F484690

General Info

Members Datasets Scaffolds Average Seq Length
886 435 1772 196

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10154911|Ga0081538_101549112
Length 232
Sequence VPAGSGPIEYEPSAAVVAVNDDGGVLRPPTPTTMPSRPPPVSLSVTRPEIWPVGASAAGGAAKLSTGLPFLEHMLDQVARHGMLDLEIEAKGDLHIDAHHTVEDIGITLGQAVAKAIGDKAGVRRFGHAYVPLDEALSRVVLDFSGRPGLEYHVKFTRALIGEFDVDLMHEFFQGFVNHAQVTLHIDNLRGDNAHHQCETMFKAFARALRMAAEPDPRAGGAVPSTKGTLQG

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
114 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
171 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
189 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
203 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
204 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
205 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
209 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
223 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
234 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
237 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
240 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
241 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
242 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
245 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
246 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
247 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
250 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
251 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
252 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
258 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
277 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
281 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
297 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
298 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
299 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
315 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
316 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
317 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
318 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
319 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
320 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
329 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
330 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
331 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
332 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
333 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
347 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
348 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
349 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
352 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
353 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
354 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
355 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
371 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
379 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
380 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
381 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
385 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
388 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
402 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
403 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
406 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
407 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
408 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
409 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
410 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
411 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
412 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
413 2738541297 Duganella sp. GV083 Isolate Unclassified
414 2738541357 Duganella sp. GV053 Isolate Unclassified
415 2738543003 Duganella sp. GV066 Isolate Unclassified
416 2738543026 Duganella sp. GV089 Isolate Unclassified
417 2738543029 Duganella sp. GV039 Isolate Unclassified
418 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
419 2821131069 Duganella sp. 1224 Isolate Unclassified
420 2842711865 Duganella sp. R-73148 Isolate Unclassified
421 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
422 2857553236 Duganella sp. R-74557 Isolate Unclassified
423 2857558681 Duganella sp. R-74565 Isolate Unclassified
424 2857564685 Duganella sp. R-74599 Isolate Unclassified
425 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
426 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
427 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
428 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
429 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
430 2904424332 Duganella sp. 1411 Isolate Rhizosphere
431 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
432 2919476304 Duganella sp. 3397 Isolate Unclassified
433 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
434 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
435 2952252522 Salinicola sp. DM10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0.23
Isolates 3.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.05
Nodule 0.45
Rhizoplane 0.79
Rhizosphere 89.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10154911 3300005981 Bacteria 1030
2 JGI25155J39150_1000252 3300002704 Bacteria 20486
3 JGI25155J39150_1000471 3300002704 Bacteria 10080
4 JGI25156J39149_1000288 3300002705 Bacteria 33984
5 JGI25156J39149_1004072 3300002705 Bacteria 4562
6 JGI25154J39366_1000311 3300002738 Bacteria 28175
7 JGI25154J39366_1000313 3300002738 Bacteria 28101
8 JGI25157J39369_1000171 3300002741 Bacteria 54600
9 JGI25150J39212_1001839 3300002774 Bacteria 5615
10 JGI25151J46595_10051050 3300003187 Bacteria 1403
11 Ga0007417J51691_1079838 3300003544 Bacteria 770
12 Ga0055532_1000044 3300003758 Bacteria 191110
13 Ga0055535_1006487 3300003761 Bacteria 2358
14 Ga0055529_1000015 3300003763 Bacteria 366950
15 Ga0055526_1000007 3300003771 Bacteria 321998
16 Ga0055526_1000037 3300003771 Bacteria 134834
17 Ga0065714_10176867 3300005288 Bacteria 979
18 Ga0065714_10183074 3300005288 Bacteria 955
19 Ga0065707_10028354 3300005295 Bacteria 1158
20 Ga0065707_10093232 3300005295 Bacteria 3656
21 Ga0065707_10146765 3300005295 Bacteria 1705
22 Ga0070676_10100527 3300005328 Bacteria 1785
23 Ga0070690_100000183 3300005330 Bacteria 32306
24 Ga0070690_100028668 3300005330 Bacteria 3450
25 Ga0068869_100000139 3300005334 Bacteria 35367
26 Ga0070666_10261455 3300005335 Bacteria 1227
27 Ga0070680_100000688 3300005336 Bacteria 23463
28 Ga0070680_100328147 3300005336 Bacteria 1300
29 Ga0070680_100435945 3300005336 Bacteria 1119
30 Ga0070682_100059915 3300005337 Bacteria 2406
31 Ga0068868_100000115 3300005338 Bacteria 50197
32 Ga0070689_100001743 3300005340 Bacteria 13915
33 Ga0070689_100052931 3300005340 Bacteria 3141
34 Ga0070689_100463101 3300005340 Bacteria 1080
35 Ga0070691_10008416 3300005341 Bacteria 4724
36 Ga0070691_10163927 3300005341 Bacteria 1148
37 Ga0070687_100000091 3300005343 Bacteria 29810
38 Ga0070687_100057792 3300005343 Bacteria 2035
39 Ga0070687_100064050 3300005343 Bacteria 1952
40 Ga0070687_100099246 3300005343 Bacteria 1627
41 Ga0070692_10304212 3300005345 Bacteria 974
42 Ga0070668_100051434 3300005347 Bacteria 3174
43 Ga0070675_100165495 3300005354 Bacteria 1904
44 Ga0070675_100663011 3300005354 Bacteria 949
45 Ga0070674_100088353 3300005356 Bacteria 2230
46 Ga0070659_100082251 3300005366 Bacteria 2573
47 Ga0070703_10007089 3300005406 Bacteria 3144
48 Ga0070709_10180189 3300005434 Bacteria 1483
49 Ga0070701_10778781 3300005438 Bacteria 650
50 Ga0070705_100000441 3300005440 Bacteria 23797
51 Ga0070705_100100728 3300005440 Bacteria 1823
52 Ga0070705_100441138 3300005440 Bacteria 974
53 Ga0070700_100001332 3300005441 Bacteria 12264
54 Ga0070700_100002644 3300005441 Bacteria 9169
55 Ga0070700_100114033 3300005441 Bacteria 1801
56 Ga0070694_100000133 3300005444 Bacteria 37050
57 Ga0070694_100018018 3300005444 Bacteria 4474
58 Ga0070694_100028039 3300005444 Bacteria 3661
59 Ga0070694_100044368 3300005444 Bacteria 2975
60 Ga0070694_100071913 3300005444 Bacteria 2385
61 Ga0070694_100203836 3300005444 Bacteria 1476
62 Ga0070694_100243243 3300005444 Bacteria 1358
63 Ga0070694_100281743 3300005444 Bacteria 1267
64 Ga0070694_100359985 3300005444 Bacteria 1129
65 Ga0070694_100646632 3300005444 Bacteria 855
66 Ga0070708_100105538 3300005445 Bacteria 2585
67 Ga0070681_10000081 3300005458 Bacteria 71809
68 Ga0070681_10018249 3300005458 Bacteria 7011
69 Ga0070681_10153316 3300005458 Bacteria 2230
70 Ga0070681_10195826 3300005458 Bacteria 1940
71 Ga0068867_100000084 3300005459 Bacteria 58558
72 Ga0068867_100002479 3300005459 Bacteria 12970
73 Ga0070706_100076438 3300005467 Bacteria 3099
74 Ga0070707_100026726 3300005468 Bacteria 5483
75 Ga0070698_101290778 3300005471 Bacteria 680
76 Ga0070699_100050684 3300005518 Bacteria 3594
77 Ga0070679_100042718 3300005530 Bacteria 4515
78 Ga0070679_100155414 3300005530 Bacteria 2262
79 Ga0070684_100202324 3300005535 Bacteria 1809
80 Ga0070697_100000299 3300005536 Bacteria 39638
81 Ga0070697_100004807 3300005536 Bacteria 10352
82 Ga0070697_100211102 3300005536 Bacteria 1653
83 Ga0068853_100058101 3300005539 Bacteria 3339
84 Ga0070672_100504943 3300005543 Bacteria 1046
85 Ga0070686_100000193 3300005544 Bacteria 42276
86 Ga0070686_100139498 3300005544 Bacteria 1686
87 Ga0070686_100242193 3300005544 Bacteria 1314
88 Ga0070695_100000163 3300005545 Bacteria 31628
89 Ga0070695_100006828 3300005545 Bacteria 6757
90 Ga0070695_100027364 3300005545 Bacteria 3531
91 Ga0070695_100087620 3300005545 Bacteria 2071
92 Ga0070695_100098397 3300005545 Bacteria 1966
93 Ga0070695_100110894 3300005545 Bacteria 1861
94 Ga0070696_100000570 3300005546 Bacteria 23539
95 Ga0070696_100004599 3300005546 Bacteria 9212
96 Ga0070696_100013604 3300005546 Bacteria 5461
97 Ga0070696_100215508 3300005546 Bacteria 1439
98 Ga0070693_100000111 3300005547 Bacteria 36381
99 Ga0070704_100000008 3300005549 Bacteria 71641
100 Ga0070704_100182942 3300005549 Bacteria 1678
101 Ga0068855_100000242 3300005563 Bacteria 68674
102 Ga0068855_100152556 3300005563 Bacteria 2626
103 Ga0068855_100211348 3300005563 Bacteria 2180
104 Ga0068854_100006366 3300005578 Bacteria 7509
105 Ga0068856_100160335 3300005614 Bacteria 2259
106 Ga0068856_100423008 3300005614 Bacteria 1352
107 Ga0070702_100000012 3300005615 Bacteria 58298
108 Ga0068852_100269519 3300005616 Bacteria 1638
109 Ga0068852_100756740 3300005616 Bacteria 984
110 Ga0068859_100005212 3300005617 Bacteria 13208
111 Ga0068859_100547586 3300005617 Bacteria 1252
112 Ga0068864_100059830 3300005618 Bacteria 3297
113 Ga0068864_100254119 3300005618 Bacteria 1633
114 Ga0068866_10000109 3300005718 Bacteria 35401
115 Ga0068861_100000814 3300005719 Bacteria 18847
116 Ga0068861_100011165 3300005719 Bacteria 6236
117 Ga0068870_10095558 3300005840 Bacteria 1670
118 Ga0068870_10135470 3300005840 Bacteria 1435
119 Ga0068858_100023814 3300005842 Bacteria 5705
120 Ga0068858_100381916 3300005842 Bacteria 1352
121 Ga0068862_100002876 3300005844 Bacteria 15079
122 Ga0068862_100008234 3300005844 Bacteria 8625
123 Ga0075364_10346816 3300006051 Bacteria 1012
124 Ga0075364_10745886 3300006051 Bacteria 668
125 Ga0070715_10132417 3300006163 Bacteria 1201
126 Ga0070716_100026868 3300006173 Bacteria 3086
127 Ga0070716_100168241 3300006173 Bacteria 1428
128 Ga0070716_100292238 3300006173 Bacteria 1130
129 Ga0070716_100747894 3300006173 Bacteria 752
130 Ga0075362_10008204 3300006177 Bacteria 3986
131 Ga0097621_100003524 3300006237 Bacteria 10813
132 Ga0097621_100028427 3300006237 Bacteria 4407
133 Ga0068871_100000559 3300006358 Bacteria 25362
134 Ga0068871_100014580 3300006358 Bacteria 5862
135 Ga0075428_100033964 3300006844 Bacteria 5627
136 Ga0075428_100664862 3300006844 Bacteria 1111
137 Ga0075430_100006977 3300006846 Bacteria 9521
138 Ga0075430_100977377 3300006846 Bacteria 697
139 Ga0075431_100247744 3300006847 Bacteria 1811
140 Ga0075433_10006494 3300006852 Bacteria 9246
141 Ga0075433_10283872 3300006852 Bacteria 1466
142 Ga0075434_100000079 3300006871 Bacteria 52051
143 Ga0075434_100001287 3300006871 Bacteria 20920
144 Ga0075434_100020461 3300006871 Bacteria 6420
145 Ga0075434_100214916 3300006871 Bacteria 1943
146 Ga0075434_100247060 3300006871 Bacteria 1804
147 Ga0075434_100501681 3300006871 Bacteria 1234
148 Ga0075434_100813005 3300006871 Bacteria 951
149 Ga0075429_100000891 3300006880 Bacteria 23613
150 Ga0075429_100048189 3300006880 Bacteria 3707
151 Ga0075429_100067097 3300006880 Bacteria 3122
152 Ga0068865_100002206 3300006881 Bacteria 11476
153 Ga0068865_100004107 3300006881 Bacteria 8751
154 Ga0075436_100000789 3300006914 Bacteria 21020
155 Ga0075436_100008442 3300006914 Bacteria 7041
156 Ga0075436_100027934 3300006914 Bacteria 3884
157 Ga0075436_100135911 3300006914 Bacteria 1726
158 Ga0075436_100228214 3300006914 Bacteria 1322
159 Ga0075436_100494859 3300006914 Bacteria 894
160 Ga0097620_100005212 3300006931 Bacteria 13208
161 Ga0097620_100547583 3300006931 Bacteria 1252
162 Ga0079104_1011322 3300006946 Bacteria 2873
163 Ga0075435_100000655 3300007076 Bacteria 21307
164 Ga0075435_100003904 3300007076 Bacteria 10179
165 Ga0075435_100010489 3300007076 Bacteria 6777
166 Ga0075435_100083036 3300007076 Bacteria 2634
167 Ga0075435_100095897 3300007076 Bacteria 2453
168 Ga0075435_100222527 3300007076 Bacteria 1603
169 Ga0075435_100271705 3300007076 Bacteria 1446
170 Ga0075435_100468995 3300007076 Bacteria 1087
171 Ga0099794_10121695 3300007265 Bacteria 1313
172 Ga0099795_10055246 3300007788 Bacteria 1458
173 Ga0105244_10000412 3300009036 Bacteria 39755
174 Ga0105244_10041635 3300009036 Bacteria 2380
175 Ga0105244_10304845 3300009036 Bacteria 737
176 Ga0105250_10146464 3300009092 Bacteria 981
177 Ga0105240_10007532 3300009093 Bacteria 15792
178 Ga0105240_10026536 3300009093 Bacteria 7600
179 Ga0105240_10316720 3300009093 Bacteria 1779
180 Ga0111539_10011985 3300009094 Bacteria 10872
181 Ga0111539_10013498 3300009094 Bacteria 10209
182 Ga0111539_10029705 3300009094 Bacteria 6654
183 Ga0111539_10613481 3300009094 Bacteria 1267
184 Ga0105245_10000245 3300009098 Bacteria 51952
185 Ga0105245_10026778 3300009098 Bacteria 5077
186 Ga0114129_10000219 3300009147 Bacteria 63579
187 Ga0114129_10241959 3300009147 Bacteria 2425
188 Ga0114129_10418725 3300009147 Bacteria 1762
189 Ga0114129_11276693 3300009147 Bacteria 911
190 Ga0114129_11552568 3300009147 Bacteria 812
191 Ga0105243_10000279 3300009148 Bacteria 56997
192 Ga0105241_10062959 3300009174 Bacteria 2860
193 Ga0105242_10000480 3300009176 Bacteria 31755
194 Ga0105242_10046492 3300009176 Bacteria 3521
195 Ga0105242_10156759 3300009176 Bacteria 1989
196 Ga0105248_10502895 3300009177 Bacteria 1366
197 Ga0105237_10181974 3300009545 Bacteria 2102
198 Ga0105238_10047036 3300009551 Bacteria 4351
199 Ga0105249_10007151 3300009553 Bacteria 9742
200 Ga0105249_10086025 3300009553 Bacteria 2931
201 Ga0099796_10035086 3300010159 Bacteria 1661
202 Ga0157373_10220548 3300013100 Bacteria 1338
203 Ga0157378_10000294 3300013297 Bacteria 48405
204 Ga0163162_10101727 3300013306 Bacteria 2966
205 Ga0157372_10961460 3300013307 Bacteria 990
206 Ga0163163_11624610 3300014325 Bacteria 707
207 Ga0157380_10284264 3300014326 Bacteria 1515
208 Ga0182008_10000609 3300014497 Bacteria 26312
209 Ga0157377_10004975 3300014745 Bacteria 6198
210 Ga0157379_10029733 3300014968 Bacteria 4858
211 Ga0157379_10169377 3300014968 Bacteria 1971
212 Ga0157376_10002130 3300014969 Bacteria 13330
213 Ga0182006_1000023 3300015261 Bacteria 275031
214 Ga0182006_1000125 3300015261 Bacteria 82143
215 Ga0182006_1009055 3300015261 Bacteria 4478
216 Ga0182007_10000082 3300015262 Bacteria 71660
217 Ga0182005_1000006 3300015265 Bacteria 515188
218 Ga0182005_1000047 3300015265 Bacteria 126754
219 Ga0163161_10013268 3300017792 Bacteria 5728
220 Ga0163161_10070329 3300017792 Bacteria 2559
221 Ga0163161_10607694 3300017792 Bacteria 902
222 Ga0213872_10079118 3300021361 Bacteria 1477
223 Ga0213872_10199498 3300021361 Bacteria 858
224 Ga0209435_100004 3300025206 Bacteria 633417
225 Ga0209435_100168 3300025206 Bacteria 20495
226 Ga0209147_100011 3300025229 Bacteria 702140
227 Ga0209437_100207 3300025233 Bacteria 112147
228 Ga0209258_100279 3300025242 Bacteria 86008
229 Ga0207425_1000176 3300025245 Bacteria 52680
230 Ga0209646_1000125 3300025246 Bacteria 135847
231 Ga0209646_1000140 3300025246 Bacteria 111155
232 Ga0209646_1000205 3300025246 Bacteria 69450
233 Ga0209026_1000066 3300025250 Bacteria 207691
234 Ga0209026_1002319 3300025250 Bacteria 7236
235 Ga0209026_1030661 3300025250 Bacteria 798
236 Ga0209148_1013906 3300025254 Bacteria 1435
237 Ga0209759_1000114 3300025256 Bacteria 142233
238 Ga0209759_1000961 3300025256 Bacteria 20401
239 Ga0209233_1020816 3300025261 Bacteria 1711
240 Ga0209455_1000031 3300025272 Bacteria 519952
241 Ga0209455_1004399 3300025272 Bacteria 4629
242 Ga0209025_1003577 3300025294 Bacteria 14530
243 Ga0209564_1000010 3300025295 Bacteria 885399
244 Ga0209564_1000042 3300025295 Bacteria 392805
245 Ga0209758_1000433 3300025297 Bacteria 70750
246 Ga0207655_1001385 3300025728 Bacteria 22650
247 Ga0207655_1005830 3300025728 Bacteria 8274
248 Ga0207713_1026364 3300025735 Bacteria 2665
249 Ga0207653_10025685 3300025885 Bacteria 1884
250 Ga0207642_10004540 3300025899 Bacteria 4484
251 Ga0207688_10034174 3300025901 Bacteria 2814
252 Ga0207647_10068324 3300025904 Bacteria 2151
253 Ga0207684_10011988 3300025910 Bacteria 7549
254 Ga0207684_10849722 3300025910 Bacteria 769
255 Ga0207654_10002619 3300025911 Bacteria 9130
256 Ga0207707_10007590 3300025912 Bacteria 9451
257 Ga0207707_10179483 3300025912 Bacteria 1849
258 Ga0207707_10221069 3300025912 Bacteria 1649
259 Ga0207695_10007348 3300025913 Bacteria 14059
260 Ga0207671_10111165 3300025914 Bacteria 2084
261 Ga0207671_10164735 3300025914 Bacteria 1718
262 Ga0207663_10309528 3300025916 Bacteria 1183
263 Ga0207660_10002762 3300025917 Bacteria 11505
264 Ga0207660_10051323 3300025917 Bacteria 2932
265 Ga0207660_10418387 3300025917 Bacteria 1081
266 Ga0207662_10000176 3300025918 Bacteria 30450
267 Ga0207662_10020338 3300025918 Bacteria 3787
268 Ga0207662_10031534 3300025918 Bacteria 3080
269 Ga0207662_10673954 3300025918 Bacteria 723
270 Ga0207652_10005421 3300025921 Bacteria 10349
271 Ga0207652_10096934 3300025921 Bacteria 2598
272 Ga0207646_10022393 3300025922 Bacteria 5823
273 Ga0207646_10034021 3300025922 Bacteria 4606
274 Ga0207681_10074197 3300025923 Bacteria 2382
275 Ga0207694_10509441 3300025924 Bacteria 1008
276 Ga0207659_10008745 3300025926 Bacteria 6305
277 Ga0207659_10430550 3300025926 Bacteria 1108
278 Ga0207659_10854406 3300025926 Bacteria 782
279 Ga0207687_10001352 3300025927 Bacteria 16793
280 Ga0207687_10058530 3300025927 Bacteria 2711
281 Ga0207686_10000627 3300025934 Bacteria 21927
282 Ga0207686_10128102 3300025934 Bacteria 1737
283 Ga0207709_10000549 3300025935 Bacteria 32146
284 Ga0207709_10009164 3300025935 Bacteria 5452
285 Ga0207670_10039886 3300025936 Bacteria 3078
286 Ga0207670_10043125 3300025936 Bacteria 2977
287 Ga0207669_10317121 3300025937 Bacteria 1191
288 Ga0207704_10000329 3300025938 Bacteria 22100
289 Ga0207704_10018414 3300025938 Bacteria 3645
290 Ga0207665_10007215 3300025939 Bacteria 7354
291 Ga0207665_10136089 3300025939 Bacteria 1748
292 Ga0207665_10161652 3300025939 Bacteria 1611
293 Ga0207691_10120139 3300025940 Bacteria 2330
294 Ga0207711_10434006 3300025941 Bacteria 1222
295 Ga0207661_10090479 3300025944 Bacteria 2548
296 Ga0207712_10022192 3300025961 Bacteria 4177
297 Ga0207668_10016248 3300025972 Bacteria 4642
298 Ga0207640_10033700 3300025981 Bacteria 3189
299 Ga0207677_10000669 3300026023 Bacteria 20376
300 Ga0207677_10059997 3300026023 Bacteria 2627
301 Ga0207677_10699518 3300026023 Bacteria 899
302 Ga0207703_10005933 3300026035 Bacteria 9788
303 Ga0207703_10029223 3300026035 Bacteria 4348
304 Ga0207639_10040826 3300026041 Bacteria 3466
305 Ga0207708_10000275 3300026075 Bacteria 40312
306 Ga0207708_10037205 3300026075 Bacteria 3707
307 Ga0207708_10411784 3300026075 Bacteria 1120
308 Ga0207702_10071848 3300026078 Bacteria 2981
309 Ga0207648_10000185 3300026089 Bacteria 65925
310 Ga0207648_10001654 3300026089 Bacteria 24445
311 Ga0207676_10567431 3300026095 Bacteria 1086
312 Ga0207674_10103608 3300026116 Bacteria 2825
313 Ga0207675_100000150 3300026118 Bacteria 61064
314 Ga0207675_100080942 3300026118 Bacteria 3045
315 Ga0207683_10115993 3300026121 Bacteria 2401
316 Ga0207698_10267892 3300026142 Bacteria 1573
317 Ga0207698_10283503 3300026142 Bacteria 1534
318 Ga0209281_1003338 3300027111 Bacteria 5382
319 Ga0209969_1002680 3300027360 Bacteria 2467
320 Ga0209969_1012340 3300027360 Bacteria 1231
321 Ga0209967_1000561 3300027364 Bacteria 4882
322 Ga0209967_1003478 3300027364 Bacteria 2076
323 Ga0210000_1000970 3300027462 Bacteria 4014
324 Ga0210000_1001740 3300027462 Bacteria 3081
325 Ga0209995_1001745 3300027471 Bacteria 3379
326 Ga0209179_1004916 3300027512 Bacteria 2055
327 Ga0209968_1004125 3300027526 Bacteria 2181
328 Ga0209999_1005018 3300027543 Bacteria 2381
329 Ga0209999_1017181 3300027543 Bacteria 1319
330 Ga0209588_1007435 3300027671 Bacteria 3222
331 Ga0209971_1081568 3300027682 Bacteria 788
332 Ga0209966_1004277 3300027695 Bacteria 2417
333 Ga0209974_10016022 3300027876 Bacteria 2488
334 Ga0207428_10000290 3300027907 Bacteria 67367
335 Ga0207428_10025385 3300027907 Bacteria 4960
336 Ga0207428_10047565 3300027907 Bacteria 3444
337 Ga0207428_10063834 3300027907 Bacteria 2908
338 Ga0207428_10496211 3300027907 Bacteria 887
339 Ga0268265_10001010 3300028380 Bacteria 25458
340 Ga0268265_10008669 3300028380 Bacteria 6873
341 Ga0307517_10206767 3300028786 Bacteria 1217
342 Ga0307515_10139635 3300028794 Bacteria 2608
343 Ga0316181_1151886 3300030744 Bacteria 2785
344 Ga0307408_100066343 3300031548 Bacteria 2650
345 Ga0307408_100299524 3300031548 Bacteria 1346
346 Ga0316575_10001586 3300031665 Bacteria 7394
347 Ga0316575_10003078 3300031665 Bacteria 5693
348 Ga0316575_10133838 3300031665 Bacteria 1018
349 Ga0316579_10006383 3300031691 Bacteria 4814
350 Ga0265314_10023239 3300031711 Bacteria 4732
351 Ga0316578_10006914 3300031728 Bacteria 5642
352 Ga0316578_10019153 3300031728 Bacteria 3761
353 Ga0307405_10003031 3300031731 Bacteria 7608
354 Ga0316577_10011728 3300031733 Bacteria 4754
355 Ga0316577_10145427 3300031733 Bacteria 1336
356 Ga0307413_10103949 3300031824 Bacteria 1884
357 Ga0307410_10000539 3300031852 Bacteria 15527
358 Ga0307406_10014860 3300031901 Bacteria 4488
359 Ga0307407_10069599 3300031903 Bacteria 2089
360 Ga0307412_10019535 3300031911 Bacteria 4106
361 Ga0307416_100141028 3300032002 Bacteria 2190
362 Ga0307416_100273486 3300032002 Bacteria 1660
363 Ga0307416_100484985 3300032002 Bacteria 1297
364 Ga0307416_100765238 3300032002 Bacteria 1059
365 Ga0307416_100828917 3300032002 Bacteria 1022
366 Ga0307416_100989201 3300032002 Bacteria 944
367 Ga0307416_101753204 3300032002 Bacteria 725
368 Ga0307411_10062647 3300032005 Bacteria 2481
369 Ga0307411_10648036 3300032005 Bacteria 914
370 Ga0307415_100045681 3300032126 Bacteria 2938
371 Ga0316583_10131148 3300032133 Bacteria 873
372 Ga0316585_10047728 3300032137 Bacteria 1371
373 Ga0316580_10020002 3300032139 Bacteria 2060
374 Ga0316593_10008065 3300032168 Bacteria 2922
375 Ga0373934_0000524 3300035086 Bacteria 13506
376 Ga0373934_0003529 3300035086 Bacteria 5750
377 Ga0373934_0027468 3300035086 Bacteria 2212
378 Ga0373944_0000909 3300035089 Bacteria 7302
379 Ga0373949_0009770 3300035090 Bacteria 2100
380 Ga0373952_0010157 3300035092 Bacteria 1815
381 Ga0373923_0001446 3300035111 Bacteria 6812
382 Ga0373923_0022790 3300035111 Bacteria 2459
383 Ga0373936_0003119 3300035113 Bacteria 6206
384 Ga0373936_0011164 3300035113 Bacteria 3394
385 Ga0373936_0110585 3300035113 Bacteria 1166
386 Ga0373939_0003574 3300035114 Bacteria 3650
387 Ga0373939_0041704 3300035114 Bacteria 1384
388 Ga0373941_0038627 3300035115 Bacteria 1462
389 Ga0373941_0049333 3300035115 Bacteria 1332
390 Ga0373953_0022814 3300035117 Bacteria 2364
391 Ga0373954_0002148 3300035118 Bacteria 8184
392 Ga0373954_0037910 3300035118 Bacteria 2240
393 Ga0373956_0000135 3300035119 Bacteria 26321
394 Ga0373956_0010109 3300035119 Bacteria 3853
395 Ga0373957_0007330 3300035120 Bacteria 3527
396 Ga0373957_0008551 3300035120 Bacteria 3320
397 Ga0373960_0108099 3300035121 Bacteria 909
398 Ga0373960_0108280 3300035121 Bacteria 909
399 Ga0373943_0110815 3300035170 Bacteria 1447
400 Ga0373946_0057881 3300035171 Bacteria 1640
401 Ga0373946_0063474 3300035171 Bacteria 1577
402 Ga0373955_0007893 3300035172 Bacteria 4913
403 Ga0373955_0068738 3300035172 Bacteria 1975
404 Ga0373955_0261814 3300035172 Bacteria 1038
405 Ga0373942_0025084 3300035207 Bacteria 1534
406 Ga0373942_0084666 3300035207 Bacteria 947
407 Ga0373961_0004525 3300035241 Bacteria 3361
408 Ga0373961_0026789 3300035241 Bacteria 1578
409 Ga0373961_0036263 3300035241 Bacteria 1403
410 Ga0373962_0001944 3300035242 Bacteria 4928
411 Ga0316574_0002868 3300035398 Bacteria 8757
412 Ga0316574_0064011 3300035398 Bacteria 2313
413 Ga0316574_0122577 3300035398 Bacteria 1670
414 Ga0373924_0024443 3300035410 Bacteria 2380
415 Ga0373924_0047708 3300035410 Bacteria 1767
416 Ga0373924_0196319 3300035410 Bacteria 889
417 Ga0373924_0269742 3300035410 Bacteria 754
418 Ga0373931_0000163 3300035691 Bacteria 29108
419 Ga0373931_0020082 3300035691 Bacteria 3340
420 Ga0373931_0184591 3300035691 Bacteria 1237
421 Ga0373931_0482561 3300035691 Bacteria 797
422 Ga0373935_0046669 3300035692 Bacteria 2736
423 Ga0373935_0118923 3300035692 Bacteria 1762
424 Ga0373935_0646776 3300035692 Bacteria 775
425 Ga0373927_0018600 3300035695 Bacteria 4562
426 Ga0373933_0002313 3300035724 Bacteria 10829
427 Ga0373933_0008376 3300035724 Bacteria 5647
428 Ga0373933_0070820 3300035724 Bacteria 2121
429 Ga0373933_0627181 3300035724 Bacteria 706
430 Ga0373947_0032914 3300035725 Bacteria 3057
431 Ga0373947_0139496 3300035725 Bacteria 1554
432 Ga0373947_0156143 3300035725 Bacteria 1473
433 Ga0373947_0175104 3300035725 Bacteria 1394
434 Ga0373937_0001313 3300036401 Bacteria 20818
435 Ga0373937_0033470 3300036401 Bacteria 4667
436 Ga0373937_0067095 3300036401 Bacteria 3305
437 Ga0373937_0076864 3300036401 Bacteria 3084
438 Ga0373937_0140242 3300036401 Bacteria 2261
439 Ga0373937_0172469 3300036401 Bacteria 2029
440 Ga0373937_0209683 3300036401 Bacteria 1833
441 Ga0316582_0014225 3300036647 Bacteria 4508
442 Ga0316582_0023391 3300036647 Bacteria 3682
443 Ga0316584_0231204 3300036712 Bacteria 1355
444 Ga0373925_0025897 3300037068 Bacteria 4288
445 Ga0373925_0108840 3300037068 Bacteria 2139
446 Ga0316581_0003333 3300037588 Bacteria 3987
447 Ga0436360_1247629 3300039438 Bacteria 1429
448 Ga0436361_0031960 3300039447 Bacteria 30752
449 Ga0436361_0183378 3300039447 Bacteria 3080
450 Ga0436361_0224368 3300039447 Bacteria 99317
451 Ga0436361_0475359 3300039447 Bacteria 1987
452 Ga0439439_0092299 3300041406 Bacteria 828
453 Ga0439453_0003405 3300041408 Bacteria 2287
454 Ga0439466_0071477 3300041411 Bacteria 1104
455 Ga0451800_1368170 3300041459 Bacteria 1155
456 Ga0451853_2519352 3300041512 Bacteria 996
457 Ga0439441_001220 3300042001 Bacteria 3280
458 Ga0439441_008765 3300042001 Bacteria 1660
459 Ga0439451_010902 3300042009 Bacteria 1833
460 Ga0439454_014529 3300042011 Bacteria 1093
461 Ga0439446_0008714 3300042156 Bacteria 2700
462 Ga0439446_0042915 3300042156 Bacteria 1336
463 Ga0439434_0000867 3300042435 Bacteria 8710
464 Ga0439434_0045763 3300042435 Bacteria 1350
465 Ga0439435_0000145 3300042436 Bacteria 9631
466 Ga0439435_0002402 3300042436 Bacteria 3709
467 Ga0439435_0024654 3300042436 Bacteria 1589
468 Ga0439444_0016130 3300042437 Bacteria 1268
469 Ga0439460_0000484 3300042461 Bacteria 8608
470 Ga0439460_0070741 3300042461 Bacteria 1080
471 Ga0450893_0059299 3300042532 Bacteria 728
472 Ga0451577_0021757 3300042876 Bacteria 5864
473 Ga0453684_0002459 3300044712 Bacteria 44922
474 Ga0466960_0165918 3300044901 Bacteria 1189
475 Ga0451576_0001107 3300045051 Bacteria 49185
476 Ga0451576_0008931 3300045051 Bacteria 11690
477 Ga0451576_0079706 3300045051 Bacteria 3407
478 Ga0451576_0104634 3300045051 Bacteria 2944
479 Ga0451576_0107249 3300045051 Bacteria 2906
480 Ga0451576_0116553 3300045051 Bacteria 2781
481 Ga0495617_000020 3300046452 Bacteria 230257
482 Ga0495627_000004 3300046453 Bacteria 640612
483 Ga0495627_016628 3300046453 Bacteria 2515
484 Ga0495592_0010390 3300046454 Bacteria 7022
485 Ga0495592_0014005 3300046454 Bacteria 6092
486 Ga0495592_0029825 3300046454 Bacteria 4127
487 Ga0495592_0126836 3300046454 Bacteria 1789
488 Ga0495603_0317435 3300046455 Bacteria 894
489 Ga0495590_0000012 3300046457 Bacteria 303377
490 Ga0495629_0213540 3300046459 Bacteria 1332
491 Ga0495638_0000047 3300046460 Bacteria 216004
492 Ga0495638_0112350 3300046460 Bacteria 1617
493 Ga0495638_0123734 3300046460 Bacteria 1526
494 Ga0495641_0003418 3300046461 Bacteria 11897
495 Ga0495651_0000274 3300046462 Bacteria 40100
496 Ga0495651_0001676 3300046462 Bacteria 17133
497 Ga0495651_0385390 3300046462 Bacteria 918
498 Ga0495653_0000035 3300046463 Bacteria 129875
499 Ga0495653_0005409 3300046463 Bacteria 10393
500 Ga0495650_0000128 3300046471 Bacteria 177256
501 Ga0495650_0000157 3300046471 Bacteria 155023
502 Ga0495650_0000261 3300046471 Bacteria 101830
503 Ga0495650_0002873 3300046471 Bacteria 13135
504 Ga0495650_0015617 3300046471 Bacteria 3886
505 Ga0495650_0029788 3300046471 Bacteria 2483
506 Ga0495580_0011719 3300046472 Bacteria 6772
507 Ga0495580_0045545 3300046472 Bacteria 3115
508 Ga0495582_0018307 3300046473 Bacteria 3832
509 Ga0495605_0000018 3300046474 Bacteria 270187
510 Ga0495639_0002991 3300046475 Bacteria 7359
511 Ga0495639_0021855 3300046475 Bacteria 2803
512 Ga0495639_0025710 3300046475 Bacteria 2598
513 Ga0495662_0040946 3300046476 Bacteria 2237
514 Ga0495662_0309770 3300046476 Bacteria 776
515 Ga0495664_0499015 3300046477 Bacteria 727
516 Ga0495584_0201659 3300046491 Bacteria 1011
517 Ga0495585_0006253 3300046492 Bacteria 7417
518 Ga0495607_0006186 3300046501 Bacteria 8459
519 Ga0495607_0007691 3300046501 Bacteria 7428
520 Ga0495607_0102330 3300046501 Bacteria 1532
521 Ga0495583_0002050 3300046506 Bacteria 18274
522 Ga0495606_0000288 3300046507 Bacteria 87389
523 Ga0495606_0000512 3300046507 Bacteria 63012
524 Ga0495606_0000790 3300046507 Bacteria 48364
525 Ga0495606_0001762 3300046507 Bacteria 27726
526 Ga0495606_0001799 3300046507 Bacteria 27290
527 Ga0495606_0004472 3300046507 Bacteria 13939
528 Ga0495606_0059541 3300046507 Bacteria 2449
529 Ga0495608_0000767 3300046511 Bacteria 22475
530 Ga0495608_0007610 3300046511 Bacteria 7636
531 Ga0495608_0358870 3300046511 Bacteria 896
532 Ga0495608_0410027 3300046511 Bacteria 828
533 Ga0495608_0480883 3300046511 Bacteria 753
534 Ga0495610_0000014 3300046512 Bacteria 444708
535 Ga0495610_0018280 3300046512 Bacteria 3964
536 Ga0495610_0077986 3300046512 Bacteria 1528
537 Ga0495618_0085019 3300046514 Bacteria 2021
538 Ga0495618_0142955 3300046514 Bacteria 1530
539 Ga0495628_0003354 3300046516 Bacteria 14318
540 Ga0495628_0009437 3300046516 Bacteria 8329
541 Ga0495628_0029940 3300046516 Bacteria 4410
542 Ga0495628_0033466 3300046516 Bacteria 4142
543 Ga0495628_0249247 3300046516 Bacteria 1326
544 Ga0495630_0010824 3300046517 Bacteria 6587
545 Ga0495630_0153015 3300046517 Bacteria 1755
546 Ga0495630_0308259 3300046517 Bacteria 1210
547 Ga0495630_0460573 3300046517 Bacteria 974
548 Ga0495637_0000142 3300046520 Bacteria 54212
549 Ga0495637_0003152 3300046520 Bacteria 8802
550 Ga0495643_0000082 3300046522 Bacteria 159651
551 Ga0495643_0000160 3300046522 Bacteria 107502
552 Ga0495643_0087501 3300046522 Bacteria 1612
553 Ga0495644_0255344 3300046523 Bacteria 681
554 Ga0495648_0000019 3300046524 Bacteria 276407
555 Ga0495648_0013458 3300046524 Bacteria 6046
556 Ga0495648_0085582 3300046524 Bacteria 1780
557 Ga0495666_0003438 3300046526 Bacteria 7983
558 Ga0495666_0005319 3300046526 Bacteria 6490
559 Ga0495666_0012214 3300046526 Bacteria 4285
560 Ga0495642_0000449 3300046528 Bacteria 21699
561 Ga0495642_0056212 3300046528 Bacteria 1625
562 Ga0495652_0002976 3300046529 Bacteria 17031
563 Ga0495652_0105783 3300046529 Bacteria 2273
564 Ga0495652_0189848 3300046529 Bacteria 1569
565 Ga0495652_0291170 3300046529 Bacteria 1191
566 Ga0495654_0000014 3300046530 Bacteria 312126
567 Ga0495654_0011993 3300046530 Bacteria 4671
568 Ga0495654_0022625 3300046530 Bacteria 3261
569 Ga0495665_0004802 3300046531 Bacteria 7298
570 Ga0495640_0005911 3300046533 Bacteria 9704
571 Ga0495640_0013075 3300046533 Bacteria 6321
572 Ga0495640_0024651 3300046533 Bacteria 4374
573 Ga0495586_0000624 3300046535 Bacteria 20417
574 Ga0495586_0009851 3300046535 Bacteria 5087
575 Ga0495586_0032785 3300046535 Bacteria 2786
576 Ga0495586_0327673 3300046535 Bacteria 878
577 Ga0495587_0002749 3300046536 Bacteria 11735
578 Ga0495598_0066056 3300046537 Bacteria 1127
579 Ga0495609_0002203 3300046538 Bacteria 12207
580 Ga0495621_0144887 3300046539 Bacteria 931
581 Ga0495597_0000535 3300046542 Bacteria 31448
582 Ga0495597_0001237 3300046542 Bacteria 18972
583 Ga0495645_0000247 3300046543 Bacteria 39450
584 Ga0495622_0000034 3300046557 Bacteria 123671
585 Ga0495622_0000071 3300046557 Bacteria 89071
586 Ga0495622_0031570 3300046557 Bacteria 2475
587 Ga0495622_0342749 3300046557 Bacteria 647
588 Ga0495633_0000086 3300046558 Bacteria 124357
589 Ga0495633_0000217 3300046558 Bacteria 71892
590 Ga0495633_0001397 3300046558 Bacteria 18813
591 Ga0495633_0007711 3300046558 Bacteria 6157
592 Ga0495667_0007160 3300046559 Bacteria 7569
593 Ga0495667_0037931 3300046559 Bacteria 3210
594 Ga0495656_0060460 3300046615 Bacteria 1651
595 Ga0495668_0000308 3300046616 Bacteria 67599
596 Ga0495668_0002035 3300046616 Bacteria 17616
597 Ga0495668_0002147 3300046616 Bacteria 16956
598 Ga0495634_0004588 3300046642 Bacteria 10791
599 Ga0495634_0004750 3300046642 Bacteria 10569
600 Ga0495625_0000447 3300046660 Bacteria 62017
601 Ga0495625_0005159 3300046660 Bacteria 12053
602 Ga0495625_0008737 3300046660 Bacteria 8587
603 Ga0495625_0046579 3300046660 Bacteria 3128
604 Ga0495625_0105079 3300046660 Bacteria 1935
605 Ga0495635_0031638 3300046663 Bacteria 3672
606 Ga0495635_0053171 3300046663 Bacteria 2790
607 Ga0495635_0114624 3300046663 Bacteria 1840
608 Ga0495588_0001603 3300046674 Bacteria 9665
609 Ga0495657_0009194 3300046675 Bacteria 7501
610 Ga0495657_0149832 3300046675 Bacteria 1449
611 Ga0495657_0159736 3300046675 Bacteria 1395
612 Ga0495599_0000345 3300046678 Bacteria 27538
613 Ga0495599_0003076 3300046678 Bacteria 9713
614 Ga0495599_0026190 3300046678 Bacteria 3654
615 Ga0495647_0003049 3300046681 Bacteria 5338
616 Ga0495647_0008774 3300046681 Bacteria 3404
617 Ga0495658_0002606 3300046683 Bacteria 9064
618 Ga0495658_0029738 3300046683 Bacteria 2960
619 Ga0495658_0046930 3300046683 Bacteria 2430
620 Ga0495669_0007028 3300046684 Bacteria 4712
621 Ga0495669_0023987 3300046684 Bacteria 2658
622 Ga0495613_0194236 3300046689 Bacteria 1433
623 Ga0495624_0130294 3300046690 Bacteria 1542
624 Ga0495624_0196387 3300046690 Bacteria 1226
625 Ga0495671_0045889 3300046692 Bacteria 2186
626 Ga0495649_0052695 3300046694 Bacteria 2204
627 Ga0495649_0084220 3300046694 Bacteria 1698
628 Ga0495649_0275169 3300046694 Bacteria 861
629 Ga0495600_0001375 3300046809 Bacteria 13432
630 Ga0495600_0026672 3300046809 Bacteria 3730
631 Ga0495660_0014380 3300046810 Bacteria 4580
632 Ga0495660_0032898 3300046810 Bacteria 2910
633 Ga0495660_0121922 3300046810 Bacteria 1318
634 Ga0495581_0303242 3300047315 Bacteria 933
635 Ga0495581_0337778 3300047315 Bacteria 879
636 Ga0495604_0003259 3300047317 Bacteria 12969
637 Ga0495604_0116248 3300047317 Bacteria 1942
638 Ga0495604_0449448 3300047317 Bacteria 842
639 Ga0495636_0015316 3300047318 Bacteria 3056
640 Ga0495636_0036828 3300047318 Bacteria 2019
641 Ga0495674_0005197 3300047319 Bacteria 12503
642 Ga0495674_0345786 3300047319 Bacteria 1208
643 Ga0495672_0000081 3300047320 Bacteria 159863
644 Ga0495676_0014246 3300047321 Bacteria 7118
645 Ga0495680_0007743 3300047322 Bacteria 9811
646 Ga0495680_0027785 3300047322 Bacteria 4642
647 Ga0495680_0093036 3300047322 Bacteria 2257
648 Ga0495680_0373459 3300047322 Bacteria 989
649 Ga0495687_000172 3300047443 Bacteria 95963
650 Ga0495687_000699 3300047443 Bacteria 37523
651 Ga0495675_0007491 3300047444 Bacteria 6723
652 Ga0495677_0040057 3300047445 Bacteria 1713
653 Ga0495685_029749 3300047447 Bacteria 1878
654 Ga0495673_0000008 3300047469 Bacteria 752462
655 Ga0495673_0000009 3300047469 Bacteria 731993
656 Ga0495673_0000012 3300047469 Bacteria 656908
657 Ga0495681_0029400 3300047470 Bacteria 2812
658 Ga0495684_0004387 3300047471 Bacteria 11028
659 Ga0495686_0000677 3300047472 Bacteria 46044
660 Ga0495686_0128925 3300047472 Bacteria 1501
661 Ga0495686_0201909 3300047472 Bacteria 1140
662 Ga0495593_0096696 3300047673 Bacteria 1517
663 Ga0495614_0117339 3300048089 Bacteria 1172
664 Ga0495615_0021049 3300048090 Bacteria 1468
665 Ga0495615_0058711 3300048090 Bacteria 1010
666 Ga0496102_0000153 3300048905 Bacteria 94014
667 Ga0496102_0111852 3300048905 Bacteria 2546
668 Ga0496103_0033276 3300048906 Bacteria 3149
669 Ga0496107_0052423 3300048910 Bacteria 2943
670 Ga0496116_0020942 3300048919 Bacteria 4947
671 Ga0496116_0021069 3300048919 Bacteria 4927
672 Ga0496116_0033493 3300048919 Bacteria 3646
673 Ga0496117_0000075 3300048920 Bacteria 232451
674 Ga0496118_0000055 3300048921 Bacteria 232451
675 Ga0496121_0013029 3300048924 Bacteria 8981
676 Ga0496121_0044969 3300048924 Bacteria 3801
677 Ga0496121_0143142 3300048924 Bacteria 1770
678 Ga0496122_0000905 3300048925 Bacteria 54607
679 Ga0496122_0003176 3300048925 Bacteria 21923
680 Ga0496122_0083088 3300048925 Bacteria 2222
681 Ga0496123_0000227 3300048926 Bacteria 113878
682 Ga0496123_0008164 3300048926 Bacteria 9657
683 Ga0496123_0009479 3300048926 Bacteria 8763
684 Ga0496124_0071124 3300048927 Bacteria 2885
685 Ga0496125_0004412 3300048928 Bacteria 16261
686 Ga0496125_0081932 3300048928 Bacteria 2462
687 Ga0496126_0062219 3300048929 Bacteria 3350
688 Ga0495678_000027 3300049459 Bacteria 222075
689 Ga0495678_000346 3300049459 Bacteria 48212
690 Ga0495678_072886 3300049459 Bacteria 1253
691 Ga0495682_0000999 3300049460 Bacteria 16865
692 Ga0501298_032199 3300049521 Bacteria 1034
693 Ga0501299_025603 3300049522 Bacteria 1109
694 Ga0501031_0137678 3300049568 Bacteria 1595
695 Ga0501031_0394860 3300049568 Bacteria 895
696 Ga0501032_0022145 3300049569 Bacteria 4409
697 Ga0501033_0027066 3300049570 Bacteria 4314
698 Ga0501036_0028859 3300049572 Bacteria 4689
699 Ga0501036_0034164 3300049572 Bacteria 4301
700 Ga0501036_0096441 3300049572 Bacteria 2500
701 Ga0501036_0125475 3300049572 Bacteria 2168
702 Ga0501036_0259984 3300049572 Bacteria 1454
703 Ga0501036_0423243 3300049572 Bacteria 1110
704 Ga0501038_0012391 3300049574 Bacteria 7793
705 Ga0501038_0018090 3300049574 Bacteria 6366
706 Ga0501038_0134073 3300049574 Bacteria 2030
707 Ga0501039_0004420 3300049575 Bacteria 10611
708 Ga0501039_0020079 3300049575 Bacteria 5122
709 Ga0501039_0028296 3300049575 Bacteria 4314
710 Ga0501039_0028433 3300049575 Bacteria 4304
711 Ga0501039_0104525 3300049575 Bacteria 2211
712 Ga0501039_0402373 3300049575 Bacteria 1075
713 Ga0501039_0421402 3300049575 Bacteria 1048
714 Ga0501039_0451743 3300049575 Bacteria 1009
715 Ga0501040_0003267 3300049576 Bacteria 10476
716 Ga0501040_0049194 3300049576 Bacteria 2882
717 Ga0501040_0188182 3300049576 Bacteria 1464
718 Ga0501040_0212066 3300049576 Bacteria 1377
719 Ga0501040_0233148 3300049576 Bacteria 1311
720 Ga0501040_0492212 3300049576 Bacteria 884
721 Ga0501040_0792258 3300049576 Bacteria 686
722 Ga0501041_0001563 3300049577 Bacteria 12746
723 Ga0501041_0077698 3300049577 Bacteria 2042
724 Ga0501041_0078616 3300049577 Bacteria 2030
725 Ga0501041_0137778 3300049577 Bacteria 1521
726 Ga0501042_0003021 3300049578 Bacteria 10463
727 Ga0501042_0028035 3300049578 Bacteria 3963
728 Ga0501042_0145705 3300049578 Bacteria 1707
729 Ga0501043_0201724 3300049579 Bacteria 1544
730 Ga0501046_0003243 3300049580 Bacteria 14952
731 Ga0501046_0066204 3300049580 Bacteria 2817
732 Ga0501046_0150053 3300049580 Bacteria 1759
733 Ga0501047_0627558 3300049581 Bacteria 895
734 Ga0501048_0037202 3300049582 Bacteria 3495
735 Ga0501048_0049791 3300049582 Bacteria 2985
736 Ga0501048_0137962 3300049582 Bacteria 1724
737 Ga0501068_0002746 3300049584 Bacteria 9355
738 Ga0501068_0017863 3300049584 Bacteria 4106
739 Ga0501068_0212704 3300049584 Bacteria 1228
740 Ga0501069_0467099 3300049585 Bacteria 751
741 Ga0501070_0017200 3300049586 Bacteria 6070
742 Ga0501071_0016570 3300049587 Bacteria 5070
743 Ga0501071_0174342 3300049587 Bacteria 1610
744 Ga0501072_0001241 3300049588 Bacteria 19034
745 Ga0501072_0033082 3300049588 Bacteria 4051
746 Ga0501072_0037703 3300049588 Bacteria 3791
747 Ga0501072_0042063 3300049588 Bacteria 3589
748 Ga0501072_0106886 3300049588 Bacteria 2226
749 Ga0501073_0092142 3300049589 Bacteria 2106
750 Ga0501073_0166125 3300049589 Bacteria 1528
751 Ga0501073_0233571 3300049589 Bacteria 1270
752 Ga0501073_0282222 3300049589 Bacteria 1146
753 Ga0501073_0289539 3300049589 Bacteria 1130
754 Ga0501074_0044148 3300049590 Bacteria 3227
755 Ga0501074_0045115 3300049590 Bacteria 3189
756 Ga0501074_0637043 3300049590 Bacteria 753
757 Ga0501075_0002198 3300049591 Bacteria 12907
758 Ga0501075_0004962 3300049591 Bacteria 9071
759 Ga0501075_0042626 3300049591 Bacteria 3403
760 Ga0501075_0044205 3300049591 Bacteria 3341
761 Ga0501075_0070668 3300049591 Bacteria 2638
762 Ga0501076_0140173 3300049592 Bacteria 1964
763 Ga0501076_0218356 3300049592 Bacteria 1558
764 Ga0501076_0411484 3300049592 Bacteria 1112
765 Ga0501076_0446871 3300049592 Bacteria 1064
766 Ga0501077_0018016 3300049593 Bacteria 4463
767 Ga0501077_0096517 3300049593 Bacteria 1873
768 Ga0501217_068489 3300049661 Bacteria 962
769 Ga0501235_074948 3300049669 Bacteria 804
770 Ga0501236_006844 3300049670 Bacteria 1411
771 Ga0501249_030899 3300049679 Bacteria 1193
772 Ga0501249_056783 3300049679 Bacteria 904
773 Ga0501079_0021474 3300049741 Bacteria 4939
774 Ga0501079_0022439 3300049741 Bacteria 4840
775 Ga0501079_0147299 3300049741 Bacteria 1835
776 Ga0501079_0232064 3300049741 Bacteria 1441
777 Ga0501079_0257772 3300049741 Bacteria 1363
778 Ga0501080_0000634 3300049742 Bacteria 27899
779 Ga0501080_0004675 3300049742 Bacteria 12215
780 Ga0501080_0018543 3300049742 Bacteria 6438
781 Ga0501080_0129192 3300049742 Bacteria 2339
782 Ga0501080_0180518 3300049742 Bacteria 1943
783 Ga0501080_0201540 3300049742 Bacteria 1827
784 Ga0501081_0034464 3300049743 Bacteria 3444
785 Ga0501081_0052616 3300049743 Bacteria 2811
786 Ga0501081_0190171 3300049743 Bacteria 1486
787 Ga0501269_000005 3300049766 Bacteria 77832
788 Ga0501035_0540006 3300049822 Bacteria 956
789 Ga0501045_0033124 3300049824 Bacteria 3746
790 Ga0501045_0042472 3300049824 Bacteria 3309
791 Ga0501045_0146997 3300049824 Bacteria 1753
792 Ga0501045_0246281 3300049824 Bacteria 1330
793 Ga0501045_0802043 3300049824 Bacteria 693
794 nmdc:mga03683_37441_c1 3300050489 Bacteria 1977
795 nmdc:mga00v17_48250_c1 3300050491 Bacteria 2580
796 nmdc:mga00v17_705929_c1 3300050491 Bacteria 646
797 nmdc:mga05p37_389_c1 3300050507 Bacteria 47594
798 nmdc:mga05p37_956513_c1 3300050507 Bacteria 916
799 nmdc:mga09592_166_c1 3300050508 Bacteria 46469
800 nmdc:mga09592_37356_c1 3300050508 Bacteria 4074
801 nmdc:mga09592_60352_c1 3300050508 Bacteria 3206
802 nmdc:mga09592_66351_c1 3300050508 Bacteria 3059
803 nmdc:mga0qj67_110224_c1 3300050509 Bacteria 2222
804 nmdc:mga06r32_182006_c1 3300050510 Bacteria 2087
805 nmdc:mga06r32_628086_c1 3300050510 Bacteria 1044
806 nmdc:mga06r32_846051_c1 3300050510 Bacteria 874
807 nmdc:mga08y16_194690_c1 3300050511 Bacteria 2102
808 nmdc:mga08y16_2159_c1 3300050511 Bacteria 20171
809 nmdc:mga08y16_219039_c1 3300050511 Bacteria 1971
810 nmdc:mga0n895_251343_c1 3300050512 Bacteria 1794
811 nmdc:mga0n895_278079_c1 3300050512 Bacteria 1698
812 nmdc:mga0n895_291533_c1 3300050512 Bacteria 1654
813 nmdc:mga0n895_344472_c1 3300050512 Bacteria 1509
814 nmdc:mga0n895_67926_c1 3300050512 Bacteria 3531
815 nmdc:mga0n895_734_c1 3300050512 Bacteria 23141
816 nmdc:mga0n895_7924_c1 3300050512 Bacteria 9159
817 nmdc:mga0rr50_117062_c1 3300050513 Bacteria 2116
818 nmdc:mga0rr50_120136_c1 3300050513 Bacteria 2090
819 nmdc:mga0rr50_12102_c1 3300050513 Bacteria 5559
820 nmdc:mga0rr50_179807_c1 3300050513 Bacteria 1728
821 nmdc:mga0rr50_2416_c1 3300050513 Bacteria 10515
822 nmdc:mga0rr50_364350_c1 3300050513 Bacteria 1217
823 nmdc:mga0rr50_3670_c1 3300050513 Bacteria 8893
824 nmdc:mga0rr50_373862_c1 3300050513 Bacteria 1201
825 nmdc:mga0rr50_454279_c1 3300050513 Bacteria 1086
826 nmdc:mga0rr50_75238_c1 3300050513 Bacteria 2588
827 nmdc:mga08x19_14881_c1 3300050514 Bacteria 4725
828 nmdc:mga08x19_1688_c1 3300050514 Bacteria 13577
829 nmdc:mga08x19_175777_c1 3300050514 Bacteria 1460
830 nmdc:mga08x19_258_c1 3300050514 Bacteria 28365
831 nmdc:mga08x19_259714_c1 3300050514 Bacteria 1200
832 nmdc:mga08x19_41284_c1 3300050514 Bacteria 2938
833 nmdc:mga08x19_431957_c1 3300050514 Bacteria 926
834 nmdc:mga08x19_43525_c1 3300050514 Bacteria 2865
835 nmdc:mga08x19_759_c1 3300050514 Bacteria 20607
836 nmdc:mga08x19_7654_c1 3300050514 Bacteria 6416
837 nmdc:mga0a205_17979_c1 3300050515 Bacteria 6639
838 nmdc:mga0a205_348268_c1 3300050515 Bacteria 1349
839 nmdc:mga0a205_484503_c1 3300050515 Bacteria 1095
840 nmdc:mga0a205_747479_c1 3300050515 Bacteria 827
841 Ga0495601_0003245 3300053077 Bacteria 9294
842 Ga0495601_0021328 3300053077 Bacteria 3967
843 Ga0495601_0058084 3300053077 Bacteria 2451
844 Ga0495601_0586061 3300053077 Bacteria 716
845 Ga0495612_0045727 3300053078 Bacteria 1792
846 Ga0495595_0000266 3300053084 Bacteria 20675
847 Ga0500618_000170 3300053125 Bacteria 54570
848 Ga0500586_017123 3300053145 Bacteria 2212
849 Ga0501084_0005520 3300054114 Bacteria 10383
850 Ga0501084_0006302 3300054114 Bacteria 9749
851 Ga0501084_0493841 3300054114 Bacteria 1034
852 Ga0590071_021793 3300059421 Bacteria 1511
853 Ga0501082_0000750 3300060353 Bacteria 28493
854 Ga0501082_0814886 3300060353 Bacteria 817
855 Ga0530510_0000245 3300061734 Bacteria 34065
856 Ga0530510_0004031 3300061734 Bacteria 10140
857 Ga0530510_0015381 3300061734 Bacteria 5407
858 Ga0530510_0348995 3300061734 Bacteria 1111
859 2511249690 2511231003 Bacteria 5606035
860 2550695170 2548876994 Bacteria 4904866
861 2554818193 2554235132 Bacteria 6772433
862 2601666856 2600255292 Bacteria 6300551
863 2608380509 2606217733 Bacteria 6360972
864 2738826215 2738541297 Bacteria 6549566
865 2739150012 2738541357 Bacteria 6549408
866 2739191931 2738543003 Bacteria 6549560
867 2739318408 2738543026 Bacteria 6549408
868 2739336649 2738543029 Bacteria 6549249
869 2819592776 2818991445 Bacteria 4955017
870 2821134982 2821131069 Bacteria 6108407
871 2842715841 2842711865 Bacteria 7155354
872 2857552751 2857547612 Bacteria 6179999
873 2857558119 2857553236 Bacteria 6166726
874 2857558768 2857558681 Bacteria 6617694
875 2857569645 2857564685 Bacteria 6290584
876 2884815960 2884811622 Bacteria 5552861
877 2884838657 2884836552 Bacteria 5219991
878 2884854948 2884852848 Bacteria 5221161
879 2885086331 2885080285 Bacteria 6355622
880 2896156383 2896154374 Bacteria 5221518
881 2904428346 2904424332 Bacteria 7633521
882 2919049068 2919046199 Bacteria 5567169
883 2919476427 2919476304 Bacteria 5888696
884 2932415678 2932410948 Bacteria 6312192
885 2932421668 2932416698 Bacteria 6315112
886 2952255907 2952252522 Bacteria 4171745
887 Ga0081538_10154911
888 JGI25155J39150_1000252
889 JGI25155J39150_1000471
890 JGI25156J39149_1000288
891 JGI25156J39149_1004072
892 JGI25154J39366_1000311
893 JGI25154J39366_1000313
894 JGI25157J39369_1000171
895 JGI25150J39212_1001839
896 JGI25151J46595_10051050
897 Ga0007417J51691_1079838
898 Ga0055532_1000044
899 Ga0055535_1006487
900 Ga0055529_1000015
901 Ga0055526_1000007
902 Ga0055526_1000037
903 Ga0065714_10176867
904 Ga0065714_10183074
905 Ga0065707_10028354
906 Ga0065707_10093232
907 Ga0065707_10146765
908 Ga0070676_10100527
909 Ga0070690_100000183
910 Ga0070690_100028668
911 Ga0068869_100000139
912 Ga0070666_10261455
913 Ga0070680_100000688
914 Ga0070680_100328147
915 Ga0070680_100435945
916 Ga0070682_100059915
917 Ga0068868_100000115
918 Ga0070689_100001743
919 Ga0070689_100052931
920 Ga0070689_100463101
921 Ga0070691_10008416
922 Ga0070691_10163927
923 Ga0070687_100000091
924 Ga0070687_100057792
925 Ga0070687_100064050
926 Ga0070687_100099246
927 Ga0070692_10304212
928 Ga0070668_100051434
929 Ga0070675_100165495
930 Ga0070675_100663011
931 Ga0070674_100088353
932 Ga0070659_100082251
933 Ga0070703_10007089
934 Ga0070709_10180189
935 Ga0070701_10778781
936 Ga0070705_100000441
937 Ga0070705_100100728
938 Ga0070705_100441138
939 Ga0070700_100001332
940 Ga0070700_100002644
941 Ga0070700_100114033
942 Ga0070694_100000133
943 Ga0070694_100018018
944 Ga0070694_100028039
945 Ga0070694_100044368
946 Ga0070694_100071913
947 Ga0070694_100203836
948 Ga0070694_100243243
949 Ga0070694_100281743
950 Ga0070694_100359985
951 Ga0070694_100646632
952 Ga0070708_100105538
953 Ga0070681_10000081
954 Ga0070681_10018249
955 Ga0070681_10153316
956 Ga0070681_10195826
957 Ga0068867_100000084
958 Ga0068867_100002479
959 Ga0070706_100076438
960 Ga0070707_100026726
961 Ga0070698_101290778
962 Ga0070699_100050684
963 Ga0070679_100042718
964 Ga0070679_100155414
965 Ga0070684_100202324
966 Ga0070697_100000299
967 Ga0070697_100004807
968 Ga0070697_100211102
969 Ga0068853_100058101
970 Ga0070672_100504943
971 Ga0070686_100000193
972 Ga0070686_100139498
973 Ga0070686_100242193
974 Ga0070695_100000163
975 Ga0070695_100006828
976 Ga0070695_100027364
977 Ga0070695_100087620
978 Ga0070695_100098397
979 Ga0070695_100110894
980 Ga0070696_100000570
981 Ga0070696_100004599
982 Ga0070696_100013604
983 Ga0070696_100215508
984 Ga0070693_100000111
985 Ga0070704_100000008
986 Ga0070704_100182942
987 Ga0068855_100000242
988 Ga0068855_100152556
989 Ga0068855_100211348
990 Ga0068854_100006366
991 Ga0068856_100160335
992 Ga0068856_100423008
993 Ga0070702_100000012
994 Ga0068852_100269519
995 Ga0068852_100756740
996 Ga0068859_100005212
997 Ga0068859_100547586
998 Ga0068864_100059830
999 Ga0068864_100254119
1000 Ga0068866_10000109
1001 Ga0068861_100000814
1002 Ga0068861_100011165
1003 Ga0068870_10095558
1004 Ga0068870_10135470
1005 Ga0068858_100023814
1006 Ga0068858_100381916
1007 Ga0068862_100002876
1008 Ga0068862_100008234
1009 Ga0075364_10346816
1010 Ga0075364_10745886
1011 Ga0070715_10132417
1012 Ga0070716_100026868
1013 Ga0070716_100168241
1014 Ga0070716_100292238
1015 Ga0070716_100747894
1016 Ga0075362_10008204
1017 Ga0097621_100003524
1018 Ga0097621_100028427
1019 Ga0068871_100000559
1020 Ga0068871_100014580
1021 Ga0075428_100033964
1022 Ga0075428_100664862
1023 Ga0075430_100006977
1024 Ga0075430_100977377
1025 Ga0075431_100247744
1026 Ga0075433_10006494
1027 Ga0075433_10283872
1028 Ga0075434_100000079
1029 Ga0075434_100001287
1030 Ga0075434_100020461
1031 Ga0075434_100214916
1032 Ga0075434_100247060
1033 Ga0075434_100501681
1034 Ga0075434_100813005
1035 Ga0075429_100000891
1036 Ga0075429_100048189
1037 Ga0075429_100067097
1038 Ga0068865_100002206
1039 Ga0068865_100004107
1040 Ga0075436_100000789
1041 Ga0075436_100008442
1042 Ga0075436_100027934
1043 Ga0075436_100135911
1044 Ga0075436_100228214
1045 Ga0075436_100494859
1046 Ga0097620_100005212
1047 Ga0097620_100547583
1048 Ga0079104_1011322
1049 Ga0075435_100000655
1050 Ga0075435_100003904
1051 Ga0075435_100010489
1052 Ga0075435_100083036
1053 Ga0075435_100095897
1054 Ga0075435_100222527
1055 Ga0075435_100271705
1056 Ga0075435_100468995
1057 Ga0099794_10121695
1058 Ga0099795_10055246
1059 Ga0105244_10000412
1060 Ga0105244_10041635
1061 Ga0105244_10304845
1062 Ga0105250_10146464
1063 Ga0105240_10007532
1064 Ga0105240_10026536
1065 Ga0105240_10316720
1066 Ga0111539_10011985
1067 Ga0111539_10013498
1068 Ga0111539_10029705
1069 Ga0111539_10613481
1070 Ga0105245_10000245
1071 Ga0105245_10026778
1072 Ga0114129_10000219
1073 Ga0114129_10241959
1074 Ga0114129_10418725
1075 Ga0114129_11276693
1076 Ga0114129_11552568
1077 Ga0105243_10000279
1078 Ga0105241_10062959
1079 Ga0105242_10000480
1080 Ga0105242_10046492
1081 Ga0105242_10156759
1082 Ga0105248_10502895
1083 Ga0105237_10181974
1084 Ga0105238_10047036
1085 Ga0105249_10007151
1086 Ga0105249_10086025
1087 Ga0099796_10035086
1088 Ga0157373_10220548
1089 Ga0157378_10000294
1090 Ga0163162_10101727
1091 Ga0157372_10961460
1092 Ga0163163_11624610
1093 Ga0157380_10284264
1094 Ga0182008_10000609
1095 Ga0157377_10004975
1096 Ga0157379_10029733
1097 Ga0157379_10169377
1098 Ga0157376_10002130
1099 Ga0182006_1000023
1100 Ga0182006_1000125
1101 Ga0182006_1009055
1102 Ga0182007_10000082
1103 Ga0182005_1000006
1104 Ga0182005_1000047
1105 Ga0163161_10013268
1106 Ga0163161_10070329
1107 Ga0163161_10607694
1108 Ga0213872_10079118
1109 Ga0213872_10199498
1110 Ga0209435_100004
1111 Ga0209435_100168
1112 Ga0209147_100011
1113 Ga0209437_100207
1114 Ga0209258_100279
1115 Ga0207425_1000176
1116 Ga0209646_1000125
1117 Ga0209646_1000140
1118 Ga0209646_1000205
1119 Ga0209026_1000066
1120 Ga0209026_1002319
1121 Ga0209026_1030661
1122 Ga0209148_1013906
1123 Ga0209759_1000114
1124 Ga0209759_1000961
1125 Ga0209233_1020816
1126 Ga0209455_1000031
1127 Ga0209455_1004399
1128 Ga0209025_1003577
1129 Ga0209564_1000010
1130 Ga0209564_1000042
1131 Ga0209758_1000433
1132 Ga0207655_1001385
1133 Ga0207655_1005830
1134 Ga0207713_1026364
1135 Ga0207653_10025685
1136 Ga0207642_10004540
1137 Ga0207688_10034174
1138 Ga0207647_10068324
1139 Ga0207684_10011988
1140 Ga0207684_10849722
1141 Ga0207654_10002619
1142 Ga0207707_10007590
1143 Ga0207707_10179483
1144 Ga0207707_10221069
1145 Ga0207695_10007348
1146 Ga0207671_10111165
1147 Ga0207671_10164735
1148 Ga0207663_10309528
1149 Ga0207660_10002762
1150 Ga0207660_10051323
1151 Ga0207660_10418387
1152 Ga0207662_10000176
1153 Ga0207662_10020338
1154 Ga0207662_10031534
1155 Ga0207662_10673954
1156 Ga0207652_10005421
1157 Ga0207652_10096934
1158 Ga0207646_10022393
1159 Ga0207646_10034021
1160 Ga0207681_10074197
1161 Ga0207694_10509441
1162 Ga0207659_10008745
1163 Ga0207659_10430550
1164 Ga0207659_10854406
1165 Ga0207687_10001352
1166 Ga0207687_10058530
1167 Ga0207686_10000627
1168 Ga0207686_10128102
1169 Ga0207709_10000549
1170 Ga0207709_10009164
1171 Ga0207670_10039886
1172 Ga0207670_10043125
1173 Ga0207669_10317121
1174 Ga0207704_10000329
1175 Ga0207704_10018414
1176 Ga0207665_10007215
1177 Ga0207665_10136089
1178 Ga0207665_10161652
1179 Ga0207691_10120139
1180 Ga0207711_10434006
1181 Ga0207661_10090479
1182 Ga0207712_10022192
1183 Ga0207668_10016248
1184 Ga0207640_10033700
1185 Ga0207677_10000669
1186 Ga0207677_10059997
1187 Ga0207677_10699518
1188 Ga0207703_10005933
1189 Ga0207703_10029223
1190 Ga0207639_10040826
1191 Ga0207708_10000275
1192 Ga0207708_10037205
1193 Ga0207708_10411784
1194 Ga0207702_10071848
1195 Ga0207648_10000185
1196 Ga0207648_10001654
1197 Ga0207676_10567431
1198 Ga0207674_10103608
1199 Ga0207675_100000150
1200 Ga0207675_100080942
1201 Ga0207683_10115993
1202 Ga0207698_10267892
1203 Ga0207698_10283503
1204 Ga0209281_1003338
1205 Ga0209969_1002680
1206 Ga0209969_1012340
1207 Ga0209967_1000561
1208 Ga0209967_1003478
1209 Ga0210000_1000970
1210 Ga0210000_1001740
1211 Ga0209995_1001745
1212 Ga0209179_1004916
1213 Ga0209968_1004125
1214 Ga0209999_1005018
1215 Ga0209999_1017181
1216 Ga0209588_1007435
1217 Ga0209971_1081568
1218 Ga0209966_1004277
1219 Ga0209974_10016022
1220 Ga0207428_10000290
1221 Ga0207428_10025385
1222 Ga0207428_10047565
1223 Ga0207428_10063834
1224 Ga0207428_10496211
1225 Ga0268265_10001010
1226 Ga0268265_10008669
1227 Ga0307517_10206767
1228 Ga0307515_10139635
1229 Ga0316181_1151886
1230 Ga0307408_100066343
1231 Ga0307408_100299524
1232 Ga0316575_10001586
1233 Ga0316575_10003078
1234 Ga0316575_10133838
1235 Ga0316579_10006383
1236 Ga0265314_10023239
1237 Ga0316578_10006914
1238 Ga0316578_10019153
1239 Ga0307405_10003031
1240 Ga0316577_10011728
1241 Ga0316577_10145427
1242 Ga0307413_10103949
1243 Ga0307410_10000539
1244 Ga0307406_10014860
1245 Ga0307407_10069599
1246 Ga0307412_10019535
1247 Ga0307416_100141028
1248 Ga0307416_100273486
1249 Ga0307416_100484985
1250 Ga0307416_100765238
1251 Ga0307416_100828917
1252 Ga0307416_100989201
1253 Ga0307416_101753204
1254 Ga0307411_10062647
1255 Ga0307411_10648036
1256 Ga0307415_100045681
1257 Ga0316583_10131148
1258 Ga0316585_10047728
1259 Ga0316580_10020002
1260 Ga0316593_10008065
1261 Ga0373934_0000524
1262 Ga0373934_0003529
1263 Ga0373934_0027468
1264 Ga0373944_0000909
1265 Ga0373949_0009770
1266 Ga0373952_0010157
1267 Ga0373923_0001446
1268 Ga0373923_0022790
1269 Ga0373936_0003119
1270 Ga0373936_0011164
1271 Ga0373936_0110585
1272 Ga0373939_0003574
1273 Ga0373939_0041704
1274 Ga0373941_0038627
1275 Ga0373941_0049333
1276 Ga0373953_0022814
1277 Ga0373954_0002148
1278 Ga0373954_0037910
1279 Ga0373956_0000135
1280 Ga0373956_0010109
1281 Ga0373957_0007330
1282 Ga0373957_0008551
1283 Ga0373960_0108099
1284 Ga0373960_0108280
1285 Ga0373943_0110815
1286 Ga0373946_0057881
1287 Ga0373946_0063474
1288 Ga0373955_0007893
1289 Ga0373955_0068738
1290 Ga0373955_0261814
1291 Ga0373942_0025084
1292 Ga0373942_0084666
1293 Ga0373961_0004525
1294 Ga0373961_0026789
1295 Ga0373961_0036263
1296 Ga0373962_0001944
1297 Ga0316574_0002868
1298 Ga0316574_0064011
1299 Ga0316574_0122577
1300 Ga0373924_0024443
1301 Ga0373924_0047708
1302 Ga0373924_0196319
1303 Ga0373924_0269742
1304 Ga0373931_0000163
1305 Ga0373931_0020082
1306 Ga0373931_0184591
1307 Ga0373931_0482561
1308 Ga0373935_0046669
1309 Ga0373935_0118923
1310 Ga0373935_0646776
1311 Ga0373927_0018600
1312 Ga0373933_0002313
1313 Ga0373933_0008376
1314 Ga0373933_0070820
1315 Ga0373933_0627181
1316 Ga0373947_0032914
1317 Ga0373947_0139496
1318 Ga0373947_0156143
1319 Ga0373947_0175104
1320 Ga0373937_0001313
1321 Ga0373937_0033470
1322 Ga0373937_0067095
1323 Ga0373937_0076864
1324 Ga0373937_0140242
1325 Ga0373937_0172469
1326 Ga0373937_0209683
1327 Ga0316582_0014225
1328 Ga0316582_0023391
1329 Ga0316584_0231204
1330 Ga0373925_0025897
1331 Ga0373925_0108840
1332 Ga0316581_0003333
1333 Ga0436360_1247629
1334 Ga0436361_0031960
1335 Ga0436361_0183378
1336 Ga0436361_0224368
1337 Ga0436361_0475359
1338 Ga0439439_0092299
1339 Ga0439453_0003405
1340 Ga0439466_0071477
1341 Ga0451800_1368170
1342 Ga0451853_2519352
1343 Ga0439441_001220
1344 Ga0439441_008765
1345 Ga0439451_010902
1346 Ga0439454_014529
1347 Ga0439446_0008714
1348 Ga0439446_0042915
1349 Ga0439434_0000867
1350 Ga0439434_0045763
1351 Ga0439435_0000145
1352 Ga0439435_0002402
1353 Ga0439435_0024654
1354 Ga0439444_0016130
1355 Ga0439460_0000484
1356 Ga0439460_0070741
1357 Ga0450893_0059299
1358 Ga0451577_0021757
1359 Ga0453684_0002459
1360 Ga0466960_0165918
1361 Ga0451576_0001107
1362 Ga0451576_0008931
1363 Ga0451576_0079706
1364 Ga0451576_0104634
1365 Ga0451576_0107249
1366 Ga0451576_0116553
1367 Ga0495617_000020
1368 Ga0495627_000004
1369 Ga0495627_016628
1370 Ga0495592_0010390
1371 Ga0495592_0014005
1372 Ga0495592_0029825
1373 Ga0495592_0126836
1374 Ga0495603_0317435
1375 Ga0495590_0000012
1376 Ga0495629_0213540
1377 Ga0495638_0000047
1378 Ga0495638_0112350
1379 Ga0495638_0123734
1380 Ga0495641_0003418
1381 Ga0495651_0000274
1382 Ga0495651_0001676
1383 Ga0495651_0385390
1384 Ga0495653_0000035
1385 Ga0495653_0005409
1386 Ga0495650_0000128
1387 Ga0495650_0000157
1388 Ga0495650_0000261
1389 Ga0495650_0002873
1390 Ga0495650_0015617
1391 Ga0495650_0029788
1392 Ga0495580_0011719
1393 Ga0495580_0045545
1394 Ga0495582_0018307
1395 Ga0495605_0000018
1396 Ga0495639_0002991
1397 Ga0495639_0021855
1398 Ga0495639_0025710
1399 Ga0495662_0040946
1400 Ga0495662_0309770
1401 Ga0495664_0499015
1402 Ga0495584_0201659
1403 Ga0495585_0006253
1404 Ga0495607_0006186
1405 Ga0495607_0007691
1406 Ga0495607_0102330
1407 Ga0495583_0002050
1408 Ga0495606_0000288
1409 Ga0495606_0000512
1410 Ga0495606_0000790
1411 Ga0495606_0001762
1412 Ga0495606_0001799
1413 Ga0495606_0004472
1414 Ga0495606_0059541
1415 Ga0495608_0000767
1416 Ga0495608_0007610
1417 Ga0495608_0358870
1418 Ga0495608_0410027
1419 Ga0495608_0480883
1420 Ga0495610_0000014
1421 Ga0495610_0018280
1422 Ga0495610_0077986
1423 Ga0495618_0085019
1424 Ga0495618_0142955
1425 Ga0495628_0003354
1426 Ga0495628_0009437
1427 Ga0495628_0029940
1428 Ga0495628_0033466
1429 Ga0495628_0249247
1430 Ga0495630_0010824
1431 Ga0495630_0153015
1432 Ga0495630_0308259
1433 Ga0495630_0460573
1434 Ga0495637_0000142
1435 Ga0495637_0003152
1436 Ga0495643_0000082
1437 Ga0495643_0000160
1438 Ga0495643_0087501
1439 Ga0495644_0255344
1440 Ga0495648_0000019
1441 Ga0495648_0013458
1442 Ga0495648_0085582
1443 Ga0495666_0003438
1444 Ga0495666_0005319
1445 Ga0495666_0012214
1446 Ga0495642_0000449
1447 Ga0495642_0056212
1448 Ga0495652_0002976
1449 Ga0495652_0105783
1450 Ga0495652_0189848
1451 Ga0495652_0291170
1452 Ga0495654_0000014
1453 Ga0495654_0011993
1454 Ga0495654_0022625
1455 Ga0495665_0004802
1456 Ga0495640_0005911
1457 Ga0495640_0013075
1458 Ga0495640_0024651
1459 Ga0495586_0000624
1460 Ga0495586_0009851
1461 Ga0495586_0032785
1462 Ga0495586_0327673
1463 Ga0495587_0002749
1464 Ga0495598_0066056
1465 Ga0495609_0002203
1466 Ga0495621_0144887
1467 Ga0495597_0000535
1468 Ga0495597_0001237
1469 Ga0495645_0000247
1470 Ga0495622_0000034
1471 Ga0495622_0000071
1472 Ga0495622_0031570
1473 Ga0495622_0342749
1474 Ga0495633_0000086
1475 Ga0495633_0000217
1476 Ga0495633_0001397
1477 Ga0495633_0007711
1478 Ga0495667_0007160
1479 Ga0495667_0037931
1480 Ga0495656_0060460
1481 Ga0495668_0000308
1482 Ga0495668_0002035
1483 Ga0495668_0002147
1484 Ga0495634_0004588
1485 Ga0495634_0004750
1486 Ga0495625_0000447
1487 Ga0495625_0005159
1488 Ga0495625_0008737
1489 Ga0495625_0046579
1490 Ga0495625_0105079
1491 Ga0495635_0031638
1492 Ga0495635_0053171
1493 Ga0495635_0114624
1494 Ga0495588_0001603
1495 Ga0495657_0009194
1496 Ga0495657_0149832
1497 Ga0495657_0159736
1498 Ga0495599_0000345
1499 Ga0495599_0003076
1500 Ga0495599_0026190
1501 Ga0495647_0003049
1502 Ga0495647_0008774
1503 Ga0495658_0002606
1504 Ga0495658_0029738
1505 Ga0495658_0046930
1506 Ga0495669_0007028
1507 Ga0495669_0023987
1508 Ga0495613_0194236
1509 Ga0495624_0130294
1510 Ga0495624_0196387
1511 Ga0495671_0045889
1512 Ga0495649_0052695
1513 Ga0495649_0084220
1514 Ga0495649_0275169
1515 Ga0495600_0001375
1516 Ga0495600_0026672
1517 Ga0495660_0014380
1518 Ga0495660_0032898
1519 Ga0495660_0121922
1520 Ga0495581_0303242
1521 Ga0495581_0337778
1522 Ga0495604_0003259
1523 Ga0495604_0116248
1524 Ga0495604_0449448
1525 Ga0495636_0015316
1526 Ga0495636_0036828
1527 Ga0495674_0005197
1528 Ga0495674_0345786
1529 Ga0495672_0000081
1530 Ga0495676_0014246
1531 Ga0495680_0007743
1532 Ga0495680_0027785
1533 Ga0495680_0093036
1534 Ga0495680_0373459
1535 Ga0495687_000172
1536 Ga0495687_000699
1537 Ga0495675_0007491
1538 Ga0495677_0040057
1539 Ga0495685_029749
1540 Ga0495673_0000008
1541 Ga0495673_0000009
1542 Ga0495673_0000012
1543 Ga0495681_0029400
1544 Ga0495684_0004387
1545 Ga0495686_0000677
1546 Ga0495686_0128925
1547 Ga0495686_0201909
1548 Ga0495593_0096696
1549 Ga0495614_0117339
1550 Ga0495615_0021049
1551 Ga0495615_0058711
1552 Ga0496102_0000153
1553 Ga0496102_0111852
1554 Ga0496103_0033276
1555 Ga0496107_0052423
1556 Ga0496116_0020942
1557 Ga0496116_0021069
1558 Ga0496116_0033493
1559 Ga0496117_0000075
1560 Ga0496118_0000055
1561 Ga0496121_0013029
1562 Ga0496121_0044969
1563 Ga0496121_0143142
1564 Ga0496122_0000905
1565 Ga0496122_0003176
1566 Ga0496122_0083088
1567 Ga0496123_0000227
1568 Ga0496123_0008164
1569 Ga0496123_0009479
1570 Ga0496124_0071124
1571 Ga0496125_0004412
1572 Ga0496125_0081932
1573 Ga0496126_0062219
1574 Ga0495678_000027
1575 Ga0495678_000346
1576 Ga0495678_072886
1577 Ga0495682_0000999
1578 Ga0501298_032199
1579 Ga0501299_025603
1580 Ga0501031_0137678
1581 Ga0501031_0394860
1582 Ga0501032_0022145
1583 Ga0501033_0027066
1584 Ga0501036_0028859
1585 Ga0501036_0034164
1586 Ga0501036_0096441
1587 Ga0501036_0125475
1588 Ga0501036_0259984
1589 Ga0501036_0423243
1590 Ga0501038_0012391
1591 Ga0501038_0018090
1592 Ga0501038_0134073
1593 Ga0501039_0004420
1594 Ga0501039_0020079
1595 Ga0501039_0028296
1596 Ga0501039_0028433
1597 Ga0501039_0104525
1598 Ga0501039_0402373
1599 Ga0501039_0421402
1600 Ga0501039_0451743
1601 Ga0501040_0003267
1602 Ga0501040_0049194
1603 Ga0501040_0188182
1604 Ga0501040_0212066
1605 Ga0501040_0233148
1606 Ga0501040_0492212
1607 Ga0501040_0792258
1608 Ga0501041_0001563
1609 Ga0501041_0077698
1610 Ga0501041_0078616
1611 Ga0501041_0137778
1612 Ga0501042_0003021
1613 Ga0501042_0028035
1614 Ga0501042_0145705
1615 Ga0501043_0201724
1616 Ga0501046_0003243
1617 Ga0501046_0066204
1618 Ga0501046_0150053
1619 Ga0501047_0627558
1620 Ga0501048_0037202
1621 Ga0501048_0049791
1622 Ga0501048_0137962
1623 Ga0501068_0002746
1624 Ga0501068_0017863
1625 Ga0501068_0212704
1626 Ga0501069_0467099
1627 Ga0501070_0017200
1628 Ga0501071_0016570
1629 Ga0501071_0174342
1630 Ga0501072_0001241
1631 Ga0501072_0033082
1632 Ga0501072_0037703
1633 Ga0501072_0042063
1634 Ga0501072_0106886
1635 Ga0501073_0092142
1636 Ga0501073_0166125
1637 Ga0501073_0233571
1638 Ga0501073_0282222
1639 Ga0501073_0289539
1640 Ga0501074_0044148
1641 Ga0501074_0045115
1642 Ga0501074_0637043
1643 Ga0501075_0002198
1644 Ga0501075_0004962
1645 Ga0501075_0042626
1646 Ga0501075_0044205
1647 Ga0501075_0070668
1648 Ga0501076_0140173
1649 Ga0501076_0218356
1650 Ga0501076_0411484
1651 Ga0501076_0446871
1652 Ga0501077_0018016
1653 Ga0501077_0096517
1654 Ga0501217_068489
1655 Ga0501235_074948
1656 Ga0501236_006844
1657 Ga0501249_030899
1658 Ga0501249_056783
1659 Ga0501079_0021474
1660 Ga0501079_0022439
1661 Ga0501079_0147299
1662 Ga0501079_0232064
1663 Ga0501079_0257772
1664 Ga0501080_0000634
1665 Ga0501080_0004675
1666 Ga0501080_0018543
1667 Ga0501080_0129192
1668 Ga0501080_0180518
1669 Ga0501080_0201540
1670 Ga0501081_0034464
1671 Ga0501081_0052616
1672 Ga0501081_0190171
1673 Ga0501269_000005
1674 Ga0501035_0540006
1675 Ga0501045_0033124
1676 Ga0501045_0042472
1677 Ga0501045_0146997
1678 Ga0501045_0246281
1679 Ga0501045_0802043
1680 nmdc:mga03683_37441_c1
1681 nmdc:mga00v17_48250_c1
1682 nmdc:mga00v17_705929_c1
1683 nmdc:mga05p37_389_c1
1684 nmdc:mga05p37_956513_c1
1685 nmdc:mga09592_166_c1
1686 nmdc:mga09592_37356_c1
1687 nmdc:mga09592_60352_c1
1688 nmdc:mga09592_66351_c1
1689 nmdc:mga0qj67_110224_c1
1690 nmdc:mga06r32_182006_c1
1691 nmdc:mga06r32_628086_c1
1692 nmdc:mga06r32_846051_c1
1693 nmdc:mga08y16_194690_c1
1694 nmdc:mga08y16_2159_c1
1695 nmdc:mga08y16_219039_c1
1696 nmdc:mga0n895_251343_c1
1697 nmdc:mga0n895_278079_c1
1698 nmdc:mga0n895_291533_c1
1699 nmdc:mga0n895_344472_c1
1700 nmdc:mga0n895_67926_c1
1701 nmdc:mga0n895_734_c1
1702 nmdc:mga0n895_7924_c1
1703 nmdc:mga0rr50_117062_c1
1704 nmdc:mga0rr50_120136_c1
1705 nmdc:mga0rr50_12102_c1
1706 nmdc:mga0rr50_179807_c1
1707 nmdc:mga0rr50_2416_c1
1708 nmdc:mga0rr50_364350_c1
1709 nmdc:mga0rr50_3670_c1
1710 nmdc:mga0rr50_373862_c1
1711 nmdc:mga0rr50_454279_c1
1712 nmdc:mga0rr50_75238_c1
1713 nmdc:mga08x19_14881_c1
1714 nmdc:mga08x19_1688_c1
1715 nmdc:mga08x19_175777_c1
1716 nmdc:mga08x19_258_c1
1717 nmdc:mga08x19_259714_c1
1718 nmdc:mga08x19_41284_c1
1719 nmdc:mga08x19_431957_c1
1720 nmdc:mga08x19_43525_c1
1721 nmdc:mga08x19_759_c1
1722 nmdc:mga08x19_7654_c1
1723 nmdc:mga0a205_17979_c1
1724 nmdc:mga0a205_348268_c1
1725 nmdc:mga0a205_484503_c1
1726 nmdc:mga0a205_747479_c1
1727 Ga0495601_0003245
1728 Ga0495601_0021328
1729 Ga0495601_0058084
1730 Ga0495601_0586061
1731 Ga0495612_0045727
1732 Ga0495595_0000266
1733 Ga0500618_000170
1734 Ga0500586_017123
1735 Ga0501084_0005520
1736 Ga0501084_0006302
1737 Ga0501084_0493841
1738 Ga0590071_021793
1739 Ga0501082_0000750
1740 Ga0501082_0814886
1741 Ga0530510_0000245
1742 Ga0530510_0004031
1743 Ga0530510_0015381
1744 Ga0530510_0348995
1745 2511249690
1746 2550695170
1747 2554818193
1748 2601666856
1749 2608380509
1750 2738826215
1751 2739150012
1752 2739191931
1753 2739318408
1754 2739336649
1755 2819592776
1756 2821134982
1757 2842715841
1758 2857552751
1759 2857558119
1760 2857558768
1761 2857569645
1762 2884815960
1763 2884838657
1764 2884854948
1765 2885086331
1766 2896156383
1767 2904428346
1768 2919049068
1769 2919476427
1770 2932415678
1771 2932421668
1772 2952255907

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

66

209

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9853 5 186
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9747 5 186
4mu4-assembly1.cif.gz_A the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution 0.9701 3 196
5el9-assembly1.cif.gz_A a. thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (s)-c348, to 1.1a resolution 0.9682 3 196
6fwh-assembly1.cif.gz_A acanthamoeba igpd in complex with r-c348 to 1.7a resolution 0.9668 4 196
ID Description Score Start End Superfamily
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9814 2 92 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9679 93 184 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9672 93 186 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9575 93 184 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9573 93 186 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A3D0LTM6-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1.009 6 73 GO:0000105
GO:0004424
AF-A0A1Z9GWE8-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1.005 5 86 GO:0000105
GO:0004424
AF-A0A522GSK4-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1.005 6 80 GO:0000105
GO:0004424
AF-A0A2E4EWP6-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1.004 6 68 GO:0000105
GO:0004424
AF-A0A850D107-F1-model_v4 deleted 1.004 3 63

Map