080 |
| 471 | Ga0450893_0059299 | 3300042532 | Bacteria | 728 |
| 472 | Ga0451577_0021757 | 3300042876 | Bacteria | 5864 |
| 473 | Ga0453684_0002459 | 3300044712 | Bacteria | 44922 |
| 474 | Ga0466960_0165918 | 3300044901 | Bacteria | 1189 |
| 475 | Ga0451576_0001107 | 3300045051 | Bacteria | 49185 |
| 476 | Ga0451576_0008931 | 3300045051 | Bacteria | 11690 |
| 477 | Ga0451576_0079706 | 3300045051 | Bacteria | 3407 |
| 478 | Ga0451576_0104634 | 3300045051 | Bacteria | 2944 |
| 479 | Ga0451576_0107249 | 3300045051 | Bacteria | 2906 |
| 480 | Ga0451576_0116553 | 3300045051 | Bacteria | 2781 |
| 481 | Ga0495617_000020 | 3300046452 | Bacteria | 230257 |
| 482 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 483 | Ga0495627_016628 | 3300046453 | Bacteria | 2515 |
| 484 | Ga0495592_0010390 | 3300046454 | Bacteria | 7022 |
| 485 | Ga0495592_0014005 | 3300046454 | Bacteria | 6092 |
| 486 | Ga0495592_0029825 | 3300046454 | Bacteria | 4127 |
| 487 | Ga0495592_0126836 | 3300046454 | Bacteria | 1789 |
| 488 | Ga0495603_0317435 | 3300046455 | Bacteria | 894 |
| 489 | Ga0495590_0000012 | 3300046457 | Bacteria | 303377 |
| 490 | Ga0495629_0213540 | 3300046459 | Bacteria | 1332 |
| 491 | Ga0495638_0000047 | 3300046460 | Bacteria | 216004 |
| 492 | Ga0495638_0112350 | 3300046460 | Bacteria | 1617 |
| 493 | Ga0495638_0123734 | 3300046460 | Bacteria | 1526 |
| 494 | Ga0495641_0003418 | 3300046461 | Bacteria | 11897 |
| 495 | Ga0495651_0000274 | 3300046462 | Bacteria | 40100 |
| 496 | Ga0495651_0001676 | 3300046462 | Bacteria | 17133 |
| 497 | Ga0495651_0385390 | 3300046462 | Bacteria | 918 |
| 498 | Ga0495653_0000035 | 3300046463 | Bacteria | 129875 |
| 499 | Ga0495653_0005409 | 3300046463 | Bacteria | 10393 |
| 500 | Ga0495650_0000128 | 3300046471 | Bacteria | 177256 |
| 501 | Ga0495650_0000157 | 3300046471 | Bacteria | 155023 |
| 502 | Ga0495650_0000261 | 3300046471 | Bacteria | 101830 |
| 503 | Ga0495650_0002873 | 3300046471 | Bacteria | 13135 |
| 504 | Ga0495650_0015617 | 3300046471 | Bacteria | 3886 |
| 505 | Ga0495650_0029788 | 3300046471 | Bacteria | 2483 |
| 506 | Ga0495580_0011719 | 3300046472 | Bacteria | 6772 |
| 507 | Ga0495580_0045545 | 3300046472 | Bacteria | 3115 |
| 508 | Ga0495582_0018307 | 3300046473 | Bacteria | 3832 |
| 509 | Ga0495605_0000018 | 3300046474 | Bacteria | 270187 |
| 510 | Ga0495639_0002991 | 3300046475 | Bacteria | 7359 |
| 511 | Ga0495639_0021855 | 3300046475 | Bacteria | 2803 |
| 512 | Ga0495639_0025710 | 3300046475 | Bacteria | 2598 |
| 513 | Ga0495662_0040946 | 3300046476 | Bacteria | 2237 |
| 514 | Ga0495662_0309770 | 3300046476 | Bacteria | 776 |
| 515 | Ga0495664_0499015 | 3300046477 | Bacteria | 727 |
| 516 | Ga0495584_0201659 | 3300046491 | Bacteria | 1011 |
| 517 | Ga0495585_0006253 | 3300046492 | Bacteria | 7417 |
| 518 | Ga0495607_0006186 | 3300046501 | Bacteria | 8459 |
| 519 | Ga0495607_0007691 | 3300046501 | Bacteria | 7428 |
| 520 | Ga0495607_0102330 | 3300046501 | Bacteria | 1532 |
| 521 | Ga0495583_0002050 | 3300046506 | Bacteria | 18274 |
| 522 | Ga0495606_0000288 | 3300046507 | Bacteria | 87389 |
| 523 | Ga0495606_0000512 | 3300046507 | Bacteria | 63012 |
| 524 | Ga0495606_0000790 | 3300046507 | Bacteria | 48364 |
| 525 | Ga0495606_0001762 | 3300046507 | Bacteria | 27726 |
| 526 | Ga0495606_0001799 | 3300046507 | Bacteria | 27290 |
| 527 | Ga0495606_0004472 | 3300046507 | Bacteria | 13939 |
| 528 | Ga0495606_0059541 | 3300046507 | Bacteria | 2449 |
| 529 | Ga0495608_0000767 | 3300046511 | Bacteria | 22475 |
| 530 | Ga0495608_0007610 | 3300046511 | Bacteria | 7636 |
| 531 | Ga0495608_0358870 | 3300046511 | Bacteria | 896 |
| 532 | Ga0495608_0410027 | 3300046511 | Bacteria | 828 |
| 533 | Ga0495608_0480883 | 3300046511 | Bacteria | 753 |
| 534 | Ga0495610_0000014 | 3300046512 | Bacteria | 444708 |
| 535 | Ga0495610_0018280 | 3300046512 | Bacteria | 3964 |
| 536 | Ga0495610_0077986 | 3300046512 | Bacteria | 1528 |
| 537 | Ga0495618_0085019 | 3300046514 | Bacteria | 2021 |
| 538 | Ga0495618_0142955 | 3300046514 | Bacteria | 1530 |
| 539 | Ga0495628_0003354 | 3300046516 | Bacteria | 14318 |
| 540 | Ga0495628_0009437 | 3300046516 | Bacteria | 8329 |
| 541 | Ga0495628_0029940 | 3300046516 | Bacteria | 4410 |
| 542 | Ga0495628_0033466 | 3300046516 | Bacteria | 4142 |
| 543 | Ga0495628_0249247 | 3300046516 | Bacteria | 1326 |
| 544 | Ga0495630_0010824 | 3300046517 | Bacteria | 6587 |
| 545 | Ga0495630_0153015 | 3300046517 | Bacteria | 1755 |
| 546 | Ga0495630_0308259 | 3300046517 | Bacteria | 1210 |
| 547 | Ga0495630_0460573 | 3300046517 | Bacteria | 974 |
| 548 | Ga0495637_0000142 | 3300046520 | Bacteria | 54212 |
| 549 | Ga0495637_0003152 | 3300046520 | Bacteria | 8802 |
| 550 | Ga0495643_0000082 | 3300046522 | Bacteria | 159651 |
| 551 | Ga0495643_0000160 | 3300046522 | Bacteria | 107502 |
| 552 | Ga0495643_0087501 | 3300046522 | Bacteria | 1612 |
| 553 | Ga0495644_0255344 | 3300046523 | Bacteria | 681 |
| 554 | Ga0495648_0000019 | 3300046524 | Bacteria | 276407 |
| 555 | Ga0495648_0013458 | 3300046524 | Bacteria | 6046 |
| 556 | Ga0495648_0085582 | 3300046524 | Bacteria | 1780 |
| 557 | Ga0495666_0003438 | 3300046526 | Bacteria | 7983 |
| 558 | Ga0495666_0005319 | 3300046526 | Bacteria | 6490 |
| 559 | Ga0495666_0012214 | 3300046526 | Bacteria | 4285 |
| 560 | Ga0495642_0000449 | 3300046528 | Bacteria | 21699 |
| 561 | Ga0495642_0056212 | 3300046528 | Bacteria | 1625 |
| 562 | Ga0495652_0002976 | 3300046529 | Bacteria | 17031 |
| 563 | Ga0495652_0105783 | 3300046529 | Bacteria | 2273 |
| 564 | Ga0495652_0189848 | 3300046529 | Bacteria | 1569 |
| 565 | Ga0495652_0291170 | 3300046529 | Bacteria | 1191 |
| 566 | Ga0495654_0000014 | 3300046530 | Bacteria | 312126 |
| 567 | Ga0495654_0011993 | 3300046530 | Bacteria | 4671 |
| 568 | Ga0495654_0022625 | 3300046530 | Bacteria | 3261 |
| 569 | Ga0495665_0004802 | 3300046531 | Bacteria | 7298 |
| 570 | Ga0495640_0005911 | 3300046533 | Bacteria | 9704 |
| 571 | Ga0495640_0013075 | 3300046533 | Bacteria | 6321 |
| 572 | Ga0495640_0024651 | 3300046533 | Bacteria | 4374 |
| 573 | Ga0495586_0000624 | 3300046535 | Bacteria | 20417 |
| 574 | Ga0495586_0009851 | 3300046535 | Bacteria | 5087 |
| 575 | Ga0495586_0032785 | 3300046535 | Bacteria | 2786 |
| 576 | Ga0495586_0327673 | 3300046535 | Bacteria | 878 |
| 577 | Ga0495587_0002749 | 3300046536 | Bacteria | 11735 |
| 578 | Ga0495598_0066056 | 3300046537 | Bacteria | 1127 |
| 579 | Ga0495609_0002203 | 3300046538 | Bacteria | 12207 |
| 580 | Ga0495621_0144887 | 3300046539 | Bacteria | 931 |
| 581 | Ga0495597_0000535 | 3300046542 | Bacteria | 31448 |
| 582 | Ga0495597_0001237 | 3300046542 | Bacteria | 18972 |
| 583 | Ga0495645_0000247 | 3300046543 | Bacteria | 39450 |
| 584 | Ga0495622_0000034 | 3300046557 | Bacteria | 123671 |
| 585 | Ga0495622_0000071 | 3300046557 | Bacteria | 89071 |
| 586 | Ga0495622_0031570 | 3300046557 | Bacteria | 2475 |
| 587 | Ga0495622_0342749 | 3300046557 | Bacteria | 647 |
| 588 | Ga0495633_0000086 | 3300046558 | Bacteria | 124357 |
| 589 | Ga0495633_0000217 | 3300046558 | Bacteria | 71892 |
| 590 | Ga0495633_0001397 | 3300046558 | Bacteria | 18813 |
| 591 | Ga0495633_0007711 | 3300046558 | Bacteria | 6157 |
| 592 | Ga0495667_0007160 | 3300046559 | Bacteria | 7569 |
| 593 | Ga0495667_0037931 | 3300046559 | Bacteria | 3210 |
| 594 | Ga0495656_0060460 | 3300046615 | Bacteria | 1651 |
| 595 | Ga0495668_0000308 | 3300046616 | Bacteria | 67599 |
| 596 | Ga0495668_0002035 | 3300046616 | Bacteria | 17616 |
| 597 | Ga0495668_0002147 | 3300046616 | Bacteria | 16956 |
| 598 | Ga0495634_0004588 | 3300046642 | Bacteria | 10791 |
| 599 | Ga0495634_0004750 | 3300046642 | Bacteria | 10569 |
| 600 | Ga0495625_0000447 | 3300046660 | Bacteria | 62017 |
| 601 | Ga0495625_0005159 | 3300046660 | Bacteria | 12053 |
| 602 | Ga0495625_0008737 | 3300046660 | Bacteria | 8587 |
| 603 | Ga0495625_0046579 | 3300046660 | Bacteria | 3128 |
| 604 | Ga0495625_0105079 | 3300046660 | Bacteria | 1935 |
| 605 | Ga0495635_0031638 | 3300046663 | Bacteria | 3672 |
| 606 | Ga0495635_0053171 | 3300046663 | Bacteria | 2790 |
| 607 | Ga0495635_0114624 | 3300046663 | Bacteria | 1840 |
| 608 | Ga0495588_0001603 | 3300046674 | Bacteria | 9665 |
| 609 | Ga0495657_0009194 | 3300046675 | Bacteria | 7501 |
| 610 | Ga0495657_0149832 | 3300046675 | Bacteria | 1449 |
| 611 | Ga0495657_0159736 | 3300046675 | Bacteria | 1395 |
| 612 | Ga0495599_0000345 | 3300046678 | Bacteria | 27538 |
| 613 | Ga0495599_0003076 | 3300046678 | Bacteria | 9713 |
| 614 | Ga0495599_0026190 | 3300046678 | Bacteria | 3654 |
| 615 | Ga0495647_0003049 | 3300046681 | Bacteria | 5338 |
| 616 | Ga0495647_0008774 | 3300046681 | Bacteria | 3404 |
| 617 | Ga0495658_0002606 | 3300046683 | Bacteria | 9064 |
| 618 | Ga0495658_0029738 | 3300046683 | Bacteria | 2960 |
| 619 | Ga0495658_0046930 | 3300046683 | Bacteria | 2430 |
| 620 | Ga0495669_0007028 | 3300046684 | Bacteria | 4712 |
| 621 | Ga0495669_0023987 | 3300046684 | Bacteria | 2658 |
| 622 | Ga0495613_0194236 | 3300046689 | Bacteria | 1433 |
| 623 | Ga0495624_0130294 | 3300046690 | Bacteria | 1542 |
| 624 | Ga0495624_0196387 | 3300046690 | Bacteria | 1226 |
| 625 | Ga0495671_0045889 | 3300046692 | Bacteria | 2186 |
| 626 | Ga0495649_0052695 | 3300046694 | Bacteria | 2204 |
| 627 | Ga0495649_0084220 | 3300046694 | Bacteria | 1698 |
| 628 | Ga0495649_0275169 | 3300046694 | Bacteria | 861 |
| 629 | Ga0495600_0001375 | 3300046809 | Bacteria | 13432 |
| 630 | Ga0495600_0026672 | 3300046809 | Bacteria | 3730 |
| 631 | Ga0495660_0014380 | 3300046810 | Bacteria | 4580 |
| 632 | Ga0495660_0032898 | 3300046810 | Bacteria | 2910 |
| 633 | Ga0495660_0121922 | 3300046810 | Bacteria | 1318 |
| 634 | Ga0495581_0303242 | 3300047315 | Bacteria | 933 |
| 635 | Ga0495581_0337778 | 3300047315 | Bacteria | 879 |
| 636 | Ga0495604_0003259 | 3300047317 | Bacteria | 12969 |
| 637 | Ga0495604_0116248 | 3300047317 | Bacteria | 1942 |
| 638 | Ga0495604_0449448 | 3300047317 | Bacteria | 842 |
| 639 | Ga0495636_0015316 | 3300047318 | Bacteria | 3056 |
| 640 | Ga0495636_0036828 | 3300047318 | Bacteria | 2019 |
| 641 | Ga0495674_0005197 | 3300047319 | Bacteria | 12503 |
| 642 | Ga0495674_0345786 | 3300047319 | Bacteria | 1208 |
| 643 | Ga0495672_0000081 | 3300047320 | Bacteria | 159863 |
| 644 | Ga0495676_0014246 | 3300047321 | Bacteria | 7118 |
| 645 | Ga0495680_0007743 | 3300047322 | Bacteria | 9811 |
| 646 | Ga0495680_0027785 | 3300047322 | Bacteria | 4642 |
| 647 | Ga0495680_0093036 | 3300047322 | Bacteria | 2257 |
| 648 | Ga0495680_0373459 | 3300047322 | Bacteria | 989 |
| 649 | Ga0495687_000172 | 3300047443 | Bacteria | 95963 |
| 650 | Ga0495687_000699 | 3300047443 | Bacteria | 37523 |
| 651 | Ga0495675_0007491 | 3300047444 | Bacteria | 6723 |
| 652 | Ga0495677_0040057 | 3300047445 | Bacteria | 1713 |
| 653 | Ga0495685_029749 | 3300047447 | Bacteria | 1878 |
| 654 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 655 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 656 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 657 | Ga0495681_0029400 | 3300047470 | Bacteria | 2812 |
| 658 | Ga0495684_0004387 | 3300047471 | Bacteria | 11028 |
| 659 | Ga0495686_0000677 | 3300047472 | Bacteria | 46044 |
| 660 | Ga0495686_0128925 | 3300047472 | Bacteria | 1501 |
| 661 | Ga0495686_0201909 | 3300047472 | Bacteria | 1140 |
| 662 | Ga0495593_0096696 | 3300047673 | Bacteria | 1517 |
| 663 | Ga0495614_0117339 | 3300048089 | Bacteria | 1172 |
| 664 | Ga0495615_0021049 | 3300048090 | Bacteria | 1468 |
| 665 | Ga0495615_0058711 | 3300048090 | Bacteria | 1010 |
| 666 | Ga0496102_0000153 | 3300048905 | Bacteria | 94014 |
| 667 | Ga0496102_0111852 | 3300048905 | Bacteria | 2546 |
| 668 | Ga0496103_0033276 | 3300048906 | Bacteria | 3149 |
| 669 | Ga0496107_0052423 | 3300048910 | Bacteria | 2943 |
| 670 | Ga0496116_0020942 | 3300048919 | Bacteria | 4947 |
| 671 | Ga0496116_0021069 | 3300048919 | Bacteria | 4927 |
| 672 | Ga0496116_0033493 | 3300048919 | Bacteria | 3646 |
| 673 | Ga0496117_0000075 | 3300048920 | Bacteria | 232451 |
| 674 | Ga0496118_0000055 | 3300048921 | Bacteria | 232451 |
| 675 | Ga0496121_0013029 | 3300048924 | Bacteria | 8981 |
| 676 | Ga0496121_0044969 | 3300048924 | Bacteria | 3801 |
| 677 | Ga0496121_0143142 | 3300048924 | Bacteria | 1770 |
| 678 | Ga0496122_0000905 | 3300048925 | Bacteria | 54607 |
| 679 | Ga0496122_0003176 | 3300048925 | Bacteria | 21923 |
| 680 | Ga0496122_0083088 | 3300048925 | Bacteria | 2222 |
| 681 | Ga0496123_0000227 | 3300048926 | Bacteria | 113878 |
| 682 | Ga0496123_0008164 | 3300048926 | Bacteria | 9657 |
| 683 | Ga0496123_0009479 | 3300048926 | Bacteria | 8763 |
| 684 | Ga0496124_0071124 | 3300048927 | Bacteria | 2885 |
| 685 | Ga0496125_0004412 | 3300048928 | Bacteria | 16261 |
| 686 | Ga0496125_0081932 | 3300048928 | Bacteria | 2462 |
| 687 | Ga0496126_0062219 | 3300048929 | Bacteria | 3350 |
| 688 | Ga0495678_000027 | 3300049459 | Bacteria | 222075 |
| 689 | Ga0495678_000346 | 3300049459 | Bacteria | 48212 |
| 690 | Ga0495678_072886 | 3300049459 | Bacteria | 1253 |
| 691 | Ga0495682_0000999 | 3300049460 | Bacteria | 16865 |
| 692 | Ga0501298_032199 | 3300049521 | Bacteria | 1034 |
| 693 | Ga0501299_025603 | 3300049522 | Bacteria | 1109 |
| 694 | Ga0501031_0137678 | 3300049568 | Bacteria | 1595 |
| 695 | Ga0501031_0394860 | 3300049568 | Bacteria | 895 |
| 696 | Ga0501032_0022145 | 3300049569 | Bacteria | 4409 |
| 697 | Ga0501033_0027066 | 3300049570 | Bacteria | 4314 |
| 698 | Ga0501036_0028859 | 3300049572 | Bacteria | 4689 |
| 699 | Ga0501036_0034164 | 3300049572 | Bacteria | 4301 |
| 700 | Ga0501036_0096441 | 3300049572 | Bacteria | 2500 |
| 701 | Ga0501036_0125475 | 3300049572 | Bacteria | 2168 |
| 702 | Ga0501036_0259984 | 3300049572 | Bacteria | 1454 |
| 703 | Ga0501036_0423243 | 3300049572 | Bacteria | 1110 |
| 704 | Ga0501038_0012391 | 3300049574 | Bacteria | 7793 |
| 705 | Ga0501038_0018090 | 3300049574 | Bacteria | 6366 |
| 706 | Ga0501038_0134073 | 3300049574 | Bacteria | 2030 |
| 707 | Ga0501039_0004420 | 3300049575 | Bacteria | 10611 |
| 708 | Ga0501039_0020079 | 3300049575 | Bacteria | 5122 |
| 709 | Ga0501039_0028296 | 3300049575 | Bacteria | 4314 |
| 710 | Ga0501039_0028433 | 3300049575 | Bacteria | 4304 |
| 711 | Ga0501039_0104525 | 3300049575 | Bacteria | 2211 |
| 712 | Ga0501039_0402373 | 3300049575 | Bacteria | 1075 |
| 713 | Ga0501039_0421402 | 3300049575 | Bacteria | 1048 |
| 714 | Ga0501039_0451743 | 3300049575 | Bacteria | 1009 |
| 715 | Ga0501040_0003267 | 3300049576 | Bacteria | 10476 |
| 716 | Ga0501040_0049194 | 3300049576 | Bacteria | 2882 |
| 717 | Ga0501040_0188182 | 3300049576 | Bacteria | 1464 |
| 718 | Ga0501040_0212066 | 3300049576 | Bacteria | 1377 |
| 719 | Ga0501040_0233148 | 3300049576 | Bacteria | 1311 |
| 720 | Ga0501040_0492212 | 3300049576 | Bacteria | 884 |
| 721 | Ga0501040_0792258 | 3300049576 | Bacteria | 686 |
| 722 | Ga0501041_0001563 | 3300049577 | Bacteria | 12746 |
| 723 | Ga0501041_0077698 | 3300049577 | Bacteria | 2042 |
| 724 | Ga0501041_0078616 | 3300049577 | Bacteria | 2030 |
| 725 | Ga0501041_0137778 | 3300049577 | Bacteria | 1521 |
| 726 | Ga0501042_0003021 | 3300049578 | Bacteria | 10463 |
| 727 | Ga0501042_0028035 | 3300049578 | Bacteria | 3963 |
| 728 | Ga0501042_0145705 | 3300049578 | Bacteria | 1707 |
| 729 | Ga0501043_0201724 | 3300049579 | Bacteria | 1544 |
| 730 | Ga0501046_0003243 | 3300049580 | Bacteria | 14952 |
| 731 | Ga0501046_0066204 | 3300049580 | Bacteria | 2817 |
| 732 | Ga0501046_0150053 | 3300049580 | Bacteria | 1759 |
| 733 | Ga0501047_0627558 | 3300049581 | Bacteria | 895 |
| 734 | Ga0501048_0037202 | 3300049582 | Bacteria | 3495 |
| 735 | Ga0501048_0049791 | 3300049582 | Bacteria | 2985 |
| 736 | Ga0501048_0137962 | 3300049582 | Bacteria | 1724 |
| 737 | Ga0501068_0002746 | 3300049584 | Bacteria | 9355 |
| 738 | Ga0501068_0017863 | 3300049584 | Bacteria | 4106 |
| 739 | Ga0501068_0212704 | 3300049584 | Bacteria | 1228 |
| 740 | Ga0501069_0467099 | 3300049585 | Bacteria | 751 |
| 741 | Ga0501070_0017200 | 3300049586 | Bacteria | 6070 |
| 742 | Ga0501071_0016570 | 3300049587 | Bacteria | 5070 |
| 743 | Ga0501071_0174342 | 3300049587 | Bacteria | 1610 |
| 744 | Ga0501072_0001241 | 3300049588 | Bacteria | 19034 |
| 745 | Ga0501072_0033082 | 3300049588 | Bacteria | 4051 |
| 746 | Ga0501072_0037703 | 3300049588 | Bacteria | 3791 |
| 747 | Ga0501072_0042063 | 3300049588 | Bacteria | 3589 |
| 748 | Ga0501072_0106886 | 3300049588 | Bacteria | 2226 |
| 749 | Ga0501073_0092142 | 3300049589 | Bacteria | 2106 |
| 750 | Ga0501073_0166125 | 3300049589 | Bacteria | 1528 |
| 751 | Ga0501073_0233571 | 3300049589 | Bacteria | 1270 |
| 752 | Ga0501073_0282222 | 3300049589 | Bacteria | 1146 |
| 753 | Ga0501073_0289539 | 3300049589 | Bacteria | 1130 |
| 754 | Ga0501074_0044148 | 3300049590 | Bacteria | 3227 |
| 755 | Ga0501074_0045115 | 3300049590 | Bacteria | 3189 |
| 756 | Ga0501074_0637043 | 3300049590 | Bacteria | 753 |
| 757 | Ga0501075_0002198 | 3300049591 | Bacteria | 12907 |
| 758 | Ga0501075_0004962 | 3300049591 | Bacteria | 9071 |
| 759 | Ga0501075_0042626 | 3300049591 | Bacteria | 3403 |
| 760 | Ga0501075_0044205 | 3300049591 | Bacteria | 3341 |
| 761 | Ga0501075_0070668 | 3300049591 | Bacteria | 2638 |
| 762 | Ga0501076_0140173 | 3300049592 | Bacteria | 1964 |
| 763 | Ga0501076_0218356 | 3300049592 | Bacteria | 1558 |
| 764 | Ga0501076_0411484 | 3300049592 | Bacteria | 1112 |
| 765 | Ga0501076_0446871 | 3300049592 | Bacteria | 1064 |
| 766 | Ga0501077_0018016 | 3300049593 | Bacteria | 4463 |
| 767 | Ga0501077_0096517 | 3300049593 | Bacteria | 1873 |
| 768 | Ga0501217_068489 | 3300049661 | Bacteria | 962 |
| 769 | Ga0501235_074948 | 3300049669 | Bacteria | 804 |
| 770 | Ga0501236_006844 | 3300049670 | Bacteria | 1411 |
| 771 | Ga0501249_030899 | 3300049679 | Bacteria | 1193 |
| 772 | Ga0501249_056783 | 3300049679 | Bacteria | 904 |
| 773 | Ga0501079_0021474 | 3300049741 | Bacteria | 4939 |
| 774 | Ga0501079_0022439 | 3300049741 | Bacteria | 4840 |
| 775 | Ga0501079_0147299 | 3300049741 | Bacteria | 1835 |
| 776 | Ga0501079_0232064 | 3300049741 | Bacteria | 1441 |
| 777 | Ga0501079_0257772 | 3300049741 | Bacteria | 1363 |
| 778 | Ga0501080_0000634 | 3300049742 | Bacteria | 27899 |
| 779 | Ga0501080_0004675 | 3300049742 | Bacteria | 12215 |
| 780 | Ga0501080_0018543 | 3300049742 | Bacteria | 6438 |
| 781 | Ga0501080_0129192 | 3300049742 | Bacteria | 2339 |
| 782 | Ga0501080_0180518 | 3300049742 | Bacteria | 1943 |
| 783 | Ga0501080_0201540 | 3300049742 | Bacteria | 1827 |
| 784 | Ga0501081_0034464 | 3300049743 | Bacteria | 3444 |
| 785 | Ga0501081_0052616 | 3300049743 | Bacteria | 2811 |
| 786 | Ga0501081_0190171 | 3300049743 | Bacteria | 1486 |
| 787 | Ga0501269_000005 | 3300049766 | Bacteria | 77832 |
| 788 | Ga0501035_0540006 | 3300049822 | Bacteria | 956 |
| 789 | Ga0501045_0033124 | 3300049824 | Bacteria | 3746 |
| 790 | Ga0501045_0042472 | 3300049824 | Bacteria | 3309 |
| 791 | Ga0501045_0146997 | 3300049824 | Bacteria | 1753 |
| 792 | Ga0501045_0246281 | 3300049824 | Bacteria | 1330 |
| 793 | Ga0501045_0802043 | 3300049824 | Bacteria | 693 |
| 794 | nmdc:mga03683_37441_c1 | 3300050489 | Bacteria | 1977 |
| 795 | nmdc:mga00v17_48250_c1 | 3300050491 | Bacteria | 2580 |
| 796 | nmdc:mga00v17_705929_c1 | 3300050491 | Bacteria | 646 |
| 797 | nmdc:mga05p37_389_c1 | 3300050507 | Bacteria | 47594 |
| 798 | nmdc:mga05p37_956513_c1 | 3300050507 | Bacteria | 916 |
| 799 | nmdc:mga09592_166_c1 | 3300050508 | Bacteria | 46469 |
| 800 | nmdc:mga09592_37356_c1 | 3300050508 | Bacteria | 4074 |
| 801 | nmdc:mga09592_60352_c1 | 3300050508 | Bacteria | 3206 |
| 802 | nmdc:mga09592_66351_c1 | 3300050508 | Bacteria | 3059 |
| 803 | nmdc:mga0qj67_110224_c1 | 3300050509 | Bacteria | 2222 |
| 804 | nmdc:mga06r32_182006_c1 | 3300050510 | Bacteria | 2087 |
| 805 | nmdc:mga06r32_628086_c1 | 3300050510 | Bacteria | 1044 |
| 806 | nmdc:mga06r32_846051_c1 | 3300050510 | Bacteria | 874 |
| 807 | nmdc:mga08y16_194690_c1 | 3300050511 | Bacteria | 2102 |
| 808 | nmdc:mga08y16_2159_c1 | 3300050511 | Bacteria | 20171 |
| 809 | nmdc:mga08y16_219039_c1 | 3300050511 | Bacteria | 1971 |
| 810 | nmdc:mga0n895_251343_c1 | 3300050512 | Bacteria | 1794 |
| 811 | nmdc:mga0n895_278079_c1 | 3300050512 | Bacteria | 1698 |
| 812 | nmdc:mga0n895_291533_c1 | 3300050512 | Bacteria | 1654 |
| 813 | nmdc:mga0n895_344472_c1 | 3300050512 | Bacteria | 1509 |
| 814 | nmdc:mga0n895_67926_c1 | 3300050512 | Bacteria | 3531 |
| 815 | nmdc:mga0n895_734_c1 | 3300050512 | Bacteria | 23141 |
| 816 | nmdc:mga0n895_7924_c1 | 3300050512 | Bacteria | 9159 |
| 817 | nmdc:mga0rr50_117062_c1 | 3300050513 | Bacteria | 2116 |
| 818 | nmdc:mga0rr50_120136_c1 | 3300050513 | Bacteria | 2090 |
| 819 | nmdc:mga0rr50_12102_c1 | 3300050513 | Bacteria | 5559 |
| 820 | nmdc:mga0rr50_179807_c1 | 3300050513 | Bacteria | 1728 |
| 821 | nmdc:mga0rr50_2416_c1 | 3300050513 | Bacteria | 10515 |
| 822 | nmdc:mga0rr50_364350_c1 | 3300050513 | Bacteria | 1217 |
| 823 | nmdc:mga0rr50_3670_c1 | 3300050513 | Bacteria | 8893 |
| 824 | nmdc:mga0rr50_373862_c1 | 3300050513 | Bacteria | 1201 |
| 825 | nmdc:mga0rr50_454279_c1 | 3300050513 | Bacteria | 1086 |
| 826 | nmdc:mga0rr50_75238_c1 | 3300050513 | Bacteria | 2588 |
| 827 | nmdc:mga08x19_14881_c1 | 3300050514 | Bacteria | 4725 |
| 828 | nmdc:mga08x19_1688_c1 | 3300050514 | Bacteria | 13577 |
| 829 | nmdc:mga08x19_175777_c1 | 3300050514 | Bacteria | 1460 |
| 830 | nmdc:mga08x19_258_c1 | 3300050514 | Bacteria | 28365 |
| 831 | nmdc:mga08x19_259714_c1 | 3300050514 | Bacteria | 1200 |
| 832 | nmdc:mga08x19_41284_c1 | 3300050514 | Bacteria | 2938 |
| 833 | nmdc:mga08x19_431957_c1 | 3300050514 | Bacteria | 926 |
| 834 | nmdc:mga08x19_43525_c1 | 3300050514 | Bacteria | 2865 |
| 835 | nmdc:mga08x19_759_c1 | 3300050514 | Bacteria | 20607 |
| 836 | nmdc:mga08x19_7654_c1 | 3300050514 | Bacteria | 6416 |
| 837 | nmdc:mga0a205_17979_c1 | 3300050515 | Bacteria | 6639 |
| 838 | nmdc:mga0a205_348268_c1 | 3300050515 | Bacteria | 1349 |
| 839 | nmdc:mga0a205_484503_c1 | 3300050515 | Bacteria | 1095 |
| 840 | nmdc:mga0a205_747479_c1 | 3300050515 | Bacteria | 827 |
| 841 | Ga0495601_0003245 | 3300053077 | Bacteria | 9294 |
| 842 | Ga0495601_0021328 | 3300053077 | Bacteria | 3967 |
| 843 | Ga0495601_0058084 | 3300053077 | Bacteria | 2451 |
| 844 | Ga0495601_0586061 | 3300053077 | Bacteria | 716 |
| 845 | Ga0495612_0045727 | 3300053078 | Bacteria | 1792 |
| 846 | Ga0495595_0000266 | 3300053084 | Bacteria | 20675 |
| 847 | Ga0500618_000170 | 3300053125 | Bacteria | 54570 |
| 848 | Ga0500586_017123 | 3300053145 | Bacteria | 2212 |
| 849 | Ga0501084_0005520 | 3300054114 | Bacteria | 10383 |
| 850 | Ga0501084_0006302 | 3300054114 | Bacteria | 9749 |
| 851 | Ga0501084_0493841 | 3300054114 | Bacteria | 1034 |
| 852 | Ga0590071_021793 | 3300059421 | Bacteria | 1511 |
| 853 | Ga0501082_0000750 | 3300060353 | Bacteria | 28493 |
| 854 | Ga0501082_0814886 | 3300060353 | Bacteria | 817 |
| 855 | Ga0530510_0000245 | 3300061734 | Bacteria | 34065 |
| 856 | Ga0530510_0004031 | 3300061734 | Bacteria | 10140 |
| 857 | Ga0530510_0015381 | 3300061734 | Bacteria | 5407 |
| 858 | Ga0530510_0348995 | 3300061734 | Bacteria | 1111 |
| 859 | 2511249690 | 2511231003 | Bacteria | 5606035 |
| 860 | 2550695170 | 2548876994 | Bacteria | 4904866 |
| 861 | 2554818193 | 2554235132 | Bacteria | 6772433 |
| 862 | 2601666856 | 2600255292 | Bacteria | 6300551 |
| 863 | 2608380509 | 2606217733 | Bacteria | 6360972 |
| 864 | 2738826215 | 2738541297 | Bacteria | 6549566 |
| 865 | 2739150012 | 2738541357 | Bacteria | 6549408 |
| 866 | 2739191931 | 2738543003 | Bacteria | 6549560 |
| 867 | 2739318408 | 2738543026 | Bacteria | 6549408 |
| 868 | 2739336649 | 2738543029 | Bacteria | 6549249 |
| 869 | 2819592776 | 2818991445 | Bacteria | 4955017 |
| 870 | 2821134982 | 2821131069 | Bacteria | 6108407 |
| 871 | 2842715841 | 2842711865 | Bacteria | 7155354 |
| 872 | 2857552751 | 2857547612 | Bacteria | 6179999 |
| 873 | 2857558119 | 2857553236 | Bacteria | 6166726 |
| 874 | 2857558768 | 2857558681 | Bacteria | 6617694 |
| 875 | 2857569645 | 2857564685 | Bacteria | 6290584 |
| 876 | 2884815960 | 2884811622 | Bacteria | 5552861 |
| 877 | 2884838657 | 2884836552 | Bacteria | 5219991 |
| 878 | 2884854948 | 2884852848 | Bacteria | 5221161 |
| 879 | 2885086331 | 2885080285 | Bacteria | 6355622 |
| 880 | 2896156383 | 2896154374 | Bacteria | 5221518 |
| 881 | 2904428346 | 2904424332 | Bacteria | 7633521 |
| 882 | 2919049068 | 2919046199 | Bacteria | 5567169 |
| 883 | 2919476427 | 2919476304 | Bacteria | 5888696 |
| 884 | 2932415678 | 2932410948 | Bacteria | 6312192 |
| 885 | 2932421668 | 2932416698 | Bacteria | 6315112 |
| 886 | 2952255907 | 2952252522 | Bacteria | 4171745 |
| 887 | Ga0081538_10154911 | |||
| 888 | JGI25155J39150_1000252 | |||
| 889 | JGI25155J39150_1000471 | |||
| 890 | JGI25156J39149_1000288 | |||
| 891 | JGI25156J39149_1004072 | |||
| 892 | JGI25154J39366_1000311 | |||
| 893 | JGI25154J39366_1000313 | |||
| 894 | JGI25157J39369_1000171 | |||
| 895 | JGI25150J39212_1001839 | |||
| 896 | JGI25151J46595_10051050 | |||
| 897 | Ga0007417J51691_1079838 | |||
| 898 | Ga0055532_1000044 | |||
| 899 | Ga0055535_1006487 | |||
| 900 | Ga0055529_1000015 | |||
| 901 | Ga0055526_1000007 | |||
| 902 | Ga0055526_1000037 | |||
| 903 | Ga0065714_10176867 | |||
| 904 | Ga0065714_10183074 | |||
| 905 | Ga0065707_10028354 | |||
| 906 | Ga0065707_10093232 | |||
| 907 | Ga0065707_10146765 | |||
| 908 | Ga0070676_10100527 | |||
| 909 | Ga0070690_100000183 | |||
| 910 | Ga0070690_100028668 | |||
| 911 | Ga0068869_100000139 | |||
| 912 | Ga0070666_10261455 | |||
| 913 | Ga0070680_100000688 | |||
| 914 | Ga0070680_100328147 | |||
| 915 | Ga0070680_100435945 | |||
| 916 | Ga0070682_100059915 | |||
| 917 | Ga0068868_100000115 | |||
| 918 | Ga0070689_100001743 | |||
| 919 | Ga0070689_100052931 | |||
| 920 | Ga0070689_100463101 | |||
| 921 | Ga0070691_10008416 | |||
| 922 | Ga0070691_10163927 | |||
| 923 | Ga0070687_100000091 | |||
| 924 | Ga0070687_100057792 | |||
| 925 | Ga0070687_100064050 | |||
| 926 | Ga0070687_100099246 | |||
| 927 | Ga0070692_10304212 | |||
| 928 | Ga0070668_100051434 | |||
| 929 | Ga0070675_100165495 | |||
| 930 | Ga0070675_100663011 | |||
| 931 | Ga0070674_100088353 | |||
| 932 | Ga0070659_100082251 | |||
| 933 | Ga0070703_10007089 | |||
| 934 | Ga0070709_10180189 | |||
| 935 | Ga0070701_10778781 | |||
| 936 | Ga0070705_100000441 | |||
| 937 | Ga0070705_100100728 | |||
| 938 | Ga0070705_100441138 | |||
| 939 | Ga0070700_100001332 | |||
| 940 | Ga0070700_100002644 | |||
| 941 | Ga0070700_100114033 | |||
| 942 | Ga0070694_100000133 | |||
| 943 | Ga0070694_100018018 | |||
| 944 | Ga0070694_100028039 | |||
| 945 | Ga0070694_100044368 | |||
| 946 | Ga0070694_100071913 | |||
| 947 | Ga0070694_100203836 | |||
| 948 | Ga0070694_100243243 | |||
| 949 | Ga0070694_100281743 | |||
| 950 | Ga0070694_100359985 | |||
| 951 | Ga0070694_100646632 | |||
| 952 | Ga0070708_100105538 | |||
| 953 | Ga0070681_10000081 | |||
| 954 | Ga0070681_10018249 | |||
| 955 | Ga0070681_10153316 | |||
| 956 | Ga0070681_10195826 | |||
| 957 | Ga0068867_100000084 | |||
| 958 | Ga0068867_100002479 | |||
| 959 | Ga0070706_100076438 | |||
| 960 | Ga0070707_100026726 | |||
| 961 | Ga0070698_101290778 | |||
| 962 | Ga0070699_100050684 | |||
| 963 | Ga0070679_100042718 | |||
| 964 | Ga0070679_100155414 | |||
| 965 | Ga0070684_100202324 | |||
| 966 | Ga0070697_100000299 | |||
| 967 | Ga0070697_100004807 | |||
| 968 | Ga0070697_100211102 | |||
| 969 | Ga0068853_100058101 | |||
| 970 | Ga0070672_100504943 | |||
| 971 | Ga0070686_100000193 | |||
| 972 | Ga0070686_100139498 | |||
| 973 | Ga0070686_100242193 | |||
| 974 | Ga0070695_100000163 | |||
| 975 | Ga0070695_100006828 | |||
| 976 | Ga0070695_100027364 | |||
| 977 | Ga0070695_100087620 | |||
| 978 | Ga0070695_100098397 | |||
| 979 | Ga0070695_100110894 | |||
| 980 | Ga0070696_100000570 | |||
| 981 | Ga0070696_100004599 | |||
| 982 | Ga0070696_100013604 | |||
| 983 | Ga0070696_100215508 | |||
| 984 | Ga0070693_100000111 | |||
| 985 | Ga0070704_100000008 | |||
| 986 | Ga0070704_100182942 | |||
| 987 | Ga0068855_100000242 | |||
| 988 | Ga0068855_100152556 | |||
| 989 | Ga0068855_100211348 | |||
| 990 | Ga0068854_100006366 | |||
| 991 | Ga0068856_100160335 | |||
| 992 | Ga0068856_100423008 | |||
| 993 | Ga0070702_100000012 | |||
| 994 | Ga0068852_100269519 | |||
| 995 | Ga0068852_100756740 | |||
| 996 | Ga0068859_100005212 | |||
| 997 | Ga0068859_100547586 | |||
| 998 | Ga0068864_100059830 | |||
| 999 | Ga0068864_100254119 | |||
| 1000 | Ga0068866_10000109 | |||
| 1001 | Ga0068861_100000814 | |||
| 1002 | Ga0068861_100011165 | |||
| 1003 | Ga0068870_10095558 | |||
| 1004 | Ga0068870_10135470 | |||
| 1005 | Ga0068858_100023814 | |||
| 1006 | Ga0068858_100381916 | |||
| 1007 | Ga0068862_100002876 | |||
| 1008 | Ga0068862_100008234 | |||
| 1009 | Ga0075364_10346816 | |||
| 1010 | Ga0075364_10745886 | |||
| 1011 | Ga0070715_10132417 | |||
| 1012 | Ga0070716_100026868 | |||
| 1013 | Ga0070716_100168241 | |||
| 1014 | Ga0070716_100292238 | |||
| 1015 | Ga0070716_100747894 | |||
| 1016 | Ga0075362_10008204 | |||
| 1017 | Ga0097621_100003524 | |||
| 1018 | Ga0097621_100028427 | |||
| 1019 | Ga0068871_100000559 | |||
| 1020 | Ga0068871_100014580 | |||
| 1021 | Ga0075428_100033964 | |||
| 1022 | Ga0075428_100664862 | |||
| 1023 | Ga0075430_100006977 | |||
| 1024 | Ga0075430_100977377 | |||
| 1025 | Ga0075431_100247744 | |||
| 1026 | Ga0075433_10006494 | |||
| 1027 | Ga0075433_10283872 | |||
| 1028 | Ga0075434_100000079 | |||
| 1029 | Ga0075434_100001287 | |||
| 1030 | Ga0075434_100020461 | |||
| 1031 | Ga0075434_100214916 | |||
| 1032 | Ga0075434_100247060 | |||
| 1033 | Ga0075434_100501681 | |||
| 1034 | Ga0075434_100813005 | |||
| 1035 | Ga0075429_100000891 | |||
| 1036 | Ga0075429_100048189 | |||
| 1037 | Ga0075429_100067097 | |||
| 1038 | Ga0068865_100002206 | |||
| 1039 | Ga0068865_100004107 | |||
| 1040 | Ga0075436_100000789 | |||
| 1041 | Ga0075436_100008442 | |||
| 1042 | Ga0075436_100027934 | |||
| 1043 | Ga0075436_100135911 | |||
| 1044 | Ga0075436_100228214 | |||
| 1045 | Ga0075436_100494859 | |||
| 1046 | Ga0097620_100005212 | |||
| 1047 | Ga0097620_100547583 | |||
| 1048 | Ga0079104_1011322 | |||
| 1049 | Ga0075435_100000655 | |||
| 1050 | Ga0075435_100003904 | |||
| 1051 | Ga0075435_100010489 | |||
| 1052 | Ga0075435_100083036 | |||
| 1053 | Ga0075435_100095897 | |||
| 1054 | Ga0075435_100222527 | |||
| 1055 | Ga0075435_100271705 | |||
| 1056 | Ga0075435_100468995 | |||
| 1057 | Ga0099794_10121695 | |||
| 1058 | Ga0099795_10055246 | |||
| 1059 | Ga0105244_10000412 | |||
| 1060 | Ga0105244_10041635 | |||
| 1061 | Ga0105244_10304845 | |||
| 1062 | Ga0105250_10146464 | |||
| 1063 | Ga0105240_10007532 | |||
| 1064 | Ga0105240_10026536 | |||
| 1065 | Ga0105240_10316720 | |||
| 1066 | Ga0111539_10011985 | |||
| 1067 | Ga0111539_10013498 | |||
| 1068 | Ga0111539_10029705 | |||
| 1069 | Ga0111539_10613481 | |||
| 1070 | Ga0105245_10000245 | |||
| 1071 | Ga0105245_10026778 | |||
| 1072 | Ga0114129_10000219 | |||
| 1073 | Ga0114129_10241959 | |||
| 1074 | Ga0114129_10418725 | |||
| 1075 | Ga0114129_11276693 | |||
| 1076 | Ga0114129_11552568 | |||
| 1077 | Ga0105243_10000279 | |||
| 1078 | Ga0105241_10062959 | |||
| 1079 | Ga0105242_10000480 | |||
| 1080 | Ga0105242_10046492 | |||
| 1081 | Ga0105242_10156759 | |||
| 1082 | Ga0105248_10502895 | |||
| 1083 | Ga0105237_10181974 | |||
| 1084 | Ga0105238_10047036 | |||
| 1085 | Ga0105249_10007151 | |||
| 1086 | Ga0105249_10086025 | |||
| 1087 | Ga0099796_10035086 | |||
| 1088 | Ga0157373_10220548 | |||
| 1089 | Ga0157378_10000294 | |||
| 1090 | Ga0163162_10101727 | |||
| 1091 | Ga0157372_10961460 | |||
| 1092 | Ga0163163_11624610 | |||
| 1093 | Ga0157380_10284264 | |||
| 1094 | Ga0182008_10000609 | |||
| 1095 | Ga0157377_10004975 | |||
| 1096 | Ga0157379_10029733 | |||
| 1097 | Ga0157379_10169377 | |||
| 1098 | Ga0157376_10002130 | |||
| 1099 | Ga0182006_1000023 | |||
| 1100 | Ga0182006_1000125 | |||
| 1101 | Ga0182006_1009055 | |||
| 1102 | Ga0182007_10000082 | |||
| 1103 | Ga0182005_1000006 | |||
| 1104 | Ga0182005_1000047 | |||
| 1105 | Ga0163161_10013268 | |||
| 1106 | Ga0163161_10070329 | |||
| 1107 | Ga0163161_10607694 | |||
| 1108 | Ga0213872_10079118 | |||
| 1109 | Ga0213872_10199498 | |||
| 1110 | Ga0209435_100004 | |||
| 1111 | Ga0209435_100168 | |||
| 1112 | Ga0209147_100011 | |||
| 1113 | Ga0209437_100207 | |||
| 1114 | Ga0209258_100279 | |||
| 1115 | Ga0207425_1000176 | |||
| 1116 | Ga0209646_1000125 | |||
| 1117 | Ga0209646_1000140 | |||
| 1118 | Ga0209646_1000205 | |||
| 1119 | Ga0209026_1000066 | |||
| 1120 | Ga0209026_1002319 | |||
| 1121 | Ga0209026_1030661 | |||
| 1122 | Ga0209148_1013906 | |||
| 1123 | Ga0209759_1000114 | |||
| 1124 | Ga0209759_1000961 | |||
| 1125 | Ga0209233_1020816 | |||
| 1126 | Ga0209455_1000031 | |||
| 1127 | Ga0209455_1004399 | |||
| 1128 | Ga0209025_1003577 | |||
| 1129 | Ga0209564_1000010 | |||
| 1130 | Ga0209564_1000042 | |||
| 1131 | Ga0209758_1000433 | |||
| 1132 | Ga0207655_1001385 | |||
| 1133 | Ga0207655_1005830 | |||
| 1134 | Ga0207713_1026364 | |||
| 1135 | Ga0207653_10025685 | |||
| 1136 | Ga0207642_10004540 | |||
| 1137 | Ga0207688_10034174 | |||
| 1138 | Ga0207647_10068324 | |||
| 1139 | Ga0207684_10011988 | |||
| 1140 | Ga0207684_10849722 | |||
| 1141 | Ga0207654_10002619 | |||
| 1142 | Ga0207707_10007590 | |||
| 1143 | Ga0207707_10179483 | |||
| 1144 | Ga0207707_10221069 | |||
| 1145 | Ga0207695_10007348 | |||
| 1146 | Ga0207671_10111165 | |||
| 1147 | Ga0207671_10164735 | |||
| 1148 | Ga0207663_10309528 | |||
| 1149 | Ga0207660_10002762 | |||
| 1150 | Ga0207660_10051323 | |||
| 1151 | Ga0207660_10418387 | |||
| 1152 | Ga0207662_10000176 | |||
| 1153 | Ga0207662_10020338 | |||
| 1154 | Ga0207662_10031534 | |||
| 1155 | Ga0207662_10673954 | |||
| 1156 | Ga0207652_10005421 | |||
| 1157 | Ga0207652_10096934 | |||
| 1158 | Ga0207646_10022393 | |||
| 1159 | Ga0207646_10034021 | |||
| 1160 | Ga0207681_10074197 | |||
| 1161 | Ga0207694_10509441 | |||
| 1162 | Ga0207659_10008745 | |||
| 1163 | Ga0207659_10430550 | |||
| 1164 | Ga0207659_10854406 | |||
| 1165 | Ga0207687_10001352 | |||
| 1166 | Ga0207687_10058530 | |||
| 1167 | Ga0207686_10000627 | |||
| 1168 | Ga0207686_10128102 | |||
| 1169 | Ga0207709_10000549 | |||
| 1170 | Ga0207709_10009164 | |||
| 1171 | Ga0207670_10039886 | |||
| 1172 | Ga0207670_10043125 | |||
| 1173 | Ga0207669_10317121 | |||
| 1174 | Ga0207704_10000329 | |||
| 1175 | Ga0207704_10018414 | |||
| 1176 | Ga0207665_10007215 | |||
| 1177 | Ga0207665_10136089 | |||
| 1178 | Ga0207665_10161652 | |||
| 1179 | Ga0207691_10120139 | |||
| 1180 | Ga0207711_10434006 | |||
| 1181 | Ga0207661_10090479 | |||
| 1182 | Ga0207712_10022192 | |||
| 1183 | Ga0207668_10016248 | |||
| 1184 | Ga0207640_10033700 | |||
| 1185 | Ga0207677_10000669 | |||
| 1186 | Ga0207677_10059997 | |||
| 1187 | Ga0207677_10699518 | |||
| 1188 | Ga0207703_10005933 | |||
| 1189 | Ga0207703_10029223 | |||
| 1190 | Ga0207639_10040826 | |||
| 1191 | Ga0207708_10000275 | |||
| 1192 | Ga0207708_10037205 | |||
| 1193 | Ga0207708_10411784 | |||
| 1194 | Ga0207702_10071848 | |||
| 1195 | Ga0207648_10000185 | |||
| 1196 | Ga0207648_10001654 | |||
| 1197 | Ga0207676_10567431 | |||
| 1198 | Ga0207674_10103608 | |||
| 1199 | Ga0207675_100000150 | |||
| 1200 | Ga0207675_100080942 | |||
| 1201 | Ga0207683_10115993 | |||
| 1202 | Ga0207698_10267892 | |||
| 1203 | Ga0207698_10283503 | |||
| 1204 | Ga0209281_1003338 | |||
| 1205 | Ga0209969_1002680 | |||
| 1206 | Ga0209969_1012340 | |||
| 1207 | Ga0209967_1000561 | |||
| 1208 | Ga0209967_1003478 | |||
| 1209 | Ga0210000_1000970 | |||
| 1210 | Ga0210000_1001740 | |||
| 1211 | Ga0209995_1001745 | |||
| 1212 | Ga0209179_1004916 | |||
| 1213 | Ga0209968_1004125 | |||
| 1214 | Ga0209999_1005018 | |||
| 1215 | Ga0209999_1017181 | |||
| 1216 | Ga0209588_1007435 | |||
| 1217 | Ga0209971_1081568 | |||
| 1218 | Ga0209966_1004277 | |||
| 1219 | Ga0209974_10016022 | |||
| 1220 | Ga0207428_10000290 | |||
| 1221 | Ga0207428_10025385 | |||
| 1222 | Ga0207428_10047565 | |||
| 1223 | Ga0207428_10063834 | |||
| 1224 | Ga0207428_10496211 | |||
| 1225 | Ga0268265_10001010 | |||
| 1226 | Ga0268265_10008669 | |||
| 1227 | Ga0307517_10206767 | |||
| 1228 | Ga0307515_10139635 | |||
| 1229 | Ga0316181_1151886 | |||
| 1230 | Ga0307408_100066343 | |||
| 1231 | Ga0307408_100299524 | |||
| 1232 | Ga0316575_10001586 | |||
| 1233 | Ga0316575_10003078 | |||
| 1234 | Ga0316575_10133838 | |||
| 1235 | Ga0316579_10006383 | |||
| 1236 | Ga0265314_10023239 | |||
| 1237 | Ga0316578_10006914 | |||
| 1238 | Ga0316578_10019153 | |||
| 1239 | Ga0307405_10003031 | |||
| 1240 | Ga0316577_10011728 | |||
| 1241 | Ga0316577_10145427 | |||
| 1242 | Ga0307413_10103949 | |||
| 1243 | Ga0307410_10000539 | |||
| 1244 | Ga0307406_10014860 | |||
| 1245 | Ga0307407_10069599 | |||
| 1246 | Ga0307412_10019535 | |||
| 1247 | Ga0307416_100141028 | |||
| 1248 | Ga0307416_100273486 | |||
| 1249 | Ga0307416_100484985 | |||
| 1250 | Ga0307416_100765238 | |||
| 1251 | Ga0307416_100828917 | |||
| 1252 | Ga0307416_100989201 | |||
| 1253 | Ga0307416_101753204 | |||
| 1254 | Ga0307411_10062647 | |||
| 1255 | Ga0307411_10648036 | |||
| 1256 | Ga0307415_100045681 | |||
| 1257 | Ga0316583_10131148 | |||
| 1258 | Ga0316585_10047728 | |||
| 1259 | Ga0316580_10020002 | |||
| 1260 | Ga0316593_10008065 | |||
| 1261 | Ga0373934_0000524 | |||
| 1262 | Ga0373934_0003529 | |||
| 1263 | Ga0373934_0027468 | |||
| 1264 | Ga0373944_0000909 | |||
| 1265 | Ga0373949_0009770 | |||
| 1266 | Ga0373952_0010157 | |||
| 1267 | Ga0373923_0001446 | |||
| 1268 | Ga0373923_0022790 | |||
| 1269 | Ga0373936_0003119 | |||
| 1270 | Ga0373936_0011164 | |||
| 1271 | Ga0373936_0110585 | |||
| 1272 | Ga0373939_0003574 | |||
| 1273 | Ga0373939_0041704 | |||
| 1274 | Ga0373941_0038627 | |||
| 1275 | Ga0373941_0049333 | |||
| 1276 | Ga0373953_0022814 | |||
| 1277 | Ga0373954_0002148 | |||
| 1278 | Ga0373954_0037910 | |||
| 1279 | Ga0373956_0000135 | |||
| 1280 | Ga0373956_0010109 | |||
| 1281 | Ga0373957_0007330 | |||
| 1282 | Ga0373957_0008551 | |||
| 1283 | Ga0373960_0108099 | |||
| 1284 | Ga0373960_0108280 | |||
| 1285 | Ga0373943_0110815 | |||
| 1286 | Ga0373946_0057881 | |||
| 1287 | Ga0373946_0063474 | |||
| 1288 | Ga0373955_0007893 | |||
| 1289 | Ga0373955_0068738 | |||
| 1290 | Ga0373955_0261814 | |||
| 1291 | Ga0373942_0025084 | |||
| 1292 | Ga0373942_0084666 | |||
| 1293 | Ga0373961_0004525 | |||
| 1294 | Ga0373961_0026789 | |||
| 1295 | Ga0373961_0036263 | |||
| 1296 | Ga0373962_0001944 | |||
| 1297 | Ga0316574_0002868 | |||
| 1298 | Ga0316574_0064011 | |||
| 1299 | Ga0316574_0122577 | |||
| 1300 | Ga0373924_0024443 | |||
| 1301 | Ga0373924_0047708 | |||
| 1302 | Ga0373924_0196319 | |||
| 1303 | Ga0373924_0269742 | |||
| 1304 | Ga0373931_0000163 | |||
| 1305 | Ga0373931_0020082 | |||
| 1306 | Ga0373931_0184591 | |||
| 1307 | Ga0373931_0482561 | |||
| 1308 | Ga0373935_0046669 | |||
| 1309 | Ga0373935_0118923 | |||
| 1310 | Ga0373935_0646776 | |||
| 1311 | Ga0373927_0018600 | |||
| 1312 | Ga0373933_0002313 | |||
| 1313 | Ga0373933_0008376 | |||
| 1314 | Ga0373933_0070820 | |||
| 1315 | Ga0373933_0627181 | |||
| 1316 | Ga0373947_0032914 | |||
| 1317 | Ga0373947_0139496 | |||
| 1318 | Ga0373947_0156143 | |||
| 1319 | Ga0373947_0175104 | |||
| 1320 | Ga0373937_0001313 | |||
| 1321 | Ga0373937_0033470 | |||
| 1322 | Ga0373937_0067095 | |||
| 1323 | Ga0373937_0076864 | |||
| 1324 | Ga0373937_0140242 | |||
| 1325 | Ga0373937_0172469 | |||
| 1326 | Ga0373937_0209683 | |||
| 1327 | Ga0316582_0014225 | |||
| 1328 | Ga0316582_0023391 | |||
| 1329 | Ga0316584_0231204 | |||
| 1330 | Ga0373925_0025897 | |||
| 1331 | Ga0373925_0108840 | |||
| 1332 | Ga0316581_0003333 | |||
| 1333 | Ga0436360_1247629 | |||
| 1334 | Ga0436361_0031960 | |||
| 1335 | Ga0436361_0183378 | |||
| 1336 | Ga0436361_0224368 | |||
| 1337 | Ga0436361_0475359 | |||
| 1338 | Ga0439439_0092299 | |||
| 1339 | Ga0439453_0003405 | |||
| 1340 | Ga0439466_0071477 | |||
| 1341 | Ga0451800_1368170 | |||
| 1342 | Ga0451853_2519352 | |||
| 1343 | Ga0439441_001220 | |||
| 1344 | Ga0439441_008765 | |||
| 1345 | Ga0439451_010902 | |||
| 1346 | Ga0439454_014529 | |||
| 1347 | Ga0439446_0008714 | |||
| 1348 | Ga0439446_0042915 | |||
| 1349 | Ga0439434_0000867 | |||
| 1350 | Ga0439434_0045763 | |||
| 1351 | Ga0439435_0000145 | |||
| 1352 | Ga0439435_0002402 | |||
| 1353 | Ga0439435_0024654 | |||
| 1354 | Ga0439444_0016130 | |||
| 1355 | Ga0439460_0000484 | |||
| 1356 | Ga0439460_0070741 | |||
| 1357 | Ga0450893_0059299 | |||
| 1358 | Ga0451577_0021757 | |||
| 1359 | Ga0453684_0002459 | |||
| 1360 | Ga0466960_0165918 | |||
| 1361 | Ga0451576_0001107 | |||
| 1362 | Ga0451576_0008931 | |||
| 1363 | Ga0451576_0079706 | |||
| 1364 | Ga0451576_0104634 | |||
| 1365 | Ga0451576_0107249 | |||
| 1366 | Ga0451576_0116553 | |||
| 1367 | Ga0495617_000020 | |||
| 1368 | Ga0495627_000004 | |||
| 1369 | Ga0495627_016628 | |||
| 1370 | Ga0495592_0010390 | |||
| 1371 | Ga0495592_0014005 | |||
| 1372 | Ga0495592_0029825 | |||
| 1373 | Ga0495592_0126836 | |||
| 1374 | Ga0495603_0317435 | |||
| 1375 | Ga0495590_0000012 | |||
| 1376 | Ga0495629_0213540 | |||
| 1377 | Ga0495638_0000047 | |||
| 1378 | Ga0495638_0112350 | |||
| 1379 | Ga0495638_0123734 | |||
| 1380 | Ga0495641_0003418 | |||
| 1381 | Ga0495651_0000274 | |||
| 1382 | Ga0495651_0001676 | |||
| 1383 | Ga0495651_0385390 | |||
| 1384 | Ga0495653_0000035 | |||
| 1385 | Ga0495653_0005409 | |||
| 1386 | Ga0495650_0000128 | |||
| 1387 | Ga0495650_0000157 | |||
| 1388 | Ga0495650_0000261 | |||
| 1389 | Ga0495650_0002873 | |||
| 1390 | Ga0495650_0015617 | |||
| 1391 | Ga0495650_0029788 | |||
| 1392 | Ga0495580_0011719 | |||
| 1393 | Ga0495580_0045545 | |||
| 1394 | Ga0495582_0018307 | |||
| 1395 | Ga0495605_0000018 | |||
| 1396 | Ga0495639_0002991 | |||
| 1397 | Ga0495639_0021855 | |||
| 1398 | Ga0495639_0025710 | |||
| 1399 | Ga0495662_0040946 | |||
| 1400 | Ga0495662_0309770 | |||
| 1401 | Ga0495664_0499015 | |||
| 1402 | Ga0495584_0201659 | |||
| 1403 | Ga0495585_0006253 | |||
| 1404 | Ga0495607_0006186 | |||
| 1405 | Ga0495607_0007691 | |||
| 1406 | Ga0495607_0102330 | |||
| 1407 | Ga0495583_0002050 | |||
| 1408 | Ga0495606_0000288 | |||
| 1409 | Ga0495606_0000512 | |||
| 1410 | Ga0495606_0000790 | |||
| 1411 | Ga0495606_0001762 | |||
| 1412 | Ga0495606_0001799 | |||
| 1413 | Ga0495606_0004472 | |||
| 1414 | Ga0495606_0059541 | |||
| 1415 | Ga0495608_0000767 | |||
| 1416 | Ga0495608_0007610 | |||
| 1417 | Ga0495608_0358870 | |||
| 1418 | Ga0495608_0410027 | |||
| 1419 | Ga0495608_0480883 | |||
| 1420 | Ga0495610_0000014 | |||
| 1421 | Ga0495610_0018280 | |||
| 1422 | Ga0495610_0077986 | |||
| 1423 | Ga0495618_0085019 | |||
| 1424 | Ga0495618_0142955 | |||
| 1425 | Ga0495628_0003354 | |||
| 1426 | Ga0495628_0009437 | |||
| 1427 | Ga0495628_0029940 | |||
| 1428 | Ga0495628_0033466 | |||
| 1429 | Ga0495628_0249247 | |||
| 1430 | Ga0495630_0010824 | |||
| 1431 | Ga0495630_0153015 | |||
| 1432 | Ga0495630_0308259 | |||
| 1433 | Ga0495630_0460573 | |||
| 1434 | Ga0495637_0000142 | |||
| 1435 | Ga0495637_0003152 | |||
| 1436 | Ga0495643_0000082 | |||
| 1437 | Ga0495643_0000160 | |||
| 1438 | Ga0495643_0087501 | |||
| 1439 | Ga0495644_0255344 | |||
| 1440 | Ga0495648_0000019 | |||
| 1441 | Ga0495648_0013458 | |||
| 1442 | Ga0495648_0085582 | |||
| 1443 | Ga0495666_0003438 | |||
| 1444 | Ga0495666_0005319 | |||
| 1445 | Ga0495666_0012214 | |||
| 1446 | Ga0495642_0000449 | |||
| 1447 | Ga0495642_0056212 | |||
| 1448 | Ga0495652_0002976 | |||
| 1449 | Ga0495652_0105783 | |||
| 1450 | Ga0495652_0189848 | |||
| 1451 | Ga0495652_0291170 | |||
| 1452 | Ga0495654_0000014 | |||
| 1453 | Ga0495654_0011993 | |||
| 1454 | Ga0495654_0022625 | |||
| 1455 | Ga0495665_0004802 | |||
| 1456 | Ga0495640_0005911 | |||
| 1457 | Ga0495640_0013075 | |||
| 1458 | Ga0495640_0024651 | |||
| 1459 | Ga0495586_0000624 | |||
| 1460 | Ga0495586_0009851 | |||
| 1461 | Ga0495586_0032785 | |||
| 1462 | Ga0495586_0327673 | |||
| 1463 | Ga0495587_0002749 | |||
| 1464 | Ga0495598_0066056 | |||
| 1465 | Ga0495609_0002203 | |||
| 1466 | Ga0495621_0144887 | |||
| 1467 | Ga0495597_0000535 | |||
| 1468 | Ga0495597_0001237 | |||
| 1469 | Ga0495645_0000247 | |||
| 1470 | Ga0495622_0000034 | |||
| 1471 | Ga0495622_0000071 | |||
| 1472 | Ga0495622_0031570 | |||
| 1473 | Ga0495622_0342749 | |||
| 1474 | Ga0495633_0000086 | |||
| 1475 | Ga0495633_0000217 | |||
| 1476 | Ga0495633_0001397 | |||
| 1477 | Ga0495633_0007711 | |||
| 1478 | Ga0495667_0007160 | |||
| 1479 | Ga0495667_0037931 | |||
| 1480 | Ga0495656_0060460 | |||
| 1481 | Ga0495668_0000308 | |||
| 1482 | Ga0495668_0002035 | |||
| 1483 | Ga0495668_0002147 | |||
| 1484 | Ga0495634_0004588 | |||
| 1485 | Ga0495634_0004750 | |||
| 1486 | Ga0495625_0000447 | |||
| 1487 | Ga0495625_0005159 | |||
| 1488 | Ga0495625_0008737 | |||
| 1489 | Ga0495625_0046579 | |||
| 1490 | Ga0495625_0105079 | |||
| 1491 | Ga0495635_0031638 | |||
| 1492 | Ga0495635_0053171 | |||
| 1493 | Ga0495635_0114624 | |||
| 1494 | Ga0495588_0001603 | |||
| 1495 | Ga0495657_0009194 | |||
| 1496 | Ga0495657_0149832 | |||
| 1497 | Ga0495657_0159736 | |||
| 1498 | Ga0495599_0000345 | |||
| 1499 | Ga0495599_0003076 | |||
| 1500 | Ga0495599_0026190 | |||
| 1501 | Ga0495647_0003049 | |||
| 1502 | Ga0495647_0008774 | |||
| 1503 | Ga0495658_0002606 | |||
| 1504 | Ga0495658_0029738 | |||
| 1505 | Ga0495658_0046930 | |||
| 1506 | Ga0495669_0007028 | |||
| 1507 | Ga0495669_0023987 | |||
| 1508 | Ga0495613_0194236 | |||
| 1509 | Ga0495624_0130294 | |||
| 1510 | Ga0495624_0196387 | |||
| 1511 | Ga0495671_0045889 | |||
| 1512 | Ga0495649_0052695 | |||
| 1513 | Ga0495649_0084220 | |||
| 1514 | Ga0495649_0275169 | |||
| 1515 | Ga0495600_0001375 | |||
| 1516 | Ga0495600_0026672 | |||
| 1517 | Ga0495660_0014380 | |||
| 1518 | Ga0495660_0032898 | |||
| 1519 | Ga0495660_0121922 | |||
| 1520 | Ga0495581_0303242 | |||
| 1521 | Ga0495581_0337778 | |||
| 1522 | Ga0495604_0003259 | |||
| 1523 | Ga0495604_0116248 | |||
| 1524 | Ga0495604_0449448 | |||
| 1525 | Ga0495636_0015316 | |||
| 1526 | Ga0495636_0036828 | |||
| 1527 | Ga0495674_0005197 | |||
| 1528 | Ga0495674_0345786 | |||
| 1529 | Ga0495672_0000081 | |||
| 1530 | Ga0495676_0014246 | |||
| 1531 | Ga0495680_0007743 | |||
| 1532 | Ga0495680_0027785 | |||
| 1533 | Ga0495680_0093036 | |||
| 1534 | Ga0495680_0373459 | |||
| 1535 | Ga0495687_000172 | |||
| 1536 | Ga0495687_000699 | |||
| 1537 | Ga0495675_0007491 | |||
| 1538 | Ga0495677_0040057 | |||
| 1539 | Ga0495685_029749 | |||
| 1540 | Ga0495673_0000008 | |||
| 1541 | Ga0495673_0000009 | |||
| 1542 | Ga0495673_0000012 | |||
| 1543 | Ga0495681_0029400 | |||
| 1544 | Ga0495684_0004387 | |||
| 1545 | Ga0495686_0000677 | |||
| 1546 | Ga0495686_0128925 | |||
| 1547 | Ga0495686_0201909 | |||
| 1548 | Ga0495593_0096696 | |||
| 1549 | Ga0495614_0117339 | |||
| 1550 | Ga0495615_0021049 | |||
| 1551 | Ga0495615_0058711 | |||
| 1552 | Ga0496102_0000153 | |||
| 1553 | Ga0496102_0111852 | |||
| 1554 | Ga0496103_0033276 | |||
| 1555 | Ga0496107_0052423 | |||
| 1556 | Ga0496116_0020942 | |||
| 1557 | Ga0496116_0021069 | |||
| 1558 | Ga0496116_0033493 | |||
| 1559 | Ga0496117_0000075 | |||
| 1560 | Ga0496118_0000055 | |||
| 1561 | Ga0496121_0013029 | |||
| 1562 | Ga0496121_0044969 | |||
| 1563 | Ga0496121_0143142 | |||
| 1564 | Ga0496122_0000905 | |||
| 1565 | Ga0496122_0003176 | |||
| 1566 | Ga0496122_0083088 | |||
| 1567 | Ga0496123_0000227 | |||
| 1568 | Ga0496123_0008164 | |||
| 1569 | Ga0496123_0009479 | |||
| 1570 | Ga0496124_0071124 | |||
| 1571 | Ga0496125_0004412 | |||
| 1572 | Ga0496125_0081932 | |||
| 1573 | Ga0496126_0062219 | |||
| 1574 | Ga0495678_000027 | |||
| 1575 | Ga0495678_000346 | |||
| 1576 | Ga0495678_072886 | |||
| 1577 | Ga0495682_0000999 | |||
| 1578 | Ga0501298_032199 | |||
| 1579 | Ga0501299_025603 | |||
| 1580 | Ga0501031_0137678 | |||
| 1581 | Ga0501031_0394860 | |||
| 1582 | Ga0501032_0022145 | |||
| 1583 | Ga0501033_0027066 | |||
| 1584 | Ga0501036_0028859 | |||
| 1585 | Ga0501036_0034164 | |||
| 1586 | Ga0501036_0096441 | |||
| 1587 | Ga0501036_0125475 | |||
| 1588 | Ga0501036_0259984 | |||
| 1589 | Ga0501036_0423243 | |||
| 1590 | Ga0501038_0012391 | |||
| 1591 | Ga0501038_0018090 | |||
| 1592 | Ga0501038_0134073 | |||
| 1593 | Ga0501039_0004420 | |||
| 1594 | Ga0501039_0020079 | |||
| 1595 | Ga0501039_0028296 | |||
| 1596 | Ga0501039_0028433 | |||
| 1597 | Ga0501039_0104525 | |||
| 1598 | Ga0501039_0402373 | |||
| 1599 | Ga0501039_0421402 | |||
| 1600 | Ga0501039_0451743 | |||
| 1601 | Ga0501040_0003267 | |||
| 1602 | Ga0501040_0049194 | |||
| 1603 | Ga0501040_0188182 | |||
| 1604 | Ga0501040_0212066 | |||
| 1605 | Ga0501040_0233148 | |||
| 1606 | Ga0501040_0492212 | |||
| 1607 | Ga0501040_0792258 | |||
| 1608 | Ga0501041_0001563 | |||
| 1609 | Ga0501041_0077698 | |||
| 1610 | Ga0501041_0078616 | |||
| 1611 | Ga0501041_0137778 | |||
| 1612 | Ga0501042_0003021 | |||
| 1613 | Ga0501042_0028035 | |||
| 1614 | Ga0501042_0145705 | |||
| 1615 | Ga0501043_0201724 | |||
| 1616 | Ga0501046_0003243 | |||
| 1617 | Ga0501046_0066204 | |||
| 1618 | Ga0501046_0150053 | |||
| 1619 | Ga0501047_0627558 | |||
| 1620 | Ga0501048_0037202 | |||
| 1621 | Ga0501048_0049791 | |||
| 1622 | Ga0501048_0137962 | |||
| 1623 | Ga0501068_0002746 | |||
| 1624 | Ga0501068_0017863 | |||
| 1625 | Ga0501068_0212704 | |||
| 1626 | Ga0501069_0467099 | |||
| 1627 | Ga0501070_0017200 | |||
| 1628 | Ga0501071_0016570 | |||
| 1629 | Ga0501071_0174342 | |||
| 1630 | Ga0501072_0001241 | |||
| 1631 | Ga0501072_0033082 | |||
| 1632 | Ga0501072_0037703 | |||
| 1633 | Ga0501072_0042063 | |||
| 1634 | Ga0501072_0106886 | |||
| 1635 | Ga0501073_0092142 | |||
| 1636 | Ga0501073_0166125 | |||
| 1637 | Ga0501073_0233571 | |||
| 1638 | Ga0501073_0282222 | |||
| 1639 | Ga0501073_0289539 | |||
| 1640 | Ga0501074_0044148 | |||
| 1641 | Ga0501074_0045115 | |||
| 1642 | Ga0501074_0637043 | |||
| 1643 | Ga0501075_0002198 | |||
| 1644 | Ga0501075_0004962 | |||
| 1645 | Ga0501075_0042626 | |||
| 1646 | Ga0501075_0044205 | |||
| 1647 | Ga0501075_0070668 | |||
| 1648 | Ga0501076_0140173 | |||
| 1649 | Ga0501076_0218356 | |||
| 1650 | Ga0501076_0411484 | |||
| 1651 | Ga0501076_0446871 | |||
| 1652 | Ga0501077_0018016 | |||
| 1653 | Ga0501077_0096517 | |||
| 1654 | Ga0501217_068489 | |||
| 1655 | Ga0501235_074948 | |||
| 1656 | Ga0501236_006844 | |||
| 1657 | Ga0501249_030899 | |||
| 1658 | Ga0501249_056783 | |||
| 1659 | Ga0501079_0021474 | |||
| 1660 | Ga0501079_0022439 | |||
| 1661 | Ga0501079_0147299 | |||
| 1662 | Ga0501079_0232064 | |||
| 1663 | Ga0501079_0257772 | |||
| 1664 | Ga0501080_0000634 | |||
| 1665 | Ga0501080_0004675 | |||
| 1666 | Ga0501080_0018543 | |||
| 1667 | Ga0501080_0129192 | |||
| 1668 | Ga0501080_0180518 | |||
| 1669 | Ga0501080_0201540 | |||
| 1670 | Ga0501081_0034464 | |||
| 1671 | Ga0501081_0052616 | |||
| 1672 | Ga0501081_0190171 | |||
| 1673 | Ga0501269_000005 | |||
| 1674 | Ga0501035_0540006 | |||
| 1675 | Ga0501045_0033124 | |||
| 1676 | Ga0501045_0042472 | |||
| 1677 | Ga0501045_0146997 | |||
| 1678 | Ga0501045_0246281 | |||
| 1679 | Ga0501045_0802043 | |||
| 1680 | nmdc:mga03683_37441_c1 | |||
| 1681 | nmdc:mga00v17_48250_c1 | |||
| 1682 | nmdc:mga00v17_705929_c1 | |||
| 1683 | nmdc:mga05p37_389_c1 | |||
| 1684 | nmdc:mga05p37_956513_c1 | |||
| 1685 | nmdc:mga09592_166_c1 | |||
| 1686 | nmdc:mga09592_37356_c1 | |||
| 1687 | nmdc:mga09592_60352_c1 | |||
| 1688 | nmdc:mga09592_66351_c1 | |||
| 1689 | nmdc:mga0qj67_110224_c1 | |||
| 1690 | nmdc:mga06r32_182006_c1 | |||
| 1691 | nmdc:mga06r32_628086_c1 | |||
| 1692 | nmdc:mga06r32_846051_c1 | |||
| 1693 | nmdc:mga08y16_194690_c1 | |||
| 1694 | nmdc:mga08y16_2159_c1 | |||
| 1695 | nmdc:mga08y16_219039_c1 | |||
| 1696 | nmdc:mga0n895_251343_c1 | |||
| 1697 | nmdc:mga0n895_278079_c1 | |||
| 1698 | nmdc:mga0n895_291533_c1 | |||
| 1699 | nmdc:mga0n895_344472_c1 | |||
| 1700 | nmdc:mga0n895_67926_c1 | |||
| 1701 | nmdc:mga0n895_734_c1 | |||
| 1702 | nmdc:mga0n895_7924_c1 | |||
| 1703 | nmdc:mga0rr50_117062_c1 | |||
| 1704 | nmdc:mga0rr50_120136_c1 | |||
| 1705 | nmdc:mga0rr50_12102_c1 | |||
| 1706 | nmdc:mga0rr50_179807_c1 | |||
| 1707 | nmdc:mga0rr50_2416_c1 | |||
| 1708 | nmdc:mga0rr50_364350_c1 | |||
| 1709 | nmdc:mga0rr50_3670_c1 | |||
| 1710 | nmdc:mga0rr50_373862_c1 | |||
| 1711 | nmdc:mga0rr50_454279_c1 | |||
| 1712 | nmdc:mga0rr50_75238_c1 | |||
| 1713 | nmdc:mga08x19_14881_c1 | |||
| 1714 | nmdc:mga08x19_1688_c1 | |||
| 1715 | nmdc:mga08x19_175777_c1 | |||
| 1716 | nmdc:mga08x19_258_c1 | |||
| 1717 | nmdc:mga08x19_259714_c1 | |||
| 1718 | nmdc:mga08x19_41284_c1 | |||
| 1719 | nmdc:mga08x19_431957_c1 | |||
| 1720 | nmdc:mga08x19_43525_c1 | |||
| 1721 | nmdc:mga08x19_759_c1 | |||
| 1722 | nmdc:mga08x19_7654_c1 | |||
| 1723 | nmdc:mga0a205_17979_c1 | |||
| 1724 | nmdc:mga0a205_348268_c1 | |||
| 1725 | nmdc:mga0a205_484503_c1 | |||
| 1726 | nmdc:mga0a205_747479_c1 | |||
| 1727 | Ga0495601_0003245 | |||
| 1728 | Ga0495601_0021328 | |||
| 1729 | Ga0495601_0058084 | |||
| 1730 | Ga0495601_0586061 | |||
| 1731 | Ga0495612_0045727 | |||
| 1732 | Ga0495595_0000266 | |||
| 1733 | Ga0500618_000170 | |||
| 1734 | Ga0500586_017123 | |||
| 1735 | Ga0501084_0005520 | |||
| 1736 | Ga0501084_0006302 | |||
| 1737 | Ga0501084_0493841 | |||
| 1738 | Ga0590071_021793 | |||
| 1739 | Ga0501082_0000750 | |||
| 1740 | Ga0501082_0814886 | |||
| 1741 | Ga0530510_0000245 | |||
| 1742 | Ga0530510_0004031 | |||
| 1743 | Ga0530510_0015381 | |||
| 1744 | Ga0530510_0348995 | |||
| 1745 | 2511249690 | |||
| 1746 | 2550695170 | |||
| 1747 | 2554818193 | |||
| 1748 | 2601666856 | |||
| 1749 | 2608380509 | |||
| 1750 | 2738826215 | |||
| 1751 | 2739150012 | |||
| 1752 | 2739191931 | |||
| 1753 | 2739318408 | |||
| 1754 | 2739336649 | |||
| 1755 | 2819592776 | |||
| 1756 | 2821134982 | |||
| 1757 | 2842715841 | |||
| 1758 | 2857552751 | |||
| 1759 | 2857558119 | |||
| 1760 | 2857558768 | |||
| 1761 | 2857569645 | |||
| 1762 | 2884815960 | |||
| 1763 | 2884838657 | |||
| 1764 | 2884854948 | |||
| 1765 | 2885086331 | |||
| 1766 | 2896156383 | |||
| 1767 | 2904428346 | |||
| 1768 | 2919049068 | |||
| 1769 | 2919476427 | |||
| 1770 | 2932415678 | |||
| 1771 | 2932421668 | |||
| 1772 | 2952255907 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f1d-assembly1.cif.gz_D | x-ray structure of imidazoleglycerol-phosphate dehydratase | 0.9853 | 5 | 186 |
| 2f1d-assembly1.cif.gz_D | x-ray structure of imidazoleglycerol-phosphate dehydratase | 0.9747 | 5 | 186 |
| 4mu4-assembly1.cif.gz_A | the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution | 0.9701 | 3 | 196 |
| 5el9-assembly1.cif.gz_A | a. thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (s)-c348, to 1.1a resolution | 0.9682 | 3 | 196 |
| 6fwh-assembly1.cif.gz_A | acanthamoeba igpd in complex with r-c348 to 1.7a resolution | 0.9668 | 4 | 196 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6T988_68_169_3.30.230.40 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9814 | 2 | 92 | 3.30.230.40 |
| 2ae8A02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9679 | 93 | 184 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9672 | 93 | 186 | 3.30.230.40 |
| 2ae8A02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9575 | 93 | 184 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9573 | 93 | 186 | 3.30.230.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0LTM6-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.009 | 6 | 73 |
GO:0000105
GO:0004424 |
| AF-A0A1Z9GWE8-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.005 | 5 | 86 |
GO:0000105
GO:0004424 |
| AF-A0A522GSK4-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.005 | 6 | 80 |
GO:0000105
GO:0004424 |
| AF-A0A2E4EWP6-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 1.004 | 6 | 68 |
GO:0000105
GO:0004424 |
| AF-A0A850D107-F1-model_v4 | deleted | 1.004 | 3 | 63 |
|