F484692
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 886 | 394 | 1772 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300009036|Ga0105244_10284323|Ga0105244_102843231 |
| Length | 141 |
| Sequence | MGTIRQWPGPAPAEYPTLMPQGSHLESGKDAESLALRHLEQQGLRLLAQNWSCKRGELDLVMLDGDTVVFVEVRYRKNTQWGGAAGSIDARKRKKLIFAAQYFLQRESRWANSPCRFDVIAIEGALDTAPRLNWLRNAFDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 22 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 23 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 24 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 25 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 26 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 27 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 28 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 29 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 30 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 31 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 39 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 40 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 41 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 50 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 78 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 92 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 93 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 95 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 96 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 97 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 98 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 99 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 100 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 106 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 107 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 108 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 112 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 113 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 114 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 115 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 116 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 117 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 118 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 119 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 120 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 121 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 122 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 123 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 124 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 125 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 126 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 127 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 128 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 129 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 130 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 131 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 132 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 133 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 134 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 135 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 136 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 137 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 138 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 139 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 140 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 216 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 217 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 218 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 219 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 220 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 221 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 222 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 223 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 224 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 225 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 233 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 234 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 235 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 238 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 239 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 240 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 241 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 242 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 243 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 244 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 245 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 246 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 247 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 248 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 249 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 250 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 251 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 252 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 253 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 254 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 255 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 256 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 257 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 258 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 259 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 260 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 261 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 262 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 263 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 264 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 265 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 266 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 267 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 268 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 269 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 270 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 271 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 272 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 273 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 274 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 275 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 276 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 277 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 278 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 279 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 280 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 281 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 282 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 283 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 284 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 285 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 286 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 287 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 288 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 289 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 290 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 291 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 292 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 293 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 294 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 295 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 296 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 297 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 298 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 299 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 300 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 301 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 302 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 303 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 304 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 305 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 306 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 307 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 308 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 309 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 310 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 311 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 312 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 313 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 314 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 315 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 316 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 317 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 318 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 319 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 320 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 321 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 322 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 323 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 324 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 325 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 326 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 327 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 328 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 329 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 330 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 331 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 332 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 333 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 334 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 335 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 336 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 337 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 338 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 339 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 340 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 341 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 342 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 343 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 344 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 345 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 346 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 347 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 348 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 349 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 350 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 351 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 352 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 353 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 354 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 355 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 356 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 357 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 358 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 359 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 360 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 361 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 362 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 363 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 364 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 365 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 366 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 367 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 368 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 369 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 370 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 371 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 372 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 373 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 374 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 375 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 376 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 377 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 378 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 379 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 380 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 381 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 382 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 383 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 384 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 385 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 386 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 387 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 388 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 389 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 390 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 391 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 392 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 393 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 394 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.51 |
| Metatranscriptomes | 0 |
| Isolates | 17.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 5.76 |
| Nodule | 2.71 |
| Rhizoplane | 5.08 |
| Rhizosphere | 76.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105244_10284323 | 3300009036 | Bacteria | 767 |
| 2 | MRS2a_Contig_6365 | 2124908027 | Bacteria | 1672 |
| 3 | MRS2a_Contig_63 | 2124908027 | Bacteria | 63450 |
| 4 | JGI25162J39368_1002343 | 3300002737 | Bacteria | 7528 |
| 5 | JGI25162J39368_1002368 | 3300002737 | Bacteria | 7454 |
| 6 | JGI25164J39214_1001140 | 3300002772 | Bacteria | 7528 |
| 7 | JGI25164J39214_1001148 | 3300002772 | Bacteria | 7454 |
| 8 | JGI25165J46597_1002064 | 3300003214 | Bacteria | 7528 |
| 9 | JGI25165J46597_1002076 | 3300003214 | Bacteria | 7454 |
| 10 | rootH1_10113058 | 3300003323 | Bacteria | 1731 |
| 11 | Ga0055536_1002477 | 3300003781 | Bacteria | 10365 |
| 12 | Ga0055536_1009168 | 3300003781 | Bacteria | 4136 |
| 13 | Ga0055536_1009170 | 3300003781 | Bacteria | 4135 |
| 14 | Ga0055530_10002925 | 3300003791 | Bacteria | 10344 |
| 15 | Ga0055530_10003090 | 3300003791 | Bacteria | 9889 |
| 16 | Ga0055530_10003689 | 3300003791 | Bacteria | 8546 |
| 17 | Ga0055540_1002354 | 3300003792 | Bacteria | 10114 |
| 18 | Ga0055540_1002654 | 3300003792 | Bacteria | 9248 |
| 19 | Ga0055540_1002780 | 3300003792 | Bacteria | 8962 |
| 20 | Ga0055531_10000348 | 3300003794 | Bacteria | 45293 |
| 21 | Ga0055531_10090088 | 3300003794 | Bacteria | 653 |
| 22 | Ga0065714_10000200 | 3300005288 | Bacteria | 7519 |
| 23 | Ga0065714_10010890 | 3300005288 | Bacteria | 2161 |
| 24 | Ga0065714_10016682 | 3300005288 | Bacteria | 2476 |
| 25 | Ga0065714_10019055 | 3300005288 | Bacteria | 2100 |
| 26 | Ga0065714_10065997 | 3300005288 | Bacteria | 7859 |
| 27 | Ga0065714_10074076 | 3300005288 | Bacteria | 3085 |
| 28 | Ga0065714_10116478 | 3300005288 | Bacteria | 1402 |
| 29 | Ga0065714_10148665 | 3300005288 | Bacteria | 1120 |
| 30 | Ga0065704_10027423 | 3300005289 | Bacteria | 1241 |
| 31 | Ga0065704_10030190 | 3300005289 | Bacteria | 1276 |
| 32 | Ga0065704_10031494 | 3300005289 | Bacteria | 1051 |
| 33 | Ga0065704_10072936 | 3300005289 | Bacteria | 7776 |
| 34 | Ga0065704_10080368 | 3300005289 | Bacteria | 3958 |
| 35 | Ga0065704_10321926 | 3300005289 | Bacteria | 851 |
| 36 | Ga0065712_10000146 | 3300005290 | Bacteria | 63767 |
| 37 | Ga0065712_10000717 | 3300005290 | Bacteria | 8614 |
| 38 | Ga0065715_10153109 | 3300005293 | Bacteria | 1697 |
| 39 | Ga0070676_10582923 | 3300005328 | Bacteria | 804 |
| 40 | Ga0070714_100717935 | 3300005435 | Bacteria | 965 |
| 41 | Ga0070662_100651465 | 3300005457 | Bacteria | 888 |
| 42 | Ga0070665_100659418 | 3300005548 | Bacteria | 1059 |
| 43 | Ga0070665_100672402 | 3300005548 | Bacteria | 1048 |
| 44 | Ga0070702_101795896 | 3300005615 | Bacteria | 512 |
| 45 | Ga0070717_10948683 | 3300006028 | Bacteria | 783 |
| 46 | Ga0075363_100305575 | 3300006048 | Bacteria | 924 |
| 47 | Ga0075364_10084038 | 3300006051 | Bacteria | 2107 |
| 48 | Ga0075364_10151254 | 3300006051 | Bacteria | 1564 |
| 49 | Ga0075364_10549449 | 3300006051 | Bacteria | 789 |
| 50 | Ga0075432_10004050 | 3300006058 | Bacteria | 5003 |
| 51 | Ga0075432_10084883 | 3300006058 | Bacteria | 1152 |
| 52 | Ga0075432_10099805 | 3300006058 | Bacteria | 1071 |
| 53 | Ga0075432_10516211 | 3300006058 | Bacteria | 535 |
| 54 | Ga0075362_10179175 | 3300006177 | Bacteria | 1026 |
| 55 | Ga0075362_10190353 | 3300006177 | Bacteria | 996 |
| 56 | Ga0075369_10126777 | 3300006186 | Bacteria | 1158 |
| 57 | Ga0075366_10680393 | 3300006195 | Bacteria | 639 |
| 58 | Ga0075370_10312948 | 3300006353 | Bacteria | 935 |
| 59 | Ga0075370_10516229 | 3300006353 | Bacteria | 722 |
| 60 | Ga0075436_100477209 | 3300006914 | Bacteria | 910 |
| 61 | Ga0075436_100984525 | 3300006914 | Bacteria | 632 |
| 62 | Ga0079104_1002687 | 3300006946 | Bacteria | 9162 |
| 63 | Ga0079104_1003518 | 3300006946 | Bacteria | 7216 |
| 64 | Ga0099826_10037988 | 3300006948 | Bacteria | 3387 |
| 65 | Ga0105251_10000004 | 3300009011 | Bacteria | 285212 |
| 66 | Ga0105251_10004443 | 3300009011 | Bacteria | 9541 |
| 67 | Ga0105251_10007066 | 3300009011 | Bacteria | 6997 |
| 68 | Ga0105251_10152037 | 3300009011 | Bacteria | 1045 |
| 69 | Ga0105251_10376619 | 3300009011 | Bacteria | 650 |
| 70 | Ga0105244_10001043 | 3300009036 | Bacteria | 23186 |
| 71 | Ga0105244_10005209 | 3300009036 | Bacteria | 8698 |
| 72 | Ga0105244_10017949 | 3300009036 | Bacteria | 3983 |
| 73 | Ga0105244_10018410 | 3300009036 | Bacteria | 3919 |
| 74 | Ga0105244_10042431 | 3300009036 | Bacteria | 2352 |
| 75 | Ga0105244_10049032 | 3300009036 | Bacteria | 2160 |
| 76 | Ga0105244_10162520 | 3300009036 | Bacteria | 1066 |
| 77 | Ga0105250_10002390 | 3300009092 | Bacteria | 9469 |
| 78 | Ga0105250_10011759 | 3300009092 | Bacteria | 3627 |
| 79 | Ga0105250_10072110 | 3300009092 | Bacteria | 1396 |
| 80 | Ga0105250_10134459 | 3300009092 | Bacteria | 1022 |
| 81 | Ga0105250_10190386 | 3300009092 | Bacteria | 863 |
| 82 | Ga0105250_10223713 | 3300009092 | Bacteria | 799 |
| 83 | Ga0105243_10002016 | 3300009148 | Bacteria | 17266 |
| 84 | Ga0105243_10021965 | 3300009148 | Bacteria | 4847 |
| 85 | Ga0105243_10035653 | 3300009148 | Bacteria | 3858 |
| 86 | Ga0105243_10088108 | 3300009148 | Bacteria | 2550 |
| 87 | Ga0105243_10100894 | 3300009148 | Bacteria | 2396 |
| 88 | Ga0105243_10935939 | 3300009148 | Bacteria | 864 |
| 89 | Ga0105242_10108381 | 3300009176 | Bacteria | 2364 |
| 90 | Ga0105242_11007755 | 3300009176 | Bacteria | 841 |
| 91 | Ga0105238_11068549 | 3300009551 | Bacteria | 829 |
| 92 | Ga0105249_10068245 | 3300009553 | Bacteria | 3279 |
| 93 | Ga0105246_10003691 | 3300011119 | Bacteria | 9267 |
| 94 | Ga0105246_10007602 | 3300011119 | Bacteria | 6647 |
| 95 | Ga0105246_10051958 | 3300011119 | Bacteria | 2815 |
| 96 | Ga0157336_1021986 | 3300012477 | Bacteria | 584 |
| 97 | Ga0157345_1000406 | 3300012498 | Bacteria | 4559 |
| 98 | Ga0157347_1012782 | 3300012502 | Bacteria | 910 |
| 99 | Ga0157373_10006663 | 3300013100 | Bacteria | 8605 |
| 100 | Ga0157373_10011669 | 3300013100 | Bacteria | 6452 |
| 101 | Ga0157373_10035499 | 3300013100 | Bacteria | 3579 |
| 102 | Ga0157373_10081575 | 3300013100 | Bacteria | 2280 |
| 103 | Ga0157373_10612783 | 3300013100 | Bacteria | 793 |
| 104 | Ga0157371_10016794 | 3300013102 | Bacteria | 5452 |
| 105 | Ga0157371_10022390 | 3300013102 | Bacteria | 4632 |
| 106 | Ga0157371_10029549 | 3300013102 | Bacteria | 3961 |
| 107 | Ga0157371_10048074 | 3300013102 | Bacteria | 3033 |
| 108 | Ga0157371_10423721 | 3300013102 | Bacteria | 976 |
| 109 | Ga0157370_10100977 | 3300013104 | Bacteria | 2702 |
| 110 | Ga0157370_10129888 | 3300013104 | Bacteria | 2350 |
| 111 | Ga0157370_10308121 | 3300013104 | Bacteria | 1461 |
| 112 | Ga0157370_10440361 | 3300013104 | Bacteria | 1198 |
| 113 | Ga0157370_10470853 | 3300013104 | Bacteria | 1154 |
| 114 | Ga0157370_10538873 | 3300013104 | Bacteria | 1070 |
| 115 | Ga0157369_10004082 | 3300013105 | Bacteria | 17282 |
| 116 | Ga0157369_11743848 | 3300013105 | Bacteria | 633 |
| 117 | Ga0163162_10031182 | 3300013306 | Bacteria | 5286 |
| 118 | Ga0157372_10041925 | 3300013307 | Bacteria | 5061 |
| 119 | Ga0157375_10099065 | 3300013308 | Bacteria | 2993 |
| 120 | Ga0157375_11539420 | 3300013308 | Bacteria | 785 |
| 121 | Ga0157380_11096178 | 3300014326 | Bacteria | 835 |
| 122 | Ga0182008_10005981 | 3300014497 | Bacteria | 6851 |
| 123 | Ga0182008_10019027 | 3300014497 | Bacteria | 3550 |
| 124 | Ga0182008_10021627 | 3300014497 | Bacteria | 3303 |
| 125 | Ga0182008_10039351 | 3300014497 | Bacteria | 2363 |
| 126 | Ga0182008_10112047 | 3300014497 | Bacteria | 1352 |
| 127 | Ga0182008_10184842 | 3300014497 | Bacteria | 1056 |
| 128 | Ga0182006_1013528 | 3300015261 | Bacteria | 3539 |
| 129 | Ga0182006_1018530 | 3300015261 | Bacteria | 2940 |
| 130 | Ga0182006_1022967 | 3300015261 | Bacteria | 2586 |
| 131 | Ga0182006_1031971 | 3300015261 | Bacteria | 2117 |
| 132 | Ga0182007_10010960 | 3300015262 | Bacteria | 3552 |
| 133 | Ga0182007_10243394 | 3300015262 | Bacteria | 643 |
| 134 | Ga0182005_1011004 | 3300015265 | Bacteria | 2589 |
| 135 | Ga0182005_1025175 | 3300015265 | Bacteria | 1624 |
| 136 | Ga0163161_10033270 | 3300017792 | Bacteria | 3684 |
| 137 | Ga0163161_10098800 | 3300017792 | Bacteria | 2170 |
| 138 | Ga0163161_10198086 | 3300017792 | Bacteria | 1547 |
| 139 | Ga0163161_10618130 | 3300017792 | Bacteria | 895 |
| 140 | Ga0209760_100534 | 3300025207 | Bacteria | 7232 |
| 141 | Ga0209674_116692 | 3300025226 | Bacteria | 608 |
| 142 | Ga0209672_100625 | 3300025228 | Bacteria | 18270 |
| 143 | Ga0209563_102480 | 3300025230 | Bacteria | 4154 |
| 144 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 145 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 146 | Ga0209759_1015308 | 3300025256 | Bacteria | 1984 |
| 147 | Ga0209233_1000059 | 3300025261 | Bacteria | 414562 |
| 148 | Ga0209675_1004261 | 3300025291 | Bacteria | 6445 |
| 149 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 150 | Ga0209676_1017459 | 3300025292 | Bacteria | 2539 |
| 151 | Ga0209676_1019618 | 3300025292 | Bacteria | 2322 |
| 152 | Ga0209050_1000019 | 3300025298 | Bacteria | 608757 |
| 153 | Ga0209050_1000027 | 3300025298 | Bacteria | 483261 |
| 154 | Ga0209050_1004537 | 3300025298 | Bacteria | 9334 |
| 155 | Ga0209051_1000102 | 3300025303 | Bacteria | 162911 |
| 156 | Ga0209051_1000383 | 3300025303 | Bacteria | 62847 |
| 157 | Ga0209051_1008728 | 3300025303 | Bacteria | 5328 |
| 158 | Ga0209257_1000119 | 3300025304 | Bacteria | 225893 |
| 159 | Ga0209257_1011631 | 3300025304 | Bacteria | 4205 |
| 160 | Ga0207696_1000054 | 3300025711 | Bacteria | 266962 |
| 161 | Ga0207696_1000213 | 3300025711 | Bacteria | 87128 |
| 162 | Ga0207696_1003221 | 3300025711 | Bacteria | 7529 |
| 163 | Ga0207696_1008374 | 3300025711 | Bacteria | 3965 |
| 164 | Ga0207696_1049746 | 3300025711 | Bacteria | 1201 |
| 165 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 166 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 167 | Ga0207655_1001289 | 3300025728 | Bacteria | 23749 |
| 168 | Ga0207655_1004342 | 3300025728 | Bacteria | 10097 |
| 169 | Ga0207655_1009983 | 3300025728 | Bacteria | 5822 |
| 170 | Ga0207655_1012220 | 3300025728 | Bacteria | 5038 |
| 171 | Ga0207655_1015195 | 3300025728 | Bacteria | 4297 |
| 172 | Ga0207655_1015443 | 3300025728 | Bacteria | 4245 |
| 173 | Ga0207655_1016868 | 3300025728 | Bacteria | 3970 |
| 174 | Ga0207655_1048185 | 3300025728 | Bacteria | 1752 |
| 175 | Ga0207655_1053401 | 3300025728 | Bacteria | 1616 |
| 176 | Ga0207655_1108396 | 3300025728 | Bacteria | 943 |
| 177 | Ga0207713_1000013 | 3300025735 | Bacteria | 475751 |
| 178 | Ga0207713_1005285 | 3300025735 | Bacteria | 8122 |
| 179 | Ga0207713_1005703 | 3300025735 | Bacteria | 7730 |
| 180 | Ga0207713_1007779 | 3300025735 | Bacteria | 6256 |
| 181 | Ga0207713_1009866 | 3300025735 | Bacteria | 5341 |
| 182 | Ga0207713_1014244 | 3300025735 | Bacteria | 4145 |
| 183 | Ga0207713_1018723 | 3300025735 | Bacteria | 3418 |
| 184 | Ga0207713_1022092 | 3300025735 | Bacteria | 3031 |
| 185 | Ga0207713_1120972 | 3300025735 | Bacteria | 878 |
| 186 | Ga0207645_10662098 | 3300025907 | Bacteria | 709 |
| 187 | Ga0207681_10038543 | 3300025923 | Bacteria | 3167 |
| 188 | Ga0207664_10817785 | 3300025929 | Bacteria | 838 |
| 189 | Ga0207706_10052083 | 3300025933 | Bacteria | 3614 |
| 190 | Ga0207686_11047115 | 3300025934 | Bacteria | 664 |
| 191 | Ga0207709_10000224 | 3300025935 | Bacteria | 71687 |
| 192 | Ga0207709_10001009 | 3300025935 | Bacteria | 20872 |
| 193 | Ga0207709_10003502 | 3300025935 | Bacteria | 9294 |
| 194 | Ga0207709_10099832 | 3300025935 | Bacteria | 1916 |
| 195 | Ga0207709_10427187 | 3300025935 | Bacteria | 1019 |
| 196 | Ga0207678_10080860 | 3300026067 | Bacteria | 2782 |
| 197 | Ga0209281_1000015 | 3300027111 | Bacteria | 590084 |
| 198 | Ga0209281_1002030 | 3300027111 | Bacteria | 9176 |
| 199 | Ga0209281_1002560 | 3300027111 | Bacteria | 7081 |
| 200 | Ga0209371_1000372 | 3300027312 | Bacteria | 48390 |
| 201 | Ga0209969_1005590 | 3300027360 | Bacteria | 1768 |
| 202 | Ga0209981_1009128 | 3300027378 | Bacteria | 1354 |
| 203 | Ga0209981_1018505 | 3300027378 | Bacteria | 987 |
| 204 | Ga0209996_1001815 | 3300027395 | Bacteria | 2614 |
| 205 | Ga0209984_1000904 | 3300027424 | Bacteria | 3177 |
| 206 | Ga0210000_1043629 | 3300027462 | Bacteria | 714 |
| 207 | Ga0209995_1000370 | 3300027471 | Bacteria | 6974 |
| 208 | Ga0209968_1009181 | 3300027526 | Bacteria | 1511 |
| 209 | Ga0209983_1001799 | 3300027665 | Bacteria | 4764 |
| 210 | Ga0209983_1014344 | 3300027665 | Bacteria | 1633 |
| 211 | Ga0209971_1000990 | 3300027682 | Bacteria | 7309 |
| 212 | Ga0209974_10008818 | 3300027876 | Bacteria | 3437 |
| 213 | Ga0209974_10042207 | 3300027876 | Bacteria | 1519 |
| 214 | Ga0207428_10019963 | 3300027907 | Bacteria | 5707 |
| 215 | Ga0207428_10095682 | 3300027907 | Bacteria | 2301 |
| 216 | Ga0207428_10097055 | 3300027907 | Bacteria | 2281 |
| 217 | Ga0207428_10175017 | 3300027907 | Bacteria | 1624 |
| 218 | Ga0207428_10371753 | 3300027907 | Bacteria | 1050 |
| 219 | Ga0268266_11170812 | 3300028379 | Bacteria | 743 |
| 220 | Ga0307517_10304678 | 3300028786 | Bacteria | 891 |
| 221 | Ga0307515_10523950 | 3300028794 | Bacteria | 795 |
| 222 | Ga0268256_1000316 | 3300030500 | Bacteria | 48390 |
| 223 | Ga0307511_10041014 | 3300030521 | Bacteria | 3917 |
| 224 | Ga0316177_1067959 | 3300030731 | Bacteria | 707 |
| 225 | Ga0314311_1053106 | 3300030733 | Bacteria | 2373 |
| 226 | Ga0316179_1118252 | 3300030734 | Bacteria | 3410 |
| 227 | Ga0316178_1061339 | 3300030735 | Bacteria | 40218 |
| 228 | Ga0316183_1164786 | 3300030742 | Bacteria | 2969 |
| 229 | Ga0307513_10677141 | 3300031456 | Bacteria | 738 |
| 230 | Ga0307408_100000020 | 3300031548 | Bacteria | 340408 |
| 231 | Ga0307408_100026677 | 3300031548 | Bacteria | 3971 |
| 232 | Ga0307408_100052194 | 3300031548 | Bacteria | 2949 |
| 233 | Ga0307408_100084620 | 3300031548 | Bacteria | 2379 |
| 234 | Ga0307408_100155822 | 3300031548 | Bacteria | 1808 |
| 235 | Ga0307516_10758312 | 3300031730 | Bacteria | 630 |
| 236 | Ga0307405_10016467 | 3300031731 | Bacteria | 4032 |
| 237 | Ga0307405_10045984 | 3300031731 | Bacteria | 2678 |
| 238 | Ga0307413_10004776 | 3300031824 | Bacteria | 5950 |
| 239 | Ga0307413_10327181 | 3300031824 | Bacteria | 1173 |
| 240 | Ga0307413_10332244 | 3300031824 | Bacteria | 1165 |
| 241 | Ga0307413_10412353 | 3300031824 | Bacteria | 1061 |
| 242 | Ga0307410_11095442 | 3300031852 | Bacteria | 690 |
| 243 | Ga0307406_10068257 | 3300031901 | Bacteria | 2320 |
| 244 | Ga0307406_10081625 | 3300031901 | Bacteria | 2150 |
| 245 | Ga0307407_10164372 | 3300031903 | Bacteria | 1455 |
| 246 | Ga0307407_10252854 | 3300031903 | Bacteria | 1208 |
| 247 | Ga0307407_10535555 | 3300031903 | Bacteria | 863 |
| 248 | Ga0307412_10026347 | 3300031911 | Bacteria | 3612 |
| 249 | Ga0307412_10042695 | 3300031911 | Bacteria | 2948 |
| 250 | Ga0307412_10043739 | 3300031911 | Bacteria | 2918 |
| 251 | Ga0307412_10323155 | 3300031911 | Bacteria | 1228 |
| 252 | Ga0307409_100153497 | 3300031995 | Bacteria | 2003 |
| 253 | Ga0307409_100347020 | 3300031995 | Bacteria | 1399 |
| 254 | Ga0307409_101039419 | 3300031995 | Bacteria | 838 |
| 255 | Ga0307416_101199984 | 3300032002 | Bacteria | 864 |
| 256 | Ga0307416_102661354 | 3300032002 | Bacteria | 597 |
| 257 | Ga0307414_10022843 | 3300032004 | Bacteria | 3954 |
| 258 | Ga0307414_10347300 | 3300032004 | Bacteria | 1272 |
| 259 | Ga0307414_10407538 | 3300032004 | Bacteria | 1182 |
| 260 | Ga0307414_10428881 | 3300032004 | Bacteria | 1155 |
| 261 | Ga0307414_10574864 | 3300032004 | Bacteria | 1007 |
| 262 | Ga0307414_11071539 | 3300032004 | Bacteria | 743 |
| 263 | Ga0307411_10092469 | 3300032005 | Bacteria | 2115 |
| 264 | Ga0307411_10113658 | 3300032005 | Bacteria | 1943 |
| 265 | Ga0307411_10143139 | 3300032005 | Bacteria | 1765 |
| 266 | Ga0307411_10199398 | 3300032005 | Bacteria | 1535 |
| 267 | Ga0307510_10049362 | 3300033180 | Bacteria | 4476 |
| 268 | Ga0237819_00850 | 3300038705 | Bacteria | 9625 |
| 269 | Ga0439436_0001947 | 3300041404 | Bacteria | 6113 |
| 270 | Ga0439438_004835 | 3300041405 | Bacteria | 5071 |
| 271 | Ga0439438_005991 | 3300041405 | Bacteria | 4379 |
| 272 | Ga0439438_012496 | 3300041405 | Bacteria | 2602 |
| 273 | Ga0439438_013016 | 3300041405 | Bacteria | 2525 |
| 274 | Ga0439438_033892 | 3300041405 | Bacteria | 1347 |
| 275 | Ga0439438_035560 | 3300041405 | Bacteria | 1308 |
| 276 | Ga0439447_005256 | 3300041407 | Bacteria | 4323 |
| 277 | Ga0439447_007191 | 3300041407 | Bacteria | 3553 |
| 278 | Ga0439447_007499 | 3300041407 | Bacteria | 3456 |
| 279 | Ga0439447_028240 | 3300041407 | Bacteria | 1426 |
| 280 | Ga0439466_0002455 | 3300041411 | Bacteria | 7268 |
| 281 | Ga0439466_0012706 | 3300041411 | Bacteria | 3095 |
| 282 | Ga0439466_0030461 | 3300041411 | Bacteria | 1850 |
| 283 | Ga0439466_0039442 | 3300041411 | Bacteria | 1583 |
| 284 | Ga0439466_0059830 | 3300041411 | Bacteria | 1229 |
| 285 | Ga0439466_0088008 | 3300041411 | Bacteria | 975 |
| 286 | Ga0439465_0088938 | 3300041413 | Bacteria | 1055 |
| 287 | Ga0439432_006875 | 3300042006 | Bacteria | 4052 |
| 288 | Ga0439432_017053 | 3300042006 | Bacteria | 2439 |
| 289 | Ga0439451_015210 | 3300042009 | Bacteria | 1550 |
| 290 | Ga0439452_002068 | 3300042010 | Bacteria | 7620 |
| 291 | Ga0439452_003491 | 3300042010 | Bacteria | 5494 |
| 292 | Ga0439452_005492 | 3300042010 | Bacteria | 4074 |
| 293 | Ga0439452_006171 | 3300042010 | Bacteria | 3776 |
| 294 | Ga0439452_018818 | 3300042010 | Bacteria | 1834 |
| 295 | Ga0439452_055582 | 3300042010 | Bacteria | 897 |
| 296 | Ga0439456_008547 | 3300042013 | Bacteria | 2115 |
| 297 | Ga0439456_009482 | 3300042013 | Bacteria | 2010 |
| 298 | Ga0439456_064912 | 3300042013 | Bacteria | 805 |
| 299 | Ga0439463_000398 | 3300042016 | Bacteria | 12029 |
| 300 | Ga0439463_118357 | 3300042016 | Bacteria | 684 |
| 301 | Ga0450911_002061 | 3300042115 | Bacteria | 4138 |
| 302 | Ga0450911_014547 | 3300042115 | Bacteria | 1045 |
| 303 | Ga0450911_021889 | 3300042115 | Bacteria | 833 |
| 304 | Ga0450919_003656 | 3300042121 | Bacteria | 1909 |
| 305 | Ga0450919_015498 | 3300042121 | Bacteria | 860 |
| 306 | Ga0450920_002273 | 3300042122 | Bacteria | 3254 |
| 307 | Ga0450922_003438 | 3300042124 | Bacteria | 1459 |
| 308 | Ga0450922_007710 | 3300042124 | Bacteria | 1012 |
| 309 | Ga0450923_009756 | 3300042125 | Bacteria | 1687 |
| 310 | Ga0450923_019088 | 3300042125 | Bacteria | 1318 |
| 311 | Ga0450903_006890 | 3300042138 | Bacteria | 1880 |
| 312 | Ga0450906_038611 | 3300042145 | Bacteria | 842 |
| 313 | Ga0450907_001573 | 3300042146 | Bacteria | 4854 |
| 314 | Ga0450910_002470 | 3300042147 | Bacteria | 2427 |
| 315 | Ga0439446_0002625 | 3300042156 | Bacteria | 4340 |
| 316 | Ga0439446_0281111 | 3300042156 | Bacteria | 580 |
| 317 | Ga0450908_004130 | 3300042184 | Bacteria | 2805 |
| 318 | Ga0439434_0004449 | 3300042435 | Bacteria | 4099 |
| 319 | Ga0439464_0002011 | 3300042439 | Bacteria | 4930 |
| 320 | Ga0439464_0005339 | 3300042439 | Bacteria | 3318 |
| 321 | Ga0439464_0007803 | 3300042439 | Bacteria | 2801 |
| 322 | Ga0450893_0004562 | 3300042532 | Bacteria | 2207 |
| 323 | Ga0450893_0025484 | 3300042532 | Bacteria | 1037 |
| 324 | Ga0450901_007621 | 3300042533 | Bacteria | 1114 |
| 325 | Ga0495617_005254 | 3300046452 | Bacteria | 4609 |
| 326 | Ga0495617_018827 | 3300046452 | Bacteria | 2335 |
| 327 | Ga0495617_019507 | 3300046452 | Bacteria | 2293 |
| 328 | Ga0495617_038146 | 3300046452 | Bacteria | 1608 |
| 329 | Ga0495617_051979 | 3300046452 | Bacteria | 1362 |
| 330 | Ga0495617_056646 | 3300046452 | Bacteria | 1300 |
| 331 | Ga0495627_002521 | 3300046453 | Bacteria | 8738 |
| 332 | Ga0495627_009785 | 3300046453 | Bacteria | 3513 |
| 333 | Ga0495627_071325 | 3300046453 | Bacteria | 1014 |
| 334 | Ga0495627_095624 | 3300046453 | Bacteria | 851 |
| 335 | Ga0495627_221450 | 3300046453 | Bacteria | 519 |
| 336 | Ga0495603_0025579 | 3300046455 | Bacteria | 3569 |
| 337 | Ga0495590_0005392 | 3300046457 | Bacteria | 5076 |
| 338 | Ga0495590_0053578 | 3300046457 | Bacteria | 1409 |
| 339 | Ga0495590_0058969 | 3300046457 | Bacteria | 1342 |
| 340 | Ga0495590_0074039 | 3300046457 | Bacteria | 1197 |
| 341 | Ga0495590_0082356 | 3300046457 | Bacteria | 1134 |
| 342 | Ga0495591_000015 | 3300046458 | Bacteria | 252107 |
| 343 | Ga0495591_002895 | 3300046458 | Bacteria | 9205 |
| 344 | Ga0495591_004113 | 3300046458 | Bacteria | 7235 |
| 345 | Ga0495591_006233 | 3300046458 | Bacteria | 5317 |
| 346 | Ga0495591_008874 | 3300046458 | Bacteria | 4060 |
| 347 | Ga0495591_010833 | 3300046458 | Bacteria | 3495 |
| 348 | Ga0495591_011046 | 3300046458 | Bacteria | 3444 |
| 349 | Ga0495591_012960 | 3300046458 | Bacteria | 3075 |
| 350 | Ga0495591_014684 | 3300046458 | Bacteria | 2800 |
| 351 | Ga0495629_0033508 | 3300046459 | Bacteria | 3633 |
| 352 | Ga0495638_0000164 | 3300046460 | Bacteria | 103139 |
| 353 | Ga0495638_0014846 | 3300046460 | Bacteria | 5250 |
| 354 | Ga0495638_0014868 | 3300046460 | Bacteria | 5244 |
| 355 | Ga0495638_0080108 | 3300046460 | Bacteria | 1985 |
| 356 | Ga0495638_0134088 | 3300046460 | Bacteria | 1452 |
| 357 | Ga0495638_0178702 | 3300046460 | Bacteria | 1212 |
| 358 | Ga0495638_0186743 | 3300046460 | Bacteria | 1178 |
| 359 | Ga0495638_0192229 | 3300046460 | Bacteria | 1157 |
| 360 | Ga0495653_0001870 | 3300046463 | Bacteria | 16627 |
| 361 | Ga0495653_0046479 | 3300046463 | Bacteria | 3361 |
| 362 | Ga0495653_0056069 | 3300046463 | Bacteria | 3005 |
| 363 | Ga0495653_0076865 | 3300046463 | Bacteria | 2481 |
| 364 | Ga0495650_0004551 | 3300046471 | Bacteria | 9465 |
| 365 | Ga0495650_0011165 | 3300046471 | Bacteria | 4948 |
| 366 | Ga0495650_0015874 | 3300046471 | Bacteria | 3844 |
| 367 | Ga0495650_0016615 | 3300046471 | Bacteria | 3720 |
| 368 | Ga0495650_0017682 | 3300046471 | Bacteria | 3566 |
| 369 | Ga0495650_0045832 | 3300046471 | Bacteria | 1838 |
| 370 | Ga0495650_0087562 | 3300046471 | Bacteria | 1190 |
| 371 | Ga0495650_0109288 | 3300046471 | Bacteria | 1028 |
| 372 | Ga0495582_0011363 | 3300046473 | Bacteria | 4906 |
| 373 | Ga0495605_0003192 | 3300046474 | Bacteria | 9838 |
| 374 | Ga0495605_0007738 | 3300046474 | Bacteria | 6090 |
| 375 | Ga0495605_0008705 | 3300046474 | Bacteria | 5730 |
| 376 | Ga0495605_0010449 | 3300046474 | Bacteria | 5192 |
| 377 | Ga0495605_0010639 | 3300046474 | Bacteria | 5142 |
| 378 | Ga0495605_0010684 | 3300046474 | Bacteria | 5132 |
| 379 | Ga0495605_0015768 | 3300046474 | Bacteria | 4106 |
| 380 | Ga0495605_0088872 | 3300046474 | Bacteria | 1435 |
| 381 | Ga0495605_0092256 | 3300046474 | Bacteria | 1402 |
| 382 | Ga0495605_0133777 | 3300046474 | Bacteria | 1116 |
| 383 | Ga0495605_0239423 | 3300046474 | Bacteria | 779 |
| 384 | Ga0495639_0002688 | 3300046475 | Bacteria | 7725 |
| 385 | Ga0495639_0026561 | 3300046475 | Bacteria | 2559 |
| 386 | Ga0495584_0004204 | 3300046491 | Bacteria | 7769 |
| 387 | Ga0495584_0009064 | 3300046491 | Bacteria | 5140 |
| 388 | Ga0495584_0061895 | 3300046491 | Bacteria | 1881 |
| 389 | Ga0495584_0079759 | 3300046491 | Bacteria | 1647 |
| 390 | Ga0495584_0092146 | 3300046491 | Bacteria | 1528 |
| 391 | Ga0495584_0119702 | 3300046491 | Bacteria | 1333 |
| 392 | Ga0495584_0383041 | 3300046491 | Bacteria | 715 |
| 393 | Ga0495585_0011356 | 3300046492 | Bacteria | 5270 |
| 394 | Ga0495585_0017278 | 3300046492 | Bacteria | 4170 |
| 395 | Ga0495585_0081114 | 3300046492 | Bacteria | 1757 |
| 396 | Ga0495585_0122382 | 3300046492 | Bacteria | 1375 |
| 397 | Ga0495596_0006544 | 3300046500 | Bacteria | 5350 |
| 398 | Ga0495596_0083574 | 3300046500 | Bacteria | 1239 |
| 399 | Ga0495607_0002286 | 3300046501 | Bacteria | 15754 |
| 400 | Ga0495607_0005389 | 3300046501 | Bacteria | 9175 |
| 401 | Ga0495607_0005406 | 3300046501 | Bacteria | 9149 |
| 402 | Ga0495607_0005433 | 3300046501 | Bacteria | 9127 |
| 403 | Ga0495607_0013447 | 3300046501 | Bacteria | 5362 |
| 404 | Ga0495607_0014534 | 3300046501 | Bacteria | 5120 |
| 405 | Ga0495607_0014535 | 3300046501 | Bacteria | 5119 |
| 406 | Ga0495607_0022540 | 3300046501 | Bacteria | 3952 |
| 407 | Ga0495607_0028261 | 3300046501 | Bacteria | 3461 |
| 408 | Ga0495607_0035661 | 3300046501 | Bacteria | 3007 |
| 409 | Ga0495607_0045578 | 3300046501 | Bacteria | 2578 |
| 410 | Ga0495607_0051559 | 3300046501 | Bacteria | 2389 |
| 411 | Ga0495607_0096806 | 3300046501 | Bacteria | 1588 |
| 412 | Ga0495607_0121885 | 3300046501 | Bacteria | 1367 |
| 413 | Ga0495607_0185660 | 3300046501 | Bacteria | 1039 |
| 414 | Ga0495607_0378176 | 3300046501 | Bacteria | 648 |
| 415 | Ga0495583_0004401 | 3300046506 | Bacteria | 10106 |
| 416 | Ga0495583_0005753 | 3300046506 | Bacteria | 8298 |
| 417 | Ga0495583_0015958 | 3300046506 | Bacteria | 4059 |
| 418 | Ga0495583_0016145 | 3300046506 | Bacteria | 4026 |
| 419 | Ga0495583_0017659 | 3300046506 | Bacteria | 3781 |
| 420 | Ga0495583_0037496 | 3300046506 | Bacteria | 2297 |
| 421 | Ga0495583_0068785 | 3300046506 | Bacteria | 1560 |
| 422 | Ga0495606_0001115 | 3300046507 | Bacteria | 38368 |
| 423 | Ga0495606_0003532 | 3300046507 | Bacteria | 16531 |
| 424 | Ga0495606_0017307 | 3300046507 | Bacteria | 5456 |
| 425 | Ga0495606_0017986 | 3300046507 | Bacteria | 5318 |
| 426 | Ga0495606_0022667 | 3300046507 | Bacteria | 4566 |
| 427 | Ga0495606_0023324 | 3300046507 | Bacteria | 4487 |
| 428 | Ga0495606_0025496 | 3300046507 | Bacteria | 4232 |
| 429 | Ga0495606_0033353 | 3300046507 | Bacteria | 3551 |
| 430 | Ga0495606_0034211 | 3300046507 | Bacteria | 3490 |
| 431 | Ga0495606_0088915 | 3300046507 | Bacteria | 1903 |
| 432 | Ga0495606_0163539 | 3300046507 | Bacteria | 1296 |
| 433 | Ga0495610_0015699 | 3300046512 | Bacteria | 4390 |
| 434 | Ga0495610_0019105 | 3300046512 | Bacteria | 3844 |
| 435 | Ga0495610_0022319 | 3300046512 | Bacteria | 3464 |
| 436 | Ga0495610_0033789 | 3300046512 | Bacteria | 2640 |
| 437 | Ga0495610_0062866 | 3300046512 | Bacteria | 1760 |
| 438 | Ga0495610_0272314 | 3300046512 | Bacteria | 662 |
| 439 | Ga0495616_0009667 | 3300046513 | Bacteria | 5621 |
| 440 | Ga0495616_0016921 | 3300046513 | Bacteria | 4026 |
| 441 | Ga0495616_0018335 | 3300046513 | Bacteria | 3844 |
| 442 | Ga0495616_0055611 | 3300046513 | Bacteria | 1958 |
| 443 | Ga0495616_0148199 | 3300046513 | Bacteria | 1063 |
| 444 | Ga0495616_0226203 | 3300046513 | Bacteria | 812 |
| 445 | Ga0495616_0343692 | 3300046513 | Bacteria | 622 |
| 446 | Ga0495620_0008155 | 3300046515 | Bacteria | 5636 |
| 447 | Ga0495620_0008360 | 3300046515 | Bacteria | 5560 |
| 448 | Ga0495620_0009999 | 3300046515 | Bacteria | 5018 |
| 449 | Ga0495620_0010670 | 3300046515 | Bacteria | 4836 |
| 450 | Ga0495620_0042422 | 3300046515 | Bacteria | 1987 |
| 451 | Ga0495620_0081400 | 3300046515 | Bacteria | 1309 |
| 452 | Ga0495630_0317747 | 3300046517 | Bacteria | 1190 |
| 453 | Ga0495631_0006910 | 3300046518 | Bacteria | 5818 |
| 454 | Ga0495631_0008741 | 3300046518 | Bacteria | 5090 |
| 455 | Ga0495631_0009105 | 3300046518 | Bacteria | 4971 |
| 456 | Ga0495631_0016294 | 3300046518 | Bacteria | 3546 |
| 457 | Ga0495631_0121312 | 3300046518 | Bacteria | 1124 |
| 458 | Ga0495632_0010120 | 3300046519 | Bacteria | 5614 |
| 459 | Ga0495632_0011673 | 3300046519 | Bacteria | 5115 |
| 460 | Ga0495632_0011827 | 3300046519 | Bacteria | 5077 |
| 461 | Ga0495632_0014349 | 3300046519 | Bacteria | 4484 |
| 462 | Ga0495632_0017298 | 3300046519 | Bacteria | 3984 |
| 463 | Ga0495632_0034749 | 3300046519 | Bacteria | 2577 |
| 464 | Ga0495632_0087816 | 3300046519 | Bacteria | 1477 |
| 465 | Ga0495632_0230386 | 3300046519 | Bacteria | 835 |
| 466 | Ga0495632_0326219 | 3300046519 | Bacteria | 677 |
| 467 | Ga0495637_0002754 | 3300046520 | Bacteria | 9555 |
| 468 | Ga0495637_0006137 | 3300046520 | Bacteria | 6047 |
| 469 | Ga0495637_0007676 | 3300046520 | Bacteria | 5335 |
| 470 | Ga0495637_0009878 | 3300046520 | Bacteria | 4642 |
| 471 | Ga0495637_0011097 | 3300046520 | Bacteria | 4337 |
| 472 | Ga0495637_0013267 | 3300046520 | Bacteria | 3915 |
| 473 | Ga0495637_0014581 | 3300046520 | Bacteria | 3705 |
| 474 | Ga0495637_0023155 | 3300046520 | Bacteria | 2826 |
| 475 | Ga0495637_0029375 | 3300046520 | Bacteria | 2448 |
| 476 | Ga0495637_0137673 | 3300046520 | Bacteria | 928 |
| 477 | Ga0495637_0186339 | 3300046520 | Bacteria | 767 |
| 478 | Ga0495643_0001220 | 3300046522 | Bacteria | 24866 |
| 479 | Ga0495643_0014224 | 3300046522 | Bacteria | 4738 |
| 480 | Ga0495643_0014720 | 3300046522 | Bacteria | 4647 |
| 481 | Ga0495643_0016323 | 3300046522 | Bacteria | 4363 |
| 482 | Ga0495643_0022424 | 3300046522 | Bacteria | 3603 |
| 483 | Ga0495643_0072319 | 3300046522 | Bacteria | 1808 |
| 484 | Ga0495643_0092244 | 3300046522 | Bacteria | 1561 |
| 485 | Ga0495643_0134829 | 3300046522 | Bacteria | 1236 |
| 486 | Ga0495644_0011264 | 3300046523 | Bacteria | 3445 |
| 487 | Ga0495644_0024499 | 3300046523 | Bacteria | 2295 |
| 488 | Ga0495648_0002757 | 3300046524 | Bacteria | 15864 |
| 489 | Ga0495648_0020724 | 3300046524 | Bacteria | 4575 |
| 490 | Ga0495648_0068471 | 3300046524 | Bacteria | 2070 |
| 491 | Ga0495648_0141007 | 3300046524 | Bacteria | 1268 |
| 492 | Ga0495648_0157311 | 3300046524 | Bacteria | 1178 |
| 493 | Ga0495648_0285350 | 3300046524 | Bacteria | 780 |
| 494 | Ga0495648_0330859 | 3300046524 | Bacteria | 702 |
| 495 | Ga0495666_0008636 | 3300046526 | Bacteria | 5105 |
| 496 | Ga0495666_0015667 | 3300046526 | Bacteria | 3775 |
| 497 | Ga0495642_0004844 | 3300046528 | Bacteria | 5202 |
| 498 | Ga0495642_0086277 | 3300046528 | Bacteria | 1325 |
| 499 | Ga0495652_0152432 | 3300046529 | Bacteria | 1804 |
| 500 | Ga0495654_0004450 | 3300046530 | Bacteria | 8312 |
| 501 | Ga0495654_0007398 | 3300046530 | Bacteria | 6136 |
| 502 | Ga0495654_0014809 | 3300046530 | Bacteria | 4146 |
| 503 | Ga0495654_0015390 | 3300046530 | Bacteria | 4061 |
| 504 | Ga0495654_0017707 | 3300046530 | Bacteria | 3739 |
| 505 | Ga0495654_0019172 | 3300046530 | Bacteria | 3578 |
| 506 | Ga0495654_0019440 | 3300046530 | Bacteria | 3552 |
| 507 | Ga0495654_0020022 | 3300046530 | Bacteria | 3493 |
| 508 | Ga0495654_0026604 | 3300046530 | Bacteria | 2972 |
| 509 | Ga0495654_0029675 | 3300046530 | Bacteria | 2787 |
| 510 | Ga0495654_0030003 | 3300046530 | Bacteria | 2769 |
| 511 | Ga0495654_0278209 | 3300046530 | Bacteria | 689 |
| 512 | Ga0495586_0040848 | 3300046535 | Bacteria | 2497 |
| 513 | Ga0495587_0012284 | 3300046536 | Bacteria | 5399 |
| 514 | Ga0495587_0022683 | 3300046536 | Bacteria | 3862 |
| 515 | Ga0495609_0003213 | 3300046538 | Bacteria | 9486 |
| 516 | Ga0495609_0007879 | 3300046538 | Bacteria | 5267 |
| 517 | Ga0495609_0039186 | 3300046538 | Bacteria | 2134 |
| 518 | Ga0495609_0046763 | 3300046538 | Bacteria | 1937 |
| 519 | Ga0495597_0001457 | 3300046542 | Bacteria | 16939 |
| 520 | Ga0495597_0027373 | 3300046542 | Bacteria | 2614 |
| 521 | Ga0495597_0047214 | 3300046542 | Bacteria | 1906 |
| 522 | Ga0495597_0175356 | 3300046542 | Bacteria | 868 |
| 523 | Ga0495645_0117725 | 3300046543 | Bacteria | 1874 |
| 524 | Ga0495645_0260279 | 3300046543 | Bacteria | 1149 |
| 525 | Ga0495622_0006744 | 3300046557 | Bacteria | 5324 |
| 526 | Ga0495622_0008637 | 3300046557 | Bacteria | 4720 |
| 527 | Ga0495622_0010751 | 3300046557 | Bacteria | 4223 |
| 528 | Ga0495622_0017003 | 3300046557 | Bacteria | 3386 |
| 529 | Ga0495622_0032167 | 3300046557 | Bacteria | 2450 |
| 530 | Ga0495622_0171494 | 3300046557 | Bacteria | 975 |
| 531 | Ga0495633_0014722 | 3300046558 | Bacteria | 4078 |
| 532 | Ga0495656_0357977 | 3300046615 | Bacteria | 757 |
| 533 | Ga0495656_0555535 | 3300046615 | Bacteria | 612 |
| 534 | Ga0495668_0011841 | 3300046616 | Bacteria | 5199 |
| 535 | Ga0495668_0017874 | 3300046616 | Bacteria | 4108 |
| 536 | Ga0495668_0022974 | 3300046616 | Bacteria | 3561 |
| 537 | Ga0495668_0110354 | 3300046616 | Bacteria | 1504 |
| 538 | Ga0495668_0157801 | 3300046616 | Bacteria | 1242 |
| 539 | Ga0495611_0006133 | 3300046648 | Bacteria | 5129 |
| 540 | Ga0495611_0008856 | 3300046648 | Bacteria | 4255 |
| 541 | Ga0495625_0019890 | 3300046660 | Bacteria | 5195 |
| 542 | Ga0495625_0020325 | 3300046660 | Bacteria | 5129 |
| 543 | Ga0495625_0029611 | 3300046660 | Bacteria | 4091 |
| 544 | Ga0495625_0038359 | 3300046660 | Bacteria | 3508 |
| 545 | Ga0495625_0049169 | 3300046660 | Bacteria | 3032 |
| 546 | Ga0495625_0140695 | 3300046660 | Bacteria | 1628 |
| 547 | Ga0495635_0031268 | 3300046663 | Bacteria | 3697 |
| 548 | Ga0495635_0859036 | 3300046663 | Bacteria | 582 |
| 549 | Ga0495661_0004633 | 3300046665 | Bacteria | 9893 |
| 550 | Ga0495661_0004922 | 3300046665 | Bacteria | 9555 |
| 551 | Ga0495661_0014463 | 3300046665 | Bacteria | 5286 |
| 552 | Ga0495661_0025942 | 3300046665 | Bacteria | 3778 |
| 553 | Ga0495661_0028384 | 3300046665 | Bacteria | 3583 |
| 554 | Ga0495661_0044397 | 3300046665 | Bacteria | 2725 |
| 555 | Ga0495661_0073105 | 3300046665 | Bacteria | 1998 |
| 556 | Ga0495661_0098895 | 3300046665 | Bacteria | 1646 |
| 557 | Ga0495661_0130109 | 3300046665 | Bacteria | 1380 |
| 558 | Ga0495588_0140095 | 3300046674 | Bacteria | 1277 |
| 559 | Ga0495646_0026262 | 3300046680 | Bacteria | 3657 |
| 560 | Ga0495646_0213370 | 3300046680 | Bacteria | 1046 |
| 561 | Ga0495613_0050511 | 3300046689 | Bacteria | 3066 |
| 562 | Ga0495613_0326339 | 3300046689 | Bacteria | 1058 |
| 563 | Ga0495624_0016190 | 3300046690 | Bacteria | 5021 |
| 564 | Ga0495670_0007721 | 3300046691 | Bacteria | 5290 |
| 565 | Ga0495670_0012987 | 3300046691 | Bacteria | 4095 |
| 566 | Ga0495670_0020033 | 3300046691 | Bacteria | 3296 |
| 567 | Ga0495670_0072775 | 3300046691 | Bacteria | 1741 |
| 568 | Ga0495671_0001579 | 3300046692 | Bacteria | 15080 |
| 569 | Ga0495671_0003567 | 3300046692 | Bacteria | 9501 |
| 570 | Ga0495671_0041774 | 3300046692 | Bacteria | 2307 |
| 571 | Ga0495671_0126223 | 3300046692 | Bacteria | 1247 |
| 572 | Ga0495649_0016490 | 3300046694 | Bacteria | 4186 |
| 573 | Ga0495649_0030990 | 3300046694 | Bacteria | 2950 |
| 574 | Ga0495649_0039352 | 3300046694 | Bacteria | 2592 |
| 575 | Ga0495649_0072948 | 3300046694 | Bacteria | 1839 |
| 576 | Ga0495649_0109044 | 3300046694 | Bacteria | 1468 |
| 577 | Ga0495649_0221090 | 3300046694 | Bacteria | 979 |
| 578 | Ga0495649_0274753 | 3300046694 | Bacteria | 861 |
| 579 | Ga0495649_0363234 | 3300046694 | Bacteria | 730 |
| 580 | Ga0495649_0419311 | 3300046694 | Bacteria | 670 |
| 581 | Ga0495589_0009237 | 3300046794 | Bacteria | 5128 |
| 582 | Ga0495589_0026180 | 3300046794 | Bacteria | 2956 |
| 583 | Ga0495589_0037858 | 3300046794 | Bacteria | 2415 |
| 584 | Ga0495589_0266287 | 3300046794 | Bacteria | 798 |
| 585 | Ga0495600_0013552 | 3300046809 | Bacteria | 5126 |
| 586 | Ga0495660_0002084 | 3300046810 | Bacteria | 12960 |
| 587 | Ga0495660_0008386 | 3300046810 | Bacteria | 6044 |
| 588 | Ga0495660_0024657 | 3300046810 | Bacteria | 3425 |
| 589 | Ga0495660_0044680 | 3300046810 | Bacteria | 2435 |
| 590 | Ga0495660_0053373 | 3300046810 | Bacteria | 2194 |
| 591 | Ga0495660_0080051 | 3300046810 | Bacteria | 1715 |
| 592 | Ga0495660_0114313 | 3300046810 | Bacteria | 1373 |
| 593 | Ga0495660_0135049 | 3300046810 | Bacteria | 1233 |
| 594 | Ga0495660_0163747 | 3300046810 | Bacteria | 1088 |
| 595 | Ga0495660_0165733 | 3300046810 | Bacteria | 1080 |
| 596 | Ga0495660_0309168 | 3300046810 | Bacteria | 713 |
| 597 | Ga0495604_0078717 | 3300047317 | Bacteria | 2473 |
| 598 | Ga0495604_0085261 | 3300047317 | Bacteria | 2357 |
| 599 | Ga0495672_0003342 | 3300047320 | Bacteria | 13822 |
| 600 | Ga0495672_0003889 | 3300047320 | Bacteria | 12544 |
| 601 | Ga0495672_0010407 | 3300047320 | Bacteria | 6628 |
| 602 | Ga0495672_0015615 | 3300047320 | Bacteria | 5148 |
| 603 | Ga0495672_0019557 | 3300047320 | Bacteria | 4464 |
| 604 | Ga0495672_0019954 | 3300047320 | Bacteria | 4405 |
| 605 | Ga0495672_0021806 | 3300047320 | Bacteria | 4172 |
| 606 | Ga0495672_0024590 | 3300047320 | Bacteria | 3875 |
| 607 | Ga0495672_0026470 | 3300047320 | Bacteria | 3701 |
| 608 | Ga0495672_0031274 | 3300047320 | Bacteria | 3324 |
| 609 | Ga0495672_0130969 | 3300047320 | Bacteria | 1319 |
| 610 | Ga0495672_0242354 | 3300047320 | Bacteria | 879 |
| 611 | Ga0495672_0336639 | 3300047320 | Bacteria | 704 |
| 612 | Ga0495676_0008239 | 3300047321 | Bacteria | 9560 |
| 613 | Ga0495676_0149993 | 3300047321 | Bacteria | 1660 |
| 614 | Ga0495680_0042103 | 3300047322 | Bacteria | 3626 |
| 615 | Ga0495680_0954627 | 3300047322 | Bacteria | 550 |
| 616 | Ga0495683_0013831 | 3300047323 | Bacteria | 4211 |
| 617 | Ga0495683_0124094 | 3300047323 | Bacteria | 1223 |
| 618 | Ga0495683_0163314 | 3300047323 | Bacteria | 1028 |
| 619 | Ga0495683_0247523 | 3300047323 | Bacteria | 783 |
| 620 | Ga0495683_0293436 | 3300047323 | Bacteria | 700 |
| 621 | Ga0495687_019311 | 3300047443 | Bacteria | 3349 |
| 622 | Ga0495687_071282 | 3300047443 | Bacteria | 1392 |
| 623 | Ga0495675_0008994 | 3300047444 | Bacteria | 6208 |
| 624 | Ga0495679_039489 | 3300047446 | Bacteria | 1471 |
| 625 | Ga0495679_046562 | 3300047446 | Bacteria | 1319 |
| 626 | Ga0495685_090349 | 3300047447 | Bacteria | 1015 |
| 627 | Ga0495673_0003950 | 3300047469 | Bacteria | 9498 |
| 628 | Ga0495673_0006113 | 3300047469 | Bacteria | 7147 |
| 629 | Ga0495673_0010068 | 3300047469 | Bacteria | 5171 |
| 630 | Ga0495673_0016540 | 3300047469 | Bacteria | 3769 |
| 631 | Ga0495673_0021787 | 3300047469 | Bacteria | 3155 |
| 632 | Ga0495673_0026641 | 3300047469 | Bacteria | 2761 |
| 633 | Ga0495673_0026860 | 3300047469 | Bacteria | 2746 |
| 634 | Ga0495673_0031901 | 3300047469 | Bacteria | 2463 |
| 635 | Ga0495673_0066413 | 3300047469 | Bacteria | 1529 |
| 636 | Ga0495673_0099782 | 3300047469 | Bacteria | 1175 |
| 637 | Ga0495673_0117091 | 3300047469 | Bacteria | 1058 |
| 638 | Ga0495681_0004648 | 3300047470 | Bacteria | 9308 |
| 639 | Ga0495681_0007807 | 3300047470 | Bacteria | 6777 |
| 640 | Ga0495681_0011362 | 3300047470 | Bacteria | 5306 |
| 641 | Ga0495681_0012119 | 3300047470 | Bacteria | 5080 |
| 642 | Ga0495681_0012250 | 3300047470 | Bacteria | 5051 |
| 643 | Ga0495681_0012994 | 3300047470 | Bacteria | 4861 |
| 644 | Ga0495681_0017176 | 3300047470 | Bacteria | 4029 |
| 645 | Ga0495681_0036458 | 3300047470 | Bacteria | 2431 |
| 646 | Ga0495681_0040716 | 3300047470 | Bacteria | 2260 |
| 647 | Ga0495681_0053059 | 3300047470 | Bacteria | 1899 |
| 648 | Ga0495681_0085029 | 3300047470 | Bacteria | 1405 |
| 649 | Ga0495684_0294329 | 3300047471 | Bacteria | 1167 |
| 650 | Ga0495686_0015872 | 3300047472 | Bacteria | 5123 |
| 651 | Ga0495686_0029869 | 3300047472 | Bacteria | 3543 |
| 652 | Ga0495686_0046517 | 3300047472 | Bacteria | 2742 |
| 653 | Ga0495686_0050021 | 3300047472 | Bacteria | 2627 |
| 654 | Ga0495686_0182624 | 3300047472 | Bacteria | 1214 |
| 655 | Ga0495593_0014408 | 3300047673 | Bacteria | 4495 |
| 656 | Ga0495593_0056045 | 3300047673 | Bacteria | 2072 |
| 657 | Ga0495602_0091733 | 3300048088 | Bacteria | 2518 |
| 658 | Ga0495626_0001991 | 3300048091 | Bacteria | 15074 |
| 659 | Ga0495626_0009696 | 3300048091 | Bacteria | 5191 |
| 660 | Ga0495626_0014242 | 3300048091 | Bacteria | 4106 |
| 661 | Ga0495626_0014655 | 3300048091 | Bacteria | 4035 |
| 662 | Ga0495626_0018199 | 3300048091 | Bacteria | 3532 |
| 663 | Ga0495626_0033590 | 3300048091 | Bacteria | 2457 |
| 664 | Ga0495626_0036585 | 3300048091 | Bacteria | 2337 |
| 665 | Ga0495626_0088949 | 3300048091 | Bacteria | 1360 |
| 666 | Ga0495626_0171452 | 3300048091 | Bacteria | 904 |
| 667 | Ga0496102_0024615 | 3300048905 | Bacteria | 5352 |
| 668 | Ga0496102_0188033 | 3300048905 | Bacteria | 1946 |
| 669 | Ga0496110_0399333 | 3300048913 | Bacteria | 1253 |
| 670 | Ga0496110_0646356 | 3300048913 | Bacteria | 957 |
| 671 | Ga0496112_0508368 | 3300048915 | Bacteria | 1140 |
| 672 | Ga0496115_0436570 | 3300048918 | Bacteria | 1059 |
| 673 | Ga0496116_0009224 | 3300048919 | Bacteria | 8447 |
| 674 | Ga0496116_0019431 | 3300048919 | Bacteria | 5202 |
| 675 | Ga0496116_0029144 | 3300048919 | Bacteria | 3985 |
| 676 | Ga0496117_0001936 | 3300048920 | Bacteria | 27633 |
| 677 | Ga0496117_0012366 | 3300048920 | Bacteria | 7532 |
| 678 | Ga0496117_0064804 | 3300048920 | Bacteria | 2488 |
| 679 | Ga0496117_0159863 | 3300048920 | Bacteria | 1321 |
| 680 | Ga0496117_0405504 | 3300048920 | Bacteria | 686 |
| 681 | Ga0496118_0103372 | 3300048921 | Bacteria | 1916 |
| 682 | Ga0496118_0156661 | 3300048921 | Bacteria | 1415 |
| 683 | Ga0496118_0196887 | 3300048921 | Bacteria | 1198 |
| 684 | Ga0496119_0389673 | 3300048922 | Bacteria | 666 |
| 685 | Ga0496120_0174616 | 3300048923 | Bacteria | 1060 |
| 686 | Ga0496121_0012137 | 3300048924 | Bacteria | 9457 |
| 687 | Ga0496121_0014201 | 3300048924 | Bacteria | 8473 |
| 688 | Ga0496121_0019552 | 3300048924 | Bacteria | 6763 |
| 689 | Ga0496121_0030231 | 3300048924 | Bacteria | 4978 |
| 690 | Ga0496121_0082684 | 3300048924 | Bacteria | 2537 |
| 691 | Ga0496122_0004546 | 3300048925 | Bacteria | 17102 |
| 692 | Ga0496122_0041678 | 3300048925 | Bacteria | 3625 |
| 693 | Ga0496122_0051867 | 3300048925 | Bacteria | 3111 |
| 694 | Ga0496122_0059033 | 3300048925 | Bacteria | 2835 |
| 695 | Ga0496122_0125994 | 3300048925 | Bacteria | 1639 |
| 696 | Ga0496122_0228335 | 3300048925 | Bacteria | 1061 |
| 697 | Ga0496123_0001488 | 3300048926 | Bacteria | 32526 |
| 698 | Ga0496123_0019101 | 3300048926 | Bacteria | 5411 |
| 699 | Ga0496123_0041371 | 3300048926 | Bacteria | 3196 |
| 700 | Ga0496124_0050108 | 3300048927 | Bacteria | 3559 |
| 701 | Ga0496124_0103082 | 3300048927 | Bacteria | 2308 |
| 702 | Ga0496124_0158414 | 3300048927 | Bacteria | 1768 |
| 703 | Ga0496124_0205167 | 3300048927 | Bacteria | 1495 |
| 704 | Ga0496125_0039982 | 3300048928 | Bacteria | 4030 |
| 705 | Ga0495678_006775 | 3300049459 | Bacteria | 6032 |
| 706 | Ga0495678_012071 | 3300049459 | Bacteria | 4106 |
| 707 | Ga0495678_012391 | 3300049459 | Bacteria | 4045 |
| 708 | Ga0495678_013877 | 3300049459 | Bacteria | 3768 |
| 709 | Ga0495678_026038 | 3300049459 | Bacteria | 2503 |
| 710 | Ga0495678_029425 | 3300049459 | Bacteria | 2306 |
| 711 | Ga0495678_029701 | 3300049459 | Bacteria | 2293 |
| 712 | Ga0495678_090711 | 3300049459 | Bacteria | 1077 |
| 713 | Ga0495678_123974 | 3300049459 | Bacteria | 864 |
| 714 | Ga0495682_0002142 | 3300049460 | Bacteria | 9581 |
| 715 | Ga0495682_0056086 | 3300049460 | Bacteria | 1428 |
| 716 | Ga0495682_0072818 | 3300049460 | Bacteria | 1236 |
| 717 | Ga0501032_0017047 | 3300049569 | Bacteria | 5103 |
| 718 | Ga0501034_0304164 | 3300049571 | Bacteria | 1531 |
| 719 | Ga0501034_0803281 | 3300049571 | Bacteria | 833 |
| 720 | Ga0501037_0239124 | 3300049573 | Bacteria | 1273 |
| 721 | Ga0501038_0214015 | 3300049574 | Bacteria | 1540 |
| 722 | Ga0501039_0265071 | 3300049575 | Bacteria | 1350 |
| 723 | Ga0501039_0302200 | 3300049575 | Bacteria | 1258 |
| 724 | Ga0501241_019596 | 3300049758 | Bacteria | 1242 |
| 725 | Ga0501269_022103 | 3300049766 | Bacteria | 796 |
| 726 | nmdc:mga00v17_206134_c1 | 3300050491 | Bacteria | 1272 |
| 727 | nmdc:mga08x19_666959_c1 | 3300050514 | Bacteria | 738 |
| 728 | nmdc:mga0sz30_142374_c1 | 3300050516 | Bacteria | 1059 |
| 729 | Ga0500572_003167 | 3300053111 | Bacteria | 3808 |
| 730 | Ga0500573_0017545 | 3300053140 | Bacteria | 4076 |
| 731 | Ga0500577_0250819 | 3300053142 | Bacteria | 769 |
| 732 | 2510283934 | 2510065053 | Bacteria | 5005518 |
| 733 | 2510293393 | 2510065055 | Bacteria | 5037935 |
| 734 | 2510312885 | 2510065058 | Bacteria | 5005894 |
| 735 | 2511256926 | 2511231004 | Bacteria | 6669789 |
| 736 | 2511266935 | 2511231006 | Bacteria | 6794709 |
| 737 | 2511272926 | 2511231007 | Bacteria | 6306603 |
| 738 | 2511276126 | 2511231008 | Bacteria | 6624100 |
| 739 | 2511291216 | 2511231010 | Bacteria | 6373152 |
| 740 | 2511293775 | 2511231011 | Bacteria | 6149768 |
| 741 | 2511300536 | 2511231012 | Bacteria | 6738011 |
| 742 | 2511315510 | 2511231014 | Bacteria | 6462302 |
| 743 | 2511320342 | 2511231015 | Bacteria | 6598026 |
| 744 | 2511323571 | 2511231016 | Bacteria | 6704427 |
| 745 | 2511330728 | 2511231017 | Bacteria | 6503007 |
| 746 | 2511336806 | 2511231018 | Bacteria | 6436256 |
| 747 | 2511342584 | 2511231019 | Bacteria | 6520662 |
| 748 | 2511348106 | 2511231020 | Bacteria | 6115223 |
| 749 | 2511357049 | 2511231021 | Bacteria | 7302637 |
| 750 | 2511363204 | 2511231022 | Bacteria | 6719296 |
| 751 | 2511369748 | 2511231023 | Bacteria | 6808468 |
| 752 | 2511414941 | 2511231031 | Bacteria | 6558529 |
| 753 | 2511826789 | 2511231156 | Bacteria | 6845832 |
| 754 | 2555671992 | 2554235341 | Bacteria | 6867980 |
| 755 | 2599329645 | 2599185155 | Bacteria | 5827168 |
| 756 | 2599353843 | 2599185160 | Bacteria | 6844013 |
| 757 | 2599378951 | 2599185164 | Bacteria | 6841688 |
| 758 | 2599386071 | 2599185165 | Bacteria | 6843250 |
| 759 | 2599460677 | 2599185181 | Bacteria | 6844519 |
| 760 | 2599489698 | 2599185186 | Bacteria | 6831633 |
| 761 | 2599502858 | 2599185188 | Bacteria | 6164180 |
| 762 | 2599615114 | 2599185212 | Bacteria | 6765997 |
| 763 | 2599930115 | 2599185300 | Bacteria | 6062622 |
| 764 | 2599945359 | 2599185302 | Bacteria | 5954930 |
| 765 | 2599955631 | 2599185304 | Bacteria | 5951361 |
| 766 | 2599969343 | 2599185306 | Bacteria | 6637356 |
| 767 | 2599973361 | 2599185307 | Bacteria | 6194719 |
| 768 | 2599980684 | 2599185308 | Bacteria | 6621546 |
| 769 | 2599985744 | 2599185309 | Bacteria | 5969593 |
| 770 | 2599990638 | 2599185310 | Bacteria | 6014457 |
| 771 | 2599995956 | 2599185311 | Bacteria | 6354990 |
| 772 | 2600001976 | 2599185312 | Bacteria | 5912071 |
| 773 | 2600014500 | 2599185314 | Bacteria | 6621749 |
| 774 | 2600025528 | 2599185316 | Bacteria | 6320029 |
| 775 | 2600027856 | 2599185317 | Bacteria | 6435722 |
| 776 | 2600033426 | 2599185318 | Bacteria | 6961590 |
| 777 | 2600040289 | 2599185319 | Bacteria | 6637840 |
| 778 | 2600049343 | 2599185320 | Bacteria | 5963263 |
| 779 | 2600061609 | 2599185322 | Bacteria | 6763055 |
| 780 | 2600064227 | 2599185323 | Bacteria | 6688755 |
| 781 | 2600077323 | 2599185325 | Bacteria | 6324919 |
| 782 | 2600213291 | 2599185356 | Bacteria | 6843884 |
| 783 | 2600357023 | 2600254930 | Bacteria | 6431253 |
| 784 | 2600443501 | 2600254954 | Bacteria | 5100516 |
| 785 | 2601625906 | 2600255283 | Bacteria | 6061572 |
| 786 | 2601773458 | 2600255313 | Bacteria | 6842543 |
| 787 | 2601799706 | 2600255318 | Bacteria | 6383414 |
| 788 | 2602009045 | 2600255389 | Bacteria | 5275336 |
| 789 | 2606074109 | 2603880185 | Bacteria | 6379190 |
| 790 | 2606126246 | 2603880199 | Bacteria | 6377649 |
| 791 | 2624482654 | 2623620443 | Bacteria | 6427864 |
| 792 | 2624490281 | 2623620446 | Bacteria | 6500345 |
| 793 | 2643842004 | 2643221565 | Bacteria | 6216018 |
| 794 | 2643955414 | 2643221589 | Bacteria | 6250934 |
| 795 | 2644023766 | 2643221602 | Bacteria | 6249926 |
| 796 | 2644185891 | 2643221633 | Bacteria | 6733554 |
| 797 | 2644285801 | 2643221650 | Bacteria | 7029547 |
| 798 | 2652545175 | 2651869719 | Bacteria | 6047974 |
| 799 | 2671125642 | 2667528176 | Bacteria | 6724917 |
| 800 | 2678265159 | 2675903515 | Bacteria | 6580491 |
| 801 | 2715752018 | 2713897148 | Bacteria | 5883533 |
| 802 | 2715755352 | 2713897149 | Bacteria | 6506249 |
| 803 | 2718635866 | 2718217725 | Bacteria | 5758958 |
| 804 | 2739196495 | 2738543004 | Bacteria | 6381073 |
| 805 | 2739257470 | 2738543015 | Bacteria | 6750701 |
| 806 | 2739265346 | 2738543016 | Bacteria | 5657564 |
| 807 | 2739289270 | 2738543020 | Bacteria | 5718238 |
| 808 | 2739294582 | 2738543021 | Bacteria | 5718241 |
| 809 | 2739314480 | 2738543025 | Bacteria | 6600348 |
| 810 | 2739732539 | 2739367700 | Bacteria | 4747630 |
| 811 | 2745005615 | 2744054620 | Bacteria | 6551379 |
| 812 | 2774122092 | 2773857670 | Bacteria | 6407454 |
| 813 | 2774131875 | 2773857672 | Bacteria | 4993178 |
| 814 | 2774133535 | 2773857673 | Bacteria | 6513460 |
| 815 | 2784262578 | 2784132063 | Bacteria | 6262788 |
| 816 | 2784314337 | 2784132072 | Bacteria | 6596533 |
| 817 | 2794595538 | 2791355520 | Bacteria | 5948615 |
| 818 | 2808855824 | 2808606361 | Bacteria | 6136259 |
| 819 | 2808905171 | 2808606373 | Bacteria | 4423627 |
| 820 | 2808921968 | 2808606376 | Bacteria | 6248667 |
| 821 | 2808933355 | 2808606377 | Bacteria | 6646337 |
| 822 | 2808935905 | 2808606378 | Bacteria | 6177535 |
| 823 | 2808944089 | 2808606380 | Bacteria | 6248705 |
| 824 | 2808955463 | 2808606381 | Bacteria | 6646461 |
| 825 | 2808959683 | 2808606382 | Bacteria | 6841132 |
| 826 | 2808964303 | 2808606383 | Bacteria | 6138645 |
| 827 | 2808999191 | 2808606389 | Bacteria | 6138126 |
| 828 | 2809218560 | 2808606445 | Bacteria | 6057339 |
| 829 | 2812368551 | 2811994881 | Bacteria | 6298475 |
| 830 | 2819654243 | 2818991456 | Bacteria | 6123676 |
| 831 | 2819701515 | 2818991464 | Bacteria | 6907494 |
| 832 | 2823425111 | 2823421272 | Bacteria | 5372474 |
| 833 | 2825655945 | 2825651385 | Bacteria | 6715909 |
| 834 | 2826585537 | 2826581358 | Bacteria | 5963467 |
| 835 | 2842809197 | 2842805378 | Bacteria | 5385175 |
| 836 | 2842818203 | 2842815866 | Bacteria | 5947510 |
| 837 | 2842837509 | 2842832357 | Bacteria | 5959113 |
| 838 | 2842845293 | 2842843487 | Bacteria | 6004777 |
| 839 | 2842853095 | 2842849001 | Bacteria | 5924277 |
| 840 | 2842856349 | 2842854478 | Bacteria | 6143501 |
| 841 | 2844666158 | 2844665904 | Bacteria | 6817974 |
| 842 | 2852660601 | 2852657418 | Bacteria | 6472974 |
| 843 | 2878034584 | 2878029506 | Bacteria | 6418441 |
| 844 | 2880235231 | 2880230671 | Bacteria | 6140320 |
| 845 | 2904521604 | 2904518522 | Bacteria | 6068986 |
| 846 | 2913041768 | 2913036834 | Bacteria | 6704877 |
| 847 | 2917075865 | 2917070673 | Bacteria | 6868303 |
| 848 | 2919069575 | 2919063839 | Bacteria | 6302690 |
| 849 | 2919388652 | 2919385768 | Bacteria | 5897293 |
| 850 | 2919490027 | 2919487758 | Bacteria | 5929766 |
| 851 | 2919501828 | 2919501602 | Bacteria | 5286340 |
| 852 | 2919703755 | 2919697872 | Bacteria | 6553725 |
| 853 | 2923522609 | 2923519811 | Bacteria | 6298479 |
| 854 | 2923590413 | 2923586266 | Bacteria | 6565975 |
| 855 | 2926063501 | 2926063275 | Bacteria | 5285848 |
| 856 | 2929149086 | 2929144301 | Bacteria | 6622272 |
| 857 | 2931373491 | 2931369376 | Bacteria | 6847892 |
| 858 | 2935356851 | 2935353572 | Unclassified | 6955622 |
| 859 | 2939636965 | 2939636861 | Bacteria | 6297853 |
| 860 | 2974289261 | 2974289157 | Bacteria | 6080362 |
| 861 | 2974301304 | 2974298342 | Bacteria | 4840922 |
| 862 | 2984503781 | 2984499530 | Bacteria | 5020881 |
| 863 | 2984507637 | 2984504281 | Bacteria | 5262371 |
| 864 | 2988730689 | 2988728565 | Bacteria | 6124362 |
| 865 | 2998144641 | 2998139840 | Bacteria | 6073514 |
| 866 | 3007254077 | 3007252601 | Bacteria | 4559114 |
| 867 | 3007317185 | 3007315729 | Bacteria | 5076637 |
| 868 | 3007420557 | 3007419365 | Bacteria | 7026924 |
| 869 | 3007615669 | 3007614139 | Bacteria | 6053559 |
| 870 | 3007723949 | 3007718800 | Bacteria | 5971527 |
| 871 | 3007858376 | 3007855910 | Bacteria | 5637581 |
| 872 | 3007867571 | 3007866637 | Bacteria | 5899198 |
| 873 | 637322408 | 637000220 | Bacteria | 7074893 |
| 874 | 640487028 | 640427133 | Bacteria | 4567418 |
| 875 | 651174900 | 651053060 | Bacteria | 4689946 |
| 876 | 8016730224 | 8016728285 | Bacteria | 5263933 |
| 877 | 8019782070 | 8019775933 | Bacteria | 6858656 |
| 878 | 8029996238 | 8029995093 | Bacteria | 5990776 |
| 879 | 8034963085 | 8034962539 | Bacteria | 4884839 |
| 880 | 8056130883 | 8056125926 | Bacteria | 6228218 |
| 881 | 8056144303 | 8056143049 | Bacteria | 6307666 |
| 882 | 8056171915 | 8056166840 | Bacteria | 5820959 |
| 883 | 8056172596 | 8056172158 | Bacteria | 6133900 |
| 884 | 8056179773 | 8056177738 | Bacteria | 6748268 |
| 885 | 8056574415 | 8056569372 | Bacteria | 5997322 |
| 886 | 8057804897 | 8057798959 | Bacteria | 6713499 |
| 887 | Ga0105244_10284323 | |||
| 888 | MRS2a_Contig_6365 | |||
| 889 | MRS2a_Contig_63 | |||
| 890 | JGI25162J39368_1002343 | |||
| 891 | JGI25162J39368_1002368 | |||
| 892 | JGI25164J39214_1001140 | |||
| 893 | JGI25164J39214_1001148 | |||
| 894 | JGI25165J46597_1002064 | |||
| 895 | JGI25165J46597_1002076 | |||
| 896 | rootH1_10113058 | |||
| 897 | Ga0055536_1002477 | |||
| 898 | Ga0055536_1009168 | |||
| 899 | Ga0055536_1009170 | |||
| 900 | Ga0055530_10002925 | |||
| 901 | Ga0055530_10003090 | |||
| 902 | Ga0055530_10003689 | |||
| 903 | Ga0055540_1002354 | |||
| 904 | Ga0055540_1002654 | |||
| 905 | Ga0055540_1002780 | |||
| 906 | Ga0055531_10000348 | |||
| 907 | Ga0055531_10090088 | |||
| 908 | Ga0065714_10000200 | |||
| 909 | Ga0065714_10010890 | |||
| 910 | Ga0065714_10016682 | |||
| 911 | Ga0065714_10019055 | |||
| 912 | Ga0065714_10065997 | |||
| 913 | Ga0065714_10074076 | |||
| 914 | Ga0065714_10116478 | |||
| 915 | Ga0065714_10148665 | |||
| 916 | Ga0065704_10027423 | |||
| 917 | Ga0065704_10030190 | |||
| 918 | Ga0065704_10031494 | |||
| 919 | Ga0065704_10072936 | |||
| 920 | Ga0065704_10080368 | |||
| 921 | Ga0065704_10321926 | |||
| 922 | Ga0065712_10000146 | |||
| 923 | Ga0065712_10000717 | |||
| 924 | Ga0065715_10153109 | |||
| 925 | Ga0070676_10582923 | |||
| 926 | Ga0070714_100717935 | |||
| 927 | Ga0070662_100651465 | |||
| 928 | Ga0070665_100659418 | |||
| 929 | Ga0070665_100672402 | |||
| 930 | Ga0070702_101795896 | |||
| 931 | Ga0070717_10948683 | |||
| 932 | Ga0075363_100305575 | |||
| 933 | Ga0075364_10084038 | |||
| 934 | Ga0075364_10151254 | |||
| 935 | Ga0075364_10549449 | |||
| 936 | Ga0075432_10004050 | |||
| 937 | Ga0075432_10084883 | |||
| 938 | Ga0075432_10099805 | |||
| 939 | Ga0075432_10516211 | |||
| 940 | Ga0075362_10179175 | |||
| 941 | Ga0075362_10190353 | |||
| 942 | Ga0075369_10126777 | |||
| 943 | Ga0075366_10680393 | |||
| 944 | Ga0075370_10312948 | |||
| 945 | Ga0075370_10516229 | |||
| 946 | Ga0075436_100477209 | |||
| 947 | Ga0075436_100984525 | |||
| 948 | Ga0079104_1002687 | |||
| 949 | Ga0079104_1003518 | |||
| 950 | Ga0099826_10037988 | |||
| 951 | Ga0105251_10000004 | |||
| 952 | Ga0105251_10004443 | |||
| 953 | Ga0105251_10007066 | |||
| 954 | Ga0105251_10152037 | |||
| 955 | Ga0105251_10376619 | |||
| 956 | Ga0105244_10001043 | |||
| 957 | Ga0105244_10005209 | |||
| 958 | Ga0105244_10017949 | |||
| 959 | Ga0105244_10018410 | |||
| 960 | Ga0105244_10042431 | |||
| 961 | Ga0105244_10049032 | |||
| 962 | Ga0105244_10162520 | |||
| 963 | Ga0105250_10002390 | |||
| 964 | Ga0105250_10011759 | |||
| 965 | Ga0105250_10072110 | |||
| 966 | Ga0105250_10134459 | |||
| 967 | Ga0105250_10190386 | |||
| 968 | Ga0105250_10223713 | |||
| 969 | Ga0105243_10002016 | |||
| 970 | Ga0105243_10021965 | |||
| 971 | Ga0105243_10035653 | |||
| 972 | Ga0105243_10088108 | |||
| 973 | Ga0105243_10100894 | |||
| 974 | Ga0105243_10935939 | |||
| 975 | Ga0105242_10108381 | |||
| 976 | Ga0105242_11007755 | |||
| 977 | Ga0105238_11068549 | |||
| 978 | Ga0105249_10068245 | |||
| 979 | Ga0105246_10003691 | |||
| 980 | Ga0105246_10007602 | |||
| 981 | Ga0105246_10051958 | |||
| 982 | Ga0157336_1021986 | |||
| 983 | Ga0157345_1000406 | |||
| 984 | Ga0157347_1012782 | |||
| 985 | Ga0157373_10006663 | |||
| 986 | Ga0157373_10011669 | |||
| 987 | Ga0157373_10035499 | |||
| 988 | Ga0157373_10081575 | |||
| 989 | Ga0157373_10612783 | |||
| 990 | Ga0157371_10016794 | |||
| 991 | Ga0157371_10022390 | |||
| 992 | Ga0157371_10029549 | |||
| 993 | Ga0157371_10048074 | |||
| 994 | Ga0157371_10423721 | |||
| 995 | Ga0157370_10100977 | |||
| 996 | Ga0157370_10129888 | |||
| 997 | Ga0157370_10308121 | |||
| 998 | Ga0157370_10440361 | |||
| 999 | Ga0157370_10470853 | |||
| 1000 | Ga0157370_10538873 | |||
| 1001 | Ga0157369_10004082 | |||
| 1002 | Ga0157369_11743848 | |||
| 1003 | Ga0163162_10031182 | |||
| 1004 | Ga0157372_10041925 | |||
| 1005 | Ga0157375_10099065 | |||
| 1006 | Ga0157375_11539420 | |||
| 1007 | Ga0157380_11096178 | |||
| 1008 | Ga0182008_10005981 | |||
| 1009 | Ga0182008_10019027 | |||
| 1010 | Ga0182008_10021627 | |||
| 1011 | Ga0182008_10039351 | |||
| 1012 | Ga0182008_10112047 | |||
| 1013 | Ga0182008_10184842 | |||
| 1014 | Ga0182006_1013528 | |||
| 1015 | Ga0182006_1018530 | |||
| 1016 | Ga0182006_1022967 | |||
| 1017 | Ga0182006_1031971 | |||
| 1018 | Ga0182007_10010960 | |||
| 1019 | Ga0182007_10243394 | |||
| 1020 | Ga0182005_1011004 | |||
| 1021 | Ga0182005_1025175 | |||
| 1022 | Ga0163161_10033270 | |||
| 1023 | Ga0163161_10098800 | |||
| 1024 | Ga0163161_10198086 | |||
| 1025 | Ga0163161_10618130 | |||
| 1026 | Ga0209760_100534 | |||
| 1027 | Ga0209674_116692 | |||
| 1028 | Ga0209672_100625 | |||
| 1029 | Ga0209563_102480 | |||
| 1030 | Ga0207427_100007 | |||
| 1031 | Ga0209437_100006 | |||
| 1032 | Ga0209759_1015308 | |||
| 1033 | Ga0209233_1000059 | |||
| 1034 | Ga0209675_1004261 | |||
| 1035 | Ga0209676_1000010 | |||
| 1036 | Ga0209676_1017459 | |||
| 1037 | Ga0209676_1019618 | |||
| 1038 | Ga0209050_1000019 | |||
| 1039 | Ga0209050_1000027 | |||
| 1040 | Ga0209050_1004537 | |||
| 1041 | Ga0209051_1000102 | |||
| 1042 | Ga0209051_1000383 | |||
| 1043 | Ga0209051_1008728 | |||
| 1044 | Ga0209257_1000119 | |||
| 1045 | Ga0209257_1011631 | |||
| 1046 | Ga0207696_1000054 | |||
| 1047 | Ga0207696_1000213 | |||
| 1048 | Ga0207696_1003221 | |||
| 1049 | Ga0207696_1008374 | |||
| 1050 | Ga0207696_1049746 | |||
| 1051 | Ga0207655_1000005 | |||
| 1052 | Ga0207655_1000015 | |||
| 1053 | Ga0207655_1001289 | |||
| 1054 | Ga0207655_1004342 | |||
| 1055 | Ga0207655_1009983 | |||
| 1056 | Ga0207655_1012220 | |||
| 1057 | Ga0207655_1015195 | |||
| 1058 | Ga0207655_1015443 | |||
| 1059 | Ga0207655_1016868 | |||
| 1060 | Ga0207655_1048185 | |||
| 1061 | Ga0207655_1053401 | |||
| 1062 | Ga0207655_1108396 | |||
| 1063 | Ga0207713_1000013 | |||
| 1064 | Ga0207713_1005285 | |||
| 1065 | Ga0207713_1005703 | |||
| 1066 | Ga0207713_1007779 | |||
| 1067 | Ga0207713_1009866 | |||
| 1068 | Ga0207713_1014244 | |||
| 1069 | Ga0207713_1018723 | |||
| 1070 | Ga0207713_1022092 | |||
| 1071 | Ga0207713_1120972 | |||
| 1072 | Ga0207645_10662098 | |||
| 1073 | Ga0207681_10038543 | |||
| 1074 | Ga0207664_10817785 | |||
| 1075 | Ga0207706_10052083 | |||
| 1076 | Ga0207686_11047115 | |||
| 1077 | Ga0207709_10000224 | |||
| 1078 | Ga0207709_10001009 | |||
| 1079 | Ga0207709_10003502 | |||
| 1080 | Ga0207709_10099832 | |||
| 1081 | Ga0207709_10427187 | |||
| 1082 | Ga0207678_10080860 | |||
| 1083 | Ga0209281_1000015 | |||
| 1084 | Ga0209281_1002030 | |||
| 1085 | Ga0209281_1002560 | |||
| 1086 | Ga0209371_1000372 | |||
| 1087 | Ga0209969_1005590 | |||
| 1088 | Ga0209981_1009128 | |||
| 1089 | Ga0209981_1018505 | |||
| 1090 | Ga0209996_1001815 | |||
| 1091 | Ga0209984_1000904 | |||
| 1092 | Ga0210000_1043629 | |||
| 1093 | Ga0209995_1000370 | |||
| 1094 | Ga0209968_1009181 | |||
| 1095 | Ga0209983_1001799 | |||
| 1096 | Ga0209983_1014344 | |||
| 1097 | Ga0209971_1000990 | |||
| 1098 | Ga0209974_10008818 | |||
| 1099 | Ga0209974_10042207 | |||
| 1100 | Ga0207428_10019963 | |||
| 1101 | Ga0207428_10095682 | |||
| 1102 | Ga0207428_10097055 | |||
| 1103 | Ga0207428_10175017 | |||
| 1104 | Ga0207428_10371753 | |||
| 1105 | Ga0268266_11170812 | |||
| 1106 | Ga0307517_10304678 | |||
| 1107 | Ga0307515_10523950 | |||
| 1108 | Ga0268256_1000316 | |||
| 1109 | Ga0307511_10041014 | |||
| 1110 | Ga0316177_1067959 | |||
| 1111 | Ga0314311_1053106 | |||
| 1112 | Ga0316179_1118252 | |||
| 1113 | Ga0316178_1061339 | |||
| 1114 | Ga0316183_1164786 | |||
| 1115 | Ga0307513_10677141 | |||
| 1116 | Ga0307408_100000020 | |||
| 1117 | Ga0307408_100026677 | |||
| 1118 | Ga0307408_100052194 | |||
| 1119 | Ga0307408_100084620 | |||
| 1120 | Ga0307408_100155822 | |||
| 1121 | Ga0307516_10758312 | |||
| 1122 | Ga0307405_10016467 | |||
| 1123 | Ga0307405_10045984 | |||
| 1124 | Ga0307413_10004776 | |||
| 1125 | Ga0307413_10327181 | |||
| 1126 | Ga0307413_10332244 | |||
| 1127 | Ga0307413_10412353 | |||
| 1128 | Ga0307410_11095442 | |||
| 1129 | Ga0307406_10068257 | |||
| 1130 | Ga0307406_10081625 | |||
| 1131 | Ga0307407_10164372 | |||
| 1132 | Ga0307407_10252854 | |||
| 1133 | Ga0307407_10535555 | |||
| 1134 | Ga0307412_10026347 | |||
| 1135 | Ga0307412_10042695 | |||
| 1136 | Ga0307412_10043739 | |||
| 1137 | Ga0307412_10323155 | |||
| 1138 | Ga0307409_100153497 | |||
| 1139 | Ga0307409_100347020 | |||
| 1140 | Ga0307409_101039419 | |||
| 1141 | Ga0307416_101199984 | |||
| 1142 | Ga0307416_102661354 | |||
| 1143 | Ga0307414_10022843 | |||
| 1144 | Ga0307414_10347300 | |||
| 1145 | Ga0307414_10407538 | |||
| 1146 | Ga0307414_10428881 | |||
| 1147 | Ga0307414_10574864 | |||
| 1148 | Ga0307414_11071539 | |||
| 1149 | Ga0307411_10092469 | |||
| 1150 | Ga0307411_10113658 | |||
| 1151 | Ga0307411_10143139 | |||
| 1152 | Ga0307411_10199398 | |||
| 1153 | Ga0307510_10049362 | |||
| 1154 | Ga0237819_00850 | |||
| 1155 | Ga0439436_0001947 | |||
| 1156 | Ga0439438_004835 | |||
| 1157 | Ga0439438_005991 | |||
| 1158 | Ga0439438_012496 | |||
| 1159 | Ga0439438_013016 | |||
| 1160 | Ga0439438_033892 | |||
| 1161 | Ga0439438_035560 | |||
| 1162 | Ga0439447_005256 | |||
| 1163 | Ga0439447_007191 | |||
| 1164 | Ga0439447_007499 | |||
| 1165 | Ga0439447_028240 | |||
| 1166 | Ga0439466_0002455 | |||
| 1167 | Ga0439466_0012706 | |||
| 1168 | Ga0439466_0030461 | |||
| 1169 | Ga0439466_0039442 | |||
| 1170 | Ga0439466_0059830 | |||
| 1171 | Ga0439466_0088008 | |||
| 1172 | Ga0439465_0088938 | |||
| 1173 | Ga0439432_006875 | |||
| 1174 | Ga0439432_017053 | |||
| 1175 | Ga0439451_015210 | |||
| 1176 | Ga0439452_002068 | |||
| 1177 | Ga0439452_003491 | |||
| 1178 | Ga0439452_005492 | |||
| 1179 | Ga0439452_006171 | |||
| 1180 | Ga0439452_018818 | |||
| 1181 | Ga0439452_055582 | |||
| 1182 | Ga0439456_008547 | |||
| 1183 | Ga0439456_009482 | |||
| 1184 | Ga0439456_064912 | |||
| 1185 | Ga0439463_000398 | |||
| 1186 | Ga0439463_118357 | |||
| 1187 | Ga0450911_002061 | |||
| 1188 | Ga0450911_014547 | |||
| 1189 | Ga0450911_021889 | |||
| 1190 | Ga0450919_003656 | |||
| 1191 | Ga0450919_015498 | |||
| 1192 | Ga0450920_002273 | |||
| 1193 | Ga0450922_003438 | |||
| 1194 | Ga0450922_007710 | |||
| 1195 | Ga0450923_009756 | |||
| 1196 | Ga0450923_019088 | |||
| 1197 | Ga0450903_006890 | |||
| 1198 | Ga0450906_038611 | |||
| 1199 | Ga0450907_001573 | |||
| 1200 | Ga0450910_002470 | |||
| 1201 | Ga0439446_0002625 | |||
| 1202 | Ga0439446_0281111 | |||
| 1203 | Ga0450908_004130 | |||
| 1204 | Ga0439434_0004449 | |||
| 1205 | Ga0439464_0002011 | |||
| 1206 | Ga0439464_0005339 | |||
| 1207 | Ga0439464_0007803 | |||
| 1208 | Ga0450893_0004562 | |||
| 1209 | Ga0450893_0025484 | |||
| 1210 | Ga0450901_007621 | |||
| 1211 | Ga0495617_005254 | |||
| 1212 | Ga0495617_018827 | |||
| 1213 | Ga0495617_019507 | |||
| 1214 | Ga0495617_038146 | |||
| 1215 | Ga0495617_051979 | |||
| 1216 | Ga0495617_056646 | |||
| 1217 | Ga0495627_002521 | |||
| 1218 | Ga0495627_009785 | |||
| 1219 | Ga0495627_071325 | |||
| 1220 | Ga0495627_095624 | |||
| 1221 | Ga0495627_221450 | |||
| 1222 | Ga0495603_0025579 | |||
| 1223 | Ga0495590_0005392 | |||
| 1224 | Ga0495590_0053578 | |||
| 1225 | Ga0495590_0058969 | |||
| 1226 | Ga0495590_0074039 | |||
| 1227 | Ga0495590_0082356 | |||
| 1228 | Ga0495591_000015 | |||
| 1229 | Ga0495591_002895 | |||
| 1230 | Ga0495591_004113 | |||
| 1231 | Ga0495591_006233 | |||
| 1232 | Ga0495591_008874 | |||
| 1233 | Ga0495591_010833 | |||
| 1234 | Ga0495591_011046 | |||
| 1235 | Ga0495591_012960 | |||
| 1236 | Ga0495591_014684 | |||
| 1237 | Ga0495629_0033508 | |||
| 1238 | Ga0495638_0000164 | |||
| 1239 | Ga0495638_0014846 | |||
| 1240 | Ga0495638_0014868 | |||
| 1241 | Ga0495638_0080108 | |||
| 1242 | Ga0495638_0134088 | |||
| 1243 | Ga0495638_0178702 | |||
| 1244 | Ga0495638_0186743 | |||
| 1245 | Ga0495638_0192229 | |||
| 1246 | Ga0495653_0001870 | |||
| 1247 | Ga0495653_0046479 | |||
| 1248 | Ga0495653_0056069 | |||
| 1249 | Ga0495653_0076865 | |||
| 1250 | Ga0495650_0004551 | |||
| 1251 | Ga0495650_0011165 | |||
| 1252 | Ga0495650_0015874 | |||
| 1253 | Ga0495650_0016615 | |||
| 1254 | Ga0495650_0017682 | |||
| 1255 | Ga0495650_0045832 | |||
| 1256 | Ga0495650_0087562 | |||
| 1257 | Ga0495650_0109288 | |||
| 1258 | Ga0495582_0011363 | |||
| 1259 | Ga0495605_0003192 | |||
| 1260 | Ga0495605_0007738 | |||
| 1261 | Ga0495605_0008705 | |||
| 1262 | Ga0495605_0010449 | |||
| 1263 | Ga0495605_0010639 | |||
| 1264 | Ga0495605_0010684 | |||
| 1265 | Ga0495605_0015768 | |||
| 1266 | Ga0495605_0088872 | |||
| 1267 | Ga0495605_0092256 | |||
| 1268 | Ga0495605_0133777 | |||
| 1269 | Ga0495605_0239423 | |||
| 1270 | Ga0495639_0002688 | |||
| 1271 | Ga0495639_0026561 | |||
| 1272 | Ga0495584_0004204 | |||
| 1273 | Ga0495584_0009064 | |||
| 1274 | Ga0495584_0061895 | |||
| 1275 | Ga0495584_0079759 | |||
| 1276 | Ga0495584_0092146 | |||
| 1277 | Ga0495584_0119702 | |||
| 1278 | Ga0495584_0383041 | |||
| 1279 | Ga0495585_0011356 | |||
| 1280 | Ga0495585_0017278 | |||
| 1281 | Ga0495585_0081114 | |||
| 1282 | Ga0495585_0122382 | |||
| 1283 | Ga0495596_0006544 | |||
| 1284 | Ga0495596_0083574 | |||
| 1285 | Ga0495607_0002286 | |||
| 1286 | Ga0495607_0005389 | |||
| 1287 | Ga0495607_0005406 | |||
| 1288 | Ga0495607_0005433 | |||
| 1289 | Ga0495607_0013447 | |||
| 1290 | Ga0495607_0014534 | |||
| 1291 | Ga0495607_0014535 | |||
| 1292 | Ga0495607_0022540 | |||
| 1293 | Ga0495607_0028261 | |||
| 1294 | Ga0495607_0035661 | |||
| 1295 | Ga0495607_0045578 | |||
| 1296 | Ga0495607_0051559 | |||
| 1297 | Ga0495607_0096806 | |||
| 1298 | Ga0495607_0121885 | |||
| 1299 | Ga0495607_0185660 | |||
| 1300 | Ga0495607_0378176 | |||
| 1301 | Ga0495583_0004401 | |||
| 1302 | Ga0495583_0005753 | |||
| 1303 | Ga0495583_0015958 | |||
| 1304 | Ga0495583_0016145 | |||
| 1305 | Ga0495583_0017659 | |||
| 1306 | Ga0495583_0037496 | |||
| 1307 | Ga0495583_0068785 | |||
| 1308 | Ga0495606_0001115 | |||
| 1309 | Ga0495606_0003532 | |||
| 1310 | Ga0495606_0017307 | |||
| 1311 | Ga0495606_0017986 | |||
| 1312 | Ga0495606_0022667 | |||
| 1313 | Ga0495606_0023324 | |||
| 1314 | Ga0495606_0025496 | |||
| 1315 | Ga0495606_0033353 | |||
| 1316 | Ga0495606_0034211 | |||
| 1317 | Ga0495606_0088915 | |||
| 1318 | Ga0495606_0163539 | |||
| 1319 | Ga0495610_0015699 | |||
| 1320 | Ga0495610_0019105 | |||
| 1321 | Ga0495610_0022319 | |||
| 1322 | Ga0495610_0033789 | |||
| 1323 | Ga0495610_0062866 | |||
| 1324 | Ga0495610_0272314 | |||
| 1325 | Ga0495616_0009667 | |||
| 1326 | Ga0495616_0016921 | |||
| 1327 | Ga0495616_0018335 | |||
| 1328 | Ga0495616_0055611 | |||
| 1329 | Ga0495616_0148199 | |||
| 1330 | Ga0495616_0226203 | |||
| 1331 | Ga0495616_0343692 | |||
| 1332 | Ga0495620_0008155 | |||
| 1333 | Ga0495620_0008360 | |||
| 1334 | Ga0495620_0009999 | |||
| 1335 | Ga0495620_0010670 | |||
| 1336 | Ga0495620_0042422 | |||
| 1337 | Ga0495620_0081400 | |||
| 1338 | Ga0495630_0317747 | |||
| 1339 | Ga0495631_0006910 | |||
| 1340 | Ga0495631_0008741 | |||
| 1341 | Ga0495631_0009105 | |||
| 1342 | Ga0495631_0016294 | |||
| 1343 | Ga0495631_0121312 | |||
| 1344 | Ga0495632_0010120 | |||
| 1345 | Ga0495632_0011673 | |||
| 1346 | Ga0495632_0011827 | |||
| 1347 | Ga0495632_0014349 | |||
| 1348 | Ga0495632_0017298 | |||
| 1349 | Ga0495632_0034749 | |||
| 1350 | Ga0495632_0087816 | |||
| 1351 | Ga0495632_0230386 | |||
| 1352 | Ga0495632_0326219 | |||
| 1353 | Ga0495637_0002754 | |||
| 1354 | Ga0495637_0006137 | |||
| 1355 | Ga0495637_0007676 | |||
| 1356 | Ga0495637_0009878 | |||
| 1357 | Ga0495637_0011097 | |||
| 1358 | Ga0495637_0013267 | |||
| 1359 | Ga0495637_0014581 | |||
| 1360 | Ga0495637_0023155 | |||
| 1361 | Ga0495637_0029375 | |||
| 1362 | Ga0495637_0137673 | |||
| 1363 | Ga0495637_0186339 | |||
| 1364 | Ga0495643_0001220 | |||
| 1365 | Ga0495643_0014224 | |||
| 1366 | Ga0495643_0014720 | |||
| 1367 | Ga0495643_0016323 | |||
| 1368 | Ga0495643_0022424 | |||
| 1369 | Ga0495643_0072319 | |||
| 1370 | Ga0495643_0092244 | |||
| 1371 | Ga0495643_0134829 | |||
| 1372 | Ga0495644_0011264 | |||
| 1373 | Ga0495644_0024499 | |||
| 1374 | Ga0495648_0002757 | |||
| 1375 | Ga0495648_0020724 | |||
| 1376 | Ga0495648_0068471 | |||
| 1377 | Ga0495648_0141007 | |||
| 1378 | Ga0495648_0157311 | |||
| 1379 | Ga0495648_0285350 | |||
| 1380 | Ga0495648_0330859 | |||
| 1381 | Ga0495666_0008636 | |||
| 1382 | Ga0495666_0015667 | |||
| 1383 | Ga0495642_0004844 | |||
| 1384 | Ga0495642_0086277 | |||
| 1385 | Ga0495652_0152432 | |||
| 1386 | Ga0495654_0004450 | |||
| 1387 | Ga0495654_0007398 | |||
| 1388 | Ga0495654_0014809 | |||
| 1389 | Ga0495654_0015390 | |||
| 1390 | Ga0495654_0017707 | |||
| 1391 | Ga0495654_0019172 | |||
| 1392 | Ga0495654_0019440 | |||
| 1393 | Ga0495654_0020022 | |||
| 1394 | Ga0495654_0026604 | |||
| 1395 | Ga0495654_0029675 | |||
| 1396 | Ga0495654_0030003 | |||
| 1397 | Ga0495654_0278209 | |||
| 1398 | Ga0495586_0040848 | |||
| 1399 | Ga0495587_0012284 | |||
| 1400 | Ga0495587_0022683 | |||
| 1401 | Ga0495609_0003213 | |||
| 1402 | Ga0495609_0007879 | |||
| 1403 | Ga0495609_0039186 | |||
| 1404 | Ga0495609_0046763 | |||
| 1405 | Ga0495597_0001457 | |||
| 1406 | Ga0495597_0027373 | |||
| 1407 | Ga0495597_0047214 | |||
| 1408 | Ga0495597_0175356 | |||
| 1409 | Ga0495645_0117725 | |||
| 1410 | Ga0495645_0260279 | |||
| 1411 | Ga0495622_0006744 | |||
| 1412 | Ga0495622_0008637 | |||
| 1413 | Ga0495622_0010751 | |||
| 1414 | Ga0495622_0017003 | |||
| 1415 | Ga0495622_0032167 | |||
| 1416 | Ga0495622_0171494 | |||
| 1417 | Ga0495633_0014722 | |||
| 1418 | Ga0495656_0357977 | |||
| 1419 | Ga0495656_0555535 | |||
| 1420 | Ga0495668_0011841 | |||
| 1421 | Ga0495668_0017874 | |||
| 1422 | Ga0495668_0022974 | |||
| 1423 | Ga0495668_0110354 | |||
| 1424 | Ga0495668_0157801 | |||
| 1425 | Ga0495611_0006133 | |||
| 1426 | Ga0495611_0008856 | |||
| 1427 | Ga0495625_0019890 | |||
| 1428 | Ga0495625_0020325 | |||
| 1429 | Ga0495625_0029611 | |||
| 1430 | Ga0495625_0038359 | |||
| 1431 | Ga0495625_0049169 | |||
| 1432 | Ga0495625_0140695 | |||
| 1433 | Ga0495635_0031268 | |||
| 1434 | Ga0495635_0859036 | |||
| 1435 | Ga0495661_0004633 | |||
| 1436 | Ga0495661_0004922 | |||
| 1437 | Ga0495661_0014463 | |||
| 1438 | Ga0495661_0025942 | |||
| 1439 | Ga0495661_0028384 | |||
| 1440 | Ga0495661_0044397 | |||
| 1441 | Ga0495661_0073105 | |||
| 1442 | Ga0495661_0098895 | |||
| 1443 | Ga0495661_0130109 | |||
| 1444 | Ga0495588_0140095 | |||
| 1445 | Ga0495646_0026262 | |||
| 1446 | Ga0495646_0213370 | |||
| 1447 | Ga0495613_0050511 | |||
| 1448 | Ga0495613_0326339 | |||
| 1449 | Ga0495624_0016190 | |||
| 1450 | Ga0495670_0007721 | |||
| 1451 | Ga0495670_0012987 | |||
| 1452 | Ga0495670_0020033 | |||
| 1453 | Ga0495670_0072775 | |||
| 1454 | Ga0495671_0001579 | |||
| 1455 | Ga0495671_0003567 | |||
| 1456 | Ga0495671_0041774 | |||
| 1457 | Ga0495671_0126223 | |||
| 1458 | Ga0495649_0016490 | |||
| 1459 | Ga0495649_0030990 | |||
| 1460 | Ga0495649_0039352 | |||
| 1461 | Ga0495649_0072948 | |||
| 1462 | Ga0495649_0109044 | |||
| 1463 | Ga0495649_0221090 | |||
| 1464 | Ga0495649_0274753 | |||
| 1465 | Ga0495649_0363234 | |||
| 1466 | Ga0495649_0419311 | |||
| 1467 | Ga0495589_0009237 | |||
| 1468 | Ga0495589_0026180 | |||
| 1469 | Ga0495589_0037858 | |||
| 1470 | Ga0495589_0266287 | |||
| 1471 | Ga0495600_0013552 | |||
| 1472 | Ga0495660_0002084 | |||
| 1473 | Ga0495660_0008386 | |||
| 1474 | Ga0495660_0024657 | |||
| 1475 | Ga0495660_0044680 | |||
| 1476 | Ga0495660_0053373 | |||
| 1477 | Ga0495660_0080051 | |||
| 1478 | Ga0495660_0114313 | |||
| 1479 | Ga0495660_0135049 | |||
| 1480 | Ga0495660_0163747 | |||
| 1481 | Ga0495660_0165733 | |||
| 1482 | Ga0495660_0309168 | |||
| 1483 | Ga0495604_0078717 | |||
| 1484 | Ga0495604_0085261 | |||
| 1485 | Ga0495672_0003342 | |||
| 1486 | Ga0495672_0003889 | |||
| 1487 | Ga0495672_0010407 | |||
| 1488 | Ga0495672_0015615 | |||
| 1489 | Ga0495672_0019557 | |||
| 1490 | Ga0495672_0019954 | |||
| 1491 | Ga0495672_0021806 | |||
| 1492 | Ga0495672_0024590 | |||
| 1493 | Ga0495672_0026470 | |||
| 1494 | Ga0495672_0031274 | |||
| 1495 | Ga0495672_0130969 | |||
| 1496 | Ga0495672_0242354 | |||
| 1497 | Ga0495672_0336639 | |||
| 1498 | Ga0495676_0008239 | |||
| 1499 | Ga0495676_0149993 | |||
| 1500 | Ga0495680_0042103 | |||
| 1501 | Ga0495680_0954627 | |||
| 1502 | Ga0495683_0013831 | |||
| 1503 | Ga0495683_0124094 | |||
| 1504 | Ga0495683_0163314 | |||
| 1505 | Ga0495683_0247523 | |||
| 1506 | Ga0495683_0293436 | |||
| 1507 | Ga0495687_019311 | |||
| 1508 | Ga0495687_071282 | |||
| 1509 | Ga0495675_0008994 | |||
| 1510 | Ga0495679_039489 | |||
| 1511 | Ga0495679_046562 | |||
| 1512 | Ga0495685_090349 | |||
| 1513 | Ga0495673_0003950 | |||
| 1514 | Ga0495673_0006113 | |||
| 1515 | Ga0495673_0010068 | |||
| 1516 | Ga0495673_0016540 | |||
| 1517 | Ga0495673_0021787 | |||
| 1518 | Ga0495673_0026641 | |||
| 1519 | Ga0495673_0026860 | |||
| 1520 | Ga0495673_0031901 | |||
| 1521 | Ga0495673_0066413 | |||
| 1522 | Ga0495673_0099782 | |||
| 1523 | Ga0495673_0117091 | |||
| 1524 | Ga0495681_0004648 | |||
| 1525 | Ga0495681_0007807 | |||
| 1526 | Ga0495681_0011362 | |||
| 1527 | Ga0495681_0012119 | |||
| 1528 | Ga0495681_0012250 | |||
| 1529 | Ga0495681_0012994 | |||
| 1530 | Ga0495681_0017176 | |||
| 1531 | Ga0495681_0036458 | |||
| 1532 | Ga0495681_0040716 | |||
| 1533 | Ga0495681_0053059 | |||
| 1534 | Ga0495681_0085029 | |||
| 1535 | Ga0495684_0294329 | |||
| 1536 | Ga0495686_0015872 | |||
| 1537 | Ga0495686_0029869 | |||
| 1538 | Ga0495686_0046517 | |||
| 1539 | Ga0495686_0050021 | |||
| 1540 | Ga0495686_0182624 | |||
| 1541 | Ga0495593_0014408 | |||
| 1542 | Ga0495593_0056045 | |||
| 1543 | Ga0495602_0091733 | |||
| 1544 | Ga0495626_0001991 | |||
| 1545 | Ga0495626_0009696 | |||
| 1546 | Ga0495626_0014242 | |||
| 1547 | Ga0495626_0014655 | |||
| 1548 | Ga0495626_0018199 | |||
| 1549 | Ga0495626_0033590 | |||
| 1550 | Ga0495626_0036585 | |||
| 1551 | Ga0495626_0088949 | |||
| 1552 | Ga0495626_0171452 | |||
| 1553 | Ga0496102_0024615 | |||
| 1554 | Ga0496102_0188033 | |||
| 1555 | Ga0496110_0399333 | |||
| 1556 | Ga0496110_0646356 | |||
| 1557 | Ga0496112_0508368 | |||
| 1558 | Ga0496115_0436570 | |||
| 1559 | Ga0496116_0009224 | |||
| 1560 | Ga0496116_0019431 | |||
| 1561 | Ga0496116_0029144 | |||
| 1562 | Ga0496117_0001936 | |||
| 1563 | Ga0496117_0012366 | |||
| 1564 | Ga0496117_0064804 | |||
| 1565 | Ga0496117_0159863 | |||
| 1566 | Ga0496117_0405504 | |||
| 1567 | Ga0496118_0103372 | |||
| 1568 | Ga0496118_0156661 | |||
| 1569 | Ga0496118_0196887 | |||
| 1570 | Ga0496119_0389673 | |||
| 1571 | Ga0496120_0174616 | |||
| 1572 | Ga0496121_0012137 | |||
| 1573 | Ga0496121_0014201 | |||
| 1574 | Ga0496121_0019552 | |||
| 1575 | Ga0496121_0030231 | |||
| 1576 | Ga0496121_0082684 | |||
| 1577 | Ga0496122_0004546 | |||
| 1578 | Ga0496122_0041678 | |||
| 1579 | Ga0496122_0051867 | |||
| 1580 | Ga0496122_0059033 | |||
| 1581 | Ga0496122_0125994 | |||
| 1582 | Ga0496122_0228335 | |||
| 1583 | Ga0496123_0001488 | |||
| 1584 | Ga0496123_0019101 | |||
| 1585 | Ga0496123_0041371 | |||
| 1586 | Ga0496124_0050108 | |||
| 1587 | Ga0496124_0103082 | |||
| 1588 | Ga0496124_0158414 | |||
| 1589 | Ga0496124_0205167 | |||
| 1590 | Ga0496125_0039982 | |||
| 1591 | Ga0495678_006775 | |||
| 1592 | Ga0495678_012071 | |||
| 1593 | Ga0495678_012391 | |||
| 1594 | Ga0495678_013877 | |||
| 1595 | Ga0495678_026038 | |||
| 1596 | Ga0495678_029425 | |||
| 1597 | Ga0495678_029701 | |||
| 1598 | Ga0495678_090711 | |||
| 1599 | Ga0495678_123974 | |||
| 1600 | Ga0495682_0002142 | |||
| 1601 | Ga0495682_0056086 | |||
| 1602 | Ga0495682_0072818 | |||
| 1603 | Ga0501032_0017047 | |||
| 1604 | Ga0501034_0304164 | |||
| 1605 | Ga0501034_0803281 | |||
| 1606 | Ga0501037_0239124 | |||
| 1607 | Ga0501038_0214015 | |||
| 1608 | Ga0501039_0265071 | |||
| 1609 | Ga0501039_0302200 | |||
| 1610 | Ga0501241_019596 | |||
| 1611 | Ga0501269_022103 | |||
| 1612 | nmdc:mga00v17_206134_c1 | |||
| 1613 | nmdc:mga08x19_666959_c1 | |||
| 1614 | nmdc:mga0sz30_142374_c1 | |||
| 1615 | Ga0500572_003167 | |||
| 1616 | Ga0500573_0017545 | |||
| 1617 | Ga0500577_0250819 | |||
| 1618 | 2510283934 | |||
| 1619 | 2510293393 | |||
| 1620 | 2510312885 | |||
| 1621 | 2511256926 | |||
| 1622 | 2511266935 | |||
| 1623 | 2511272926 | |||
| 1624 | 2511276126 | |||
| 1625 | 2511291216 | |||
| 1626 | 2511293775 | |||
| 1627 | 2511300536 | |||
| 1628 | 2511315510 | |||
| 1629 | 2511320342 | |||
| 1630 | 2511323571 | |||
| 1631 | 2511330728 | |||
| 1632 | 2511336806 | |||
| 1633 | 2511342584 | |||
| 1634 | 2511348106 | |||
| 1635 | 2511357049 | |||
| 1636 | 2511363204 | |||
| 1637 | 2511369748 | |||
| 1638 | 2511414941 | |||
| 1639 | 2511826789 | |||
| 1640 | 2555671992 | |||
| 1641 | 2599329645 | |||
| 1642 | 2599353843 | |||
| 1643 | 2599378951 | |||
| 1644 | 2599386071 | |||
| 1645 | 2599460677 | |||
| 1646 | 2599489698 | |||
| 1647 | 2599502858 | |||
| 1648 | 2599615114 | |||
| 1649 | 2599930115 | |||
| 1650 | 2599945359 | |||
| 1651 | 2599955631 | |||
| 1652 | 2599969343 | |||
| 1653 | 2599973361 | |||
| 1654 | 2599980684 | |||
| 1655 | 2599985744 | |||
| 1656 | 2599990638 | |||
| 1657 | 2599995956 | |||
| 1658 | 2600001976 | |||
| 1659 | 2600014500 | |||
| 1660 | 2600025528 | |||
| 1661 | 2600027856 | |||
| 1662 | 2600033426 | |||
| 1663 | 2600040289 | |||
| 1664 | 2600049343 | |||
| 1665 | 2600061609 | |||
| 1666 | 2600064227 | |||
| 1667 | 2600077323 | |||
| 1668 | 2600213291 | |||
| 1669 | 2600357023 | |||
| 1670 | 2600443501 | |||
| 1671 | 2601625906 | |||
| 1672 | 2601773458 | |||
| 1673 | 2601799706 | |||
| 1674 | 2602009045 | |||
| 1675 | 2606074109 | |||
| 1676 | 2606126246 | |||
| 1677 | 2624482654 | |||
| 1678 | 2624490281 | |||
| 1679 | 2643842004 | |||
| 1680 | 2643955414 | |||
| 1681 | 2644023766 | |||
| 1682 | 2644185891 | |||
| 1683 | 2644285801 | |||
| 1684 | 2652545175 | |||
| 1685 | 2671125642 | |||
| 1686 | 2678265159 | |||
| 1687 | 2715752018 | |||
| 1688 | 2715755352 | |||
| 1689 | 2718635866 | |||
| 1690 | 2739196495 | |||
| 1691 | 2739257470 | |||
| 1692 | 2739265346 | |||
| 1693 | 2739289270 | |||
| 1694 | 2739294582 | |||
| 1695 | 2739314480 | |||
| 1696 | 2739732539 | |||
| 1697 | 2745005615 | |||
| 1698 | 2774122092 | |||
| 1699 | 2774131875 | |||
| 1700 | 2774133535 | |||
| 1701 | 2784262578 | |||
| 1702 | 2784314337 | |||
| 1703 | 2794595538 | |||
| 1704 | 2808855824 | |||
| 1705 | 2808905171 | |||
| 1706 | 2808921968 | |||
| 1707 | 2808933355 | |||
| 1708 | 2808935905 | |||
| 1709 | 2808944089 | |||
| 1710 | 2808955463 | |||
| 1711 | 2808959683 | |||
| 1712 | 2808964303 | |||
| 1713 | 2808999191 | |||
| 1714 | 2809218560 | |||
| 1715 | 2812368551 | |||
| 1716 | 2819654243 | |||
| 1717 | 2819701515 | |||
| 1718 | 2823425111 | |||
| 1719 | 2825655945 | |||
| 1720 | 2826585537 | |||
| 1721 | 2842809197 | |||
| 1722 | 2842818203 | |||
| 1723 | 2842837509 | |||
| 1724 | 2842845293 | |||
| 1725 | 2842853095 | |||
| 1726 | 2842856349 | |||
| 1727 | 2844666158 | |||
| 1728 | 2852660601 | |||
| 1729 | 2878034584 | |||
| 1730 | 2880235231 | |||
| 1731 | 2904521604 | |||
| 1732 | 2913041768 | |||
| 1733 | 2917075865 | |||
| 1734 | 2919069575 | |||
| 1735 | 2919388652 | |||
| 1736 | 2919490027 | |||
| 1737 | 2919501828 | |||
| 1738 | 2919703755 | |||
| 1739 | 2923522609 | |||
| 1740 | 2923590413 | |||
| 1741 | 2926063501 | |||
| 1742 | 2929149086 | |||
| 1743 | 2931373491 | |||
| 1744 | 2935356851 | |||
| 1745 | 2939636965 | |||
| 1746 | 2974289261 | |||
| 1747 | 2974301304 | |||
| 1748 | 2984503781 | |||
| 1749 | 2984507637 | |||
| 1750 | 2988730689 | |||
| 1751 | 2998144641 | |||
| 1752 | 3007254077 | |||
| 1753 | 3007317185 | |||
| 1754 | 3007420557 | |||
| 1755 | 3007615669 | |||
| 1756 | 3007723949 | |||
| 1757 | 3007858376 | |||
| 1758 | 3007867571 | |||
| 1759 | 637322408 | |||
| 1760 | 640487028 | |||
| 1761 | 651174900 | |||
| 1762 | 8016730224 | |||
| 1763 | 8019782070 | |||
| 1764 | 8029996238 | |||
| 1765 | 8034963085 | |||
| 1766 | 8056130883 | |||
| 1767 | 8056144303 | |||
| 1768 | 8056171915 | |||
| 1769 | 8056172596 | |||
| 1770 | 8056179773 | |||
| 1771 | 8056574415 | |||
| 1772 | 8057804897 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fov-assembly1.cif.gz_A | crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris | 0.9297 | 13 | 120 |
| 3fov-assembly1.cif.gz_A | crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris | 0.8946 | 13 | 120 |
| 2wcw-assembly1.cif.gz_B | 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile | 0.7589 | 10 | 115 |
| 2wcz-assembly1.cif.gz_B | 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile | 0.7523 | 15 | 115 |
| 1ipi-assembly1.cif.gz_A | crystal structure of the archaeal holliday junction resolvase hjc from pyrococcus furiosus form ii | 0.739 | 10 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45465_23_131_3.40.1350.10 | Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; | 0.9306 | 14 | 119 | 3.40.1350.10 |
| 3fovA00 | Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; | 0.9292 | 13 | 120 | 3.40.1350.10 |
| 3fovA00 | Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; | 0.8938 | 13 | 120 | 3.40.1350.10 |
| af_P45465_23_131_3.40.1350.10 | Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; | 0.8896 | 14 | 119 | 3.40.1350.10 |
| af_P9WFM9_15_126_3.40.1350.10 | Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; | 0.8527 | 13 | 115 | 3.40.1350.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A423L244-F1-model_v4 | UPF0102 protein BK671_24020 | 0.9902 | 1 | 120 |
GO:0003676
|
| AF-A0A031G419-F1-model_v4 | UPF0102 protein BW33_02461 | 0.9875 | 1 | 120 |
GO:0003676
GO:0004519 |
| AF-A0A7W4H1T6-F1-model_v4 | UPF0102 protein H3H45_01140 | 0.9826 | 8 | 120 |
GO:0003676
|
| AF-A0A259M8E2-F1-model_v4 | YraN family protein | 0.9808 | 27 | 120 |
GO:0003676
|
| AF-A0A520SGH3-F1-model_v4 | UPF0102 protein EVA63_01285 | 0.9796 | 5 | 119 |
GO:0003676
|