F484694
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 886 | 430 | 1772 | 423 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10030302|Ga0157371_100303024 |
| Length | 498 |
| Sequence | MHDIRAIRENPQVYVAGWSSRGVDEADGLVADILRLDGELRHAQTTGQDALAKRNAASKLIGAAMGRKDMAEADRLKAEVEALXGXIAAAAEIEARVGKELRDLLAGLKNLAAEDVPDGEDEAGNVEVSTWGEPRRAGPAKDHADLGEALGMLDFEAAAKMSGARFAVLKGQLARLERAVGQFMLDMQTDQHGYMEVNPPLLVRDDAMFGTGQLPKFKDDLFASFAMAPLSLESLVHSGLYAEDDPDWEAVRKEIENFFSNNAVDDGTYADYDHYLNHFRSVVLKSMRAQDVRSRWWMIPTAEVSLTNLVRQQILSEDELATPMRMTALTPCFRAEAGSAGRDTRGLIRQHQFSKVEMVSITRPEDSDAEHERMTACAEAVLKALELPFRRMLLCKGDMGFSAQKTFDLEVWLPSQGTYREISSCSNCGDFQARRMEARFKRAGEKKTEFVHTLNGSGLAVGRTLVAIMENYQQEDGRIAVPAVLQPYMGGLQFVGGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 210 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 211 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 215 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 216 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 226 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 227 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 228 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 238 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 248 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 249 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 250 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 251 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 252 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 255 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 256 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 257 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 258 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 259 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 260 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 261 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 262 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 263 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 264 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 265 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 272 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 315 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 316 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 317 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 318 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 319 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 320 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 347 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 348 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 366 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 368 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 369 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 371 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 373 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 374 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 375 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 376 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 377 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 378 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 379 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 380 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 381 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 382 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 383 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 385 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 387 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 390 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 391 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 392 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 393 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 394 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 395 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 397 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 400 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 402 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 403 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 404 | 2523533628 | Maridesulfovibrio zosterae DSM 11974 | Isolate | Rhizosphere |
| 405 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 406 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 407 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 408 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 409 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 410 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 411 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 412 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 413 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 414 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 415 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 416 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 417 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 418 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 419 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 420 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 421 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 422 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 423 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 424 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 425 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 426 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 427 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 428 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 429 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 430 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.61 |
| Metatranscriptomes | 0 |
| Isolates | 3.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.72 |
| Nodule | 0.34 |
| Rhizoplane | 1.47 |
| Rhizosphere | 80.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157371_10030302 | 3300013102 | Bacteria | 3903 |
| 2 | SwRhRL2b_contig_1045895 | 2162886007 | Bacteria | 2280 |
| 3 | ARcpr5oldR_c001570 | 3300000041 | Bacteria | 2260 |
| 4 | JGI24034J14986_100228 | 3300001432 | Bacteria | 3043 |
| 5 | JGI24736J21556_1000120 | 3300001904 | Bacteria | 13372 |
| 6 | JGI24740J21852_10010503 | 3300001979 | Bacteria | 3559 |
| 7 | JGI24735J21928_10010617 | 3300002067 | Bacteria | 2932 |
| 8 | JGI24748J21848_1000010 | 3300002074 | Bacteria | 166979 |
| 9 | JGI24748J21848_1000029 | 3300002074 | Bacteria | 90134 |
| 10 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 11 | JGI24034J26672_10000006 | 3300002239 | Bacteria | 294495 |
| 12 | JGI24742J22300_10001915 | 3300002244 | Bacteria | 3311 |
| 13 | JGI25165J46597_1000053 | 3300003214 | Bacteria | 235857 |
| 14 | JGI25153J46596_10000138 | 3300003215 | Bacteria | 75653 |
| 15 | rootL2_10042889 | 3300003322 | Bacteria | 2689 |
| 16 | Ga0055537_1002278 | 3300003773 | Bacteria | 6593 |
| 17 | Ga0055537_1006509 | 3300003773 | Bacteria | 2950 |
| 18 | Ga0055524_1000169 | 3300003775 | Bacteria | 74567 |
| 19 | Ga0055536_1010658 | 3300003781 | Bacteria | 3616 |
| 20 | Ga0055536_1010718 | 3300003781 | Bacteria | 3599 |
| 21 | Ga0055528_1014590 | 3300003790 | Bacteria | 2897 |
| 22 | Ga0055530_10000423 | 3300003791 | Bacteria | 37624 |
| 23 | Ga0055530_10009835 | 3300003791 | Bacteria | 3612 |
| 24 | Ga0055530_10014691 | 3300003791 | Bacteria | 2593 |
| 25 | Ga0055531_10000589 | 3300003794 | Bacteria | 31724 |
| 26 | Ga0055531_10004369 | 3300003794 | Bacteria | 8645 |
| 27 | Ga0055531_10017852 | 3300003794 | Bacteria | 2966 |
| 28 | Ga0065704_10003860 | 3300005289 | Bacteria | 7478 |
| 29 | Ga0065704_10083135 | 3300005289 | Bacteria | 3504 |
| 30 | Ga0065712_10009500 | 3300005290 | Bacteria | 3214 |
| 31 | Ga0065715_10002131 | 3300005293 | Bacteria | 7154 |
| 32 | Ga0065715_10009882 | 3300005293 | Bacteria | 4098 |
| 33 | Ga0065715_10013095 | 3300005293 | Bacteria | 1915 |
| 34 | Ga0065707_10003307 | 3300005295 | Bacteria | 5295 |
| 35 | Ga0065707_10009757 | 3300005295 | Bacteria | 4154 |
| 36 | Ga0065707_10088542 | 3300005295 | Bacteria | 4622 |
| 37 | Ga0065707_10152081 | 3300005295 | Bacteria | 1647 |
| 38 | Ga0070658_10077335 | 3300005327 | Bacteria | 2729 |
| 39 | Ga0070676_10000056 | 3300005328 | Bacteria | 36724 |
| 40 | Ga0070676_10000801 | 3300005328 | Bacteria | 15534 |
| 41 | Ga0070676_10017192 | 3300005328 | Bacteria | 4001 |
| 42 | Ga0070683_100129573 | 3300005329 | Bacteria | 2387 |
| 43 | Ga0070690_100039665 | 3300005330 | Bacteria | 2976 |
| 44 | Ga0070670_100000001 | 3300005331 | Bacteria | 728788 |
| 45 | Ga0070670_100027274 | 3300005331 | Bacteria | 4913 |
| 46 | Ga0070670_100247982 | 3300005331 | Bacteria | 1551 |
| 47 | Ga0068869_100012546 | 3300005334 | Bacteria | 5604 |
| 48 | Ga0068869_100065272 | 3300005334 | Bacteria | 2679 |
| 49 | Ga0068869_100066087 | 3300005334 | Bacteria | 2664 |
| 50 | Ga0070666_10009203 | 3300005335 | Bacteria | 6158 |
| 51 | Ga0070666_10031921 | 3300005335 | Bacteria | 3478 |
| 52 | Ga0070666_10047659 | 3300005335 | Bacteria | 2877 |
| 53 | Ga0070680_100051738 | 3300005336 | Bacteria | 3352 |
| 54 | Ga0070687_100040250 | 3300005343 | Bacteria | 2354 |
| 55 | Ga0070668_100013918 | 3300005347 | Bacteria | 6016 |
| 56 | Ga0070668_100038290 | 3300005347 | Bacteria | 3664 |
| 57 | Ga0070669_100013074 | 3300005353 | Bacteria | 5896 |
| 58 | Ga0070669_100020394 | 3300005353 | Bacteria | 4734 |
| 59 | Ga0070669_100071214 | 3300005353 | Bacteria | 2572 |
| 60 | Ga0070675_100005347 | 3300005354 | Bacteria | 9818 |
| 61 | Ga0070671_100000008 | 3300005355 | Bacteria | 207831 |
| 62 | Ga0070671_100003230 | 3300005355 | Bacteria | 12709 |
| 63 | Ga0070671_100084259 | 3300005355 | Bacteria | 2658 |
| 64 | Ga0070674_100001556 | 3300005356 | Bacteria | 12291 |
| 65 | Ga0070674_100001596 | 3300005356 | Bacteria | 12156 |
| 66 | Ga0070674_100057727 | 3300005356 | Bacteria | 2695 |
| 67 | Ga0070673_100017315 | 3300005364 | Bacteria | 5120 |
| 68 | Ga0070673_100122996 | 3300005364 | Bacteria | 2168 |
| 69 | Ga0070688_100000972 | 3300005365 | Bacteria | 14354 |
| 70 | Ga0070659_100079147 | 3300005366 | Bacteria | 2623 |
| 71 | Ga0070659_100151922 | 3300005366 | Bacteria | 1889 |
| 72 | Ga0070667_100000023 | 3300005367 | Bacteria | 199687 |
| 73 | Ga0070667_100031234 | 3300005367 | Bacteria | 4441 |
| 74 | Ga0070667_100037573 | 3300005367 | Bacteria | 4059 |
| 75 | Ga0070667_100125038 | 3300005367 | Bacteria | 2240 |
| 76 | Ga0070703_10000544 | 3300005406 | Bacteria | 13973 |
| 77 | Ga0070714_100011352 | 3300005435 | Bacteria | 7065 |
| 78 | Ga0070713_100180411 | 3300005436 | Bacteria | 1897 |
| 79 | Ga0070705_100000469 | 3300005440 | Bacteria | 23189 |
| 80 | Ga0070700_100001016 | 3300005441 | Bacteria | 13876 |
| 81 | Ga0070694_100009240 | 3300005444 | Bacteria | 6048 |
| 82 | Ga0070694_100167847 | 3300005444 | Bacteria | 1615 |
| 83 | Ga0070663_100002136 | 3300005455 | Bacteria | 11066 |
| 84 | Ga0070678_100038089 | 3300005456 | Bacteria | 3382 |
| 85 | Ga0070678_100086075 | 3300005456 | Bacteria | 2396 |
| 86 | Ga0070678_100291229 | 3300005456 | Bacteria | 1384 |
| 87 | Ga0070662_100002362 | 3300005457 | Bacteria | 11602 |
| 88 | Ga0070662_100004008 | 3300005457 | Bacteria | 9232 |
| 89 | Ga0070662_100088844 | 3300005457 | Bacteria | 2317 |
| 90 | Ga0070662_100127965 | 3300005457 | Bacteria | 1954 |
| 91 | Ga0070681_10056714 | 3300005458 | Bacteria | 3898 |
| 92 | Ga0070681_10135085 | 3300005458 | Bacteria | 2397 |
| 93 | Ga0070685_10000008 | 3300005466 | Bacteria | 166350 |
| 94 | Ga0070706_100052417 | 3300005467 | Bacteria | 3765 |
| 95 | Ga0070706_100266999 | 3300005467 | Bacteria | 1597 |
| 96 | Ga0070698_100004114 | 3300005471 | Bacteria | 15989 |
| 97 | Ga0070698_100292900 | 3300005471 | Bacteria | 1559 |
| 98 | Ga0070699_100001512 | 3300005518 | Bacteria | 21269 |
| 99 | Ga0070699_100244128 | 3300005518 | Bacteria | 1604 |
| 100 | Ga0070679_100006337 | 3300005530 | Bacteria | 11018 |
| 101 | Ga0070679_100014606 | 3300005530 | Bacteria | 7545 |
| 102 | Ga0070679_100076250 | 3300005530 | Bacteria | 3343 |
| 103 | Ga0070679_100169270 | 3300005530 | Bacteria | 2158 |
| 104 | Ga0070684_100056278 | 3300005535 | Bacteria | 3432 |
| 105 | Ga0070697_100007219 | 3300005536 | Bacteria | 8642 |
| 106 | Ga0070672_100005200 | 3300005543 | Bacteria | 8609 |
| 107 | Ga0070672_100024040 | 3300005543 | Bacteria | 4495 |
| 108 | Ga0070672_100147992 | 3300005543 | Bacteria | 1941 |
| 109 | Ga0070686_100063669 | 3300005544 | Bacteria | 2389 |
| 110 | Ga0070695_100003955 | 3300005545 | Bacteria | 8651 |
| 111 | Ga0070695_100104380 | 3300005545 | Bacteria | 1913 |
| 112 | Ga0070696_100000758 | 3300005546 | Bacteria | 20714 |
| 113 | Ga0070696_100051322 | 3300005546 | Bacteria | 2868 |
| 114 | Ga0070693_100006856 | 3300005547 | Bacteria | 5536 |
| 115 | Ga0070693_100007155 | 3300005547 | Bacteria | 5443 |
| 116 | Ga0070693_100053609 | 3300005547 | Bacteria | 2316 |
| 117 | Ga0070665_100004189 | 3300005548 | Bacteria | 15172 |
| 118 | Ga0070665_100012413 | 3300005548 | Bacteria | 8587 |
| 119 | Ga0070665_100059944 | 3300005548 | Bacteria | 3815 |
| 120 | Ga0070704_100037698 | 3300005549 | Bacteria | 3305 |
| 121 | Ga0070704_100056420 | 3300005549 | Bacteria | 2789 |
| 122 | Ga0068855_100001436 | 3300005563 | Bacteria | 29649 |
| 123 | Ga0068855_100049432 | 3300005563 | Bacteria | 4959 |
| 124 | Ga0068855_100072552 | 3300005563 | Bacteria | 4001 |
| 125 | Ga0068855_100104045 | 3300005563 | Bacteria | 3266 |
| 126 | Ga0068857_100125695 | 3300005577 | Bacteria | 2310 |
| 127 | Ga0068857_100126791 | 3300005577 | Bacteria | 2300 |
| 128 | Ga0068856_100015873 | 3300005614 | Bacteria | 7281 |
| 129 | Ga0070702_100096167 | 3300005615 | Bacteria | 1807 |
| 130 | Ga0068859_100000177 | 3300005617 | Bacteria | 62179 |
| 131 | Ga0068859_100004727 | 3300005617 | Bacteria | 13833 |
| 132 | Ga0068859_100159049 | 3300005617 | Bacteria | 2338 |
| 133 | Ga0068859_100170192 | 3300005617 | Bacteria | 2259 |
| 134 | Ga0068864_100000006 | 3300005618 | Bacteria | 393838 |
| 135 | Ga0068864_100001081 | 3300005618 | Bacteria | 22832 |
| 136 | Ga0068864_100199607 | 3300005618 | Bacteria | 1837 |
| 137 | Ga0068866_10001731 | 3300005718 | Bacteria | 9162 |
| 138 | Ga0068861_100003245 | 3300005719 | Bacteria | 10767 |
| 139 | Ga0068861_100014323 | 3300005719 | Bacteria | 5562 |
| 140 | Ga0068861_100060136 | 3300005719 | Bacteria | 2911 |
| 141 | Ga0068861_100104002 | 3300005719 | Bacteria | 2265 |
| 142 | Ga0068851_10010933 | 3300005834 | Bacteria | 4245 |
| 143 | Ga0068870_10010685 | 3300005840 | Bacteria | 4226 |
| 144 | Ga0068870_10042545 | 3300005840 | Bacteria | 2366 |
| 145 | Ga0068870_10073120 | 3300005840 | Bacteria | 1875 |
| 146 | Ga0068863_100001323 | 3300005841 | Bacteria | 24691 |
| 147 | Ga0068863_100016359 | 3300005841 | Bacteria | 7116 |
| 148 | Ga0068863_100024017 | 3300005841 | Bacteria | 5818 |
| 149 | Ga0068863_100026142 | 3300005841 | Bacteria | 5570 |
| 150 | Ga0068858_100000005 | 3300005842 | Bacteria | 305830 |
| 151 | Ga0068858_100000098 | 3300005842 | Bacteria | 90747 |
| 152 | Ga0068858_100061852 | 3300005842 | Bacteria | 3462 |
| 153 | Ga0068860_100001556 | 3300005843 | Bacteria | 24714 |
| 154 | Ga0068860_100002721 | 3300005843 | Bacteria | 18394 |
| 155 | Ga0068860_100040551 | 3300005843 | Bacteria | 4449 |
| 156 | Ga0068860_100167494 | 3300005843 | Bacteria | 2121 |
| 157 | Ga0068862_100001815 | 3300005844 | Bacteria | 19329 |
| 158 | Ga0068862_100005737 | 3300005844 | Bacteria | 10362 |
| 159 | Ga0068862_100015047 | 3300005844 | Bacteria | 6425 |
| 160 | Ga0068862_100034160 | 3300005844 | Bacteria | 4302 |
| 161 | Ga0068862_100089800 | 3300005844 | Bacteria | 2674 |
| 162 | Ga0081455_10001641 | 3300005937 | Bacteria | 27241 |
| 163 | Ga0081538_10005495 | 3300005981 | Bacteria | 11382 |
| 164 | Ga0081538_10025694 | 3300005981 | Bacteria | 4143 |
| 165 | Ga0081540_1028352 | 3300005983 | Bacteria | 3146 |
| 166 | Ga0075365_10026434 | 3300006038 | Bacteria | 3685 |
| 167 | Ga0070715_10000002 | 3300006163 | Bacteria | 389554 |
| 168 | Ga0075362_10051556 | 3300006177 | Bacteria | 1842 |
| 169 | Ga0075369_10011160 | 3300006186 | Bacteria | 3527 |
| 170 | Ga0097621_100000004 | 3300006237 | Bacteria | 144414 |
| 171 | Ga0068871_100000159 | 3300006358 | Bacteria | 44727 |
| 172 | Ga0068871_100122455 | 3300006358 | Bacteria | 2198 |
| 173 | Ga0075428_100005210 | 3300006844 | Bacteria | 14452 |
| 174 | Ga0075428_100007089 | 3300006844 | Bacteria | 12417 |
| 175 | Ga0075428_100011232 | 3300006844 | Bacteria | 9966 |
| 176 | Ga0075428_100020288 | 3300006844 | Bacteria | 7361 |
| 177 | Ga0075428_100024773 | 3300006844 | Bacteria | 6638 |
| 178 | Ga0075428_100059278 | 3300006844 | Bacteria | 4192 |
| 179 | Ga0075428_100303110 | 3300006844 | Bacteria | 1717 |
| 180 | Ga0075430_100002163 | 3300006846 | Bacteria | 16263 |
| 181 | Ga0075430_100006567 | 3300006846 | Bacteria | 9810 |
| 182 | Ga0075430_100089544 | 3300006846 | Bacteria | 2574 |
| 183 | Ga0075430_100093362 | 3300006846 | Bacteria | 2516 |
| 184 | Ga0075431_100000033 | 3300006847 | Bacteria | 72175 |
| 185 | Ga0075431_100008475 | 3300006847 | Bacteria | 10295 |
| 186 | Ga0075431_100094967 | 3300006847 | Bacteria | 3078 |
| 187 | Ga0075434_100027108 | 3300006871 | Bacteria | 5623 |
| 188 | Ga0075434_100053378 | 3300006871 | Bacteria | 4017 |
| 189 | Ga0075434_100057762 | 3300006871 | Bacteria | 3856 |
| 190 | Ga0075434_100097939 | 3300006871 | Bacteria | 2937 |
| 191 | Ga0075429_100002783 | 3300006880 | Bacteria | 14783 |
| 192 | Ga0075429_100118588 | 3300006880 | Bacteria | 2313 |
| 193 | Ga0075429_100277327 | 3300006880 | Bacteria | 1468 |
| 194 | Ga0068865_100013432 | 3300006881 | Bacteria | 5173 |
| 195 | Ga0068865_100025917 | 3300006881 | Bacteria | 3862 |
| 196 | Ga0068865_100051796 | 3300006881 | Bacteria | 2843 |
| 197 | Ga0068865_100155385 | 3300006881 | Bacteria | 1739 |
| 198 | Ga0075436_100000020 | 3300006914 | Bacteria | 124822 |
| 199 | Ga0075436_100038240 | 3300006914 | Bacteria | 3312 |
| 200 | Ga0075436_100151500 | 3300006914 | Bacteria | 1632 |
| 201 | Ga0097620_100000177 | 3300006931 | Bacteria | 62179 |
| 202 | Ga0097620_100004727 | 3300006931 | Bacteria | 13833 |
| 203 | Ga0097620_100159036 | 3300006931 | Bacteria | 2338 |
| 204 | Ga0097620_100170204 | 3300006931 | Bacteria | 2259 |
| 205 | Ga0097620_100397225 | 3300006931 | Bacteria | 1475 |
| 206 | Ga0075435_100000717 | 3300007076 | Bacteria | 20581 |
| 207 | Ga0075435_100002396 | 3300007076 | Bacteria | 12432 |
| 208 | Ga0075435_100045786 | 3300007076 | Bacteria | 3508 |
| 209 | Ga0075435_100081116 | 3300007076 | Bacteria | 2664 |
| 210 | Ga0105240_10018744 | 3300009093 | Bacteria | 9272 |
| 211 | Ga0111539_10000042 | 3300009094 | Bacteria | 129513 |
| 212 | Ga0111539_10000926 | 3300009094 | Bacteria | 38374 |
| 213 | Ga0111539_10003260 | 3300009094 | Bacteria | 21453 |
| 214 | Ga0111539_10016091 | 3300009094 | Bacteria | 9282 |
| 215 | Ga0111539_10023154 | 3300009094 | Bacteria | 7628 |
| 216 | Ga0111539_10024213 | 3300009094 | Bacteria | 7454 |
| 217 | Ga0111539_10045327 | 3300009094 | Bacteria | 5265 |
| 218 | Ga0111539_10168096 | 3300009094 | Bacteria | 2563 |
| 219 | Ga0111539_10203259 | 3300009094 | Bacteria | 2310 |
| 220 | Ga0111539_10283688 | 3300009094 | Bacteria | 1927 |
| 221 | Ga0111539_10329831 | 3300009094 | Bacteria | 1776 |
| 222 | Ga0105245_10000079 | 3300009098 | Bacteria | 100009 |
| 223 | Ga0105245_10063119 | 3300009098 | Bacteria | 3344 |
| 224 | Ga0105247_10000002 | 3300009101 | Bacteria | 724587 |
| 225 | Ga0114129_10001565 | 3300009147 | Bacteria | 31048 |
| 226 | Ga0114129_10016967 | 3300009147 | Bacteria | 10366 |
| 227 | Ga0114129_10023279 | 3300009147 | Bacteria | 8785 |
| 228 | Ga0114129_10090821 | 3300009147 | Bacteria | 4233 |
| 229 | Ga0114129_10273744 | 3300009147 | Bacteria | 2258 |
| 230 | Ga0114129_10340341 | 3300009147 | Bacteria | 1990 |
| 231 | Ga0105243_10009752 | 3300009148 | Bacteria | 7309 |
| 232 | Ga0105243_10042291 | 3300009148 | Bacteria | 3567 |
| 233 | Ga0105243_10216589 | 3300009148 | Bacteria | 1690 |
| 234 | Ga0105241_10014087 | 3300009174 | Bacteria | 5860 |
| 235 | Ga0105242_10074724 | 3300009176 | Bacteria | 2820 |
| 236 | Ga0105248_10003238 | 3300009177 | Bacteria | 18062 |
| 237 | Ga0105248_10020707 | 3300009177 | Bacteria | 7289 |
| 238 | Ga0105238_10047750 | 3300009551 | Bacteria | 4316 |
| 239 | Ga0105249_10007251 | 3300009553 | Bacteria | 9671 |
| 240 | Ga0105249_10283548 | 3300009553 | Bacteria | 1655 |
| 241 | Ga0105239_10003937 | 3300010375 | Bacteria | 17989 |
| 242 | Ga0105239_10014595 | 3300010375 | Bacteria | 8714 |
| 243 | Ga0105239_10232135 | 3300010375 | Bacteria | 2070 |
| 244 | Ga0157373_10023760 | 3300013100 | Bacteria | 4441 |
| 245 | Ga0157373_10028230 | 3300013100 | Bacteria | 4048 |
| 246 | Ga0157370_10017787 | 3300013104 | Bacteria | 7164 |
| 247 | Ga0157369_10009868 | 3300013105 | Bacteria | 10909 |
| 248 | Ga0157369_10249999 | 3300013105 | Bacteria | 1850 |
| 249 | Ga0157374_10000713 | 3300013296 | Bacteria | 29128 |
| 250 | Ga0157374_10054598 | 3300013296 | Bacteria | 3727 |
| 251 | Ga0157378_10073458 | 3300013297 | Bacteria | 3075 |
| 252 | Ga0157378_10084084 | 3300013297 | Bacteria | 2881 |
| 253 | Ga0163162_10032135 | 3300013306 | Bacteria | 5211 |
| 254 | Ga0163162_10102175 | 3300013306 | Bacteria | 2960 |
| 255 | Ga0157375_10014981 | 3300013308 | Bacteria | 6934 |
| 256 | Ga0163163_10017137 | 3300014325 | Bacteria | 6748 |
| 257 | Ga0157380_10009037 | 3300014326 | Bacteria | 7120 |
| 258 | Ga0157380_10011499 | 3300014326 | Bacteria | 6395 |
| 259 | Ga0157380_10129032 | 3300014326 | Bacteria | 2154 |
| 260 | Ga0157379_10193810 | 3300014968 | Bacteria | 1836 |
| 261 | Ga0157376_10003895 | 3300014969 | Bacteria | 10321 |
| 262 | Ga0213872_10000267 | 3300021361 | Bacteria | 45184 |
| 263 | Ga0213872_10003797 | 3300021361 | Bacteria | 8236 |
| 264 | Ga0213872_10004985 | 3300021361 | Bacteria | 6903 |
| 265 | Ga0213872_10012874 | 3300021361 | Bacteria | 3924 |
| 266 | Ga0213872_10024910 | 3300021361 | Bacteria | 2751 |
| 267 | Ga0213872_10031026 | 3300021361 | Bacteria | 2449 |
| 268 | Ga0213872_10038966 | 3300021361 | Bacteria | 2169 |
| 269 | Ga0213876_10000125 | 3300021384 | Bacteria | 83238 |
| 270 | Ga0213876_10025628 | 3300021384 | Bacteria | 3110 |
| 271 | Ga0209129_1015754 | 3300025258 | Bacteria | 1542 |
| 272 | Ga0209565_1000012 | 3300025263 | Bacteria | 606500 |
| 273 | Ga0209565_1000268 | 3300025263 | Bacteria | 53879 |
| 274 | Ga0209673_1000600 | 3300025273 | Bacteria | 55820 |
| 275 | Ga0209673_1001822 | 3300025273 | Bacteria | 17442 |
| 276 | Ga0209676_1000099 | 3300025292 | Bacteria | 230048 |
| 277 | Ga0209676_1000180 | 3300025292 | Bacteria | 148369 |
| 278 | Ga0209025_1000384 | 3300025294 | Bacteria | 91722 |
| 279 | Ga0209564_1018524 | 3300025295 | Bacteria | 2648 |
| 280 | Ga0209758_1000028 | 3300025297 | Bacteria | 530102 |
| 281 | Ga0209758_1003490 | 3300025297 | Bacteria | 14226 |
| 282 | Ga0209758_1019213 | 3300025297 | Bacteria | 3308 |
| 283 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 284 | Ga0209050_1000319 | 3300025298 | Bacteria | 96837 |
| 285 | Ga0209050_1003235 | 3300025298 | Bacteria | 12275 |
| 286 | Ga0209050_1008434 | 3300025298 | Bacteria | 5511 |
| 287 | Ga0209050_1010978 | 3300025298 | Bacteria | 4373 |
| 288 | Ga0209256_1000012 | 3300025299 | Bacteria | 790371 |
| 289 | Ga0209256_1001870 | 3300025299 | Bacteria | 19435 |
| 290 | Ga0209051_1002009 | 3300025303 | Bacteria | 15523 |
| 291 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 292 | Ga0209257_1000114 | 3300025304 | Bacteria | 233013 |
| 293 | Ga0209257_1000614 | 3300025304 | Bacteria | 58019 |
| 294 | Ga0209257_1000934 | 3300025304 | Bacteria | 40351 |
| 295 | Ga0209257_1002674 | 3300025304 | Bacteria | 17096 |
| 296 | Ga0207697_10011907 | 3300025315 | Bacteria | 3664 |
| 297 | Ga0207653_10002711 | 3300025885 | Bacteria | 5631 |
| 298 | Ga0207682_10012374 | 3300025893 | Bacteria | 3331 |
| 299 | Ga0207642_10002096 | 3300025899 | Bacteria | 6166 |
| 300 | Ga0207642_10065016 | 3300025899 | Bacteria | 1712 |
| 301 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 302 | Ga0207710_10002477 | 3300025900 | Bacteria | 8549 |
| 303 | Ga0207688_10037005 | 3300025901 | Bacteria | 2706 |
| 304 | Ga0207647_10000069 | 3300025904 | Bacteria | 80952 |
| 305 | Ga0207685_10000002 | 3300025905 | Bacteria | 438088 |
| 306 | Ga0207645_10007912 | 3300025907 | Bacteria | 7469 |
| 307 | Ga0207645_10014174 | 3300025907 | Bacteria | 5339 |
| 308 | Ga0207645_10016971 | 3300025907 | Bacteria | 4810 |
| 309 | Ga0207643_10027214 | 3300025908 | Bacteria | 3169 |
| 310 | Ga0207643_10048666 | 3300025908 | Bacteria | 2402 |
| 311 | Ga0207705_10085236 | 3300025909 | Bacteria | 2308 |
| 312 | Ga0207654_10006681 | 3300025911 | Bacteria | 5805 |
| 313 | Ga0207707_10010516 | 3300025912 | Bacteria | 8031 |
| 314 | Ga0207707_10088468 | 3300025912 | Bacteria | 2706 |
| 315 | Ga0207695_10006284 | 3300025913 | Bacteria | 15460 |
| 316 | Ga0207695_10012923 | 3300025913 | Bacteria | 9992 |
| 317 | Ga0207671_10002421 | 3300025914 | Bacteria | 19972 |
| 318 | Ga0207663_10043357 | 3300025916 | Bacteria | 2754 |
| 319 | Ga0207663_10166369 | 3300025916 | Bacteria | 1562 |
| 320 | Ga0207662_10067368 | 3300025918 | Bacteria | 2159 |
| 321 | Ga0207657_10005842 | 3300025919 | Bacteria | 12823 |
| 322 | Ga0207649_10098484 | 3300025920 | Bacteria | 1930 |
| 323 | Ga0207652_10121877 | 3300025921 | Bacteria | 2320 |
| 324 | Ga0207652_10168580 | 3300025921 | Bacteria | 1964 |
| 325 | Ga0207681_10007853 | 3300025923 | Bacteria | 6530 |
| 326 | Ga0207681_10030359 | 3300025923 | Bacteria | 3523 |
| 327 | Ga0207681_10056288 | 3300025923 | Bacteria | 2682 |
| 328 | Ga0207694_10003033 | 3300025924 | Bacteria | 13465 |
| 329 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 330 | Ga0207650_10007766 | 3300025925 | Bacteria | 7311 |
| 331 | Ga0207650_10019990 | 3300025925 | Bacteria | 4715 |
| 332 | Ga0207650_10143944 | 3300025925 | Bacteria | 1876 |
| 333 | Ga0207687_10000603 | 3300025927 | Bacteria | 24269 |
| 334 | Ga0207700_10199101 | 3300025928 | Bacteria | 1687 |
| 335 | Ga0207664_10008296 | 3300025929 | Bacteria | 7237 |
| 336 | Ga0207644_10000019 | 3300025931 | Bacteria | 170919 |
| 337 | Ga0207644_10000210 | 3300025931 | Bacteria | 40409 |
| 338 | Ga0207644_10002172 | 3300025931 | Bacteria | 12720 |
| 339 | Ga0207690_10021855 | 3300025932 | Bacteria | 3973 |
| 340 | Ga0207706_10001828 | 3300025933 | Bacteria | 20899 |
| 341 | Ga0207706_10003256 | 3300025933 | Bacteria | 15558 |
| 342 | Ga0207706_10065816 | 3300025933 | Bacteria | 3190 |
| 343 | Ga0207709_10003138 | 3300025935 | Bacteria | 9940 |
| 344 | Ga0207670_10007351 | 3300025936 | Bacteria | 6140 |
| 345 | Ga0207669_10001357 | 3300025937 | Bacteria | 10422 |
| 346 | Ga0207669_10061491 | 3300025937 | Bacteria | 2308 |
| 347 | Ga0207704_10015697 | 3300025938 | Bacteria | 3868 |
| 348 | Ga0207691_10006490 | 3300025940 | Bacteria | 11293 |
| 349 | Ga0207691_10017589 | 3300025940 | Bacteria | 6776 |
| 350 | Ga0207691_10050470 | 3300025940 | Bacteria | 3808 |
| 351 | Ga0207711_10000156 | 3300025941 | Bacteria | 73391 |
| 352 | Ga0207711_10003188 | 3300025941 | Bacteria | 14300 |
| 353 | Ga0207711_10010997 | 3300025941 | Bacteria | 7519 |
| 354 | Ga0207711_10020671 | 3300025941 | Bacteria | 5492 |
| 355 | Ga0207711_10039375 | 3300025941 | Bacteria | 4021 |
| 356 | Ga0207711_10054444 | 3300025941 | Bacteria | 3433 |
| 357 | Ga0207689_10014108 | 3300025942 | Bacteria | 6801 |
| 358 | Ga0207689_10076726 | 3300025942 | Bacteria | 2747 |
| 359 | Ga0207689_10289186 | 3300025942 | Bacteria | 1357 |
| 360 | Ga0207667_10000735 | 3300025949 | Bacteria | 42634 |
| 361 | Ga0207667_10116859 | 3300025949 | Bacteria | 2749 |
| 362 | Ga0207651_10125557 | 3300025960 | Bacteria | 1954 |
| 363 | Ga0207712_10000922 | 3300025961 | Bacteria | 21290 |
| 364 | Ga0207712_10022518 | 3300025961 | Bacteria | 4150 |
| 365 | Ga0207712_10221557 | 3300025961 | Bacteria | 1513 |
| 366 | Ga0207668_10090960 | 3300025972 | Bacteria | 2241 |
| 367 | Ga0207640_10031574 | 3300025981 | Bacteria | 3274 |
| 368 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 369 | Ga0207658_10113305 | 3300025986 | Bacteria | 2148 |
| 370 | Ga0207703_10000086 | 3300026035 | Bacteria | 107307 |
| 371 | Ga0207703_10000158 | 3300026035 | Bacteria | 78397 |
| 372 | Ga0207703_10033515 | 3300026035 | Bacteria | 4072 |
| 373 | Ga0207639_10108039 | 3300026041 | Bacteria | 2261 |
| 374 | Ga0207678_10030183 | 3300026067 | Bacteria | 4733 |
| 375 | Ga0207678_10255594 | 3300026067 | Bacteria | 1501 |
| 376 | Ga0207708_10003376 | 3300026075 | Bacteria | 11772 |
| 377 | Ga0207702_10007759 | 3300026078 | Bacteria | 9110 |
| 378 | Ga0207702_10087049 | 3300026078 | Bacteria | 2726 |
| 379 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 380 | Ga0207641_10005717 | 3300026088 | Bacteria | 10568 |
| 381 | Ga0207641_10020165 | 3300026088 | Bacteria | 5473 |
| 382 | Ga0207641_10037909 | 3300026088 | Bacteria | 4027 |
| 383 | Ga0207641_10187110 | 3300026088 | Bacteria | 1900 |
| 384 | Ga0207648_10001100 | 3300026089 | Bacteria | 30324 |
| 385 | Ga0207648_10073931 | 3300026089 | Bacteria | 2970 |
| 386 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 387 | Ga0207676_10002359 | 3300026095 | Bacteria | 13494 |
| 388 | Ga0207676_10161356 | 3300026095 | Bacteria | 1942 |
| 389 | Ga0207674_10010079 | 3300026116 | Bacteria | 10746 |
| 390 | Ga0207674_10122225 | 3300026116 | Bacteria | 2570 |
| 391 | Ga0207674_10143827 | 3300026116 | Bacteria | 2344 |
| 392 | Ga0207675_100004034 | 3300026118 | Bacteria | 14233 |
| 393 | Ga0207675_100043976 | 3300026118 | Bacteria | 4171 |
| 394 | Ga0207675_100074454 | 3300026118 | Bacteria | 3177 |
| 395 | Ga0207675_100097050 | 3300026118 | Bacteria | 2775 |
| 396 | Ga0207675_100181472 | 3300026118 | Bacteria | 2016 |
| 397 | Ga0207683_10000698 | 3300026121 | Bacteria | 30636 |
| 398 | Ga0207683_10000825 | 3300026121 | Bacteria | 28372 |
| 399 | Ga0207698_10075126 | 3300026142 | Bacteria | 2699 |
| 400 | Ga0209983_1006458 | 3300027665 | Bacteria | 2408 |
| 401 | Ga0209588_1033453 | 3300027671 | Bacteria | 1648 |
| 402 | Ga0209971_1000386 | 3300027682 | Bacteria | 12051 |
| 403 | Ga0207428_10001035 | 3300027907 | Bacteria | 30658 |
| 404 | Ga0207428_10003754 | 3300027907 | Bacteria | 14582 |
| 405 | Ga0207428_10063991 | 3300027907 | Bacteria | 2904 |
| 406 | Ga0207428_10064691 | 3300027907 | Bacteria | 2887 |
| 407 | Ga0268266_10003314 | 3300028379 | Bacteria | 16169 |
| 408 | Ga0268266_10026752 | 3300028379 | Bacteria | 4908 |
| 409 | Ga0268266_10179954 | 3300028379 | Bacteria | 1924 |
| 410 | Ga0268265_10000288 | 3300028380 | Bacteria | 56817 |
| 411 | Ga0268265_10000750 | 3300028380 | Bacteria | 31594 |
| 412 | Ga0268265_10088736 | 3300028380 | Bacteria | 2464 |
| 413 | Ga0268264_10000419 | 3300028381 | Bacteria | 59940 |
| 414 | Ga0268264_10001691 | 3300028381 | Bacteria | 20334 |
| 415 | Ga0268264_10193978 | 3300028381 | Bacteria | 1853 |
| 416 | Ga0265334_10000017 | 3300028573 | Bacteria | 147461 |
| 417 | Ga0265318_10000018 | 3300028577 | Bacteria | 173038 |
| 418 | Ga0307517_10018255 | 3300028786 | Bacteria | 9086 |
| 419 | Ga0307515_10061623 | 3300028794 | Bacteria | 5316 |
| 420 | Ga0307515_10164957 | 3300028794 | Bacteria | 2238 |
| 421 | Ga0265338_10061169 | 3300028800 | Bacteria | 3302 |
| 422 | Ga0265338_10102528 | 3300028800 | Bacteria | 2327 |
| 423 | Ga0307511_10011792 | 3300030521 | Bacteria | 8603 |
| 424 | Ga0265332_10002592 | 3300031238 | Bacteria | 9146 |
| 425 | Ga0265339_10004112 | 3300031249 | Bacteria | 10030 |
| 426 | Ga0265331_10000337 | 3300031250 | Bacteria | 50233 |
| 427 | Ga0265327_10000008 | 3300031251 | Bacteria | 658870 |
| 428 | Ga0265327_10000696 | 3300031251 | Bacteria | 53491 |
| 429 | Ga0265327_10001626 | 3300031251 | Bacteria | 27106 |
| 430 | Ga0265316_10001097 | 3300031344 | Bacteria | 29331 |
| 431 | Ga0307513_10005329 | 3300031456 | Bacteria | 17015 |
| 432 | Ga0307513_10107698 | 3300031456 | Bacteria | 2790 |
| 433 | Ga0307509_10061048 | 3300031507 | Bacteria | 3982 |
| 434 | Ga0265313_10000022 | 3300031595 | Bacteria | 144838 |
| 435 | Ga0307508_10000537 | 3300031616 | Bacteria | 45080 |
| 436 | Ga0307508_10054128 | 3300031616 | Bacteria | 3559 |
| 437 | Ga0307508_10115385 | 3300031616 | Bacteria | 2287 |
| 438 | Ga0316575_10028428 | 3300031665 | Bacteria | 2181 |
| 439 | Ga0316575_10046820 | 3300031665 | Bacteria | 1718 |
| 440 | Ga0316579_10066768 | 3300031691 | Bacteria | 1699 |
| 441 | Ga0265314_10035513 | 3300031711 | Bacteria | 3632 |
| 442 | Ga0265314_10049811 | 3300031711 | Bacteria | 2930 |
| 443 | Ga0265342_10000150 | 3300031712 | Bacteria | 78890 |
| 444 | Ga0265342_10009942 | 3300031712 | Bacteria | 6651 |
| 445 | Ga0316576_10000840 | 3300031727 | Bacteria | 15545 |
| 446 | Ga0316576_10003350 | 3300031727 | Bacteria | 9372 |
| 447 | Ga0316576_10008620 | 3300031727 | Bacteria | 6520 |
| 448 | Ga0316576_10018774 | 3300031727 | Bacteria | 4729 |
| 449 | Ga0316576_10019577 | 3300031727 | Bacteria | 4639 |
| 450 | Ga0316576_10033505 | 3300031727 | Bacteria | 3657 |
| 451 | Ga0316576_10033527 | 3300031727 | Bacteria | 3656 |
| 452 | Ga0316576_10034042 | 3300031727 | Bacteria | 3630 |
| 453 | Ga0316576_10093617 | 3300031727 | Bacteria | 2240 |
| 454 | Ga0316578_10000632 | 3300031728 | Bacteria | 12443 |
| 455 | Ga0316578_10006285 | 3300031728 | Bacteria | 5848 |
| 456 | Ga0316578_10019684 | 3300031728 | Bacteria | 3720 |
| 457 | Ga0316578_10030651 | 3300031728 | Bacteria | 3058 |
| 458 | Ga0316578_10049391 | 3300031728 | Bacteria | 2458 |
| 459 | Ga0316578_10083196 | 3300031728 | Bacteria | 1906 |
| 460 | Ga0316577_10006744 | 3300031733 | Bacteria | 6091 |
| 461 | Ga0316577_10033917 | 3300031733 | Bacteria | 2852 |
| 462 | Ga0316577_10042326 | 3300031733 | Bacteria | 2548 |
| 463 | Ga0316577_10050538 | 3300031733 | Bacteria | 2321 |
| 464 | Ga0316577_10081354 | 3300031733 | Bacteria | 1811 |
| 465 | Ga0307413_10027626 | 3300031824 | Bacteria | 3147 |
| 466 | Ga0307413_10071455 | 3300031824 | Bacteria | 2187 |
| 467 | Ga0307413_10079811 | 3300031824 | Bacteria | 2093 |
| 468 | Ga0307410_10027562 | 3300031852 | Bacteria | 3592 |
| 469 | Ga0307406_10053094 | 3300031901 | Bacteria | 2581 |
| 470 | Ga0307406_10060203 | 3300031901 | Bacteria | 2447 |
| 471 | Ga0307407_10039628 | 3300031903 | Bacteria | 2621 |
| 472 | Ga0307407_10039691 | 3300031903 | Bacteria | 2619 |
| 473 | Ga0307409_100024830 | 3300031995 | Bacteria | 4189 |
| 474 | Ga0307416_100017882 | 3300032002 | Bacteria | 4976 |
| 475 | Ga0307416_100081616 | 3300032002 | Bacteria | 2735 |
| 476 | Ga0307416_100122574 | 3300032002 | Bacteria | 2321 |
| 477 | Ga0307414_10001865 | 3300032004 | Bacteria | 10895 |
| 478 | Ga0307414_10053051 | 3300032004 | Bacteria | 2826 |
| 479 | Ga0307411_10000376 | 3300032005 | Bacteria | 15191 |
| 480 | Ga0307411_10062865 | 3300032005 | Bacteria | 2478 |
| 481 | Ga0307411_10117716 | 3300032005 | Bacteria | 1915 |
| 482 | Ga0307415_100013273 | 3300032126 | Bacteria | 4803 |
| 483 | Ga0307415_100196960 | 3300032126 | Bacteria | 1595 |
| 484 | Ga0316583_10010214 | 3300032133 | Bacteria | 3383 |
| 485 | Ga0316583_10018886 | 3300032133 | Bacteria | 2476 |
| 486 | Ga0316580_10030790 | 3300032139 | Bacteria | 1662 |
| 487 | Ga0373940_0034671 | 3300035088 | Bacteria | 1363 |
| 488 | Ga0373949_0000951 | 3300035090 | Bacteria | 8980 |
| 489 | Ga0373955_0049692 | 3300035172 | Bacteria | 2278 |
| 490 | Ga0373942_0007594 | 3300035207 | Bacteria | 2518 |
| 491 | Ga0316574_0002485 | 3300035398 | Bacteria | 9261 |
| 492 | Ga0316574_0009334 | 3300035398 | Bacteria | 5493 |
| 493 | Ga0316574_0054924 | 3300035398 | Bacteria | 2488 |
| 494 | Ga0373935_0007615 | 3300035692 | Bacteria | 6487 |
| 495 | Ga0373927_0000003 | 3300035695 | Bacteria | 480348 |
| 496 | Ga0373947_0084854 | 3300035725 | Bacteria | 1966 |
| 497 | Ga0373937_0001072 | 3300036401 | Bacteria | 23084 |
| 498 | Ga0373937_0053691 | 3300036401 | Bacteria | 3696 |
| 499 | Ga0373937_0205345 | 3300036401 | Bacteria | 1853 |
| 500 | Ga0316582_0007070 | 3300036647 | Bacteria | 5958 |
| 501 | Ga0316582_0102397 | 3300036647 | Bacteria | 1898 |
| 502 | Ga0316584_0000420 | 3300036712 | Bacteria | 22076 |
| 503 | Ga0316584_0032212 | 3300036712 | Bacteria | 3879 |
| 504 | Ga0316584_0036815 | 3300036712 | Bacteria | 3632 |
| 505 | Ga0316584_0096468 | 3300036712 | Bacteria | 2213 |
| 506 | Ga0316584_0098186 | 3300036712 | Bacteria | 2193 |
| 507 | Ga0316584_0128624 | 3300036712 | Bacteria | 1892 |
| 508 | Ga0373925_0031321 | 3300037068 | Bacteria | 3908 |
| 509 | Ga0373925_0081095 | 3300037068 | Bacteria | 2467 |
| 510 | Ga0395899_0004071 | 3300037312 | Bacteria | 11522 |
| 511 | Ga0395900_0003648 | 3300037418 | Bacteria | 16550 |
| 512 | Ga0395900_0052210 | 3300037418 | Bacteria | 4208 |
| 513 | Ga0395900_0104362 | 3300037418 | Bacteria | 2912 |
| 514 | Ga0395900_0160786 | 3300037418 | Bacteria | 2291 |
| 515 | Ga0395898_0002144 | 3300037466 | Bacteria | 24310 |
| 516 | Ga0395898_0013402 | 3300037466 | Bacteria | 8444 |
| 517 | Ga0395898_0031995 | 3300037466 | Bacteria | 5251 |
| 518 | Ga0395905_0000145 | 3300037471 | Bacteria | 116795 |
| 519 | Ga0395905_0001178 | 3300037471 | Bacteria | 32675 |
| 520 | Ga0395905_0121103 | 3300037471 | Bacteria | 2459 |
| 521 | Ga0395905_0137615 | 3300037471 | Unclassified | 2298 |
| 522 | Ga0316581_0009548 | 3300037588 | Bacteria | 2670 |
| 523 | Ga0436364_0158752 | 3300037853 | Bacteria | 1866 |
| 524 | Ga0436364_0432318 | 3300037853 | Bacteria | 56122 |
| 525 | Ga0395901_0001254 | 3300038443 | Bacteria | 26979 |
| 526 | Ga0395901_0093201 | 3300038443 | Bacteria | 3153 |
| 527 | Ga0395901_0094882 | 3300038443 | Bacteria | 3126 |
| 528 | Ga0395901_0113641 | 3300038443 | Bacteria | 2844 |
| 529 | Ga0395901_0179431 | 3300038443 | Bacteria | 2221 |
| 530 | Ga0400490_46219 | 3300038726 | Bacteria | 20743 |
| 531 | Ga0400485_13208 | 3300038735 | Bacteria | 6790 |
| 532 | Ga0400485_16317 | 3300038735 | Bacteria | 1460 |
| 533 | Ga0400488_17591 | 3300038741 | Bacteria | 1508 |
| 534 | Ga0400486_11253 | 3300038742 | Unclassified | 1910 |
| 535 | Ga0400486_23182 | 3300038742 | Bacteria | 11956 |
| 536 | Ga0400483_001761 | 3300039062 | Bacteria | 3404 |
| 537 | Ga0400483_204516 | 3300039062 | Bacteria | 1586 |
| 538 | Ga0400483_212392 | 3300039062 | Bacteria | 8447 |
| 539 | Ga0400483_280760 | 3300039062 | Bacteria | 5718 |
| 540 | Ga0400487_05423 | 3300039110 | Bacteria | 5710 |
| 541 | Ga0400487_59306 | 3300039110 | Bacteria | 2535 |
| 542 | Ga0436365_0749742 | 3300039437 | Bacteria | 107056 |
| 543 | Ga0436361_0015804 | 3300039447 | Bacteria | 7667 |
| 544 | Ga0436361_0046882 | 3300039447 | Bacteria | 5171 |
| 545 | Ga0436361_0049245 | 3300039447 | Bacteria | 3528 |
| 546 | Ga0436361_0271669 | 3300039447 | Bacteria | 15881 |
| 547 | Ga0436361_0298070 | 3300039447 | Bacteria | 21162 |
| 548 | Ga0436361_0446120 | 3300039447 | Bacteria | 25100 |
| 549 | Ga0436361_0464290 | 3300039447 | Bacteria | 2648 |
| 550 | Ga0436361_0585829 | 3300039447 | Bacteria | 9342 |
| 551 | Ga0436361_0589265 | 3300039447 | Bacteria | 45710 |
| 552 | Ga0436361_0629359 | 3300039447 | Bacteria | 14562 |
| 553 | Ga0436361_0735177 | 3300039447 | Bacteria | 29126 |
| 554 | Ga0436361_0778877 | 3300039447 | Bacteria | 10989 |
| 555 | Ga0436361_0860856 | 3300039447 | Bacteria | 3196 |
| 556 | Ga0436361_0946815 | 3300039447 | Bacteria | 1534 |
| 557 | Ga0436361_1123843 | 3300039447 | Bacteria | 3604 |
| 558 | Ga0436363_1440181 | 3300039450 | Bacteria | 1329 |
| 559 | Ga0436362_0157410 | 3300039453 | Bacteria | 11708 |
| 560 | Ga0439461_0000037 | 3300041410 | Bacteria | 16309 |
| 561 | Ga0439465_0005600 | 3300041413 | Bacteria | 4001 |
| 562 | Ga0439465_0025870 | 3300041413 | Bacteria | 1854 |
| 563 | Ga0439431_0000035 | 3300041997 | Bacteria | 20455 |
| 564 | Ga0439431_0025194 | 3300041997 | Bacteria | 1451 |
| 565 | Ga0439442_004776 | 3300042002 | Bacteria | 2695 |
| 566 | Ga0439445_0002180 | 3300042004 | Bacteria | 4343 |
| 567 | Ga0439432_000347 | 3300042006 | Bacteria | 16905 |
| 568 | Ga0439452_016834 | 3300042010 | Bacteria | 1978 |
| 569 | Ga0439462_0004168 | 3300042015 | Bacteria | 3517 |
| 570 | Ga0439462_0012344 | 3300042015 | Bacteria | 2181 |
| 571 | Ga0439434_0001167 | 3300042435 | Bacteria | 7599 |
| 572 | Ga0451577_0033328 | 3300042876 | Bacteria | 4643 |
| 573 | Ga0451577_0058703 | 3300042876 | Bacteria | 3430 |
| 574 | Ga0453683_0120161 | 3300044673 | Bacteria | 1654 |
| 575 | Ga0466963_0010075 | 3300044694 | Bacteria | 5715 |
| 576 | Ga0453684_0000681 | 3300044712 | Bacteria | 121111 |
| 577 | Ga0453684_0003515 | 3300044712 | Bacteria | 35112 |
| 578 | Ga0453684_0005989 | 3300044712 | Bacteria | 23556 |
| 579 | Ga0453684_0034569 | 3300044712 | Bacteria | 7012 |
| 580 | Ga0466957_0010995 | 3300044842 | Bacteria | 5206 |
| 581 | Ga0466957_0086706 | 3300044842 | Bacteria | 1956 |
| 582 | Ga0451576_0008922 | 3300045051 | Bacteria | 11698 |
| 583 | Ga0451576_0011409 | 3300045051 | Bacteria | 10098 |
| 584 | Ga0451576_0015073 | 3300045051 | Bacteria | 8584 |
| 585 | Ga0451576_0109584 | 3300045051 | Bacteria | 2873 |
| 586 | Ga0451576_0115872 | 3300045051 | Bacteria | 2790 |
| 587 | Ga0466958_0031993 | 3300045836 | Bacteria | 3128 |
| 588 | Ga0466967_0003375 | 3300045976 | Bacteria | 10398 |
| 589 | Ga0495627_000120 | 3300046453 | Bacteria | 97375 |
| 590 | Ga0495603_0003297 | 3300046455 | Bacteria | 9608 |
| 591 | Ga0495590_0001850 | 3300046457 | Bacteria | 8950 |
| 592 | Ga0495629_0057403 | 3300046459 | Bacteria | 2722 |
| 593 | Ga0495638_0000920 | 3300046460 | Bacteria | 29986 |
| 594 | Ga0495650_0000020 | 3300046471 | Bacteria | 533839 |
| 595 | Ga0495580_0108750 | 3300046472 | Bacteria | 1925 |
| 596 | Ga0495580_0131810 | 3300046472 | Bacteria | 1734 |
| 597 | Ga0495582_0021989 | 3300046473 | Bacteria | 3489 |
| 598 | Ga0495585_0037859 | 3300046492 | Bacteria | 2716 |
| 599 | Ga0495594_0089251 | 3300046499 | Bacteria | 1726 |
| 600 | Ga0495583_0000069 | 3300046506 | Bacteria | 186863 |
| 601 | Ga0495610_0007069 | 3300046512 | Bacteria | 7579 |
| 602 | Ga0495610_0007751 | 3300046512 | Bacteria | 7086 |
| 603 | Ga0495620_0015363 | 3300046515 | Bacteria | 3869 |
| 604 | Ga0495630_0212835 | 3300046517 | Bacteria | 1475 |
| 605 | Ga0495632_0049547 | 3300046519 | Bacteria | 2075 |
| 606 | Ga0495643_0010185 | 3300046522 | Bacteria | 5795 |
| 607 | Ga0495648_0027842 | 3300046524 | Bacteria | 3776 |
| 608 | Ga0495597_0008164 | 3300046542 | Bacteria | 5265 |
| 609 | Ga0495622_0005156 | 3300046557 | Bacteria | 6060 |
| 610 | Ga0495633_0065119 | 3300046558 | Bacteria | 1704 |
| 611 | Ga0495668_0000186 | 3300046616 | Bacteria | 92604 |
| 612 | Ga0495668_0025388 | 3300046616 | Bacteria | 3367 |
| 613 | Ga0495625_0158580 | 3300046660 | Bacteria | 1517 |
| 614 | Ga0495669_0000001 | 3300046684 | Bacteria | 291866 |
| 615 | Ga0495669_0016596 | 3300046684 | Bacteria | 3154 |
| 616 | Ga0495669_0042831 | 3300046684 | Bacteria | 2014 |
| 617 | Ga0495624_0035188 | 3300046690 | Bacteria | 3234 |
| 618 | Ga0495670_0000007 | 3300046691 | Bacteria | 247088 |
| 619 | Ga0495672_0004324 | 3300047320 | Bacteria | 11699 |
| 620 | Ga0495672_0015997 | 3300047320 | Bacteria | 5076 |
| 621 | Ga0495672_0033183 | 3300047320 | Bacteria | 3201 |
| 622 | Ga0495672_0053807 | 3300047320 | Bacteria | 2356 |
| 623 | Ga0495676_0000334 | 3300047321 | Bacteria | 38217 |
| 624 | Ga0495673_0000403 | 3300047469 | Bacteria | 50650 |
| 625 | Ga0495686_0000765 | 3300047472 | Bacteria | 42391 |
| 626 | Ga0495686_0001049 | 3300047472 | Bacteria | 33132 |
| 627 | Ga0495686_0010359 | 3300047472 | Bacteria | 6636 |
| 628 | Ga0495686_0043009 | 3300047472 | Bacteria | 2868 |
| 629 | Ga0495593_0037701 | 3300047673 | Bacteria | 2613 |
| 630 | Ga0496102_0011343 | 3300048905 | Bacteria | 7677 |
| 631 | Ga0496102_0048500 | 3300048905 | Bacteria | 3861 |
| 632 | Ga0496103_0005222 | 3300048906 | Bacteria | 7803 |
| 633 | Ga0496106_0004061 | 3300048909 | Bacteria | 10921 |
| 634 | Ga0496106_0065136 | 3300048909 | Bacteria | 2774 |
| 635 | Ga0496106_0145614 | 3300048909 | Bacteria | 1866 |
| 636 | Ga0496107_0015512 | 3300048910 | Bacteria | 5343 |
| 637 | Ga0496110_0138219 | 3300048913 | Bacteria | 2203 |
| 638 | Ga0496112_0053926 | 3300048915 | Bacteria | 3950 |
| 639 | Ga0496112_0079875 | 3300048915 | Bacteria | 3235 |
| 640 | Ga0496112_0164576 | 3300048915 | Bacteria | 2184 |
| 641 | Ga0496115_0002266 | 3300048918 | Bacteria | 13774 |
| 642 | Ga0496116_0033178 | 3300048919 | Bacteria | 3667 |
| 643 | Ga0496117_0032808 | 3300048920 | Bacteria | 3938 |
| 644 | Ga0496118_0030172 | 3300048921 | Bacteria | 4531 |
| 645 | Ga0496118_0075207 | 3300048921 | Bacteria | 2410 |
| 646 | Ga0496119_0024037 | 3300048922 | Bacteria | 4301 |
| 647 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 648 | Ga0496121_0000631 | 3300048924 | Bacteria | 65738 |
| 649 | Ga0496122_0023547 | 3300048925 | Bacteria | 5423 |
| 650 | Ga0496123_0006810 | 3300048926 | Bacteria | 10969 |
| 651 | Ga0496125_0001837 | 3300048928 | Bacteria | 29288 |
| 652 | Ga0496125_0037060 | 3300048928 | Bacteria | 4245 |
| 653 | Ga0496125_0070035 | 3300048928 | Bacteria | 2748 |
| 654 | Ga0496126_0148069 | 3300048929 | Bacteria | 2014 |
| 655 | Ga0495678_000738 | 3300049459 | Bacteria | 29701 |
| 656 | Ga0501031_0023554 | 3300049568 | Bacteria | 4013 |
| 657 | Ga0501032_0002952 | 3300049569 | Bacteria | 13214 |
| 658 | Ga0501032_0026073 | 3300049569 | Bacteria | 4026 |
| 659 | Ga0501032_0054951 | 3300049569 | Bacteria | 2679 |
| 660 | Ga0501033_0003092 | 3300049570 | Bacteria | 13826 |
| 661 | Ga0501033_0007825 | 3300049570 | Bacteria | 8282 |
| 662 | Ga0501033_0068432 | 3300049570 | Bacteria | 2610 |
| 663 | Ga0501033_0074238 | 3300049570 | Bacteria | 2497 |
| 664 | Ga0501033_0134506 | 3300049570 | Bacteria | 1789 |
| 665 | Ga0501033_0196739 | 3300049570 | Bacteria | 1441 |
| 666 | Ga0501034_0000013 | 3300049571 | Bacteria | 297898 |
| 667 | Ga0501034_0000280 | 3300049571 | Bacteria | 91814 |
| 668 | Ga0501034_0000415 | 3300049571 | Bacteria | 71688 |
| 669 | Ga0501034_0002434 | 3300049571 | Bacteria | 22482 |
| 670 | Ga0501034_0038952 | 3300049571 | Bacteria | 4814 |
| 671 | Ga0501034_0126795 | 3300049571 | Bacteria | 2537 |
| 672 | Ga0501034_0171074 | 3300049571 | Bacteria | 2140 |
| 673 | Ga0501036_0002006 | 3300049572 | Bacteria | 15824 |
| 674 | Ga0501036_0198380 | 3300049572 | Bacteria | 1688 |
| 675 | Ga0501037_0000487 | 3300049573 | Bacteria | 32144 |
| 676 | Ga0501037_0009708 | 3300049573 | Bacteria | 7064 |
| 677 | Ga0501037_0014451 | 3300049573 | Bacteria | 5810 |
| 678 | Ga0501037_0068411 | 3300049573 | Bacteria | 2585 |
| 679 | Ga0501038_0000308 | 3300049574 | Bacteria | 41640 |
| 680 | Ga0501038_0016356 | 3300049574 | Bacteria | 6725 |
| 681 | Ga0501038_0056902 | 3300049574 | Bacteria | 3358 |
| 682 | Ga0501039_0000249 | 3300049575 | Bacteria | 39312 |
| 683 | Ga0501039_0019968 | 3300049575 | Bacteria | 5136 |
| 684 | Ga0501040_0108460 | 3300049576 | Bacteria | 1941 |
| 685 | Ga0501041_0037142 | 3300049577 | Bacteria | 2951 |
| 686 | Ga0501041_0067686 | 3300049577 | Bacteria | 2189 |
| 687 | Ga0501043_0002326 | 3300049579 | Bacteria | 16096 |
| 688 | Ga0501043_0167113 | 3300049579 | Bacteria | 1717 |
| 689 | Ga0501046_0004392 | 3300049580 | Bacteria | 12813 |
| 690 | Ga0501046_0041049 | 3300049580 | Bacteria | 3693 |
| 691 | Ga0501046_0068682 | 3300049580 | Bacteria | 2758 |
| 692 | Ga0501046_0154565 | 3300049580 | Bacteria | 1729 |
| 693 | Ga0501047_0000469 | 3300049581 | Bacteria | 43881 |
| 694 | Ga0501047_0001112 | 3300049581 | Bacteria | 26731 |
| 695 | Ga0501047_0024082 | 3300049581 | Bacteria | 5846 |
| 696 | Ga0501047_0050924 | 3300049581 | Bacteria | 3999 |
| 697 | Ga0501047_0169676 | 3300049581 | Bacteria | 2051 |
| 698 | Ga0501047_0187158 | 3300049581 | Bacteria | 1935 |
| 699 | Ga0501048_0032975 | 3300049582 | Bacteria | 3743 |
| 700 | Ga0501048_0121820 | 3300049582 | Bacteria | 1843 |
| 701 | Ga0501067_0001487 | 3300049583 | Bacteria | 12752 |
| 702 | Ga0501067_0008213 | 3300049583 | Bacteria | 5796 |
| 703 | Ga0501067_0031419 | 3300049583 | Bacteria | 2946 |
| 704 | Ga0501067_0082488 | 3300049583 | Bacteria | 1783 |
| 705 | Ga0501068_0017699 | 3300049584 | Bacteria | 4123 |
| 706 | Ga0501068_0117881 | 3300049584 | Bacteria | 1654 |
| 707 | Ga0501069_0000411 | 3300049585 | Bacteria | 19421 |
| 708 | Ga0501069_0011302 | 3300049585 | Bacteria | 4734 |
| 709 | Ga0501070_0004769 | 3300049586 | Bacteria | 11606 |
| 710 | Ga0501070_0006021 | 3300049586 | Bacteria | 10331 |
| 711 | Ga0501070_0066390 | 3300049586 | Bacteria | 2987 |
| 712 | Ga0501070_0095433 | 3300049586 | Bacteria | 2460 |
| 713 | Ga0501070_0207224 | 3300049586 | Bacteria | 1610 |
| 714 | Ga0501071_0019726 | 3300049587 | Bacteria | 4680 |
| 715 | Ga0501072_0005781 | 3300049588 | Bacteria | 9419 |
| 716 | Ga0501072_0036829 | 3300049588 | Bacteria | 3836 |
| 717 | Ga0501072_0138994 | 3300049588 | Bacteria | 1937 |
| 718 | Ga0501073_0001711 | 3300049589 | Bacteria | 16281 |
| 719 | Ga0501073_0002016 | 3300049589 | Bacteria | 15167 |
| 720 | Ga0501073_0007841 | 3300049589 | Bacteria | 7928 |
| 721 | Ga0501073_0017023 | 3300049589 | Bacteria | 5267 |
| 722 | Ga0501073_0029602 | 3300049589 | Bacteria | 3912 |
| 723 | Ga0501074_0007384 | 3300049590 | Bacteria | 7949 |
| 724 | Ga0501074_0015001 | 3300049590 | Bacteria | 5639 |
| 725 | Ga0501075_0024615 | 3300049591 | Bacteria | 4418 |
| 726 | Ga0501075_0071806 | 3300049591 | Bacteria | 2616 |
| 727 | Ga0501075_0076710 | 3300049591 | Bacteria | 2528 |
| 728 | Ga0501076_0021969 | 3300049592 | Bacteria | 4901 |
| 729 | Ga0501076_0044295 | 3300049592 | Bacteria | 3509 |
| 730 | Ga0501077_0040685 | 3300049593 | Bacteria | 2961 |
| 731 | Ga0501202_013954 | 3300049652 | Bacteria | 1534 |
| 732 | Ga0501209_031992 | 3300049656 | Bacteria | 1340 |
| 733 | Ga0501079_0045657 | 3300049741 | Bacteria | 3381 |
| 734 | Ga0501079_0046828 | 3300049741 | Bacteria | 3337 |
| 735 | Ga0501079_0060684 | 3300049741 | Bacteria | 2917 |
| 736 | Ga0501080_0000003 | 3300049742 | Bacteria | 214890 |
| 737 | Ga0501080_0000644 | 3300049742 | Bacteria | 27691 |
| 738 | Ga0501080_0001724 | 3300049742 | Bacteria | 18686 |
| 739 | Ga0501080_0010976 | 3300049742 | Bacteria | 8292 |
| 740 | Ga0501080_0026308 | 3300049742 | Bacteria | 5406 |
| 741 | Ga0501080_0109696 | 3300049742 | Bacteria | 2558 |
| 742 | Ga0501080_0300274 | 3300049742 | Bacteria | 1457 |
| 743 | Ga0501081_0015052 | 3300049743 | Bacteria | 5103 |
| 744 | Ga0501081_0024684 | 3300049743 | Bacteria | 4039 |
| 745 | Ga0501083_0021974 | 3300049744 | Bacteria | 4430 |
| 746 | Ga0501083_0030932 | 3300049744 | Bacteria | 3674 |
| 747 | Ga0501035_0000058 | 3300049822 | Bacteria | 135089 |
| 748 | Ga0501035_0072898 | 3300049822 | Bacteria | 3038 |
| 749 | Ga0501035_0087628 | 3300049822 | Bacteria | 2743 |
| 750 | Ga0501035_0179705 | 3300049822 | Bacteria | 1823 |
| 751 | Ga0501044_0000023 | 3300049823 | Bacteria | 196555 |
| 752 | Ga0501044_0001009 | 3300049823 | Bacteria | 33822 |
| 753 | Ga0501044_0004049 | 3300049823 | Bacteria | 16444 |
| 754 | Ga0501044_0005168 | 3300049823 | Bacteria | 14535 |
| 755 | Ga0501044_0033646 | 3300049823 | Bacteria | 5384 |
| 756 | Ga0501044_0055196 | 3300049823 | Bacteria | 4081 |
| 757 | Ga0501044_0086360 | 3300049823 | Bacteria | 3169 |
| 758 | Ga0501044_0286709 | 3300049823 | Bacteria | 1579 |
| 759 | Ga0501045_0034360 | 3300049824 | Bacteria | 3681 |
| 760 | nmdc:mga05p37_102615_c1 | 3300050507 | Bacteria | 3522 |
| 761 | nmdc:mga05p37_14_c1 | 3300050507 | Bacteria | 137209 |
| 762 | nmdc:mga05p37_171826_c1 | 3300050507 | Bacteria | 2643 |
| 763 | nmdc:mga05p37_3462_c1 | 3300050507 | Bacteria | 18433 |
| 764 | nmdc:mga05p37_99101_c1 | 3300050507 | Bacteria | 3590 |
| 765 | nmdc:mga09592_13954_c1 | 3300050508 | Bacteria | 6562 |
| 766 | nmdc:mga09592_21823_c1 | 3300050508 | Bacteria | 5280 |
| 767 | nmdc:mga09592_25243_c1 | 3300050508 | Bacteria | 4917 |
| 768 | nmdc:mga09592_77530_c1 | 3300050508 | Bacteria | 2827 |
| 769 | nmdc:mga0qj67_145886_c1 | 3300050509 | Bacteria | 1919 |
| 770 | nmdc:mga0qj67_226381_c1 | 3300050509 | Bacteria | 1518 |
| 771 | nmdc:mga0qj67_2734_c1 | 3300050509 | Bacteria | 12645 |
| 772 | nmdc:mga0qj67_29305_c1 | 3300050509 | Bacteria | 4276 |
| 773 | nmdc:mga06r32_1042_c1 | 3300050510 | Bacteria | 25028 |
| 774 | nmdc:mga06r32_143618_c1 | 3300050510 | Bacteria | 2364 |
| 775 | nmdc:mga06r32_219628_c1 | 3300050510 | Bacteria | 1889 |
| 776 | nmdc:mga06r32_3549_c1 | 3300050510 | Bacteria | 13927 |
| 777 | nmdc:mga06r32_55420_c1 | 3300050510 | Bacteria | 3803 |
| 778 | nmdc:mga06r32_86749_c1 | 3300050510 | Bacteria | 3053 |
| 779 | nmdc:mga08y16_120640_c1 | 3300050511 | Bacteria | 2728 |
| 780 | nmdc:mga08y16_146126_c1 | 3300050511 | Bacteria | 2458 |
| 781 | nmdc:mga08y16_155884_c1 | 3300050511 | Bacteria | 2373 |
| 782 | nmdc:mga08y16_1630_c3 | 3300050511 | Bacteria | 9162 |
| 783 | nmdc:mga08y16_412_c1 | 3300050511 | Bacteria | 39249 |
| 784 | nmdc:mga08y16_47_c1 | 3300050511 | Bacteria | 111829 |
| 785 | nmdc:mga08y16_5453_c1 | 3300050511 | Bacteria | 13298 |
| 786 | nmdc:mga08y16_61415_c1 | 3300050511 | Bacteria | 3924 |
| 787 | nmdc:mga0n895_107089_c1 | 3300050512 | Bacteria | 2809 |
| 788 | nmdc:mga0n895_166685_c1 | 3300050512 | Bacteria | 2235 |
| 789 | nmdc:mga0rr50_47905_c1 | 3300050513 | Bacteria | 3156 |
| 790 | nmdc:mga0rr50_98_c1 | 3300050513 | Bacteria | 48790 |
| 791 | nmdc:mga0rr50_9938_c1 | 3300050513 | Bacteria | 6015 |
| 792 | nmdc:mga08x19_3_c1 | 3300050514 | Bacteria | 654433 |
| 793 | nmdc:mga08x19_744_c1 | 3300050514 | Bacteria | 20777 |
| 794 | nmdc:mga0a205_226255_c1 | 3300050515 | Bacteria | 1755 |
| 795 | nmdc:mga0sz30_10065_c1 | 3300050516 | Bacteria | 3615 |
| 796 | Ga0500635_0000341 | 3300053080 | Bacteria | 15509 |
| 797 | Ga0495619_0013355 | 3300053085 | Bacteria | 5175 |
| 798 | Ga0500578_0070210 | 3300053086 | Bacteria | 2233 |
| 799 | Ga0500643_007932 | 3300053087 | Bacteria | 4224 |
| 800 | Ga0500643_011262 | 3300053087 | Bacteria | 3272 |
| 801 | Ga0500644_0000417 | 3300053088 | Bacteria | 20038 |
| 802 | Ga0500651_0026285 | 3300053093 | Bacteria | 3657 |
| 803 | Ga0500566_0000395 | 3300053094 | Bacteria | 24231 |
| 804 | Ga0500566_0014059 | 3300053094 | Bacteria | 4705 |
| 805 | Ga0500566_0040118 | 3300053094 | Bacteria | 2706 |
| 806 | Ga0500641_0021637 | 3300053096 | Bacteria | 2455 |
| 807 | Ga0500641_0024141 | 3300053096 | Bacteria | 2342 |
| 808 | Ga0500650_0000012 | 3300053098 | Bacteria | 81170 |
| 809 | Ga0500554_009814 | 3300053102 | Bacteria | 2306 |
| 810 | Ga0500555_002402 | 3300053103 | Bacteria | 5443 |
| 811 | Ga0500555_010087 | 3300053103 | Bacteria | 2704 |
| 812 | Ga0500556_0003170 | 3300053104 | Bacteria | 4898 |
| 813 | Ga0500562_000746 | 3300053108 | Bacteria | 7911 |
| 814 | Ga0500569_003491 | 3300053109 | Bacteria | 3221 |
| 815 | Ga0500594_0000383 | 3300053118 | Bacteria | 9907 |
| 816 | Ga0500594_0001236 | 3300053118 | Bacteria | 5529 |
| 817 | Ga0500595_001105 | 3300053119 | Bacteria | 14963 |
| 818 | Ga0500595_002031 | 3300053119 | Bacteria | 10344 |
| 819 | Ga0500595_002725 | 3300053119 | Bacteria | 8557 |
| 820 | Ga0500608_000062 | 3300053122 | Bacteria | 46850 |
| 821 | Ga0500608_000926 | 3300053122 | Bacteria | 10538 |
| 822 | Ga0500608_001411 | 3300053122 | Bacteria | 8596 |
| 823 | Ga0500614_000989 | 3300053123 | Bacteria | 7062 |
| 824 | Ga0500618_000533 | 3300053125 | Bacteria | 23792 |
| 825 | Ga0500642_0000312 | 3300053130 | Bacteria | 17022 |
| 826 | Ga0500642_0004595 | 3300053130 | Bacteria | 4346 |
| 827 | Ga0500642_0073457 | 3300053130 | Bacteria | 1559 |
| 828 | Ga0500658_0000344 | 3300053134 | Bacteria | 20695 |
| 829 | Ga0500658_0030889 | 3300053134 | Bacteria | 2093 |
| 830 | Ga0500658_0032817 | 3300053134 | Bacteria | 2038 |
| 831 | Ga0500559_0009681 | 3300053136 | Bacteria | 4161 |
| 832 | Ga0500559_0043839 | 3300053136 | Bacteria | 1955 |
| 833 | Ga0500564_000244 | 3300053138 | Bacteria | 15171 |
| 834 | Ga0500564_011844 | 3300053138 | Bacteria | 3859 |
| 835 | Ga0500568_0002926 | 3300053139 | Bacteria | 9788 |
| 836 | Ga0500568_0012589 | 3300053139 | Bacteria | 3883 |
| 837 | Ga0500568_0026297 | 3300053139 | Bacteria | 2444 |
| 838 | Ga0500573_0023904 | 3300053140 | Bacteria | 3511 |
| 839 | Ga0500588_0001206 | 3300053146 | Bacteria | 4785 |
| 840 | Ga0500590_008548 | 3300053148 | Bacteria | 5113 |
| 841 | Ga0500604_0001150 | 3300053151 | Bacteria | 7350 |
| 842 | Ga0500616_0000388 | 3300053153 | Bacteria | 61251 |
| 843 | Ga0500616_0021719 | 3300053153 | Bacteria | 3594 |
| 844 | Ga0500622_0019273 | 3300053156 | Bacteria | 3624 |
| 845 | Ga0500636_0029081 | 3300053177 | Bacteria | 3263 |
| 846 | Ga0500637_0023041 | 3300053178 | Bacteria | 3399 |
| 847 | Ga0500637_0023688 | 3300053178 | Bacteria | 3360 |
| 848 | Ga0500645_010755 | 3300053730 | Bacteria | 3010 |
| 849 | Ga0501084_0000713 | 3300054114 | Bacteria | 25334 |
| 850 | Ga0501084_0044062 | 3300054114 | Bacteria | 3734 |
| 851 | Ga0501084_0116577 | 3300054114 | Bacteria | 2245 |
| 852 | Ga0590077_007197 | 3300059426 | Bacteria | 2277 |
| 853 | Ga0501082_0002642 | 3300060353 | Bacteria | 15680 |
| 854 | Ga0501082_0003016 | 3300060353 | Bacteria | 14713 |
| 855 | Ga0501082_0003390 | 3300060353 | Bacteria | 13908 |
| 856 | Ga0530510_0002688 | 3300061734 | Bacteria | 12216 |
| 857 | 2511124487 | 2510917020 | Bacteria | 5657507 |
| 858 | 2514042203 | 2513237165 | Bacteria | 6771773 |
| 859 | 2524001672 | 2523533628 | Bacteria | 4098242 |
| 860 | 2587915929 | 2585428106 | Bacteria | 5179711 |
| 861 | 2600226469 | 2599185359 | Bacteria | 4772316 |
| 862 | 2643883655 | 2643221574 | Bacteria | 2789653 |
| 863 | 2644126847 | 2643221622 | Bacteria | 4212502 |
| 864 | 2644224211 | 2643221640 | Bacteria | 5258820 |
| 865 | 2644234853 | 2643221642 | Bacteria | 5357871 |
| 866 | 2644351822 | 2643221663 | Bacteria | 3425771 |
| 867 | 2644551658 | 2643221699 | Bacteria | 5731501 |
| 868 | 2644551811 | 2643221699 | Bacteria | 5731501 |
| 869 | 2792458898 | 2791355048 | Bacteria | 5832535 |
| 870 | 2821445350 | 2821443989 | Bacteria | 7658172 |
| 871 | 2843749054 | 2843744320 | Bacteria | 5659202 |
| 872 | 2844540174 | 2844533157 | Bacteria | 7517899 |
| 873 | 2849564378 | 2849560528 | Bacteria | 5393480 |
| 874 | 2849573951 | 2849573788 | Bacteria | 5421256 |
| 875 | 2851155507 | 2851153111 | Bacteria | 5542585 |
| 876 | 2857509426 | 2857504554 | Bacteria | 5369913 |
| 877 | 2887631039 | 2887630918 | Bacteria | 3239855 |
| 878 | 2895884798 | 2895880812 | Bacteria | 11255272 |
| 879 | 2898330895 | 2898329390 | Bacteria | 5168154 |
| 880 | 2909045898 | 2909042592 | Bacteria | 6499737 |
| 881 | 2928532461 | 2928531327 | Bacteria | 5101314 |
| 882 | 2928974788 | 2928972540 | Bacteria | 3058286 |
| 883 | 2941488568 | 2941485952 | Bacteria | 3591484 |
| 884 | 2977242168 | 2977240413 | Bacteria | 3191065 |
| 885 | 644747069 | 644736347 | Bacteria | 6476522 |
| 886 | 8054565065 | 8054563764 | Bacteria | 5592885 |
| 887 | Ga0157371_10030302 | |||
| 888 | SwRhRL2b_contig_1045895 | |||
| 889 | ARcpr5oldR_c001570 | |||
| 890 | JGI24034J14986_100228 | |||
| 891 | JGI24736J21556_1000120 | |||
| 892 | JGI24740J21852_10010503 | |||
| 893 | JGI24735J21928_10010617 | |||
| 894 | JGI24748J21848_1000010 | |||
| 895 | JGI24748J21848_1000029 | |||
| 896 | JGI24034J26672_10000001 | |||
| 897 | JGI24034J26672_10000006 | |||
| 898 | JGI24742J22300_10001915 | |||
| 899 | JGI25165J46597_1000053 | |||
| 900 | JGI25153J46596_10000138 | |||
| 901 | rootL2_10042889 | |||
| 902 | Ga0055537_1002278 | |||
| 903 | Ga0055537_1006509 | |||
| 904 | Ga0055524_1000169 | |||
| 905 | Ga0055536_1010658 | |||
| 906 | Ga0055536_1010718 | |||
| 907 | Ga0055528_1014590 | |||
| 908 | Ga0055530_10000423 | |||
| 909 | Ga0055530_10009835 | |||
| 910 | Ga0055530_10014691 | |||
| 911 | Ga0055531_10000589 | |||
| 912 | Ga0055531_10004369 | |||
| 913 | Ga0055531_10017852 | |||
| 914 | Ga0065704_10003860 | |||
| 915 | Ga0065704_10083135 | |||
| 916 | Ga0065712_10009500 | |||
| 917 | Ga0065715_10002131 | |||
| 918 | Ga0065715_10009882 | |||
| 919 | Ga0065715_10013095 | |||
| 920 | Ga0065707_10003307 | |||
| 921 | Ga0065707_10009757 | |||
| 922 | Ga0065707_10088542 | |||
| 923 | Ga0065707_10152081 | |||
| 924 | Ga0070658_10077335 | |||
| 925 | Ga0070676_10000056 | |||
| 926 | Ga0070676_10000801 | |||
| 927 | Ga0070676_10017192 | |||
| 928 | Ga0070683_100129573 | |||
| 929 | Ga0070690_100039665 | |||
| 930 | Ga0070670_100000001 | |||
| 931 | Ga0070670_100027274 | |||
| 932 | Ga0070670_100247982 | |||
| 933 | Ga0068869_100012546 | |||
| 934 | Ga0068869_100065272 | |||
| 935 | Ga0068869_100066087 | |||
| 936 | Ga0070666_10009203 | |||
| 937 | Ga0070666_10031921 | |||
| 938 | Ga0070666_10047659 | |||
| 939 | Ga0070680_100051738 | |||
| 940 | Ga0070687_100040250 | |||
| 941 | Ga0070668_100013918 | |||
| 942 | Ga0070668_100038290 | |||
| 943 | Ga0070669_100013074 | |||
| 944 | Ga0070669_100020394 | |||
| 945 | Ga0070669_100071214 | |||
| 946 | Ga0070675_100005347 | |||
| 947 | Ga0070671_100000008 | |||
| 948 | Ga0070671_100003230 | |||
| 949 | Ga0070671_100084259 | |||
| 950 | Ga0070674_100001556 | |||
| 951 | Ga0070674_100001596 | |||
| 952 | Ga0070674_100057727 | |||
| 953 | Ga0070673_100017315 | |||
| 954 | Ga0070673_100122996 | |||
| 955 | Ga0070688_100000972 | |||
| 956 | Ga0070659_100079147 | |||
| 957 | Ga0070659_100151922 | |||
| 958 | Ga0070667_100000023 | |||
| 959 | Ga0070667_100031234 | |||
| 960 | Ga0070667_100037573 | |||
| 961 | Ga0070667_100125038 | |||
| 962 | Ga0070703_10000544 | |||
| 963 | Ga0070714_100011352 | |||
| 964 | Ga0070713_100180411 | |||
| 965 | Ga0070705_100000469 | |||
| 966 | Ga0070700_100001016 | |||
| 967 | Ga0070694_100009240 | |||
| 968 | Ga0070694_100167847 | |||
| 969 | Ga0070663_100002136 | |||
| 970 | Ga0070678_100038089 | |||
| 971 | Ga0070678_100086075 | |||
| 972 | Ga0070678_100291229 | |||
| 973 | Ga0070662_100002362 | |||
| 974 | Ga0070662_100004008 | |||
| 975 | Ga0070662_100088844 | |||
| 976 | Ga0070662_100127965 | |||
| 977 | Ga0070681_10056714 | |||
| 978 | Ga0070681_10135085 | |||
| 979 | Ga0070685_10000008 | |||
| 980 | Ga0070706_100052417 | |||
| 981 | Ga0070706_100266999 | |||
| 982 | Ga0070698_100004114 | |||
| 983 | Ga0070698_100292900 | |||
| 984 | Ga0070699_100001512 | |||
| 985 | Ga0070699_100244128 | |||
| 986 | Ga0070679_100006337 | |||
| 987 | Ga0070679_100014606 | |||
| 988 | Ga0070679_100076250 | |||
| 989 | Ga0070679_100169270 | |||
| 990 | Ga0070684_100056278 | |||
| 991 | Ga0070697_100007219 | |||
| 992 | Ga0070672_100005200 | |||
| 993 | Ga0070672_100024040 | |||
| 994 | Ga0070672_100147992 | |||
| 995 | Ga0070686_100063669 | |||
| 996 | Ga0070695_100003955 | |||
| 997 | Ga0070695_100104380 | |||
| 998 | Ga0070696_100000758 | |||
| 999 | Ga0070696_100051322 | |||
| 1000 | Ga0070693_100006856 | |||
| 1001 | Ga0070693_100007155 | |||
| 1002 | Ga0070693_100053609 | |||
| 1003 | Ga0070665_100004189 | |||
| 1004 | Ga0070665_100012413 | |||
| 1005 | Ga0070665_100059944 | |||
| 1006 | Ga0070704_100037698 | |||
| 1007 | Ga0070704_100056420 | |||
| 1008 | Ga0068855_100001436 | |||
| 1009 | Ga0068855_100049432 | |||
| 1010 | Ga0068855_100072552 | |||
| 1011 | Ga0068855_100104045 | |||
| 1012 | Ga0068857_100125695 | |||
| 1013 | Ga0068857_100126791 | |||
| 1014 | Ga0068856_100015873 | |||
| 1015 | Ga0070702_100096167 | |||
| 1016 | Ga0068859_100000177 | |||
| 1017 | Ga0068859_100004727 | |||
| 1018 | Ga0068859_100159049 | |||
| 1019 | Ga0068859_100170192 | |||
| 1020 | Ga0068864_100000006 | |||
| 1021 | Ga0068864_100001081 | |||
| 1022 | Ga0068864_100199607 | |||
| 1023 | Ga0068866_10001731 | |||
| 1024 | Ga0068861_100003245 | |||
| 1025 | Ga0068861_100014323 | |||
| 1026 | Ga0068861_100060136 | |||
| 1027 | Ga0068861_100104002 | |||
| 1028 | Ga0068851_10010933 | |||
| 1029 | Ga0068870_10010685 | |||
| 1030 | Ga0068870_10042545 | |||
| 1031 | Ga0068870_10073120 | |||
| 1032 | Ga0068863_100001323 | |||
| 1033 | Ga0068863_100016359 | |||
| 1034 | Ga0068863_100024017 | |||
| 1035 | Ga0068863_100026142 | |||
| 1036 | Ga0068858_100000005 | |||
| 1037 | Ga0068858_100000098 | |||
| 1038 | Ga0068858_100061852 | |||
| 1039 | Ga0068860_100001556 | |||
| 1040 | Ga0068860_100002721 | |||
| 1041 | Ga0068860_100040551 | |||
| 1042 | Ga0068860_100167494 | |||
| 1043 | Ga0068862_100001815 | |||
| 1044 | Ga0068862_100005737 | |||
| 1045 | Ga0068862_100015047 | |||
| 1046 | Ga0068862_100034160 | |||
| 1047 | Ga0068862_100089800 | |||
| 1048 | Ga0081455_10001641 | |||
| 1049 | Ga0081538_10005495 | |||
| 1050 | Ga0081538_10025694 | |||
| 1051 | Ga0081540_1028352 | |||
| 1052 | Ga0075365_10026434 | |||
| 1053 | Ga0070715_10000002 | |||
| 1054 | Ga0075362_10051556 | |||
| 1055 | Ga0075369_10011160 | |||
| 1056 | Ga0097621_100000004 | |||
| 1057 | Ga0068871_100000159 | |||
| 1058 | Ga0068871_100122455 | |||
| 1059 | Ga0075428_100005210 | |||
| 1060 | Ga0075428_100007089 | |||
| 1061 | Ga0075428_100011232 | |||
| 1062 | Ga0075428_100020288 | |||
| 1063 | Ga0075428_100024773 | |||
| 1064 | Ga0075428_100059278 | |||
| 1065 | Ga0075428_100303110 | |||
| 1066 | Ga0075430_100002163 | |||
| 1067 | Ga0075430_100006567 | |||
| 1068 | Ga0075430_100089544 | |||
| 1069 | Ga0075430_100093362 | |||
| 1070 | Ga0075431_100000033 | |||
| 1071 | Ga0075431_100008475 | |||
| 1072 | Ga0075431_100094967 | |||
| 1073 | Ga0075434_100027108 | |||
| 1074 | Ga0075434_100053378 | |||
| 1075 | Ga0075434_100057762 | |||
| 1076 | Ga0075434_100097939 | |||
| 1077 | Ga0075429_100002783 | |||
| 1078 | Ga0075429_100118588 | |||
| 1079 | Ga0075429_100277327 | |||
| 1080 | Ga0068865_100013432 | |||
| 1081 | Ga0068865_100025917 | |||
| 1082 | Ga0068865_100051796 | |||
| 1083 | Ga0068865_100155385 | |||
| 1084 | Ga0075436_100000020 | |||
| 1085 | Ga0075436_100038240 | |||
| 1086 | Ga0075436_100151500 | |||
| 1087 | Ga0097620_100000177 | |||
| 1088 | Ga0097620_100004727 | |||
| 1089 | Ga0097620_100159036 | |||
| 1090 | Ga0097620_100170204 | |||
| 1091 | Ga0097620_100397225 | |||
| 1092 | Ga0075435_100000717 | |||
| 1093 | Ga0075435_100002396 | |||
| 1094 | Ga0075435_100045786 | |||
| 1095 | Ga0075435_100081116 | |||
| 1096 | Ga0105240_10018744 | |||
| 1097 | Ga0111539_10000042 | |||
| 1098 | Ga0111539_10000926 | |||
| 1099 | Ga0111539_10003260 | |||
| 1100 | Ga0111539_10016091 | |||
| 1101 | Ga0111539_10023154 | |||
| 1102 | Ga0111539_10024213 | |||
| 1103 | Ga0111539_10045327 | |||
| 1104 | Ga0111539_10168096 | |||
| 1105 | Ga0111539_10203259 | |||
| 1106 | Ga0111539_10283688 | |||
| 1107 | Ga0111539_10329831 | |||
| 1108 | Ga0105245_10000079 | |||
| 1109 | Ga0105245_10063119 | |||
| 1110 | Ga0105247_10000002 | |||
| 1111 | Ga0114129_10001565 | |||
| 1112 | Ga0114129_10016967 | |||
| 1113 | Ga0114129_10023279 | |||
| 1114 | Ga0114129_10090821 | |||
| 1115 | Ga0114129_10273744 | |||
| 1116 | Ga0114129_10340341 | |||
| 1117 | Ga0105243_10009752 | |||
| 1118 | Ga0105243_10042291 | |||
| 1119 | Ga0105243_10216589 | |||
| 1120 | Ga0105241_10014087 | |||
| 1121 | Ga0105242_10074724 | |||
| 1122 | Ga0105248_10003238 | |||
| 1123 | Ga0105248_10020707 | |||
| 1124 | Ga0105238_10047750 | |||
| 1125 | Ga0105249_10007251 | |||
| 1126 | Ga0105249_10283548 | |||
| 1127 | Ga0105239_10003937 | |||
| 1128 | Ga0105239_10014595 | |||
| 1129 | Ga0105239_10232135 | |||
| 1130 | Ga0157373_10023760 | |||
| 1131 | Ga0157373_10028230 | |||
| 1132 | Ga0157370_10017787 | |||
| 1133 | Ga0157369_10009868 | |||
| 1134 | Ga0157369_10249999 | |||
| 1135 | Ga0157374_10000713 | |||
| 1136 | Ga0157374_10054598 | |||
| 1137 | Ga0157378_10073458 | |||
| 1138 | Ga0157378_10084084 | |||
| 1139 | Ga0163162_10032135 | |||
| 1140 | Ga0163162_10102175 | |||
| 1141 | Ga0157375_10014981 | |||
| 1142 | Ga0163163_10017137 | |||
| 1143 | Ga0157380_10009037 | |||
| 1144 | Ga0157380_10011499 | |||
| 1145 | Ga0157380_10129032 | |||
| 1146 | Ga0157379_10193810 | |||
| 1147 | Ga0157376_10003895 | |||
| 1148 | Ga0213872_10000267 | |||
| 1149 | Ga0213872_10003797 | |||
| 1150 | Ga0213872_10004985 | |||
| 1151 | Ga0213872_10012874 | |||
| 1152 | Ga0213872_10024910 | |||
| 1153 | Ga0213872_10031026 | |||
| 1154 | Ga0213872_10038966 | |||
| 1155 | Ga0213876_10000125 | |||
| 1156 | Ga0213876_10025628 | |||
| 1157 | Ga0209129_1015754 | |||
| 1158 | Ga0209565_1000012 | |||
| 1159 | Ga0209565_1000268 | |||
| 1160 | Ga0209673_1000600 | |||
| 1161 | Ga0209673_1001822 | |||
| 1162 | Ga0209676_1000099 | |||
| 1163 | Ga0209676_1000180 | |||
| 1164 | Ga0209025_1000384 | |||
| 1165 | Ga0209564_1018524 | |||
| 1166 | Ga0209758_1000028 | |||
| 1167 | Ga0209758_1003490 | |||
| 1168 | Ga0209758_1019213 | |||
| 1169 | Ga0209050_1000010 | |||
| 1170 | Ga0209050_1000319 | |||
| 1171 | Ga0209050_1003235 | |||
| 1172 | Ga0209050_1008434 | |||
| 1173 | Ga0209050_1010978 | |||
| 1174 | Ga0209256_1000012 | |||
| 1175 | Ga0209256_1001870 | |||
| 1176 | Ga0209051_1002009 | |||
| 1177 | Ga0209257_1000009 | |||
| 1178 | Ga0209257_1000114 | |||
| 1179 | Ga0209257_1000614 | |||
| 1180 | Ga0209257_1000934 | |||
| 1181 | Ga0209257_1002674 | |||
| 1182 | Ga0207697_10011907 | |||
| 1183 | Ga0207653_10002711 | |||
| 1184 | Ga0207682_10012374 | |||
| 1185 | Ga0207642_10002096 | |||
| 1186 | Ga0207642_10065016 | |||
| 1187 | Ga0207710_10000002 | |||
| 1188 | Ga0207710_10002477 | |||
| 1189 | Ga0207688_10037005 | |||
| 1190 | Ga0207647_10000069 | |||
| 1191 | Ga0207685_10000002 | |||
| 1192 | Ga0207645_10007912 | |||
| 1193 | Ga0207645_10014174 | |||
| 1194 | Ga0207645_10016971 | |||
| 1195 | Ga0207643_10027214 | |||
| 1196 | Ga0207643_10048666 | |||
| 1197 | Ga0207705_10085236 | |||
| 1198 | Ga0207654_10006681 | |||
| 1199 | Ga0207707_10010516 | |||
| 1200 | Ga0207707_10088468 | |||
| 1201 | Ga0207695_10006284 | |||
| 1202 | Ga0207695_10012923 | |||
| 1203 | Ga0207671_10002421 | |||
| 1204 | Ga0207663_10043357 | |||
| 1205 | Ga0207663_10166369 | |||
| 1206 | Ga0207662_10067368 | |||
| 1207 | Ga0207657_10005842 | |||
| 1208 | Ga0207649_10098484 | |||
| 1209 | Ga0207652_10121877 | |||
| 1210 | Ga0207652_10168580 | |||
| 1211 | Ga0207681_10007853 | |||
| 1212 | Ga0207681_10030359 | |||
| 1213 | Ga0207681_10056288 | |||
| 1214 | Ga0207694_10003033 | |||
| 1215 | Ga0207650_10000002 | |||
| 1216 | Ga0207650_10007766 | |||
| 1217 | Ga0207650_10019990 | |||
| 1218 | Ga0207650_10143944 | |||
| 1219 | Ga0207687_10000603 | |||
| 1220 | Ga0207700_10199101 | |||
| 1221 | Ga0207664_10008296 | |||
| 1222 | Ga0207644_10000019 | |||
| 1223 | Ga0207644_10000210 | |||
| 1224 | Ga0207644_10002172 | |||
| 1225 | Ga0207690_10021855 | |||
| 1226 | Ga0207706_10001828 | |||
| 1227 | Ga0207706_10003256 | |||
| 1228 | Ga0207706_10065816 | |||
| 1229 | Ga0207709_10003138 | |||
| 1230 | Ga0207670_10007351 | |||
| 1231 | Ga0207669_10001357 | |||
| 1232 | Ga0207669_10061491 | |||
| 1233 | Ga0207704_10015697 | |||
| 1234 | Ga0207691_10006490 | |||
| 1235 | Ga0207691_10017589 | |||
| 1236 | Ga0207691_10050470 | |||
| 1237 | Ga0207711_10000156 | |||
| 1238 | Ga0207711_10003188 | |||
| 1239 | Ga0207711_10010997 | |||
| 1240 | Ga0207711_10020671 | |||
| 1241 | Ga0207711_10039375 | |||
| 1242 | Ga0207711_10054444 | |||
| 1243 | Ga0207689_10014108 | |||
| 1244 | Ga0207689_10076726 | |||
| 1245 | Ga0207689_10289186 | |||
| 1246 | Ga0207667_10000735 | |||
| 1247 | Ga0207667_10116859 | |||
| 1248 | Ga0207651_10125557 | |||
| 1249 | Ga0207712_10000922 | |||
| 1250 | Ga0207712_10022518 | |||
| 1251 | Ga0207712_10221557 | |||
| 1252 | Ga0207668_10090960 | |||
| 1253 | Ga0207640_10031574 | |||
| 1254 | Ga0207658_10000001 | |||
| 1255 | Ga0207658_10113305 | |||
| 1256 | Ga0207703_10000086 | |||
| 1257 | Ga0207703_10000158 | |||
| 1258 | Ga0207703_10033515 | |||
| 1259 | Ga0207639_10108039 | |||
| 1260 | Ga0207678_10030183 | |||
| 1261 | Ga0207678_10255594 | |||
| 1262 | Ga0207708_10003376 | |||
| 1263 | Ga0207702_10007759 | |||
| 1264 | Ga0207702_10087049 | |||
| 1265 | Ga0207641_10000012 | |||
| 1266 | Ga0207641_10005717 | |||
| 1267 | Ga0207641_10020165 | |||
| 1268 | Ga0207641_10037909 | |||
| 1269 | Ga0207641_10187110 | |||
| 1270 | Ga0207648_10001100 | |||
| 1271 | Ga0207648_10073931 | |||
| 1272 | Ga0207676_10000001 | |||
| 1273 | Ga0207676_10002359 | |||
| 1274 | Ga0207676_10161356 | |||
| 1275 | Ga0207674_10010079 | |||
| 1276 | Ga0207674_10122225 | |||
| 1277 | Ga0207674_10143827 | |||
| 1278 | Ga0207675_100004034 | |||
| 1279 | Ga0207675_100043976 | |||
| 1280 | Ga0207675_100074454 | |||
| 1281 | Ga0207675_100097050 | |||
| 1282 | Ga0207675_100181472 | |||
| 1283 | Ga0207683_10000698 | |||
| 1284 | Ga0207683_10000825 | |||
| 1285 | Ga0207698_10075126 | |||
| 1286 | Ga0209983_1006458 | |||
| 1287 | Ga0209588_1033453 | |||
| 1288 | Ga0209971_1000386 | |||
| 1289 | Ga0207428_10001035 | |||
| 1290 | Ga0207428_10003754 | |||
| 1291 | Ga0207428_10063991 | |||
| 1292 | Ga0207428_10064691 | |||
| 1293 | Ga0268266_10003314 | |||
| 1294 | Ga0268266_10026752 | |||
| 1295 | Ga0268266_10179954 | |||
| 1296 | Ga0268265_10000288 | |||
| 1297 | Ga0268265_10000750 | |||
| 1298 | Ga0268265_10088736 | |||
| 1299 | Ga0268264_10000419 | |||
| 1300 | Ga0268264_10001691 | |||
| 1301 | Ga0268264_10193978 | |||
| 1302 | Ga0265334_10000017 | |||
| 1303 | Ga0265318_10000018 | |||
| 1304 | Ga0307517_10018255 | |||
| 1305 | Ga0307515_10061623 | |||
| 1306 | Ga0307515_10164957 | |||
| 1307 | Ga0265338_10061169 | |||
| 1308 | Ga0265338_10102528 | |||
| 1309 | Ga0307511_10011792 | |||
| 1310 | Ga0265332_10002592 | |||
| 1311 | Ga0265339_10004112 | |||
| 1312 | Ga0265331_10000337 | |||
| 1313 | Ga0265327_10000008 | |||
| 1314 | Ga0265327_10000696 | |||
| 1315 | Ga0265327_10001626 | |||
| 1316 | Ga0265316_10001097 | |||
| 1317 | Ga0307513_10005329 | |||
| 1318 | Ga0307513_10107698 | |||
| 1319 | Ga0307509_10061048 | |||
| 1320 | Ga0265313_10000022 | |||
| 1321 | Ga0307508_10000537 | |||
| 1322 | Ga0307508_10054128 | |||
| 1323 | Ga0307508_10115385 | |||
| 1324 | Ga0316575_10028428 | |||
| 1325 | Ga0316575_10046820 | |||
| 1326 | Ga0316579_10066768 | |||
| 1327 | Ga0265314_10035513 | |||
| 1328 | Ga0265314_10049811 | |||
| 1329 | Ga0265342_10000150 | |||
| 1330 | Ga0265342_10009942 | |||
| 1331 | Ga0316576_10000840 | |||
| 1332 | Ga0316576_10003350 | |||
| 1333 | Ga0316576_10008620 | |||
| 1334 | Ga0316576_10018774 | |||
| 1335 | Ga0316576_10019577 | |||
| 1336 | Ga0316576_10033505 | |||
| 1337 | Ga0316576_10033527 | |||
| 1338 | Ga0316576_10034042 | |||
| 1339 | Ga0316576_10093617 | |||
| 1340 | Ga0316578_10000632 | |||
| 1341 | Ga0316578_10006285 | |||
| 1342 | Ga0316578_10019684 | |||
| 1343 | Ga0316578_10030651 | |||
| 1344 | Ga0316578_10049391 | |||
| 1345 | Ga0316578_10083196 | |||
| 1346 | Ga0316577_10006744 | |||
| 1347 | Ga0316577_10033917 | |||
| 1348 | Ga0316577_10042326 | |||
| 1349 | Ga0316577_10050538 | |||
| 1350 | Ga0316577_10081354 | |||
| 1351 | Ga0307413_10027626 | |||
| 1352 | Ga0307413_10071455 | |||
| 1353 | Ga0307413_10079811 | |||
| 1354 | Ga0307410_10027562 | |||
| 1355 | Ga0307406_10053094 | |||
| 1356 | Ga0307406_10060203 | |||
| 1357 | Ga0307407_10039628 | |||
| 1358 | Ga0307407_10039691 | |||
| 1359 | Ga0307409_100024830 | |||
| 1360 | Ga0307416_100017882 | |||
| 1361 | Ga0307416_100081616 | |||
| 1362 | Ga0307416_100122574 | |||
| 1363 | Ga0307414_10001865 | |||
| 1364 | Ga0307414_10053051 | |||
| 1365 | Ga0307411_10000376 | |||
| 1366 | Ga0307411_10062865 | |||
| 1367 | Ga0307411_10117716 | |||
| 1368 | Ga0307415_100013273 | |||
| 1369 | Ga0307415_100196960 | |||
| 1370 | Ga0316583_10010214 | |||
| 1371 | Ga0316583_10018886 | |||
| 1372 | Ga0316580_10030790 | |||
| 1373 | Ga0373940_0034671 | |||
| 1374 | Ga0373949_0000951 | |||
| 1375 | Ga0373955_0049692 | |||
| 1376 | Ga0373942_0007594 | |||
| 1377 | Ga0316574_0002485 | |||
| 1378 | Ga0316574_0009334 | |||
| 1379 | Ga0316574_0054924 | |||
| 1380 | Ga0373935_0007615 | |||
| 1381 | Ga0373927_0000003 | |||
| 1382 | Ga0373947_0084854 | |||
| 1383 | Ga0373937_0001072 | |||
| 1384 | Ga0373937_0053691 | |||
| 1385 | Ga0373937_0205345 | |||
| 1386 | Ga0316582_0007070 | |||
| 1387 | Ga0316582_0102397 | |||
| 1388 | Ga0316584_0000420 | |||
| 1389 | Ga0316584_0032212 | |||
| 1390 | Ga0316584_0036815 | |||
| 1391 | Ga0316584_0096468 | |||
| 1392 | Ga0316584_0098186 | |||
| 1393 | Ga0316584_0128624 | |||
| 1394 | Ga0373925_0031321 | |||
| 1395 | Ga0373925_0081095 | |||
| 1396 | Ga0395899_0004071 | |||
| 1397 | Ga0395900_0003648 | |||
| 1398 | Ga0395900_0052210 | |||
| 1399 | Ga0395900_0104362 | |||
| 1400 | Ga0395900_0160786 | |||
| 1401 | Ga0395898_0002144 | |||
| 1402 | Ga0395898_0013402 | |||
| 1403 | Ga0395898_0031995 | |||
| 1404 | Ga0395905_0000145 | |||
| 1405 | Ga0395905_0001178 | |||
| 1406 | Ga0395905_0121103 | |||
| 1407 | Ga0395905_0137615 | |||
| 1408 | Ga0316581_0009548 | |||
| 1409 | Ga0436364_0158752 | |||
| 1410 | Ga0436364_0432318 | |||
| 1411 | Ga0395901_0001254 | |||
| 1412 | Ga0395901_0093201 | |||
| 1413 | Ga0395901_0094882 | |||
| 1414 | Ga0395901_0113641 | |||
| 1415 | Ga0395901_0179431 | |||
| 1416 | Ga0400490_46219 | |||
| 1417 | Ga0400485_13208 | |||
| 1418 | Ga0400485_16317 | |||
| 1419 | Ga0400488_17591 | |||
| 1420 | Ga0400486_11253 | |||
| 1421 | Ga0400486_23182 | |||
| 1422 | Ga0400483_001761 | |||
| 1423 | Ga0400483_204516 | |||
| 1424 | Ga0400483_212392 | |||
| 1425 | Ga0400483_280760 | |||
| 1426 | Ga0400487_05423 | |||
| 1427 | Ga0400487_59306 | |||
| 1428 | Ga0436365_0749742 | |||
| 1429 | Ga0436361_0015804 | |||
| 1430 | Ga0436361_0046882 | |||
| 1431 | Ga0436361_0049245 | |||
| 1432 | Ga0436361_0271669 | |||
| 1433 | Ga0436361_0298070 | |||
| 1434 | Ga0436361_0446120 | |||
| 1435 | Ga0436361_0464290 | |||
| 1436 | Ga0436361_0585829 | |||
| 1437 | Ga0436361_0589265 | |||
| 1438 | Ga0436361_0629359 | |||
| 1439 | Ga0436361_0735177 | |||
| 1440 | Ga0436361_0778877 | |||
| 1441 | Ga0436361_0860856 | |||
| 1442 | Ga0436361_0946815 | |||
| 1443 | Ga0436361_1123843 | |||
| 1444 | Ga0436363_1440181 | |||
| 1445 | Ga0436362_0157410 | |||
| 1446 | Ga0439461_0000037 | |||
| 1447 | Ga0439465_0005600 | |||
| 1448 | Ga0439465_0025870 | |||
| 1449 | Ga0439431_0000035 | |||
| 1450 | Ga0439431_0025194 | |||
| 1451 | Ga0439442_004776 | |||
| 1452 | Ga0439445_0002180 | |||
| 1453 | Ga0439432_000347 | |||
| 1454 | Ga0439452_016834 | |||
| 1455 | Ga0439462_0004168 | |||
| 1456 | Ga0439462_0012344 | |||
| 1457 | Ga0439434_0001167 | |||
| 1458 | Ga0451577_0033328 | |||
| 1459 | Ga0451577_0058703 | |||
| 1460 | Ga0453683_0120161 | |||
| 1461 | Ga0466963_0010075 | |||
| 1462 | Ga0453684_0000681 | |||
| 1463 | Ga0453684_0003515 | |||
| 1464 | Ga0453684_0005989 | |||
| 1465 | Ga0453684_0034569 | |||
| 1466 | Ga0466957_0010995 | |||
| 1467 | Ga0466957_0086706 | |||
| 1468 | Ga0451576_0008922 | |||
| 1469 | Ga0451576_0011409 | |||
| 1470 | Ga0451576_0015073 | |||
| 1471 | Ga0451576_0109584 | |||
| 1472 | Ga0451576_0115872 | |||
| 1473 | Ga0466958_0031993 | |||
| 1474 | Ga0466967_0003375 | |||
| 1475 | Ga0495627_000120 | |||
| 1476 | Ga0495603_0003297 | |||
| 1477 | Ga0495590_0001850 | |||
| 1478 | Ga0495629_0057403 | |||
| 1479 | Ga0495638_0000920 | |||
| 1480 | Ga0495650_0000020 | |||
| 1481 | Ga0495580_0108750 | |||
| 1482 | Ga0495580_0131810 | |||
| 1483 | Ga0495582_0021989 | |||
| 1484 | Ga0495585_0037859 | |||
| 1485 | Ga0495594_0089251 | |||
| 1486 | Ga0495583_0000069 | |||
| 1487 | Ga0495610_0007069 | |||
| 1488 | Ga0495610_0007751 | |||
| 1489 | Ga0495620_0015363 | |||
| 1490 | Ga0495630_0212835 | |||
| 1491 | Ga0495632_0049547 | |||
| 1492 | Ga0495643_0010185 | |||
| 1493 | Ga0495648_0027842 | |||
| 1494 | Ga0495597_0008164 | |||
| 1495 | Ga0495622_0005156 | |||
| 1496 | Ga0495633_0065119 | |||
| 1497 | Ga0495668_0000186 | |||
| 1498 | Ga0495668_0025388 | |||
| 1499 | Ga0495625_0158580 | |||
| 1500 | Ga0495669_0000001 | |||
| 1501 | Ga0495669_0016596 | |||
| 1502 | Ga0495669_0042831 | |||
| 1503 | Ga0495624_0035188 | |||
| 1504 | Ga0495670_0000007 | |||
| 1505 | Ga0495672_0004324 | |||
| 1506 | Ga0495672_0015997 | |||
| 1507 | Ga0495672_0033183 | |||
| 1508 | Ga0495672_0053807 | |||
| 1509 | Ga0495676_0000334 | |||
| 1510 | Ga0495673_0000403 | |||
| 1511 | Ga0495686_0000765 | |||
| 1512 | Ga0495686_0001049 | |||
| 1513 | Ga0495686_0010359 | |||
| 1514 | Ga0495686_0043009 | |||
| 1515 | Ga0495593_0037701 | |||
| 1516 | Ga0496102_0011343 | |||
| 1517 | Ga0496102_0048500 | |||
| 1518 | Ga0496103_0005222 | |||
| 1519 | Ga0496106_0004061 | |||
| 1520 | Ga0496106_0065136 | |||
| 1521 | Ga0496106_0145614 | |||
| 1522 | Ga0496107_0015512 | |||
| 1523 | Ga0496110_0138219 | |||
| 1524 | Ga0496112_0053926 | |||
| 1525 | Ga0496112_0079875 | |||
| 1526 | Ga0496112_0164576 | |||
| 1527 | Ga0496115_0002266 | |||
| 1528 | Ga0496116_0033178 | |||
| 1529 | Ga0496117_0032808 | |||
| 1530 | Ga0496118_0030172 | |||
| 1531 | Ga0496118_0075207 | |||
| 1532 | Ga0496119_0024037 | |||
| 1533 | Ga0496121_0000009 | |||
| 1534 | Ga0496121_0000631 | |||
| 1535 | Ga0496122_0023547 | |||
| 1536 | Ga0496123_0006810 | |||
| 1537 | Ga0496125_0001837 | |||
| 1538 | Ga0496125_0037060 | |||
| 1539 | Ga0496125_0070035 | |||
| 1540 | Ga0496126_0148069 | |||
| 1541 | Ga0495678_000738 | |||
| 1542 | Ga0501031_0023554 | |||
| 1543 | Ga0501032_0002952 | |||
| 1544 | Ga0501032_0026073 | |||
| 1545 | Ga0501032_0054951 | |||
| 1546 | Ga0501033_0003092 | |||
| 1547 | Ga0501033_0007825 | |||
| 1548 | Ga0501033_0068432 | |||
| 1549 | Ga0501033_0074238 | |||
| 1550 | Ga0501033_0134506 | |||
| 1551 | Ga0501033_0196739 | |||
| 1552 | Ga0501034_0000013 | |||
| 1553 | Ga0501034_0000280 | |||
| 1554 | Ga0501034_0000415 | |||
| 1555 | Ga0501034_0002434 | |||
| 1556 | Ga0501034_0038952 | |||
| 1557 | Ga0501034_0126795 | |||
| 1558 | Ga0501034_0171074 | |||
| 1559 | Ga0501036_0002006 | |||
| 1560 | Ga0501036_0198380 | |||
| 1561 | Ga0501037_0000487 | |||
| 1562 | Ga0501037_0009708 | |||
| 1563 | Ga0501037_0014451 | |||
| 1564 | Ga0501037_0068411 | |||
| 1565 | Ga0501038_0000308 | |||
| 1566 | Ga0501038_0016356 | |||
| 1567 | Ga0501038_0056902 | |||
| 1568 | Ga0501039_0000249 | |||
| 1569 | Ga0501039_0019968 | |||
| 1570 | Ga0501040_0108460 | |||
| 1571 | Ga0501041_0037142 | |||
| 1572 | Ga0501041_0067686 | |||
| 1573 | Ga0501043_0002326 | |||
| 1574 | Ga0501043_0167113 | |||
| 1575 | Ga0501046_0004392 | |||
| 1576 | Ga0501046_0041049 | |||
| 1577 | Ga0501046_0068682 | |||
| 1578 | Ga0501046_0154565 | |||
| 1579 | Ga0501047_0000469 | |||
| 1580 | Ga0501047_0001112 | |||
| 1581 | Ga0501047_0024082 | |||
| 1582 | Ga0501047_0050924 | |||
| 1583 | Ga0501047_0169676 | |||
| 1584 | Ga0501047_0187158 | |||
| 1585 | Ga0501048_0032975 | |||
| 1586 | Ga0501048_0121820 | |||
| 1587 | Ga0501067_0001487 | |||
| 1588 | Ga0501067_0008213 | |||
| 1589 | Ga0501067_0031419 | |||
| 1590 | Ga0501067_0082488 | |||
| 1591 | Ga0501068_0017699 | |||
| 1592 | Ga0501068_0117881 | |||
| 1593 | Ga0501069_0000411 | |||
| 1594 | Ga0501069_0011302 | |||
| 1595 | Ga0501070_0004769 | |||
| 1596 | Ga0501070_0006021 | |||
| 1597 | Ga0501070_0066390 | |||
| 1598 | Ga0501070_0095433 | |||
| 1599 | Ga0501070_0207224 | |||
| 1600 | Ga0501071_0019726 | |||
| 1601 | Ga0501072_0005781 | |||
| 1602 | Ga0501072_0036829 | |||
| 1603 | Ga0501072_0138994 | |||
| 1604 | Ga0501073_0001711 | |||
| 1605 | Ga0501073_0002016 | |||
| 1606 | Ga0501073_0007841 | |||
| 1607 | Ga0501073_0017023 | |||
| 1608 | Ga0501073_0029602 | |||
| 1609 | Ga0501074_0007384 | |||
| 1610 | Ga0501074_0015001 | |||
| 1611 | Ga0501075_0024615 | |||
| 1612 | Ga0501075_0071806 | |||
| 1613 | Ga0501075_0076710 | |||
| 1614 | Ga0501076_0021969 | |||
| 1615 | Ga0501076_0044295 | |||
| 1616 | Ga0501077_0040685 | |||
| 1617 | Ga0501202_013954 | |||
| 1618 | Ga0501209_031992 | |||
| 1619 | Ga0501079_0045657 | |||
| 1620 | Ga0501079_0046828 | |||
| 1621 | Ga0501079_0060684 | |||
| 1622 | Ga0501080_0000003 | |||
| 1623 | Ga0501080_0000644 | |||
| 1624 | Ga0501080_0001724 | |||
| 1625 | Ga0501080_0010976 | |||
| 1626 | Ga0501080_0026308 | |||
| 1627 | Ga0501080_0109696 | |||
| 1628 | Ga0501080_0300274 | |||
| 1629 | Ga0501081_0015052 | |||
| 1630 | Ga0501081_0024684 | |||
| 1631 | Ga0501083_0021974 | |||
| 1632 | Ga0501083_0030932 | |||
| 1633 | Ga0501035_0000058 | |||
| 1634 | Ga0501035_0072898 | |||
| 1635 | Ga0501035_0087628 | |||
| 1636 | Ga0501035_0179705 | |||
| 1637 | Ga0501044_0000023 | |||
| 1638 | Ga0501044_0001009 | |||
| 1639 | Ga0501044_0004049 | |||
| 1640 | Ga0501044_0005168 | |||
| 1641 | Ga0501044_0033646 | |||
| 1642 | Ga0501044_0055196 | |||
| 1643 | Ga0501044_0086360 | |||
| 1644 | Ga0501044_0286709 | |||
| 1645 | Ga0501045_0034360 | |||
| 1646 | nmdc:mga05p37_102615_c1 | |||
| 1647 | nmdc:mga05p37_14_c1 | |||
| 1648 | nmdc:mga05p37_171826_c1 | |||
| 1649 | nmdc:mga05p37_3462_c1 | |||
| 1650 | nmdc:mga05p37_99101_c1 | |||
| 1651 | nmdc:mga09592_13954_c1 | |||
| 1652 | nmdc:mga09592_21823_c1 | |||
| 1653 | nmdc:mga09592_25243_c1 | |||
| 1654 | nmdc:mga09592_77530_c1 | |||
| 1655 | nmdc:mga0qj67_145886_c1 | |||
| 1656 | nmdc:mga0qj67_226381_c1 | |||
| 1657 | nmdc:mga0qj67_2734_c1 | |||
| 1658 | nmdc:mga0qj67_29305_c1 | |||
| 1659 | nmdc:mga06r32_1042_c1 | |||
| 1660 | nmdc:mga06r32_143618_c1 | |||
| 1661 | nmdc:mga06r32_219628_c1 | |||
| 1662 | nmdc:mga06r32_3549_c1 | |||
| 1663 | nmdc:mga06r32_55420_c1 | |||
| 1664 | nmdc:mga06r32_86749_c1 | |||
| 1665 | nmdc:mga08y16_120640_c1 | |||
| 1666 | nmdc:mga08y16_146126_c1 | |||
| 1667 | nmdc:mga08y16_155884_c1 | |||
| 1668 | nmdc:mga08y16_1630_c3 | |||
| 1669 | nmdc:mga08y16_412_c1 | |||
| 1670 | nmdc:mga08y16_47_c1 | |||
| 1671 | nmdc:mga08y16_5453_c1 | |||
| 1672 | nmdc:mga08y16_61415_c1 | |||
| 1673 | nmdc:mga0n895_107089_c1 | |||
| 1674 | nmdc:mga0n895_166685_c1 | |||
| 1675 | nmdc:mga0rr50_47905_c1 | |||
| 1676 | nmdc:mga0rr50_98_c1 | |||
| 1677 | nmdc:mga0rr50_9938_c1 | |||
| 1678 | nmdc:mga08x19_3_c1 | |||
| 1679 | nmdc:mga08x19_744_c1 | |||
| 1680 | nmdc:mga0a205_226255_c1 | |||
| 1681 | nmdc:mga0sz30_10065_c1 | |||
| 1682 | Ga0500635_0000341 | |||
| 1683 | Ga0495619_0013355 | |||
| 1684 | Ga0500578_0070210 | |||
| 1685 | Ga0500643_007932 | |||
| 1686 | Ga0500643_011262 | |||
| 1687 | Ga0500644_0000417 | |||
| 1688 | Ga0500651_0026285 | |||
| 1689 | Ga0500566_0000395 | |||
| 1690 | Ga0500566_0014059 | |||
| 1691 | Ga0500566_0040118 | |||
| 1692 | Ga0500641_0021637 | |||
| 1693 | Ga0500641_0024141 | |||
| 1694 | Ga0500650_0000012 | |||
| 1695 | Ga0500554_009814 | |||
| 1696 | Ga0500555_002402 | |||
| 1697 | Ga0500555_010087 | |||
| 1698 | Ga0500556_0003170 | |||
| 1699 | Ga0500562_000746 | |||
| 1700 | Ga0500569_003491 | |||
| 1701 | Ga0500594_0000383 | |||
| 1702 | Ga0500594_0001236 | |||
| 1703 | Ga0500595_001105 | |||
| 1704 | Ga0500595_002031 | |||
| 1705 | Ga0500595_002725 | |||
| 1706 | Ga0500608_000062 | |||
| 1707 | Ga0500608_000926 | |||
| 1708 | Ga0500608_001411 | |||
| 1709 | Ga0500614_000989 | |||
| 1710 | Ga0500618_000533 | |||
| 1711 | Ga0500642_0000312 | |||
| 1712 | Ga0500642_0004595 | |||
| 1713 | Ga0500642_0073457 | |||
| 1714 | Ga0500658_0000344 | |||
| 1715 | Ga0500658_0030889 | |||
| 1716 | Ga0500658_0032817 | |||
| 1717 | Ga0500559_0009681 | |||
| 1718 | Ga0500559_0043839 | |||
| 1719 | Ga0500564_000244 | |||
| 1720 | Ga0500564_011844 | |||
| 1721 | Ga0500568_0002926 | |||
| 1722 | Ga0500568_0012589 | |||
| 1723 | Ga0500568_0026297 | |||
| 1724 | Ga0500573_0023904 | |||
| 1725 | Ga0500588_0001206 | |||
| 1726 | Ga0500590_008548 | |||
| 1727 | Ga0500604_0001150 | |||
| 1728 | Ga0500616_0000388 | |||
| 1729 | Ga0500616_0021719 | |||
| 1730 | Ga0500622_0019273 | |||
| 1731 | Ga0500636_0029081 | |||
| 1732 | Ga0500637_0023041 | |||
| 1733 | Ga0500637_0023688 | |||
| 1734 | Ga0500645_010755 | |||
| 1735 | Ga0501084_0000713 | |||
| 1736 | Ga0501084_0044062 | |||
| 1737 | Ga0501084_0116577 | |||
| 1738 | Ga0590077_007197 | |||
| 1739 | Ga0501082_0002642 | |||
| 1740 | Ga0501082_0003016 | |||
| 1741 | Ga0501082_0003390 | |||
| 1742 | Ga0530510_0002688 | |||
| 1743 | 2511124487 | |||
| 1744 | 2514042203 | |||
| 1745 | 2524001672 | |||
| 1746 | 2587915929 | |||
| 1747 | 2600226469 | |||
| 1748 | 2643883655 | |||
| 1749 | 2644126847 | |||
| 1750 | 2644224211 | |||
| 1751 | 2644234853 | |||
| 1752 | 2644351822 | |||
| 1753 | 2644551658 | |||
| 1754 | 2644551811 | |||
| 1755 | 2792458898 | |||
| 1756 | 2821445350 | |||
| 1757 | 2843749054 | |||
| 1758 | 2844540174 | |||
| 1759 | 2849564378 | |||
| 1760 | 2849573951 | |||
| 1761 | 2851155507 | |||
| 1762 | 2857509426 | |||
| 1763 | 2887631039 | |||
| 1764 | 2895884798 | |||
| 1765 | 2898330895 | |||
| 1766 | 2909045898 | |||
| 1767 | 2928532461 | |||
| 1768 | 2928974788 | |||
| 1769 | 2941488568 | |||
| 1770 | 2977242168 | |||
| 1771 | 644747069 | |||
| 1772 | 8054565065 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6he3-assembly1.cif.gz_B | pseudomonas aeruginosa seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)cytidine | 0.9884 | 1 | 426 |
| 6hdz-assembly1.cif.gz_B | pseudomonas aeruginosa seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)uridine | 0.9864 | 1 | 426 |
| 6he3-assembly1.cif.gz_B | pseudomonas aeruginosa seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)cytidine | 0.9832 | 1 | 426 |
| 1skv-assembly1.cif.gz_B | crystal structure of d-63 from sulfolobus spindle virus 1 | 0.9821 | 37 | 95 |
| 6hdz-assembly1.cif.gz_B | pseudomonas aeruginosa seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)uridine | 0.9812 | 1 | 426 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dq3B02 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9874 | 105 | 427 | 3.30.930.10 |
| 2dq3B02 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9781 | 105 | 427 | 3.30.930.10 |
| af_O94387_1197_1582_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9707 | 34 | 98 | 3.40.50.300 |
| af_P9WFT7_105_418_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9677 | 106 | 427 | 3.30.930.10 |
| af_K7MCG3_207_510_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.9613 | 27 | 100 | 1.20.1270.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656H7G4-F1-model_v4 | deleted | 1.001 | 314 | 426 |
|
| AF-A0A656H516-F1-model_v4 | deleted | 0.9999 | 328 | 426 |
|
| AF-A0A257NUA9-F1-model_v4 | serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) | 0.9948 | 290 | 427 |
GO:0004828
GO:0005524 GO:0005737 GO:0006434 |
| AF-A0A353Y9I4-F1-model_v4 | serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) | 0.9936 | 283 | 423 |
GO:0004828
GO:0005524 GO:0005737 GO:0006434 |
| AF-A0A2S5LPB4-F1-model_v4 | Serine--tRNA ligase (EC 6.1.1.11) | 0.9921 | 184 | 428 |
GO:0004828
GO:0005524 GO:0005737 GO:0006434 |