F484692

General Info

Members Datasets Scaffolds Average Seq Length
886 394 1772 121

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10284323|Ga0105244_102843231
Length 141
Sequence MGTIRQWPGPAPAEYPTLMPQGSHLESGKDAESLALRHLEQQGLRLLAQNWSCKRGELDLVMLDGDTVVFVEVRYRKNTQWGGAAGSIDARKRKKLIFAAQYFLQRESRWANSPCRFDVIAIEGALDTAPRLNWLRNAFDS

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
39 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
40 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
78 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
96 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
97 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
98 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
99 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
115 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
116 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
117 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
118 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
122 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
123 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
124 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
125 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
126 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
127 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
128 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
129 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
130 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
131 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
132 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
133 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
134 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
135 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
139 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
140 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
200 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
204 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
205 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
233 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
238 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
241 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
242 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
243 2511231004 Pseudomonas sp. GM102 Isolate Nodule
244 2511231006 Pseudomonas sp. GM17 Isolate Nodule
245 2511231007 Pseudomonas sp. GM18 Isolate Nodule
246 2511231008 Pseudomonas sp. GM21 Isolate Nodule
247 2511231010 Pseudomonas sp. GM25 Isolate Nodule
248 2511231011 Pseudomonas sp. GM30 Isolate Nodule
249 2511231012 Pseudomonas sp. GM33 Isolate Nodule
250 2511231014 Pseudomonas sp. GM48 Isolate Nodule
251 2511231015 Pseudomonas sp. GM49 Isolate Nodule
252 2511231016 Pseudomonas sp. GM50 Isolate Nodule
253 2511231017 Pseudomonas sp. GM55 Isolate Nodule
254 2511231018 Pseudomonas sp. GM60 Isolate Nodule
255 2511231019 Pseudomonas sp. GM67 Isolate Nodule
256 2511231020 Pseudomonas sp. GM74 Isolate Nodule
257 2511231021 Pseudomonas sp. GM78 Isolate Nodule
258 2511231022 Pseudomonas sp. GM79 Isolate Nodule
259 2511231023 Pseudomonas sp. GM80 Isolate Nodule
260 2511231031 Pseudomonas sp. GM16 Isolate Nodule
261 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
262 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
263 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
264 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
265 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
266 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
267 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
268 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
269 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
270 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
271 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
272 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
273 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
274 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
275 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
276 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
277 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
278 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
279 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
280 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
281 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
282 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
283 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
284 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
285 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
286 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
287 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
288 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
289 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
290 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
291 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
292 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
293 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
294 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
295 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
296 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
297 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
298 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
299 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
300 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
301 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
302 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
303 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
304 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
305 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
306 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
307 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
308 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
309 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
310 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
311 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
312 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
313 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
314 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
315 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
316 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
317 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
318 2739367700 Dyella sp. YR388 Isolate Unclassified
319 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
320 2773857670 Pseudomonas sp. 478 Isolate Unclassified
321 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
322 2773857673 Pseudomonas sp. 443 Isolate Unclassified
323 2784132063 Pseudomonas sp. 424 Isolate Unclassified
324 2784132072 Pseudomonas sp. 460 Isolate Unclassified
325 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
326 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
327 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
328 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
329 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
330 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
331 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
332 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
333 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
334 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
335 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
336 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
337 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
338 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
339 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
340 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
341 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
342 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
343 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
344 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
345 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
346 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
347 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
348 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
349 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
350 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
351 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
352 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
353 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
354 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
355 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
356 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
357 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
358 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
359 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
360 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
361 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
362 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
363 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
364 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
365 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
366 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
367 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
368 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
369 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
370 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
371 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
372 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
373 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
374 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
375 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
376 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
377 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
378 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
379 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
380 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
381 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
382 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
383 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
384 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
385 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
386 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
387 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
388 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
389 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
390 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
391 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
392 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
393 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
394 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.51
Metatranscriptomes 0
Isolates 17.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 5.76
Nodule 2.71
Rhizoplane 5.08
Rhizosphere 76.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10284323 3300009036 Bacteria 767
2 MRS2a_Contig_6365 2124908027 Bacteria 1672
3 MRS2a_Contig_63 2124908027 Bacteria 63450
4 JGI25162J39368_1002343 3300002737 Bacteria 7528
5 JGI25162J39368_1002368 3300002737 Bacteria 7454
6 JGI25164J39214_1001140 3300002772 Bacteria 7528
7 JGI25164J39214_1001148 3300002772 Bacteria 7454
8 JGI25165J46597_1002064 3300003214 Bacteria 7528
9 JGI25165J46597_1002076 3300003214 Bacteria 7454
10 rootH1_10113058 3300003323 Bacteria 1731
11 Ga0055536_1002477 3300003781 Bacteria 10365
12 Ga0055536_1009168 3300003781 Bacteria 4136
13 Ga0055536_1009170 3300003781 Bacteria 4135
14 Ga0055530_10002925 3300003791 Bacteria 10344
15 Ga0055530_10003090 3300003791 Bacteria 9889
16 Ga0055530_10003689 3300003791 Bacteria 8546
17 Ga0055540_1002354 3300003792 Bacteria 10114
18 Ga0055540_1002654 3300003792 Bacteria 9248
19 Ga0055540_1002780 3300003792 Bacteria 8962
20 Ga0055531_10000348 3300003794 Bacteria 45293
21 Ga0055531_10090088 3300003794 Bacteria 653
22 Ga0065714_10000200 3300005288 Bacteria 7519
23 Ga0065714_10010890 3300005288 Bacteria 2161
24 Ga0065714_10016682 3300005288 Bacteria 2476
25 Ga0065714_10019055 3300005288 Bacteria 2100
26 Ga0065714_10065997 3300005288 Bacteria 7859
27 Ga0065714_10074076 3300005288 Bacteria 3085
28 Ga0065714_10116478 3300005288 Bacteria 1402
29 Ga0065714_10148665 3300005288 Bacteria 1120
30 Ga0065704_10027423 3300005289 Bacteria 1241
31 Ga0065704_10030190 3300005289 Bacteria 1276
32 Ga0065704_10031494 3300005289 Bacteria 1051
33 Ga0065704_10072936 3300005289 Bacteria 7776
34 Ga0065704_10080368 3300005289 Bacteria 3958
35 Ga0065704_10321926 3300005289 Bacteria 851
36 Ga0065712_10000146 3300005290 Bacteria 63767
37 Ga0065712_10000717 3300005290 Bacteria 8614
38 Ga0065715_10153109 3300005293 Bacteria 1697
39 Ga0070676_10582923 3300005328 Bacteria 804
40 Ga0070714_100717935 3300005435 Bacteria 965
41 Ga0070662_100651465 3300005457 Bacteria 888
42 Ga0070665_100659418 3300005548 Bacteria 1059
43 Ga0070665_100672402 3300005548 Bacteria 1048
44 Ga0070702_101795896 3300005615 Bacteria 512
45 Ga0070717_10948683 3300006028 Bacteria 783
46 Ga0075363_100305575 3300006048 Bacteria 924
47 Ga0075364_10084038 3300006051 Bacteria 2107
48 Ga0075364_10151254 3300006051 Bacteria 1564
49 Ga0075364_10549449 3300006051 Bacteria 789
50 Ga0075432_10004050 3300006058 Bacteria 5003
51 Ga0075432_10084883 3300006058 Bacteria 1152
52 Ga0075432_10099805 3300006058 Bacteria 1071
53 Ga0075432_10516211 3300006058 Bacteria 535
54 Ga0075362_10179175 3300006177 Bacteria 1026
55 Ga0075362_10190353 3300006177 Bacteria 996
56 Ga0075369_10126777 3300006186 Bacteria 1158
57 Ga0075366_10680393 3300006195 Bacteria 639
58 Ga0075370_10312948 3300006353 Bacteria 935
59 Ga0075370_10516229 3300006353 Bacteria 722
60 Ga0075436_100477209 3300006914 Bacteria 910
61 Ga0075436_100984525 3300006914 Bacteria 632
62 Ga0079104_1002687 3300006946 Bacteria 9162
63 Ga0079104_1003518 3300006946 Bacteria 7216
64 Ga0099826_10037988 3300006948 Bacteria 3387
65 Ga0105251_10000004 3300009011 Bacteria 285212
66 Ga0105251_10004443 3300009011 Bacteria 9541
67 Ga0105251_10007066 3300009011 Bacteria 6997
68 Ga0105251_10152037 3300009011 Bacteria 1045
69 Ga0105251_10376619 3300009011 Bacteria 650
70 Ga0105244_10001043 3300009036 Bacteria 23186
71 Ga0105244_10005209 3300009036 Bacteria 8698
72 Ga0105244_10017949 3300009036 Bacteria 3983
73 Ga0105244_10018410 3300009036 Bacteria 3919
74 Ga0105244_10042431 3300009036 Bacteria 2352
75 Ga0105244_10049032 3300009036 Bacteria 2160
76 Ga0105244_10162520 3300009036 Bacteria 1066
77 Ga0105250_10002390 3300009092 Bacteria 9469
78 Ga0105250_10011759 3300009092 Bacteria 3627
79 Ga0105250_10072110 3300009092 Bacteria 1396
80 Ga0105250_10134459 3300009092 Bacteria 1022
81 Ga0105250_10190386 3300009092 Bacteria 863
82 Ga0105250_10223713 3300009092 Bacteria 799
83 Ga0105243_10002016 3300009148 Bacteria 17266
84 Ga0105243_10021965 3300009148 Bacteria 4847
85 Ga0105243_10035653 3300009148 Bacteria 3858
86 Ga0105243_10088108 3300009148 Bacteria 2550
87 Ga0105243_10100894 3300009148 Bacteria 2396
88 Ga0105243_10935939 3300009148 Bacteria 864
89 Ga0105242_10108381 3300009176 Bacteria 2364
90 Ga0105242_11007755 3300009176 Bacteria 841
91 Ga0105238_11068549 3300009551 Bacteria 829
92 Ga0105249_10068245 3300009553 Bacteria 3279
93 Ga0105246_10003691 3300011119 Bacteria 9267
94 Ga0105246_10007602 3300011119 Bacteria 6647
95 Ga0105246_10051958 3300011119 Bacteria 2815
96 Ga0157336_1021986 3300012477 Bacteria 584
97 Ga0157345_1000406 3300012498 Bacteria 4559
98 Ga0157347_1012782 3300012502 Bacteria 910
99 Ga0157373_10006663 3300013100 Bacteria 8605
100 Ga0157373_10011669 3300013100 Bacteria 6452
101 Ga0157373_10035499 3300013100 Bacteria 3579
102 Ga0157373_10081575 3300013100 Bacteria 2280
103 Ga0157373_10612783 3300013100 Bacteria 793
104 Ga0157371_10016794 3300013102 Bacteria 5452
105 Ga0157371_10022390 3300013102 Bacteria 4632
106 Ga0157371_10029549 3300013102 Bacteria 3961
107 Ga0157371_10048074 3300013102 Bacteria 3033
108 Ga0157371_10423721 3300013102 Bacteria 976
109 Ga0157370_10100977 3300013104 Bacteria 2702
110 Ga0157370_10129888 3300013104 Bacteria 2350
111 Ga0157370_10308121 3300013104 Bacteria 1461
112 Ga0157370_10440361 3300013104 Bacteria 1198
113 Ga0157370_10470853 3300013104 Bacteria 1154
114 Ga0157370_10538873 3300013104 Bacteria 1070
115 Ga0157369_10004082 3300013105 Bacteria 17282
116 Ga0157369_11743848 3300013105 Bacteria 633
117 Ga0163162_10031182 3300013306 Bacteria 5286
118 Ga0157372_10041925 3300013307 Bacteria 5061
119 Ga0157375_10099065 3300013308 Bacteria 2993
120 Ga0157375_11539420 3300013308 Bacteria 785
121 Ga0157380_11096178 3300014326 Bacteria 835
122 Ga0182008_10005981 3300014497 Bacteria 6851
123 Ga0182008_10019027 3300014497 Bacteria 3550
124 Ga0182008_10021627 3300014497 Bacteria 3303
125 Ga0182008_10039351 3300014497 Bacteria 2363
126 Ga0182008_10112047 3300014497 Bacteria 1352
127 Ga0182008_10184842 3300014497 Bacteria 1056
128 Ga0182006_1013528 3300015261 Bacteria 3539
129 Ga0182006_1018530 3300015261 Bacteria 2940
130 Ga0182006_1022967 3300015261 Bacteria 2586
131 Ga0182006_1031971 3300015261 Bacteria 2117
132 Ga0182007_10010960 3300015262 Bacteria 3552
133 Ga0182007_10243394 3300015262 Bacteria 643
134 Ga0182005_1011004 3300015265 Bacteria 2589
135 Ga0182005_1025175 3300015265 Bacteria 1624
136 Ga0163161_10033270 3300017792 Bacteria 3684
137 Ga0163161_10098800 3300017792 Bacteria 2170
138 Ga0163161_10198086 3300017792 Bacteria 1547
139 Ga0163161_10618130 3300017792 Bacteria 895
140 Ga0209760_100534 3300025207 Bacteria 7232
141 Ga0209674_116692 3300025226 Bacteria 608
142 Ga0209672_100625 3300025228 Bacteria 18270
143 Ga0209563_102480 3300025230 Bacteria 4154
144 Ga0207427_100007 3300025231 Bacteria 746220
145 Ga0209437_100006 3300025233 Bacteria 1042724
146 Ga0209759_1015308 3300025256 Bacteria 1984
147 Ga0209233_1000059 3300025261 Bacteria 414562
148 Ga0209675_1004261 3300025291 Bacteria 6445
149 Ga0209676_1000010 3300025292 Bacteria 954025
150 Ga0209676_1017459 3300025292 Bacteria 2539
151 Ga0209676_1019618 3300025292 Bacteria 2322
152 Ga0209050_1000019 3300025298 Bacteria 608757
153 Ga0209050_1000027 3300025298 Bacteria 483261
154 Ga0209050_1004537 3300025298 Bacteria 9334
155 Ga0209051_1000102 3300025303 Bacteria 162911
156 Ga0209051_1000383 3300025303 Bacteria 62847
157 Ga0209051_1008728 3300025303 Bacteria 5328
158 Ga0209257_1000119 3300025304 Bacteria 225893
159 Ga0209257_1011631 3300025304 Bacteria 4205
160 Ga0207696_1000054 3300025711 Bacteria 266962
161 Ga0207696_1000213 3300025711 Bacteria 87128
162 Ga0207696_1003221 3300025711 Bacteria 7529
163 Ga0207696_1008374 3300025711 Bacteria 3965
164 Ga0207696_1049746 3300025711 Bacteria 1201
165 Ga0207655_1000005 3300025728 Bacteria 917277
166 Ga0207655_1000015 3300025728 Bacteria 600662
167 Ga0207655_1001289 3300025728 Bacteria 23749
168 Ga0207655_1004342 3300025728 Bacteria 10097
169 Ga0207655_1009983 3300025728 Bacteria 5822
170 Ga0207655_1012220 3300025728 Bacteria 5038
171 Ga0207655_1015195 3300025728 Bacteria 4297
172 Ga0207655_1015443 3300025728 Bacteria 4245
173 Ga0207655_1016868 3300025728 Bacteria 3970
174 Ga0207655_1048185 3300025728 Bacteria 1752
175 Ga0207655_1053401 3300025728 Bacteria 1616
176 Ga0207655_1108396 3300025728 Bacteria 943
177 Ga0207713_1000013 3300025735 Bacteria 475751
178 Ga0207713_1005285 3300025735 Bacteria 8122
179 Ga0207713_1005703 3300025735 Bacteria 7730
180 Ga0207713_1007779 3300025735 Bacteria 6256
181 Ga0207713_1009866 3300025735 Bacteria 5341
182 Ga0207713_1014244 3300025735 Bacteria 4145
183 Ga0207713_1018723 3300025735 Bacteria 3418
184 Ga0207713_1022092 3300025735 Bacteria 3031
185 Ga0207713_1120972 3300025735 Bacteria 878
186 Ga0207645_10662098 3300025907 Bacteria 709
187 Ga0207681_10038543 3300025923 Bacteria 3167
188 Ga0207664_10817785 3300025929 Bacteria 838
189 Ga0207706_10052083 3300025933 Bacteria 3614
190 Ga0207686_11047115 3300025934 Bacteria 664
191 Ga0207709_10000224 3300025935 Bacteria 71687
192 Ga0207709_10001009 3300025935 Bacteria 20872
193 Ga0207709_10003502 3300025935 Bacteria 9294
194 Ga0207709_10099832 3300025935 Bacteria 1916
195 Ga0207709_10427187 3300025935 Bacteria 1019
196 Ga0207678_10080860 3300026067 Bacteria 2782
197 Ga0209281_1000015 3300027111 Bacteria 590084
198 Ga0209281_1002030 3300027111 Bacteria 9176
199 Ga0209281_1002560 3300027111 Bacteria 7081
200 Ga0209371_1000372 3300027312 Bacteria 48390
201 Ga0209969_1005590 3300027360 Bacteria 1768
202 Ga0209981_1009128 3300027378 Bacteria 1354
203 Ga0209981_1018505 3300027378 Bacteria 987
204 Ga0209996_1001815 3300027395 Bacteria 2614
205 Ga0209984_1000904 3300027424 Bacteria 3177
206 Ga0210000_1043629 3300027462 Bacteria 714
207 Ga0209995_1000370 3300027471 Bacteria 6974
208 Ga0209968_1009181 3300027526 Bacteria 1511
209 Ga0209983_1001799 3300027665 Bacteria 4764
210 Ga0209983_1014344 3300027665 Bacteria 1633
211 Ga0209971_1000990 3300027682 Bacteria 7309
212 Ga0209974_10008818 3300027876 Bacteria 3437
213 Ga0209974_10042207 3300027876 Bacteria 1519
214 Ga0207428_10019963 3300027907 Bacteria 5707
215 Ga0207428_10095682 3300027907 Bacteria 2301
216 Ga0207428_10097055 3300027907 Bacteria 2281
217 Ga0207428_10175017 3300027907 Bacteria 1624
218 Ga0207428_10371753 3300027907 Bacteria 1050
219 Ga0268266_11170812 3300028379 Bacteria 743
220 Ga0307517_10304678 3300028786 Bacteria 891
221 Ga0307515_10523950 3300028794 Bacteria 795
222 Ga0268256_1000316 3300030500 Bacteria 48390
223 Ga0307511_10041014 3300030521 Bacteria 3917
224 Ga0316177_1067959 3300030731 Bacteria 707
225 Ga0314311_1053106 3300030733 Bacteria 2373
226 Ga0316179_1118252 3300030734 Bacteria 3410
227 Ga0316178_1061339 3300030735 Bacteria 40218
228 Ga0316183_1164786 3300030742 Bacteria 2969
229 Ga0307513_10677141 3300031456 Bacteria 738
230 Ga0307408_100000020 3300031548 Bacteria 340408
231 Ga0307408_100026677 3300031548 Bacteria 3971
232 Ga0307408_100052194 3300031548 Bacteria 2949
233 Ga0307408_100084620 3300031548 Bacteria 2379
234 Ga0307408_100155822 3300031548 Bacteria 1808
235 Ga0307516_10758312 3300031730 Bacteria 630
236 Ga0307405_10016467 3300031731 Bacteria 4032
237 Ga0307405_10045984 3300031731 Bacteria 2678
238 Ga0307413_10004776 3300031824 Bacteria 5950
239 Ga0307413_10327181 3300031824 Bacteria 1173
240 Ga0307413_10332244 3300031824 Bacteria 1165
241 Ga0307413_10412353 3300031824 Bacteria 1061
242 Ga0307410_11095442 3300031852 Bacteria 690
243 Ga0307406_10068257 3300031901 Bacteria 2320
244 Ga0307406_10081625 3300031901 Bacteria 2150
245 Ga0307407_10164372 3300031903 Bacteria 1455
246 Ga0307407_10252854 3300031903 Bacteria 1208
247 Ga0307407_10535555 3300031903 Bacteria 863
248 Ga0307412_10026347 3300031911 Bacteria 3612
249 Ga0307412_10042695 3300031911 Bacteria 2948
250 Ga0307412_10043739 3300031911 Bacteria 2918
251 Ga0307412_10323155 3300031911 Bacteria 1228
252 Ga0307409_100153497 3300031995 Bacteria 2003
253 Ga0307409_100347020 3300031995 Bacteria 1399
254 Ga0307409_101039419 3300031995 Bacteria 838
255 Ga0307416_101199984 3300032002 Bacteria 864
256 Ga0307416_102661354 3300032002 Bacteria 597
257 Ga0307414_10022843 3300032004 Bacteria 3954
258 Ga0307414_10347300 3300032004 Bacteria 1272
259 Ga0307414_10407538 3300032004 Bacteria 1182
260 Ga0307414_10428881 3300032004 Bacteria 1155
261 Ga0307414_10574864 3300032004 Bacteria 1007
262 Ga0307414_11071539 3300032004 Bacteria 743
263 Ga0307411_10092469 3300032005 Bacteria 2115
264 Ga0307411_10113658 3300032005 Bacteria 1943
265 Ga0307411_10143139 3300032005 Bacteria 1765
266 Ga0307411_10199398 3300032005 Bacteria 1535
267 Ga0307510_10049362 3300033180 Bacteria 4476
268 Ga0237819_00850 3300038705 Bacteria 9625
269 Ga0439436_0001947 3300041404 Bacteria 6113
270 Ga0439438_004835 3300041405 Bacteria 5071
271 Ga0439438_005991 3300041405 Bacteria 4379
272 Ga0439438_012496 3300041405 Bacteria 2602
273 Ga0439438_013016 3300041405 Bacteria 2525
274 Ga0439438_033892 3300041405 Bacteria 1347
275 Ga0439438_035560 3300041405 Bacteria 1308
276 Ga0439447_005256 3300041407 Bacteria 4323
277 Ga0439447_007191 3300041407 Bacteria 3553
278 Ga0439447_007499 3300041407 Bacteria 3456
279 Ga0439447_028240 3300041407 Bacteria 1426
280 Ga0439466_0002455 3300041411 Bacteria 7268
281 Ga0439466_0012706 3300041411 Bacteria 3095
282 Ga0439466_0030461 3300041411 Bacteria 1850
283 Ga0439466_0039442 3300041411 Bacteria 1583
284 Ga0439466_0059830 3300041411 Bacteria 1229
285 Ga0439466_0088008 3300041411 Bacteria 975
286 Ga0439465_0088938 3300041413 Bacteria 1055
287 Ga0439432_006875 3300042006 Bacteria 4052
288 Ga0439432_017053 3300042006 Bacteria 2439
289 Ga0439451_015210 3300042009 Bacteria 1550
290 Ga0439452_002068 3300042010 Bacteria 7620
291 Ga0439452_003491 3300042010 Bacteria 5494
292 Ga0439452_005492 3300042010 Bacteria 4074
293 Ga0439452_006171 3300042010 Bacteria 3776
294 Ga0439452_018818 3300042010 Bacteria 1834
295 Ga0439452_055582 3300042010 Bacteria 897
296 Ga0439456_008547 3300042013 Bacteria 2115
297 Ga0439456_009482 3300042013 Bacteria 2010
298 Ga0439456_064912 3300042013 Bacteria 805
299 Ga0439463_000398 3300042016 Bacteria 12029
300 Ga0439463_118357 3300042016 Bacteria 684
301 Ga0450911_002061 3300042115 Bacteria 4138
302 Ga0450911_014547 3300042115 Bacteria 1045
303 Ga0450911_021889 3300042115 Bacteria 833
304 Ga0450919_003656 3300042121 Bacteria 1909
305 Ga0450919_015498 3300042121 Bacteria 860
306 Ga0450920_002273 3300042122 Bacteria 3254
307 Ga0450922_003438 3300042124 Bacteria 1459
308 Ga0450922_007710 3300042124 Bacteria 1012
309 Ga0450923_009756 3300042125 Bacteria 1687
310 Ga0450923_019088 3300042125 Bacteria 1318
311 Ga0450903_006890 3300042138 Bacteria 1880
312 Ga0450906_038611 3300042145 Bacteria 842
313 Ga0450907_001573 3300042146 Bacteria 4854
314 Ga0450910_002470 3300042147 Bacteria 2427
315 Ga0439446_0002625 3300042156 Bacteria 4340
316 Ga0439446_0281111 3300042156 Bacteria 580
317 Ga0450908_004130 3300042184 Bacteria 2805
318 Ga0439434_0004449 3300042435 Bacteria 4099
319 Ga0439464_0002011 3300042439 Bacteria 4930
320 Ga0439464_0005339 3300042439 Bacteria 3318
321 Ga0439464_0007803 3300042439 Bacteria 2801
322 Ga0450893_0004562 3300042532 Bacteria 2207
323 Ga0450893_0025484 3300042532 Bacteria 1037
324 Ga0450901_007621 3300042533 Bacteria 1114
325 Ga0495617_005254 3300046452 Bacteria 4609
326 Ga0495617_018827 3300046452 Bacteria 2335
327 Ga0495617_019507 3300046452 Bacteria 2293
328 Ga0495617_038146 3300046452 Bacteria 1608
329 Ga0495617_051979 3300046452 Bacteria 1362
330 Ga0495617_056646 3300046452 Bacteria 1300
331 Ga0495627_002521 3300046453 Bacteria 8738
332 Ga0495627_009785 3300046453 Bacteria 3513
333 Ga0495627_071325 3300046453 Bacteria 1014
334 Ga0495627_095624 3300046453 Bacteria 851
335 Ga0495627_221450 3300046453 Bacteria 519
336 Ga0495603_0025579 3300046455 Bacteria 3569
337 Ga0495590_0005392 3300046457 Bacteria 5076
338 Ga0495590_0053578 3300046457 Bacteria 1409
339 Ga0495590_0058969 3300046457 Bacteria 1342
340 Ga0495590_0074039 3300046457 Bacteria 1197
341 Ga0495590_0082356 3300046457 Bacteria 1134
342 Ga0495591_000015 3300046458 Bacteria 252107
343 Ga0495591_002895 3300046458 Bacteria 9205
344 Ga0495591_004113 3300046458 Bacteria 7235
345 Ga0495591_006233 3300046458 Bacteria 5317
346 Ga0495591_008874 3300046458 Bacteria 4060
347 Ga0495591_010833 3300046458 Bacteria 3495
348 Ga0495591_011046 3300046458 Bacteria 3444
349 Ga0495591_012960 3300046458 Bacteria 3075
350 Ga0495591_014684 3300046458 Bacteria 2800
351 Ga0495629_0033508 3300046459 Bacteria 3633
352 Ga0495638_0000164 3300046460 Bacteria 103139
353 Ga0495638_0014846 3300046460 Bacteria 5250
354 Ga0495638_0014868 3300046460 Bacteria 5244
355 Ga0495638_0080108 3300046460 Bacteria 1985
356 Ga0495638_0134088 3300046460 Bacteria 1452
357 Ga0495638_0178702 3300046460 Bacteria 1212
358 Ga0495638_0186743 3300046460 Bacteria 1178
359 Ga0495638_0192229 3300046460 Bacteria 1157
360 Ga0495653_0001870 3300046463 Bacteria 16627
361 Ga0495653_0046479 3300046463 Bacteria 3361
362 Ga0495653_0056069 3300046463 Bacteria 3005
363 Ga0495653_0076865 3300046463 Bacteria 2481
364 Ga0495650_0004551 3300046471 Bacteria 9465
365 Ga0495650_0011165 3300046471 Bacteria 4948
366 Ga0495650_0015874 3300046471 Bacteria 3844
367 Ga0495650_0016615 3300046471 Bacteria 3720
368 Ga0495650_0017682 3300046471 Bacteria 3566
369 Ga0495650_0045832 3300046471 Bacteria 1838
370 Ga0495650_0087562 3300046471 Bacteria 1190
371 Ga0495650_0109288 3300046471 Bacteria 1028
372 Ga0495582_0011363 3300046473 Bacteria 4906
373 Ga0495605_0003192 3300046474 Bacteria 9838
374 Ga0495605_0007738 3300046474 Bacteria 6090
375 Ga0495605_0008705 3300046474 Bacteria 5730
376 Ga0495605_0010449 3300046474 Bacteria 5192
377 Ga0495605_0010639 3300046474 Bacteria 5142
378 Ga0495605_0010684 3300046474 Bacteria 5132
379 Ga0495605_0015768 3300046474 Bacteria 4106
380 Ga0495605_0088872 3300046474 Bacteria 1435
381 Ga0495605_0092256 3300046474 Bacteria 1402
382 Ga0495605_0133777 3300046474 Bacteria 1116
383 Ga0495605_0239423 3300046474 Bacteria 779
384 Ga0495639_0002688 3300046475 Bacteria 7725
385 Ga0495639_0026561 3300046475 Bacteria 2559
386 Ga0495584_0004204 3300046491 Bacteria 7769
387 Ga0495584_0009064 3300046491 Bacteria 5140
388 Ga0495584_0061895 3300046491 Bacteria 1881
389 Ga0495584_0079759 3300046491 Bacteria 1647
390 Ga0495584_0092146 3300046491 Bacteria 1528
391 Ga0495584_0119702 3300046491 Bacteria 1333
392 Ga0495584_0383041 3300046491 Bacteria 715
393 Ga0495585_0011356 3300046492 Bacteria 5270
394 Ga0495585_0017278 3300046492 Bacteria 4170
395 Ga0495585_0081114 3300046492 Bacteria 1757
396 Ga0495585_0122382 3300046492 Bacteria 1375
397 Ga0495596_0006544 3300046500 Bacteria 5350
398 Ga0495596_0083574 3300046500 Bacteria 1239
399 Ga0495607_0002286 3300046501 Bacteria 15754
400 Ga0495607_0005389 3300046501 Bacteria 9175
401 Ga0495607_0005406 3300046501 Bacteria 9149
402 Ga0495607_0005433 3300046501 Bacteria 9127
403 Ga0495607_0013447 3300046501 Bacteria 5362
404 Ga0495607_0014534 3300046501 Bacteria 5120
405 Ga0495607_0014535 3300046501 Bacteria 5119
406 Ga0495607_0022540 3300046501 Bacteria 3952
407 Ga0495607_0028261 3300046501 Bacteria 3461
408 Ga0495607_0035661 3300046501 Bacteria 3007
409 Ga0495607_0045578 3300046501 Bacteria 2578
410 Ga0495607_0051559 3300046501 Bacteria 2389
411 Ga0495607_0096806 3300046501 Bacteria 1588
412 Ga0495607_0121885 3300046501 Bacteria 1367
413 Ga0495607_0185660 3300046501 Bacteria 1039
414 Ga0495607_0378176 3300046501 Bacteria 648
415 Ga0495583_0004401 3300046506 Bacteria 10106
416 Ga0495583_0005753 3300046506 Bacteria 8298
417 Ga0495583_0015958 3300046506 Bacteria 4059
418 Ga0495583_0016145 3300046506 Bacteria 4026
419 Ga0495583_0017659 3300046506 Bacteria 3781
420 Ga0495583_0037496 3300046506 Bacteria 2297
421 Ga0495583_0068785 3300046506 Bacteria 1560
422 Ga0495606_0001115 3300046507 Bacteria 38368
423 Ga0495606_0003532 3300046507 Bacteria 16531
424 Ga0495606_0017307 3300046507 Bacteria 5456
425 Ga0495606_0017986 3300046507 Bacteria 5318
426 Ga0495606_0022667 3300046507 Bacteria 4566
427 Ga0495606_0023324 3300046507 Bacteria 4487
428 Ga0495606_0025496 3300046507 Bacteria 4232
429 Ga0495606_0033353 3300046507 Bacteria 3551
430 Ga0495606_0034211 3300046507 Bacteria 3490
431 Ga0495606_0088915 3300046507 Bacteria 1903
432 Ga0495606_0163539 3300046507 Bacteria 1296
433 Ga0495610_0015699 3300046512 Bacteria 4390
434 Ga0495610_0019105 3300046512 Bacteria 3844
435 Ga0495610_0022319 3300046512 Bacteria 3464
436 Ga0495610_0033789 3300046512 Bacteria 2640
437 Ga0495610_0062866 3300046512 Bacteria 1760
438 Ga0495610_0272314 3300046512 Bacteria 662
439 Ga0495616_0009667 3300046513 Bacteria 5621
440 Ga0495616_0016921 3300046513 Bacteria 4026
441 Ga0495616_0018335 3300046513 Bacteria 3844
442 Ga0495616_0055611 3300046513 Bacteria 1958
443 Ga0495616_0148199 3300046513 Bacteria 1063
444 Ga0495616_0226203 3300046513 Bacteria 812
445 Ga0495616_0343692 3300046513 Bacteria 622
446 Ga0495620_0008155 3300046515 Bacteria 5636
447 Ga0495620_0008360 3300046515 Bacteria 5560
448 Ga0495620_0009999 3300046515 Bacteria 5018
449 Ga0495620_0010670 3300046515 Bacteria 4836
450 Ga0495620_0042422 3300046515 Bacteria 1987
451 Ga0495620_0081400 3300046515 Bacteria 1309
452 Ga0495630_0317747 3300046517 Bacteria 1190
453 Ga0495631_0006910 3300046518 Bacteria 5818
454 Ga0495631_0008741 3300046518 Bacteria 5090
455 Ga0495631_0009105 3300046518 Bacteria 4971
456 Ga0495631_0016294 3300046518 Bacteria 3546
457 Ga0495631_0121312 3300046518 Bacteria 1124
458 Ga0495632_0010120 3300046519 Bacteria 5614
459 Ga0495632_0011673 3300046519 Bacteria 5115
460 Ga0495632_0011827 3300046519 Bacteria 5077
461 Ga0495632_0014349 3300046519 Bacteria 4484
462 Ga0495632_0017298 3300046519 Bacteria 3984
463 Ga0495632_0034749 3300046519 Bacteria 2577
464 Ga0495632_0087816 3300046519 Bacteria 1477
465 Ga0495632_0230386 3300046519 Bacteria 835
466 Ga0495632_0326219 3300046519 Bacteria 677
467 Ga0495637_0002754 3300046520 Bacteria 9555
468 Ga0495637_0006137 3300046520 Bacteria 6047
469 Ga0495637_0007676 3300046520 Bacteria 5335
470 Ga0495637_0009878 3300046520 Bacteria 4642
471 Ga0495637_0011097 3300046520 Bacteria 4337
472 Ga0495637_0013267 3300046520 Bacteria 3915
473 Ga0495637_0014581 3300046520 Bacteria 3705
474 Ga0495637_0023155 3300046520 Bacteria 2826
475 Ga0495637_0029375 3300046520 Bacteria 2448
476 Ga0495637_0137673 3300046520 Bacteria 928
477 Ga0495637_0186339 3300046520 Bacteria 767
478 Ga0495643_0001220 3300046522 Bacteria 24866
479 Ga0495643_0014224 3300046522 Bacteria 4738
480 Ga0495643_0014720 3300046522 Bacteria 4647
481 Ga0495643_0016323 3300046522 Bacteria 4363
482 Ga0495643_0022424 3300046522 Bacteria 3603
483 Ga0495643_0072319 3300046522 Bacteria 1808
484 Ga0495643_0092244 3300046522 Bacteria 1561
485 Ga0495643_0134829 3300046522 Bacteria 1236
486 Ga0495644_0011264 3300046523 Bacteria 3445
487 Ga0495644_0024499 3300046523 Bacteria 2295
488 Ga0495648_0002757 3300046524 Bacteria 15864
489 Ga0495648_0020724 3300046524 Bacteria 4575
490 Ga0495648_0068471 3300046524 Bacteria 2070
491 Ga0495648_0141007 3300046524 Bacteria 1268
492 Ga0495648_0157311 3300046524 Bacteria 1178
493 Ga0495648_0285350 3300046524 Bacteria 780
494 Ga0495648_0330859 3300046524 Bacteria 702
495 Ga0495666_0008636 3300046526 Bacteria 5105
496 Ga0495666_0015667 3300046526 Bacteria 3775
497 Ga0495642_0004844 3300046528 Bacteria 5202
498 Ga0495642_0086277 3300046528 Bacteria 1325
499 Ga0495652_0152432 3300046529 Bacteria 1804
500 Ga0495654_0004450 3300046530 Bacteria 8312
501 Ga0495654_0007398 3300046530 Bacteria 6136
502 Ga0495654_0014809 3300046530 Bacteria 4146
503 Ga0495654_0015390 3300046530 Bacteria 4061
504 Ga0495654_0017707 3300046530 Bacteria 3739
505 Ga0495654_0019172 3300046530 Bacteria 3578
506 Ga0495654_0019440 3300046530 Bacteria 3552
507 Ga0495654_0020022 3300046530 Bacteria 3493
508 Ga0495654_0026604 3300046530 Bacteria 2972
509 Ga0495654_0029675 3300046530 Bacteria 2787
510 Ga0495654_0030003 3300046530 Bacteria 2769
511 Ga0495654_0278209 3300046530 Bacteria 689
512 Ga0495586_0040848 3300046535 Bacteria 2497
513 Ga0495587_0012284 3300046536 Bacteria 5399
514 Ga0495587_0022683 3300046536 Bacteria 3862
515 Ga0495609_0003213 3300046538 Bacteria 9486
516 Ga0495609_0007879 3300046538 Bacteria 5267
517 Ga0495609_0039186 3300046538 Bacteria 2134
518 Ga0495609_0046763 3300046538 Bacteria 1937
519 Ga0495597_0001457 3300046542 Bacteria 16939
520 Ga0495597_0027373 3300046542 Bacteria 2614
521 Ga0495597_0047214 3300046542 Bacteria 1906
522 Ga0495597_0175356 3300046542 Bacteria 868
523 Ga0495645_0117725 3300046543 Bacteria 1874
524 Ga0495645_0260279 3300046543 Bacteria 1149
525 Ga0495622_0006744 3300046557 Bacteria 5324
526 Ga0495622_0008637 3300046557 Bacteria 4720
527 Ga0495622_0010751 3300046557 Bacteria 4223
528 Ga0495622_0017003 3300046557 Bacteria 3386
529 Ga0495622_0032167 3300046557 Bacteria 2450
530 Ga0495622_0171494 3300046557 Bacteria 975
531 Ga0495633_0014722 3300046558 Bacteria 4078
532 Ga0495656_0357977 3300046615 Bacteria 757
533 Ga0495656_0555535 3300046615 Bacteria 612
534 Ga0495668_0011841 3300046616 Bacteria 5199
535 Ga0495668_0017874 3300046616 Bacteria 4108
536 Ga0495668_0022974 3300046616 Bacteria 3561
537 Ga0495668_0110354 3300046616 Bacteria 1504
538 Ga0495668_0157801 3300046616 Bacteria 1242
539 Ga0495611_0006133 3300046648 Bacteria 5129
540 Ga0495611_0008856 3300046648 Bacteria 4255
541 Ga0495625_0019890 3300046660 Bacteria 5195
542 Ga0495625_0020325 3300046660 Bacteria 5129
543 Ga0495625_0029611 3300046660 Bacteria 4091
544 Ga0495625_0038359 3300046660 Bacteria 3508
545 Ga0495625_0049169 3300046660 Bacteria 3032
546 Ga0495625_0140695 3300046660 Bacteria 1628
547 Ga0495635_0031268 3300046663 Bacteria 3697
548 Ga0495635_0859036 3300046663 Bacteria 582
549 Ga0495661_0004633 3300046665 Bacteria 9893
550 Ga0495661_0004922 3300046665 Bacteria 9555
551 Ga0495661_0014463 3300046665 Bacteria 5286
552 Ga0495661_0025942 3300046665 Bacteria 3778
553 Ga0495661_0028384 3300046665 Bacteria 3583
554 Ga0495661_0044397 3300046665 Bacteria 2725
555 Ga0495661_0073105 3300046665 Bacteria 1998
556 Ga0495661_0098895 3300046665 Bacteria 1646
557 Ga0495661_0130109 3300046665 Bacteria 1380
558 Ga0495588_0140095 3300046674 Bacteria 1277
559 Ga0495646_0026262 3300046680 Bacteria 3657
560 Ga0495646_0213370 3300046680 Bacteria 1046
561 Ga0495613_0050511 3300046689 Bacteria 3066
562 Ga0495613_0326339 3300046689 Bacteria 1058
563 Ga0495624_0016190 3300046690 Bacteria 5021
564 Ga0495670_0007721 3300046691 Bacteria 5290
565 Ga0495670_0012987 3300046691 Bacteria 4095
566 Ga0495670_0020033 3300046691 Bacteria 3296
567 Ga0495670_0072775 3300046691 Bacteria 1741
568 Ga0495671_0001579 3300046692 Bacteria 15080
569 Ga0495671_0003567 3300046692 Bacteria 9501
570 Ga0495671_0041774 3300046692 Bacteria 2307
571 Ga0495671_0126223 3300046692 Bacteria 1247
572 Ga0495649_0016490 3300046694 Bacteria 4186
573 Ga0495649_0030990 3300046694 Bacteria 2950
574 Ga0495649_0039352 3300046694 Bacteria 2592
575 Ga0495649_0072948 3300046694 Bacteria 1839
576 Ga0495649_0109044 3300046694 Bacteria 1468
577 Ga0495649_0221090 3300046694 Bacteria 979
578 Ga0495649_0274753 3300046694 Bacteria 861
579 Ga0495649_0363234 3300046694 Bacteria 730
580 Ga0495649_0419311 3300046694 Bacteria 670
581 Ga0495589_0009237 3300046794 Bacteria 5128
582 Ga0495589_0026180 3300046794 Bacteria 2956
583 Ga0495589_0037858 3300046794 Bacteria 2415
584 Ga0495589_0266287 3300046794 Bacteria 798
585 Ga0495600_0013552 3300046809 Bacteria 5126
586 Ga0495660_0002084 3300046810 Bacteria 12960
587 Ga0495660_0008386 3300046810 Bacteria 6044
588 Ga0495660_0024657 3300046810 Bacteria 3425
589 Ga0495660_0044680 3300046810 Bacteria 2435
590 Ga0495660_0053373 3300046810 Bacteria 2194
591 Ga0495660_0080051 3300046810 Bacteria 1715
592 Ga0495660_0114313 3300046810 Bacteria 1373
593 Ga0495660_0135049 3300046810 Bacteria 1233
594 Ga0495660_0163747 3300046810 Bacteria 1088
595 Ga0495660_0165733 3300046810 Bacteria 1080
596 Ga0495660_0309168 3300046810 Bacteria 713
597 Ga0495604_0078717 3300047317 Bacteria 2473
598 Ga0495604_0085261 3300047317 Bacteria 2357
599 Ga0495672_0003342 3300047320 Bacteria 13822
600 Ga0495672_0003889 3300047320 Bacteria 12544
601 Ga0495672_0010407 3300047320 Bacteria 6628
602 Ga0495672_0015615 3300047320 Bacteria 5148
603 Ga0495672_0019557 3300047320 Bacteria 4464
604 Ga0495672_0019954 3300047320 Bacteria 4405
605 Ga0495672_0021806 3300047320 Bacteria 4172
606 Ga0495672_0024590 3300047320 Bacteria 3875
607 Ga0495672_0026470 3300047320 Bacteria 3701
608 Ga0495672_0031274 3300047320 Bacteria 3324
609 Ga0495672_0130969 3300047320 Bacteria 1319
610 Ga0495672_0242354 3300047320 Bacteria 879
611 Ga0495672_0336639 3300047320 Bacteria 704
612 Ga0495676_0008239 3300047321 Bacteria 9560
613 Ga0495676_0149993 3300047321 Bacteria 1660
614 Ga0495680_0042103 3300047322 Bacteria 3626
615 Ga0495680_0954627 3300047322 Bacteria 550
616 Ga0495683_0013831 3300047323 Bacteria 4211
617 Ga0495683_0124094 3300047323 Bacteria 1223
618 Ga0495683_0163314 3300047323 Bacteria 1028
619 Ga0495683_0247523 3300047323 Bacteria 783
620 Ga0495683_0293436 3300047323 Bacteria 700
621 Ga0495687_019311 3300047443 Bacteria 3349
622 Ga0495687_071282 3300047443 Bacteria 1392
623 Ga0495675_0008994 3300047444 Bacteria 6208
624 Ga0495679_039489 3300047446 Bacteria 1471
625 Ga0495679_046562 3300047446 Bacteria 1319
626 Ga0495685_090349 3300047447 Bacteria 1015
627 Ga0495673_0003950 3300047469 Bacteria 9498
628 Ga0495673_0006113 3300047469 Bacteria 7147
629 Ga0495673_0010068 3300047469 Bacteria 5171
630 Ga0495673_0016540 3300047469 Bacteria 3769
631 Ga0495673_0021787 3300047469 Bacteria 3155
632 Ga0495673_0026641 3300047469 Bacteria 2761
633 Ga0495673_0026860 3300047469 Bacteria 2746
634 Ga0495673_0031901 3300047469 Bacteria 2463
635 Ga0495673_0066413 3300047469 Bacteria 1529
636 Ga0495673_0099782 3300047469 Bacteria 1175
637 Ga0495673_0117091 3300047469 Bacteria 1058
638 Ga0495681_0004648 3300047470 Bacteria 9308
639 Ga0495681_0007807 3300047470 Bacteria 6777
640 Ga0495681_0011362 3300047470 Bacteria 5306
641 Ga0495681_0012119 3300047470 Bacteria 5080
642 Ga0495681_0012250 3300047470 Bacteria 5051
643 Ga0495681_0012994 3300047470 Bacteria 4861
644 Ga0495681_0017176 3300047470 Bacteria 4029
645 Ga0495681_0036458 3300047470 Bacteria 2431
646 Ga0495681_0040716 3300047470 Bacteria 2260
647 Ga0495681_0053059 3300047470 Bacteria 1899
648 Ga0495681_0085029 3300047470 Bacteria 1405
649 Ga0495684_0294329 3300047471 Bacteria 1167
650 Ga0495686_0015872 3300047472 Bacteria 5123
651 Ga0495686_0029869 3300047472 Bacteria 3543
652 Ga0495686_0046517 3300047472 Bacteria 2742
653 Ga0495686_0050021 3300047472 Bacteria 2627
654 Ga0495686_0182624 3300047472 Bacteria 1214
655 Ga0495593_0014408 3300047673 Bacteria 4495
656 Ga0495593_0056045 3300047673 Bacteria 2072
657 Ga0495602_0091733 3300048088 Bacteria 2518
658 Ga0495626_0001991 3300048091 Bacteria 15074
659 Ga0495626_0009696 3300048091 Bacteria 5191
660 Ga0495626_0014242 3300048091 Bacteria 4106
661 Ga0495626_0014655 3300048091 Bacteria 4035
662 Ga0495626_0018199 3300048091 Bacteria 3532
663 Ga0495626_0033590 3300048091 Bacteria 2457
664 Ga0495626_0036585 3300048091 Bacteria 2337
665 Ga0495626_0088949 3300048091 Bacteria 1360
666 Ga0495626_0171452 3300048091 Bacteria 904
667 Ga0496102_0024615 3300048905 Bacteria 5352
668 Ga0496102_0188033 3300048905 Bacteria 1946
669 Ga0496110_0399333 3300048913 Bacteria 1253
670 Ga0496110_0646356 3300048913 Bacteria 957
671 Ga0496112_0508368 3300048915 Bacteria 1140
672 Ga0496115_0436570 3300048918 Bacteria 1059
673 Ga0496116_0009224 3300048919 Bacteria 8447
674 Ga0496116_0019431 3300048919 Bacteria 5202
675 Ga0496116_0029144 3300048919 Bacteria 3985
676 Ga0496117_0001936 3300048920 Bacteria 27633
677 Ga0496117_0012366 3300048920 Bacteria 7532
678 Ga0496117_0064804 3300048920 Bacteria 2488
679 Ga0496117_0159863 3300048920 Bacteria 1321
680 Ga0496117_0405504 3300048920 Bacteria 686
681 Ga0496118_0103372 3300048921 Bacteria 1916
682 Ga0496118_0156661 3300048921 Bacteria 1415
683 Ga0496118_0196887 3300048921 Bacteria 1198
684 Ga0496119_0389673 3300048922 Bacteria 666
685 Ga0496120_0174616 3300048923 Bacteria 1060
686 Ga0496121_0012137 3300048924 Bacteria 9457
687 Ga0496121_0014201 3300048924 Bacteria 8473
688 Ga0496121_0019552 3300048924 Bacteria 6763
689 Ga0496121_0030231 3300048924 Bacteria 4978
690 Ga0496121_0082684 3300048924 Bacteria 2537
691 Ga0496122_0004546 3300048925 Bacteria 17102
692 Ga0496122_0041678 3300048925 Bacteria 3625
693 Ga0496122_0051867 3300048925 Bacteria 3111
694 Ga0496122_0059033 3300048925 Bacteria 2835
695 Ga0496122_0125994 3300048925 Bacteria 1639
696 Ga0496122_0228335 3300048925 Bacteria 1061
697 Ga0496123_0001488 3300048926 Bacteria 32526
698 Ga0496123_0019101 3300048926 Bacteria 5411
699 Ga0496123_0041371 3300048926 Bacteria 3196
700 Ga0496124_0050108 3300048927 Bacteria 3559
701 Ga0496124_0103082 3300048927 Bacteria 2308
702 Ga0496124_0158414 3300048927 Bacteria 1768
703 Ga0496124_0205167 3300048927 Bacteria 1495
704 Ga0496125_0039982 3300048928 Bacteria 4030
705 Ga0495678_006775 3300049459 Bacteria 6032
706 Ga0495678_012071 3300049459 Bacteria 4106
707 Ga0495678_012391 3300049459 Bacteria 4045
708 Ga0495678_013877 3300049459 Bacteria 3768
709 Ga0495678_026038 3300049459 Bacteria 2503
710 Ga0495678_029425 3300049459 Bacteria 2306
711 Ga0495678_029701 3300049459 Bacteria 2293
712 Ga0495678_090711 3300049459 Bacteria 1077
713 Ga0495678_123974 3300049459 Bacteria 864
714 Ga0495682_0002142 3300049460 Bacteria 9581
715 Ga0495682_0056086 3300049460 Bacteria 1428
716 Ga0495682_0072818 3300049460 Bacteria 1236
717 Ga0501032_0017047 3300049569 Bacteria 5103
718 Ga0501034_0304164 3300049571 Bacteria 1531
719 Ga0501034_0803281 3300049571 Bacteria 833
720 Ga0501037_0239124 3300049573 Bacteria 1273
721 Ga0501038_0214015 3300049574 Bacteria 1540
722 Ga0501039_0265071 3300049575 Bacteria 1350
723 Ga0501039_0302200 3300049575 Bacteria 1258
724 Ga0501241_019596 3300049758 Bacteria 1242
725 Ga0501269_022103 3300049766 Bacteria 796
726 nmdc:mga00v17_206134_c1 3300050491 Bacteria 1272
727 nmdc:mga08x19_666959_c1 3300050514 Bacteria 738
728 nmdc:mga0sz30_142374_c1 3300050516 Bacteria 1059
729 Ga0500572_003167 3300053111 Bacteria 3808
730 Ga0500573_0017545 3300053140 Bacteria 4076
731 Ga0500577_0250819 3300053142 Bacteria 769
732 2510283934 2510065053 Bacteria 5005518
733 2510293393 2510065055 Bacteria 5037935
734 2510312885 2510065058 Bacteria 5005894
735 2511256926 2511231004 Bacteria 6669789
736 2511266935 2511231006 Bacteria 6794709
737 2511272926 2511231007 Bacteria 6306603
738 2511276126 2511231008 Bacteria 6624100
739 2511291216 2511231010 Bacteria 6373152
740 2511293775 2511231011 Bacteria 6149768
741 2511300536 2511231012 Bacteria 6738011
742 2511315510 2511231014 Bacteria 6462302
743 2511320342 2511231015 Bacteria 6598026
744 2511323571 2511231016 Bacteria 6704427
745 2511330728 2511231017 Bacteria 6503007
746 2511336806 2511231018 Bacteria 6436256
747 2511342584 2511231019 Bacteria 6520662
748 2511348106 2511231020 Bacteria 6115223
749 2511357049 2511231021 Bacteria 7302637
750 2511363204 2511231022 Bacteria 6719296
751 2511369748 2511231023 Bacteria 6808468
752 2511414941 2511231031 Bacteria 6558529
753 2511826789 2511231156 Bacteria 6845832
754 2555671992 2554235341 Bacteria 6867980
755 2599329645 2599185155 Bacteria 5827168
756 2599353843 2599185160 Bacteria 6844013
757 2599378951 2599185164 Bacteria 6841688
758 2599386071 2599185165 Bacteria 6843250
759 2599460677 2599185181 Bacteria 6844519
760 2599489698 2599185186 Bacteria 6831633
761 2599502858 2599185188 Bacteria 6164180
762 2599615114 2599185212 Bacteria 6765997
763 2599930115 2599185300 Bacteria 6062622
764 2599945359 2599185302 Bacteria 5954930
765 2599955631 2599185304 Bacteria 5951361
766 2599969343 2599185306 Bacteria 6637356
767 2599973361 2599185307 Bacteria 6194719
768 2599980684 2599185308 Bacteria 6621546
769 2599985744 2599185309 Bacteria 5969593
770 2599990638 2599185310 Bacteria 6014457
771 2599995956 2599185311 Bacteria 6354990
772 2600001976 2599185312 Bacteria 5912071
773 2600014500 2599185314 Bacteria 6621749
774 2600025528 2599185316 Bacteria 6320029
775 2600027856 2599185317 Bacteria 6435722
776 2600033426 2599185318 Bacteria 6961590
777 2600040289 2599185319 Bacteria 6637840
778 2600049343 2599185320 Bacteria 5963263
779 2600061609 2599185322 Bacteria 6763055
780 2600064227 2599185323 Bacteria 6688755
781 2600077323 2599185325 Bacteria 6324919
782 2600213291 2599185356 Bacteria 6843884
783 2600357023 2600254930 Bacteria 6431253
784 2600443501 2600254954 Bacteria 5100516
785 2601625906 2600255283 Bacteria 6061572
786 2601773458 2600255313 Bacteria 6842543
787 2601799706 2600255318 Bacteria 6383414
788 2602009045 2600255389 Bacteria 5275336
789 2606074109 2603880185 Bacteria 6379190
790 2606126246 2603880199 Bacteria 6377649
791 2624482654 2623620443 Bacteria 6427864
792 2624490281 2623620446 Bacteria 6500345
793 2643842004 2643221565 Bacteria 6216018
794 2643955414 2643221589 Bacteria 6250934
795 2644023766 2643221602 Bacteria 6249926
796 2644185891 2643221633 Bacteria 6733554
797 2644285801 2643221650 Bacteria 7029547
798 2652545175 2651869719 Bacteria 6047974
799 2671125642 2667528176 Bacteria 6724917
800 2678265159 2675903515 Bacteria 6580491
801 2715752018 2713897148 Bacteria 5883533
802 2715755352 2713897149 Bacteria 6506249
803 2718635866 2718217725 Bacteria 5758958
804 2739196495 2738543004 Bacteria 6381073
805 2739257470 2738543015 Bacteria 6750701
806 2739265346 2738543016 Bacteria 5657564
807 2739289270 2738543020 Bacteria 5718238
808 2739294582 2738543021 Bacteria 5718241
809 2739314480 2738543025 Bacteria 6600348
810 2739732539 2739367700 Bacteria 4747630
811 2745005615 2744054620 Bacteria 6551379
812 2774122092 2773857670 Bacteria 6407454
813 2774131875 2773857672 Bacteria 4993178
814 2774133535 2773857673 Bacteria 6513460
815 2784262578 2784132063 Bacteria 6262788
816 2784314337 2784132072 Bacteria 6596533
817 2794595538 2791355520 Bacteria 5948615
818 2808855824 2808606361 Bacteria 6136259
819 2808905171 2808606373 Bacteria 4423627
820 2808921968 2808606376 Bacteria 6248667
821 2808933355 2808606377 Bacteria 6646337
822 2808935905 2808606378 Bacteria 6177535
823 2808944089 2808606380 Bacteria 6248705
824 2808955463 2808606381 Bacteria 6646461
825 2808959683 2808606382 Bacteria 6841132
826 2808964303 2808606383 Bacteria 6138645
827 2808999191 2808606389 Bacteria 6138126
828 2809218560 2808606445 Bacteria 6057339
829 2812368551 2811994881 Bacteria 6298475
830 2819654243 2818991456 Bacteria 6123676
831 2819701515 2818991464 Bacteria 6907494
832 2823425111 2823421272 Bacteria 5372474
833 2825655945 2825651385 Bacteria 6715909
834 2826585537 2826581358 Bacteria 5963467
835 2842809197 2842805378 Bacteria 5385175
836 2842818203 2842815866 Bacteria 5947510
837 2842837509 2842832357 Bacteria 5959113
838 2842845293 2842843487 Bacteria 6004777
839 2842853095 2842849001 Bacteria 5924277
840 2842856349 2842854478 Bacteria 6143501
841 2844666158 2844665904 Bacteria 6817974
842 2852660601 2852657418 Bacteria 6472974
843 2878034584 2878029506 Bacteria 6418441
844 2880235231 2880230671 Bacteria 6140320
845 2904521604 2904518522 Bacteria 6068986
846 2913041768 2913036834 Bacteria 6704877
847 2917075865 2917070673 Bacteria 6868303
848 2919069575 2919063839 Bacteria 6302690
849 2919388652 2919385768 Bacteria 5897293
850 2919490027 2919487758 Bacteria 5929766
851 2919501828 2919501602 Bacteria 5286340
852 2919703755 2919697872 Bacteria 6553725
853 2923522609 2923519811 Bacteria 6298479
854 2923590413 2923586266 Bacteria 6565975
855 2926063501 2926063275 Bacteria 5285848
856 2929149086 2929144301 Bacteria 6622272
857 2931373491 2931369376 Bacteria 6847892
858 2935356851 2935353572 Unclassified 6955622
859 2939636965 2939636861 Bacteria 6297853
860 2974289261 2974289157 Bacteria 6080362
861 2974301304 2974298342 Bacteria 4840922
862 2984503781 2984499530 Bacteria 5020881
863 2984507637 2984504281 Bacteria 5262371
864 2988730689 2988728565 Bacteria 6124362
865 2998144641 2998139840 Bacteria 6073514
866 3007254077 3007252601 Bacteria 4559114
867 3007317185 3007315729 Bacteria 5076637
868 3007420557 3007419365 Bacteria 7026924
869 3007615669 3007614139 Bacteria 6053559
870 3007723949 3007718800 Bacteria 5971527
871 3007858376 3007855910 Bacteria 5637581
872 3007867571 3007866637 Bacteria 5899198
873 637322408 637000220 Bacteria 7074893
874 640487028 640427133 Bacteria 4567418
875 651174900 651053060 Bacteria 4689946
876 8016730224 8016728285 Bacteria 5263933
877 8019782070 8019775933 Bacteria 6858656
878 8029996238 8029995093 Bacteria 5990776
879 8034963085 8034962539 Bacteria 4884839
880 8056130883 8056125926 Bacteria 6228218
881 8056144303 8056143049 Bacteria 6307666
882 8056171915 8056166840 Bacteria 5820959
883 8056172596 8056172158 Bacteria 6133900
884 8056179773 8056177738 Bacteria 6748268
885 8056574415 8056569372 Bacteria 5997322
886 8057804897 8057798959 Bacteria 6713499
887 Ga0105244_10284323
888 MRS2a_Contig_6365
889 MRS2a_Contig_63
890 JGI25162J39368_1002343
891 JGI25162J39368_1002368
892 JGI25164J39214_1001140
893 JGI25164J39214_1001148
894 JGI25165J46597_1002064
895 JGI25165J46597_1002076
896 rootH1_10113058
897 Ga0055536_1002477
898 Ga0055536_1009168
899 Ga0055536_1009170
900 Ga0055530_10002925
901 Ga0055530_10003090
902 Ga0055530_10003689
903 Ga0055540_1002354
904 Ga0055540_1002654
905 Ga0055540_1002780
906 Ga0055531_10000348
907 Ga0055531_10090088
908 Ga0065714_10000200
909 Ga0065714_10010890
910 Ga0065714_10016682
911 Ga0065714_10019055
912 Ga0065714_10065997
913 Ga0065714_10074076
914 Ga0065714_10116478
915 Ga0065714_10148665
916 Ga0065704_10027423
917 Ga0065704_10030190
918 Ga0065704_10031494
919 Ga0065704_10072936
920 Ga0065704_10080368
921 Ga0065704_10321926
922 Ga0065712_10000146
923 Ga0065712_10000717
924 Ga0065715_10153109
925 Ga0070676_10582923
926 Ga0070714_100717935
927 Ga0070662_100651465
928 Ga0070665_100659418
929 Ga0070665_100672402
930 Ga0070702_101795896
931 Ga0070717_10948683
932 Ga0075363_100305575
933 Ga0075364_10084038
934 Ga0075364_10151254
935 Ga0075364_10549449
936 Ga0075432_10004050
937 Ga0075432_10084883
938 Ga0075432_10099805
939 Ga0075432_10516211
940 Ga0075362_10179175
941 Ga0075362_10190353
942 Ga0075369_10126777
943 Ga0075366_10680393
944 Ga0075370_10312948
945 Ga0075370_10516229
946 Ga0075436_100477209
947 Ga0075436_100984525
948 Ga0079104_1002687
949 Ga0079104_1003518
950 Ga0099826_10037988
951 Ga0105251_10000004
952 Ga0105251_10004443
953 Ga0105251_10007066
954 Ga0105251_10152037
955 Ga0105251_10376619
956 Ga0105244_10001043
957 Ga0105244_10005209
958 Ga0105244_10017949
959 Ga0105244_10018410
960 Ga0105244_10042431
961 Ga0105244_10049032
962 Ga0105244_10162520
963 Ga0105250_10002390
964 Ga0105250_10011759
965 Ga0105250_10072110
966 Ga0105250_10134459
967 Ga0105250_10190386
968 Ga0105250_10223713
969 Ga0105243_10002016
970 Ga0105243_10021965
971 Ga0105243_10035653
972 Ga0105243_10088108
973 Ga0105243_10100894
974 Ga0105243_10935939
975 Ga0105242_10108381
976 Ga0105242_11007755
977 Ga0105238_11068549
978 Ga0105249_10068245
979 Ga0105246_10003691
980 Ga0105246_10007602
981 Ga0105246_10051958
982 Ga0157336_1021986
983 Ga0157345_1000406
984 Ga0157347_1012782
985 Ga0157373_10006663
986 Ga0157373_10011669
987 Ga0157373_10035499
988 Ga0157373_10081575
989 Ga0157373_10612783
990 Ga0157371_10016794
991 Ga0157371_10022390
992 Ga0157371_10029549
993 Ga0157371_10048074
994 Ga0157371_10423721
995 Ga0157370_10100977
996 Ga0157370_10129888
997 Ga0157370_10308121
998 Ga0157370_10440361
999 Ga0157370_10470853
1000 Ga0157370_10538873
1001 Ga0157369_10004082
1002 Ga0157369_11743848
1003 Ga0163162_10031182
1004 Ga0157372_10041925
1005 Ga0157375_10099065
1006 Ga0157375_11539420
1007 Ga0157380_11096178
1008 Ga0182008_10005981
1009 Ga0182008_10019027
1010 Ga0182008_10021627
1011 Ga0182008_10039351
1012 Ga0182008_10112047
1013 Ga0182008_10184842
1014 Ga0182006_1013528
1015 Ga0182006_1018530
1016 Ga0182006_1022967
1017 Ga0182006_1031971
1018 Ga0182007_10010960
1019 Ga0182007_10243394
1020 Ga0182005_1011004
1021 Ga0182005_1025175
1022 Ga0163161_10033270
1023 Ga0163161_10098800
1024 Ga0163161_10198086
1025 Ga0163161_10618130
1026 Ga0209760_100534
1027 Ga0209674_116692
1028 Ga0209672_100625
1029 Ga0209563_102480
1030 Ga0207427_100007
1031 Ga0209437_100006
1032 Ga0209759_1015308
1033 Ga0209233_1000059
1034 Ga0209675_1004261
1035 Ga0209676_1000010
1036 Ga0209676_1017459
1037 Ga0209676_1019618
1038 Ga0209050_1000019
1039 Ga0209050_1000027
1040 Ga0209050_1004537
1041 Ga0209051_1000102
1042 Ga0209051_1000383
1043 Ga0209051_1008728
1044 Ga0209257_1000119
1045 Ga0209257_1011631
1046 Ga0207696_1000054
1047 Ga0207696_1000213
1048 Ga0207696_1003221
1049 Ga0207696_1008374
1050 Ga0207696_1049746
1051 Ga0207655_1000005
1052 Ga0207655_1000015
1053 Ga0207655_1001289
1054 Ga0207655_1004342
1055 Ga0207655_1009983
1056 Ga0207655_1012220
1057 Ga0207655_1015195
1058 Ga0207655_1015443
1059 Ga0207655_1016868
1060 Ga0207655_1048185
1061 Ga0207655_1053401
1062 Ga0207655_1108396
1063 Ga0207713_1000013
1064 Ga0207713_1005285
1065 Ga0207713_1005703
1066 Ga0207713_1007779
1067 Ga0207713_1009866
1068 Ga0207713_1014244
1069 Ga0207713_1018723
1070 Ga0207713_1022092
1071 Ga0207713_1120972
1072 Ga0207645_10662098
1073 Ga0207681_10038543
1074 Ga0207664_10817785
1075 Ga0207706_10052083
1076 Ga0207686_11047115
1077 Ga0207709_10000224
1078 Ga0207709_10001009
1079 Ga0207709_10003502
1080 Ga0207709_10099832
1081 Ga0207709_10427187
1082 Ga0207678_10080860
1083 Ga0209281_1000015
1084 Ga0209281_1002030
1085 Ga0209281_1002560
1086 Ga0209371_1000372
1087 Ga0209969_1005590
1088 Ga0209981_1009128
1089 Ga0209981_1018505
1090 Ga0209996_1001815
1091 Ga0209984_1000904
1092 Ga0210000_1043629
1093 Ga0209995_1000370
1094 Ga0209968_1009181
1095 Ga0209983_1001799
1096 Ga0209983_1014344
1097 Ga0209971_1000990
1098 Ga0209974_10008818
1099 Ga0209974_10042207
1100 Ga0207428_10019963
1101 Ga0207428_10095682
1102 Ga0207428_10097055
1103 Ga0207428_10175017
1104 Ga0207428_10371753
1105 Ga0268266_11170812
1106 Ga0307517_10304678
1107 Ga0307515_10523950
1108 Ga0268256_1000316
1109 Ga0307511_10041014
1110 Ga0316177_1067959
1111 Ga0314311_1053106
1112 Ga0316179_1118252
1113 Ga0316178_1061339
1114 Ga0316183_1164786
1115 Ga0307513_10677141
1116 Ga0307408_100000020
1117 Ga0307408_100026677
1118 Ga0307408_100052194
1119 Ga0307408_100084620
1120 Ga0307408_100155822
1121 Ga0307516_10758312
1122 Ga0307405_10016467
1123 Ga0307405_10045984
1124 Ga0307413_10004776
1125 Ga0307413_10327181
1126 Ga0307413_10332244
1127 Ga0307413_10412353
1128 Ga0307410_11095442
1129 Ga0307406_10068257
1130 Ga0307406_10081625
1131 Ga0307407_10164372
1132 Ga0307407_10252854
1133 Ga0307407_10535555
1134 Ga0307412_10026347
1135 Ga0307412_10042695
1136 Ga0307412_10043739
1137 Ga0307412_10323155
1138 Ga0307409_100153497
1139 Ga0307409_100347020
1140 Ga0307409_101039419
1141 Ga0307416_101199984
1142 Ga0307416_102661354
1143 Ga0307414_10022843
1144 Ga0307414_10347300
1145 Ga0307414_10407538
1146 Ga0307414_10428881
1147 Ga0307414_10574864
1148 Ga0307414_11071539
1149 Ga0307411_10092469
1150 Ga0307411_10113658
1151 Ga0307411_10143139
1152 Ga0307411_10199398
1153 Ga0307510_10049362
1154 Ga0237819_00850
1155 Ga0439436_0001947
1156 Ga0439438_004835
1157 Ga0439438_005991
1158 Ga0439438_012496
1159 Ga0439438_013016
1160 Ga0439438_033892
1161 Ga0439438_035560
1162 Ga0439447_005256
1163 Ga0439447_007191
1164 Ga0439447_007499
1165 Ga0439447_028240
1166 Ga0439466_0002455
1167 Ga0439466_0012706
1168 Ga0439466_0030461
1169 Ga0439466_0039442
1170 Ga0439466_0059830
1171 Ga0439466_0088008
1172 Ga0439465_0088938
1173 Ga0439432_006875
1174 Ga0439432_017053
1175 Ga0439451_015210
1176 Ga0439452_002068
1177 Ga0439452_003491
1178 Ga0439452_005492
1179 Ga0439452_006171
1180 Ga0439452_018818
1181 Ga0439452_055582
1182 Ga0439456_008547
1183 Ga0439456_009482
1184 Ga0439456_064912
1185 Ga0439463_000398
1186 Ga0439463_118357
1187 Ga0450911_002061
1188 Ga0450911_014547
1189 Ga0450911_021889
1190 Ga0450919_003656
1191 Ga0450919_015498
1192 Ga0450920_002273
1193 Ga0450922_003438
1194 Ga0450922_007710
1195 Ga0450923_009756
1196 Ga0450923_019088
1197 Ga0450903_006890
1198 Ga0450906_038611
1199 Ga0450907_001573
1200 Ga0450910_002470
1201 Ga0439446_0002625
1202 Ga0439446_0281111
1203 Ga0450908_004130
1204 Ga0439434_0004449
1205 Ga0439464_0002011
1206 Ga0439464_0005339
1207 Ga0439464_0007803
1208 Ga0450893_0004562
1209 Ga0450893_0025484
1210 Ga0450901_007621
1211 Ga0495617_005254
1212 Ga0495617_018827
1213 Ga0495617_019507
1214 Ga0495617_038146
1215 Ga0495617_051979
1216 Ga0495617_056646
1217 Ga0495627_002521
1218 Ga0495627_009785
1219 Ga0495627_071325
1220 Ga0495627_095624
1221 Ga0495627_221450
1222 Ga0495603_0025579
1223 Ga0495590_0005392
1224 Ga0495590_0053578
1225 Ga0495590_0058969
1226 Ga0495590_0074039
1227 Ga0495590_0082356
1228 Ga0495591_000015
1229 Ga0495591_002895
1230 Ga0495591_004113
1231 Ga0495591_006233
1232 Ga0495591_008874
1233 Ga0495591_010833
1234 Ga0495591_011046
1235 Ga0495591_012960
1236 Ga0495591_014684
1237 Ga0495629_0033508
1238 Ga0495638_0000164
1239 Ga0495638_0014846
1240 Ga0495638_0014868
1241 Ga0495638_0080108
1242 Ga0495638_0134088
1243 Ga0495638_0178702
1244 Ga0495638_0186743
1245 Ga0495638_0192229
1246 Ga0495653_0001870
1247 Ga0495653_0046479
1248 Ga0495653_0056069
1249 Ga0495653_0076865
1250 Ga0495650_0004551
1251 Ga0495650_0011165
1252 Ga0495650_0015874
1253 Ga0495650_0016615
1254 Ga0495650_0017682
1255 Ga0495650_0045832
1256 Ga0495650_0087562
1257 Ga0495650_0109288
1258 Ga0495582_0011363
1259 Ga0495605_0003192
1260 Ga0495605_0007738
1261 Ga0495605_0008705
1262 Ga0495605_0010449
1263 Ga0495605_0010639
1264 Ga0495605_0010684
1265 Ga0495605_0015768
1266 Ga0495605_0088872
1267 Ga0495605_0092256
1268 Ga0495605_0133777
1269 Ga0495605_0239423
1270 Ga0495639_0002688
1271 Ga0495639_0026561
1272 Ga0495584_0004204
1273 Ga0495584_0009064
1274 Ga0495584_0061895
1275 Ga0495584_0079759
1276 Ga0495584_0092146
1277 Ga0495584_0119702
1278 Ga0495584_0383041
1279 Ga0495585_0011356
1280 Ga0495585_0017278
1281 Ga0495585_0081114
1282 Ga0495585_0122382
1283 Ga0495596_0006544
1284 Ga0495596_0083574
1285 Ga0495607_0002286
1286 Ga0495607_0005389
1287 Ga0495607_0005406
1288 Ga0495607_0005433
1289 Ga0495607_0013447
1290 Ga0495607_0014534
1291 Ga0495607_0014535
1292 Ga0495607_0022540
1293 Ga0495607_0028261
1294 Ga0495607_0035661
1295 Ga0495607_0045578
1296 Ga0495607_0051559
1297 Ga0495607_0096806
1298 Ga0495607_0121885
1299 Ga0495607_0185660
1300 Ga0495607_0378176
1301 Ga0495583_0004401
1302 Ga0495583_0005753
1303 Ga0495583_0015958
1304 Ga0495583_0016145
1305 Ga0495583_0017659
1306 Ga0495583_0037496
1307 Ga0495583_0068785
1308 Ga0495606_0001115
1309 Ga0495606_0003532
1310 Ga0495606_0017307
1311 Ga0495606_0017986
1312 Ga0495606_0022667
1313 Ga0495606_0023324
1314 Ga0495606_0025496
1315 Ga0495606_0033353
1316 Ga0495606_0034211
1317 Ga0495606_0088915
1318 Ga0495606_0163539
1319 Ga0495610_0015699
1320 Ga0495610_0019105
1321 Ga0495610_0022319
1322 Ga0495610_0033789
1323 Ga0495610_0062866
1324 Ga0495610_0272314
1325 Ga0495616_0009667
1326 Ga0495616_0016921
1327 Ga0495616_0018335
1328 Ga0495616_0055611
1329 Ga0495616_0148199
1330 Ga0495616_0226203
1331 Ga0495616_0343692
1332 Ga0495620_0008155
1333 Ga0495620_0008360
1334 Ga0495620_0009999
1335 Ga0495620_0010670
1336 Ga0495620_0042422
1337 Ga0495620_0081400
1338 Ga0495630_0317747
1339 Ga0495631_0006910
1340 Ga0495631_0008741
1341 Ga0495631_0009105
1342 Ga0495631_0016294
1343 Ga0495631_0121312
1344 Ga0495632_0010120
1345 Ga0495632_0011673
1346 Ga0495632_0011827
1347 Ga0495632_0014349
1348 Ga0495632_0017298
1349 Ga0495632_0034749
1350 Ga0495632_0087816
1351 Ga0495632_0230386
1352 Ga0495632_0326219
1353 Ga0495637_0002754
1354 Ga0495637_0006137
1355 Ga0495637_0007676
1356 Ga0495637_0009878
1357 Ga0495637_0011097
1358 Ga0495637_0013267
1359 Ga0495637_0014581
1360 Ga0495637_0023155
1361 Ga0495637_0029375
1362 Ga0495637_0137673
1363 Ga0495637_0186339
1364 Ga0495643_0001220
1365 Ga0495643_0014224
1366 Ga0495643_0014720
1367 Ga0495643_0016323
1368 Ga0495643_0022424
1369 Ga0495643_0072319
1370 Ga0495643_0092244
1371 Ga0495643_0134829
1372 Ga0495644_0011264
1373 Ga0495644_0024499
1374 Ga0495648_0002757
1375 Ga0495648_0020724
1376 Ga0495648_0068471
1377 Ga0495648_0141007
1378 Ga0495648_0157311
1379 Ga0495648_0285350
1380 Ga0495648_0330859
1381 Ga0495666_0008636
1382 Ga0495666_0015667
1383 Ga0495642_0004844
1384 Ga0495642_0086277
1385 Ga0495652_0152432
1386 Ga0495654_0004450
1387 Ga0495654_0007398
1388 Ga0495654_0014809
1389 Ga0495654_0015390
1390 Ga0495654_0017707
1391 Ga0495654_0019172
1392 Ga0495654_0019440
1393 Ga0495654_0020022
1394 Ga0495654_0026604
1395 Ga0495654_0029675
1396 Ga0495654_0030003
1397 Ga0495654_0278209
1398 Ga0495586_0040848
1399 Ga0495587_0012284
1400 Ga0495587_0022683
1401 Ga0495609_0003213
1402 Ga0495609_0007879
1403 Ga0495609_0039186
1404 Ga0495609_0046763
1405 Ga0495597_0001457
1406 Ga0495597_0027373
1407 Ga0495597_0047214
1408 Ga0495597_0175356
1409 Ga0495645_0117725
1410 Ga0495645_0260279
1411 Ga0495622_0006744
1412 Ga0495622_0008637
1413 Ga0495622_0010751
1414 Ga0495622_0017003
1415 Ga0495622_0032167
1416 Ga0495622_0171494
1417 Ga0495633_0014722
1418 Ga0495656_0357977
1419 Ga0495656_0555535
1420 Ga0495668_0011841
1421 Ga0495668_0017874
1422 Ga0495668_0022974
1423 Ga0495668_0110354
1424 Ga0495668_0157801
1425 Ga0495611_0006133
1426 Ga0495611_0008856
1427 Ga0495625_0019890
1428 Ga0495625_0020325
1429 Ga0495625_0029611
1430 Ga0495625_0038359
1431 Ga0495625_0049169
1432 Ga0495625_0140695
1433 Ga0495635_0031268
1434 Ga0495635_0859036
1435 Ga0495661_0004633
1436 Ga0495661_0004922
1437 Ga0495661_0014463
1438 Ga0495661_0025942
1439 Ga0495661_0028384
1440 Ga0495661_0044397
1441 Ga0495661_0073105
1442 Ga0495661_0098895
1443 Ga0495661_0130109
1444 Ga0495588_0140095
1445 Ga0495646_0026262
1446 Ga0495646_0213370
1447 Ga0495613_0050511
1448 Ga0495613_0326339
1449 Ga0495624_0016190
1450 Ga0495670_0007721
1451 Ga0495670_0012987
1452 Ga0495670_0020033
1453 Ga0495670_0072775
1454 Ga0495671_0001579
1455 Ga0495671_0003567
1456 Ga0495671_0041774
1457 Ga0495671_0126223
1458 Ga0495649_0016490
1459 Ga0495649_0030990
1460 Ga0495649_0039352
1461 Ga0495649_0072948
1462 Ga0495649_0109044
1463 Ga0495649_0221090
1464 Ga0495649_0274753
1465 Ga0495649_0363234
1466 Ga0495649_0419311
1467 Ga0495589_0009237
1468 Ga0495589_0026180
1469 Ga0495589_0037858
1470 Ga0495589_0266287
1471 Ga0495600_0013552
1472 Ga0495660_0002084
1473 Ga0495660_0008386
1474 Ga0495660_0024657
1475 Ga0495660_0044680
1476 Ga0495660_0053373
1477 Ga0495660_0080051
1478 Ga0495660_0114313
1479 Ga0495660_0135049
1480 Ga0495660_0163747
1481 Ga0495660_0165733
1482 Ga0495660_0309168
1483 Ga0495604_0078717
1484 Ga0495604_0085261
1485 Ga0495672_0003342
1486 Ga0495672_0003889
1487 Ga0495672_0010407
1488 Ga0495672_0015615
1489 Ga0495672_0019557
1490 Ga0495672_0019954
1491 Ga0495672_0021806
1492 Ga0495672_0024590
1493 Ga0495672_0026470
1494 Ga0495672_0031274
1495 Ga0495672_0130969
1496 Ga0495672_0242354
1497 Ga0495672_0336639
1498 Ga0495676_0008239
1499 Ga0495676_0149993
1500 Ga0495680_0042103
1501 Ga0495680_0954627
1502 Ga0495683_0013831
1503 Ga0495683_0124094
1504 Ga0495683_0163314
1505 Ga0495683_0247523
1506 Ga0495683_0293436
1507 Ga0495687_019311
1508 Ga0495687_071282
1509 Ga0495675_0008994
1510 Ga0495679_039489
1511 Ga0495679_046562
1512 Ga0495685_090349
1513 Ga0495673_0003950
1514 Ga0495673_0006113
1515 Ga0495673_0010068
1516 Ga0495673_0016540
1517 Ga0495673_0021787
1518 Ga0495673_0026641
1519 Ga0495673_0026860
1520 Ga0495673_0031901
1521 Ga0495673_0066413
1522 Ga0495673_0099782
1523 Ga0495673_0117091
1524 Ga0495681_0004648
1525 Ga0495681_0007807
1526 Ga0495681_0011362
1527 Ga0495681_0012119
1528 Ga0495681_0012250
1529 Ga0495681_0012994
1530 Ga0495681_0017176
1531 Ga0495681_0036458
1532 Ga0495681_0040716
1533 Ga0495681_0053059
1534 Ga0495681_0085029
1535 Ga0495684_0294329
1536 Ga0495686_0015872
1537 Ga0495686_0029869
1538 Ga0495686_0046517
1539 Ga0495686_0050021
1540 Ga0495686_0182624
1541 Ga0495593_0014408
1542 Ga0495593_0056045
1543 Ga0495602_0091733
1544 Ga0495626_0001991
1545 Ga0495626_0009696
1546 Ga0495626_0014242
1547 Ga0495626_0014655
1548 Ga0495626_0018199
1549 Ga0495626_0033590
1550 Ga0495626_0036585
1551 Ga0495626_0088949
1552 Ga0495626_0171452
1553 Ga0496102_0024615
1554 Ga0496102_0188033
1555 Ga0496110_0399333
1556 Ga0496110_0646356
1557 Ga0496112_0508368
1558 Ga0496115_0436570
1559 Ga0496116_0009224
1560 Ga0496116_0019431
1561 Ga0496116_0029144
1562 Ga0496117_0001936
1563 Ga0496117_0012366
1564 Ga0496117_0064804
1565 Ga0496117_0159863
1566 Ga0496117_0405504
1567 Ga0496118_0103372
1568 Ga0496118_0156661
1569 Ga0496118_0196887
1570 Ga0496119_0389673
1571 Ga0496120_0174616
1572 Ga0496121_0012137
1573 Ga0496121_0014201
1574 Ga0496121_0019552
1575 Ga0496121_0030231
1576 Ga0496121_0082684
1577 Ga0496122_0004546
1578 Ga0496122_0041678
1579 Ga0496122_0051867
1580 Ga0496122_0059033
1581 Ga0496122_0125994
1582 Ga0496122_0228335
1583 Ga0496123_0001488
1584 Ga0496123_0019101
1585 Ga0496123_0041371
1586 Ga0496124_0050108
1587 Ga0496124_0103082
1588 Ga0496124_0158414
1589 Ga0496124_0205167
1590 Ga0496125_0039982
1591 Ga0495678_006775
1592 Ga0495678_012071
1593 Ga0495678_012391
1594 Ga0495678_013877
1595 Ga0495678_026038
1596 Ga0495678_029425
1597 Ga0495678_029701
1598 Ga0495678_090711
1599 Ga0495678_123974
1600 Ga0495682_0002142
1601 Ga0495682_0056086
1602 Ga0495682_0072818
1603 Ga0501032_0017047
1604 Ga0501034_0304164
1605 Ga0501034_0803281
1606 Ga0501037_0239124
1607 Ga0501038_0214015
1608 Ga0501039_0265071
1609 Ga0501039_0302200
1610 Ga0501241_019596
1611 Ga0501269_022103
1612 nmdc:mga00v17_206134_c1
1613 nmdc:mga08x19_666959_c1
1614 nmdc:mga0sz30_142374_c1
1615 Ga0500572_003167
1616 Ga0500573_0017545
1617 Ga0500577_0250819
1618 2510283934
1619 2510293393
1620 2510312885
1621 2511256926
1622 2511266935
1623 2511272926
1624 2511276126
1625 2511291216
1626 2511293775
1627 2511300536
1628 2511315510
1629 2511320342
1630 2511323571
1631 2511330728
1632 2511336806
1633 2511342584
1634 2511348106
1635 2511357049
1636 2511363204
1637 2511369748
1638 2511414941
1639 2511826789
1640 2555671992
1641 2599329645
1642 2599353843
1643 2599378951
1644 2599386071
1645 2599460677
1646 2599489698
1647 2599502858
1648 2599615114
1649 2599930115
1650 2599945359
1651 2599955631
1652 2599969343
1653 2599973361
1654 2599980684
1655 2599985744
1656 2599990638
1657 2599995956
1658 2600001976
1659 2600014500
1660 2600025528
1661 2600027856
1662 2600033426
1663 2600040289
1664 2600049343
1665 2600061609
1666 2600064227
1667 2600077323
1668 2600213291
1669 2600357023
1670 2600443501
1671 2601625906
1672 2601773458
1673 2601799706
1674 2602009045
1675 2606074109
1676 2606126246
1677 2624482654
1678 2624490281
1679 2643842004
1680 2643955414
1681 2644023766
1682 2644185891
1683 2644285801
1684 2652545175
1685 2671125642
1686 2678265159
1687 2715752018
1688 2715755352
1689 2718635866
1690 2739196495
1691 2739257470
1692 2739265346
1693 2739289270
1694 2739294582
1695 2739314480
1696 2739732539
1697 2745005615
1698 2774122092
1699 2774131875
1700 2774133535
1701 2784262578
1702 2784314337
1703 2794595538
1704 2808855824
1705 2808905171
1706 2808921968
1707 2808933355
1708 2808935905
1709 2808944089
1710 2808955463
1711 2808959683
1712 2808964303
1713 2808999191
1714 2809218560
1715 2812368551
1716 2819654243
1717 2819701515
1718 2823425111
1719 2825655945
1720 2826585537
1721 2842809197
1722 2842818203
1723 2842837509
1724 2842845293
1725 2842853095
1726 2842856349
1727 2844666158
1728 2852660601
1729 2878034584
1730 2880235231
1731 2904521604
1732 2913041768
1733 2917075865
1734 2919069575
1735 2919388652
1736 2919490027
1737 2919501828
1738 2919703755
1739 2923522609
1740 2923590413
1741 2926063501
1742 2929149086
1743 2931373491
1744 2935356851
1745 2939636965
1746 2974289261
1747 2974301304
1748 2984503781
1749 2984507637
1750 2988730689
1751 2998144641
1752 3007254077
1753 3007317185
1754 3007420557
1755 3007615669
1756 3007723949
1757 3007858376
1758 3007867571
1759 637322408
1760 640487028
1761 651174900
1762 8016730224
1763 8019782070
1764 8029996238
1765 8034963085
1766 8056130883
1767 8056144303
1768 8056171915
1769 8056172596
1770 8056179773
1771 8056574415
1772 8057804897

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02021

UPF0102

Uncharacterised protein family UPF0102

31

122

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.9297 13 120
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8946 13 120
2wcw-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7589 10 115
2wcz-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7523 15 115
1ipi-assembly1.cif.gz_A crystal structure of the archaeal holliday junction resolvase hjc from pyrococcus furiosus form ii 0.739 10 115
ID Description Score Start End Superfamily
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9306 14 119 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9292 13 120 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8938 13 120 3.40.1350.10
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8896 14 119 3.40.1350.10
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8527 13 115 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A423L244-F1-model_v4 UPF0102 protein BK671_24020 0.9902 1 120 GO:0003676
AF-A0A031G419-F1-model_v4 UPF0102 protein BW33_02461 0.9875 1 120 GO:0003676
GO:0004519
AF-A0A7W4H1T6-F1-model_v4 UPF0102 protein H3H45_01140 0.9826 8 120 GO:0003676
AF-A0A259M8E2-F1-model_v4 YraN family protein 0.9808 27 120 GO:0003676
AF-A0A520SGH3-F1-model_v4 UPF0102 protein EVA63_01285 0.9796 5 119 GO:0003676

Map