F484699
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 886 | 447 | 1772 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0051213|Ga0451577_0051213_456_1244 |
| Length | 262 |
| Sequence | MSDEVQSILQLNNVEAAYGAVKAIRGVSLAVPTGSIVTVLGSNGAGKTTILKTISGILDPQKGSIVFRHDKLEGRDPAWIVRQGLVHVPEGREIFPLLTVRENLLMGAYTRPASQREQVAKDIEDVFAYFPILKERRDQQAGLLSGGQQQMLAISRALLANPTMMLLDEPSLGLSPKLTREIFEIIVRINRERGVTLLVVEQNAHIALQYADYGYVLEIGRIVMHDTCAALREKDDIKEFYLGVKEAGVREGRRWKKKKQWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 95 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 216 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 217 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 224 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 225 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 226 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 231 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 233 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 236 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 237 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 238 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 239 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 240 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 242 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 246 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 248 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 253 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 254 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 260 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 265 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 266 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 267 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 268 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 269 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 270 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 271 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 272 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 273 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 274 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 275 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 276 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 277 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 278 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 279 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 280 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 281 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 282 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 283 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 284 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 285 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 286 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 287 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 290 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 293 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 294 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 332 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 333 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 337 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 338 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 341 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 342 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 356 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 357 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 358 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 363 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 364 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 371 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 381 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 384 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 385 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 386 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 387 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 388 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 390 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 392 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 393 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 396 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 397 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 398 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 399 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 400 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 401 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 402 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 403 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 404 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 405 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 406 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 407 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 408 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 409 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 410 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 411 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 412 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 413 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 414 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 415 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 416 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 417 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 418 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 419 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 420 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 421 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 422 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 423 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 424 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 425 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 426 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 427 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 428 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 429 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 430 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 431 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 432 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 433 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 434 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 435 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 436 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 437 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 438 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 439 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 440 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 441 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 442 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 443 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 444 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 445 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 446 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 447 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.79 |
| Metatranscriptomes | 0.23 |
| Isolates | 5.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.69 |
| Nodule | 0.56 |
| Rhizoplane | 2.37 |
| Rhizosphere | 66.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451577_0051213 | 3300042876 | Bacteria | 3686 |
| 2 | JGI24739J22299_10010254 | 3300001989 | Bacteria | 3479 |
| 3 | JGI25150J39212_1012314 | 3300002774 | Bacteria | 1518 |
| 4 | JGI25159J45721_1000390 | 3300002987 | Bacteria | 20396 |
| 5 | JGI25159J45721_1010269 | 3300002987 | Bacteria | 2399 |
| 6 | JGI25159J45721_1012861 | 3300002987 | Bacteria | 1970 |
| 7 | JGI25151J46595_10001225 | 3300003187 | Bacteria | 18346 |
| 8 | JGI25151J46595_10006750 | 3300003187 | Bacteria | 5715 |
| 9 | JGI25151J46595_10037321 | 3300003187 | Bacteria | 1823 |
| 10 | JGI25151J46595_10060861 | 3300003187 | Bacteria | 1205 |
| 11 | JGI25160J50197_1000587 | 3300003354 | Bacteria | 20382 |
| 12 | JGI25160J50197_1014447 | 3300003354 | Bacteria | 2642 |
| 13 | JGI25161J50226_1000046 | 3300003374 | Bacteria | 116165 |
| 14 | JGI25161J50226_1005707 | 3300003374 | Bacteria | 2365 |
| 15 | Ga0055532_1007099 | 3300003758 | Bacteria | 1460 |
| 16 | Ga0055535_1000168 | 3300003761 | Bacteria | 70666 |
| 17 | Ga0055542_1000214 | 3300003762 | Bacteria | 70682 |
| 18 | Ga0055526_1001336 | 3300003771 | Bacteria | 17664 |
| 19 | Ga0055537_1000333 | 3300003773 | Bacteria | 32239 |
| 20 | Ga0055537_1003849 | 3300003773 | Bacteria | 4486 |
| 21 | Ga0055536_1004071 | 3300003781 | Bacteria | 7608 |
| 22 | Ga0055536_1006559 | 3300003781 | Bacteria | 5398 |
| 23 | Ga0055536_1011290 | 3300003781 | Bacteria | 3442 |
| 24 | Ga0055536_1043816 | 3300003781 | Bacteria | 1037 |
| 25 | Ga0055536_1057284 | 3300003781 | Bacteria | 823 |
| 26 | Ga0055534_1000265 | 3300003784 | Bacteria | 36441 |
| 27 | Ga0055534_1002007 | 3300003784 | Bacteria | 7407 |
| 28 | Ga0055528_1000471 | 3300003790 | Bacteria | 32238 |
| 29 | Ga0055530_10001300 | 3300003791 | Bacteria | 18811 |
| 30 | Ga0055530_10007015 | 3300003791 | Bacteria | 4852 |
| 31 | Ga0055540_1002601 | 3300003792 | Bacteria | 9395 |
| 32 | Ga0055540_1003978 | 3300003792 | Bacteria | 6882 |
| 33 | Ga0055540_1006814 | 3300003792 | Bacteria | 4454 |
| 34 | Ga0055540_1013260 | 3300003792 | Bacteria | 2531 |
| 35 | Ga0055531_10000572 | 3300003794 | Bacteria | 32155 |
| 36 | Ga0055531_10015360 | 3300003794 | Bacteria | 3380 |
| 37 | Ga0055531_10021056 | 3300003794 | Bacteria | 2547 |
| 38 | Ga0055543_1000270 | 3300004625 | Bacteria | 38712 |
| 39 | Ga0055543_1011478 | 3300004625 | Bacteria | 1811 |
| 40 | Ga0065165_1004394 | 3300005262 | Bacteria | 8786 |
| 41 | Ga0065165_1008423 | 3300005262 | Bacteria | 4828 |
| 42 | Ga0065165_1012613 | 3300005262 | Bacteria | 3426 |
| 43 | Ga0065714_10009479 | 3300005288 | Bacteria | 2571 |
| 44 | Ga0065714_10018383 | 3300005288 | Bacteria | 1653 |
| 45 | Ga0065715_10212643 | 3300005293 | Bacteria | 1307 |
| 46 | Ga0070658_10018845 | 3300005327 | Bacteria | 5529 |
| 47 | Ga0070676_10005193 | 3300005328 | Bacteria | 6916 |
| 48 | Ga0070683_100033594 | 3300005329 | Bacteria | 4679 |
| 49 | Ga0070683_100042013 | 3300005329 | Bacteria | 4209 |
| 50 | Ga0070683_100179259 | 3300005329 | Bacteria | 2011 |
| 51 | Ga0070690_100159010 | 3300005330 | Bacteria | 1547 |
| 52 | Ga0070670_100002652 | 3300005331 | Bacteria | 14794 |
| 53 | Ga0070670_100174947 | 3300005331 | Bacteria | 1863 |
| 54 | Ga0070670_100196264 | 3300005331 | Bacteria | 1753 |
| 55 | Ga0070670_100337005 | 3300005331 | Bacteria | 1323 |
| 56 | Ga0070670_100349021 | 3300005331 | Bacteria | 1300 |
| 57 | Ga0070670_100405685 | 3300005331 | Bacteria | 1204 |
| 58 | Ga0070677_10141003 | 3300005333 | Bacteria | 1112 |
| 59 | Ga0070677_10148111 | 3300005333 | Bacteria | 1089 |
| 60 | Ga0070677_10252158 | 3300005333 | Bacteria | 876 |
| 61 | Ga0068869_100267115 | 3300005334 | Bacteria | 1371 |
| 62 | Ga0068869_100368423 | 3300005334 | Bacteria | 1175 |
| 63 | Ga0070666_10041789 | 3300005335 | Bacteria | 3065 |
| 64 | Ga0070680_100003929 | 3300005336 | Bacteria | 11112 |
| 65 | Ga0070682_100009730 | 3300005337 | Bacteria | 5444 |
| 66 | Ga0068868_100012831 | 3300005338 | Bacteria | 6130 |
| 67 | Ga0068868_100024677 | 3300005338 | Bacteria | 4564 |
| 68 | Ga0068868_100102210 | 3300005338 | Bacteria | 2320 |
| 69 | Ga0070660_100021211 | 3300005339 | Bacteria | 4787 |
| 70 | Ga0070689_100099158 | 3300005340 | Bacteria | 2305 |
| 71 | Ga0070689_100329583 | 3300005340 | Bacteria | 1277 |
| 72 | Ga0070661_100055057 | 3300005344 | Bacteria | 2913 |
| 73 | Ga0070661_100113482 | 3300005344 | Bacteria | 2025 |
| 74 | Ga0070668_100034263 | 3300005347 | Bacteria | 3869 |
| 75 | Ga0070669_100095509 | 3300005353 | Bacteria | 2235 |
| 76 | Ga0070675_100000243 | 3300005354 | Bacteria | 35354 |
| 77 | Ga0070675_100049676 | 3300005354 | Bacteria | 3443 |
| 78 | Ga0070675_100074036 | 3300005354 | Bacteria | 2828 |
| 79 | Ga0070675_100118973 | 3300005354 | Bacteria | 2243 |
| 80 | Ga0070675_100325853 | 3300005354 | Bacteria | 1357 |
| 81 | Ga0070671_100006003 | 3300005355 | Bacteria | 9679 |
| 82 | Ga0070671_100118534 | 3300005355 | Bacteria | 2226 |
| 83 | Ga0070674_100079750 | 3300005356 | Bacteria | 2336 |
| 84 | Ga0070673_100488441 | 3300005364 | Bacteria | 1112 |
| 85 | Ga0070688_100075652 | 3300005365 | Bacteria | 2165 |
| 86 | Ga0070688_100091088 | 3300005365 | Bacteria | 1992 |
| 87 | Ga0070667_100004597 | 3300005367 | Bacteria | 11595 |
| 88 | Ga0070667_100010689 | 3300005367 | Bacteria | 7584 |
| 89 | Ga0070667_100087475 | 3300005367 | Bacteria | 2674 |
| 90 | Ga0070667_100256133 | 3300005367 | Bacteria | 1566 |
| 91 | Ga0070667_100544065 | 3300005367 | Bacteria | 1067 |
| 92 | Ga0070713_100040282 | 3300005436 | Bacteria | 3797 |
| 93 | Ga0070713_100395031 | 3300005436 | Bacteria | 1290 |
| 94 | Ga0070694_100467155 | 3300005444 | Bacteria | 999 |
| 95 | Ga0070708_100157330 | 3300005445 | Bacteria | 2116 |
| 96 | Ga0070678_100003356 | 3300005456 | Bacteria | 8919 |
| 97 | Ga0070678_100027877 | 3300005456 | Bacteria | 3842 |
| 98 | Ga0070678_100375644 | 3300005456 | Bacteria | 1229 |
| 99 | Ga0070662_100061150 | 3300005457 | Bacteria | 2749 |
| 100 | Ga0070662_100431390 | 3300005457 | Bacteria | 1092 |
| 101 | Ga0070662_100432137 | 3300005457 | Bacteria | 1091 |
| 102 | Ga0070681_10017373 | 3300005458 | Bacteria | 7189 |
| 103 | Ga0070681_10585894 | 3300005458 | Bacteria | 1029 |
| 104 | Ga0068867_100000070 | 3300005459 | Bacteria | 61892 |
| 105 | Ga0068867_100001303 | 3300005459 | Bacteria | 17238 |
| 106 | Ga0068867_100069326 | 3300005459 | Bacteria | 2633 |
| 107 | Ga0068867_100142732 | 3300005459 | Bacteria | 1873 |
| 108 | Ga0070685_10144850 | 3300005466 | Bacteria | 1500 |
| 109 | Ga0070685_10185263 | 3300005466 | Bacteria | 1343 |
| 110 | Ga0070706_100052079 | 3300005467 | Bacteria | 3779 |
| 111 | Ga0070706_100093757 | 3300005467 | Bacteria | 2786 |
| 112 | Ga0070707_100453004 | 3300005468 | Bacteria | 1244 |
| 113 | Ga0070698_100041385 | 3300005471 | Bacteria | 4729 |
| 114 | Ga0070698_100079874 | 3300005471 | Bacteria | 3267 |
| 115 | Ga0070698_100106590 | 3300005471 | Bacteria | 2771 |
| 116 | Ga0070698_100227194 | 3300005471 | Bacteria | 1800 |
| 117 | Ga0070679_100183922 | 3300005530 | Bacteria | 2061 |
| 118 | Ga0070684_100015745 | 3300005535 | Bacteria | 6171 |
| 119 | Ga0068853_100118500 | 3300005539 | Bacteria | 2359 |
| 120 | Ga0068853_100336849 | 3300005539 | Bacteria | 1401 |
| 121 | Ga0068853_100354295 | 3300005539 | Bacteria | 1366 |
| 122 | Ga0070672_100002056 | 3300005543 | Bacteria | 12677 |
| 123 | Ga0070672_100013934 | 3300005543 | Bacteria | 5688 |
| 124 | Ga0070672_100073770 | 3300005543 | Bacteria | 2720 |
| 125 | Ga0070672_100393632 | 3300005543 | Bacteria | 1187 |
| 126 | Ga0070686_100166977 | 3300005544 | Bacteria | 1554 |
| 127 | Ga0070665_100040676 | 3300005548 | Bacteria | 4672 |
| 128 | Ga0070665_100365877 | 3300005548 | Bacteria | 1448 |
| 129 | Ga0070665_100376080 | 3300005548 | Bacteria | 1427 |
| 130 | Ga0070664_100085331 | 3300005564 | Bacteria | 2727 |
| 131 | Ga0070664_100187735 | 3300005564 | Bacteria | 1840 |
| 132 | Ga0070664_100210478 | 3300005564 | Bacteria | 1737 |
| 133 | Ga0070664_100229438 | 3300005564 | Bacteria | 1664 |
| 134 | Ga0070664_100472252 | 3300005564 | Bacteria | 1153 |
| 135 | Ga0068857_100064216 | 3300005577 | Bacteria | 3264 |
| 136 | Ga0068856_100024423 | 3300005614 | Bacteria | 5884 |
| 137 | Ga0068856_100255077 | 3300005614 | Bacteria | 1769 |
| 138 | Ga0070702_100319298 | 3300005615 | Bacteria | 1082 |
| 139 | Ga0068852_100094926 | 3300005616 | Bacteria | 2677 |
| 140 | Ga0068852_100100747 | 3300005616 | Bacteria | 2607 |
| 141 | Ga0068852_100524008 | 3300005616 | Bacteria | 1183 |
| 142 | Ga0068859_100000664 | 3300005617 | Bacteria | 34524 |
| 143 | Ga0068859_100030244 | 3300005617 | Bacteria | 5434 |
| 144 | Ga0068859_100136827 | 3300005617 | Bacteria | 2523 |
| 145 | Ga0068864_100000649 | 3300005618 | Bacteria | 29069 |
| 146 | Ga0068864_100012522 | 3300005618 | Bacteria | 7015 |
| 147 | Ga0068861_100204172 | 3300005719 | Bacteria | 1661 |
| 148 | Ga0068863_100029931 | 3300005841 | Bacteria | 5201 |
| 149 | Ga0068863_100098457 | 3300005841 | Bacteria | 2777 |
| 150 | Ga0068863_100235284 | 3300005841 | Bacteria | 1767 |
| 151 | Ga0068863_100619755 | 3300005841 | Bacteria | 1072 |
| 152 | Ga0068858_100000753 | 3300005842 | Bacteria | 33946 |
| 153 | Ga0068858_100088379 | 3300005842 | Bacteria | 2883 |
| 154 | Ga0068860_100002764 | 3300005843 | Bacteria | 18265 |
| 155 | Ga0068862_100120065 | 3300005844 | Bacteria | 2316 |
| 156 | Ga0068862_100290676 | 3300005844 | Bacteria | 1501 |
| 157 | Ga0070717_10323965 | 3300006028 | Bacteria | 1373 |
| 158 | Ga0075365_10012259 | 3300006038 | Bacteria | 5082 |
| 159 | Ga0075365_10079420 | 3300006038 | Bacteria | 2220 |
| 160 | Ga0075365_10096667 | 3300006038 | Bacteria | 2018 |
| 161 | Ga0075365_10120190 | 3300006038 | Bacteria | 1812 |
| 162 | Ga0075365_10185954 | 3300006038 | Bacteria | 1453 |
| 163 | Ga0075363_100197864 | 3300006048 | Bacteria | 1148 |
| 164 | Ga0075364_10005816 | 3300006051 | Bacteria | 7198 |
| 165 | Ga0075364_10010345 | 3300006051 | Bacteria | 5632 |
| 166 | Ga0075364_10125768 | 3300006051 | Bacteria | 1718 |
| 167 | Ga0075432_10017095 | 3300006058 | Bacteria | 2475 |
| 168 | Ga0075432_10020342 | 3300006058 | Bacteria | 2270 |
| 169 | Ga0070716_100287477 | 3300006173 | Bacteria | 1138 |
| 170 | Ga0070712_100170383 | 3300006175 | Bacteria | 1689 |
| 171 | Ga0075362_10007426 | 3300006177 | Bacteria | 4151 |
| 172 | Ga0075362_10027898 | 3300006177 | Bacteria | 2420 |
| 173 | Ga0075362_10035193 | 3300006177 | Bacteria | 2185 |
| 174 | Ga0075362_10036824 | 3300006177 | Bacteria | 2142 |
| 175 | Ga0075362_10086376 | 3300006177 | Bacteria | 1452 |
| 176 | Ga0075362_10095301 | 3300006177 | Bacteria | 1385 |
| 177 | Ga0075362_10161603 | 3300006177 | Bacteria | 1079 |
| 178 | Ga0075367_10043210 | 3300006178 | Bacteria | 2639 |
| 179 | Ga0075367_10058404 | 3300006178 | Bacteria | 2295 |
| 180 | Ga0075367_10092164 | 3300006178 | Bacteria | 1844 |
| 181 | Ga0075367_10114642 | 3300006178 | Bacteria | 1657 |
| 182 | Ga0075367_10120299 | 3300006178 | Bacteria | 1618 |
| 183 | Ga0075369_10114381 | 3300006186 | Bacteria | 1218 |
| 184 | Ga0075366_10002264 | 3300006195 | Bacteria | 9825 |
| 185 | Ga0075366_10004609 | 3300006195 | Bacteria | 7406 |
| 186 | Ga0075366_10007302 | 3300006195 | Bacteria | 6096 |
| 187 | Ga0075366_10023123 | 3300006195 | Bacteria | 3620 |
| 188 | Ga0075366_10048512 | 3300006195 | Bacteria | 2518 |
| 189 | Ga0075366_10085314 | 3300006195 | Bacteria | 1889 |
| 190 | Ga0097621_100018401 | 3300006237 | Bacteria | 5335 |
| 191 | Ga0097621_100030835 | 3300006237 | Bacteria | 4248 |
| 192 | Ga0097621_100292723 | 3300006237 | Bacteria | 1436 |
| 193 | Ga0097621_100299508 | 3300006237 | Bacteria | 1420 |
| 194 | Ga0075370_10000228 | 3300006353 | Bacteria | 20029 |
| 195 | Ga0075370_10001803 | 3300006353 | Bacteria | 9581 |
| 196 | Ga0075370_10003908 | 3300006353 | Bacteria | 7151 |
| 197 | Ga0075370_10008651 | 3300006353 | Bacteria | 5247 |
| 198 | Ga0075370_10024701 | 3300006353 | Bacteria | 3321 |
| 199 | Ga0075370_10025174 | 3300006353 | Bacteria | 3289 |
| 200 | Ga0068871_100220351 | 3300006358 | Bacteria | 1644 |
| 201 | Ga0075428_100002520 | 3300006844 | Bacteria | 19906 |
| 202 | Ga0075430_100022035 | 3300006846 | Bacteria | 5415 |
| 203 | Ga0075430_100023654 | 3300006846 | Bacteria | 5232 |
| 204 | Ga0075430_100066535 | 3300006846 | Bacteria | 3026 |
| 205 | Ga0075430_100088625 | 3300006846 | Bacteria | 2589 |
| 206 | Ga0075430_100133493 | 3300006846 | Bacteria | 2069 |
| 207 | Ga0075431_100006591 | 3300006847 | Bacteria | 11533 |
| 208 | Ga0075431_100014970 | 3300006847 | Bacteria | 7851 |
| 209 | Ga0075431_100023387 | 3300006847 | Bacteria | 6322 |
| 210 | Ga0075431_100155537 | 3300006847 | Bacteria | 2352 |
| 211 | Ga0075429_100000655 | 3300006880 | Bacteria | 26788 |
| 212 | Ga0075429_100035877 | 3300006880 | Bacteria | 4312 |
| 213 | Ga0075429_100106064 | 3300006880 | Bacteria | 2455 |
| 214 | Ga0075429_100191372 | 3300006880 | Bacteria | 1792 |
| 215 | Ga0097620_100000664 | 3300006931 | Bacteria | 34524 |
| 216 | Ga0097620_100030244 | 3300006931 | Bacteria | 5434 |
| 217 | Ga0097620_100136824 | 3300006931 | Bacteria | 2523 |
| 218 | Ga0079104_1027794 | 3300006946 | Bacteria | 1445 |
| 219 | Ga0099826_10005686 | 3300006948 | Bacteria | 8978 |
| 220 | Ga0105244_10007097 | 3300009036 | Bacteria | 7162 |
| 221 | Ga0105244_10019619 | 3300009036 | Bacteria | 3770 |
| 222 | Ga0105240_10031052 | 3300009093 | Bacteria | 6933 |
| 223 | Ga0105240_10297992 | 3300009093 | Bacteria | 1845 |
| 224 | Ga0105240_10447420 | 3300009093 | Bacteria | 1446 |
| 225 | Ga0105240_10879982 | 3300009093 | Bacteria | 965 |
| 226 | Ga0111539_10003696 | 3300009094 | Bacteria | 20130 |
| 227 | Ga0105245_10061457 | 3300009098 | Bacteria | 3387 |
| 228 | Ga0105245_10431885 | 3300009098 | Bacteria | 1322 |
| 229 | Ga0105245_10663695 | 3300009098 | Bacteria | 1074 |
| 230 | Ga0105245_10685939 | 3300009098 | Bacteria | 1057 |
| 231 | Ga0105245_10703366 | 3300009098 | Bacteria | 1044 |
| 232 | Ga0105247_10051958 | 3300009101 | Bacteria | 2525 |
| 233 | Ga0114129_10002274 | 3300009147 | Bacteria | 26581 |
| 234 | Ga0114129_10094036 | 3300009147 | Bacteria | 4152 |
| 235 | Ga0114129_10586999 | 3300009147 | Bacteria | 1445 |
| 236 | Ga0105243_10001208 | 3300009148 | Bacteria | 23242 |
| 237 | Ga0105243_10007703 | 3300009148 | Bacteria | 8278 |
| 238 | Ga0105243_10013939 | 3300009148 | Bacteria | 6082 |
| 239 | Ga0105243_10026405 | 3300009148 | Bacteria | 4444 |
| 240 | Ga0105243_10041812 | 3300009148 | Bacteria | 3585 |
| 241 | Ga0105243_10698990 | 3300009148 | Bacteria | 988 |
| 242 | Ga0105241_10148805 | 3300009174 | Bacteria | 1913 |
| 243 | Ga0105241_10157151 | 3300009174 | Bacteria | 1866 |
| 244 | Ga0105241_10532658 | 3300009174 | Bacteria | 1052 |
| 245 | Ga0105248_10011097 | 3300009177 | Bacteria | 9940 |
| 246 | Ga0105248_10069550 | 3300009177 | Bacteria | 3952 |
| 247 | Ga0105248_10378799 | 3300009177 | Bacteria | 1593 |
| 248 | Ga0105248_10618214 | 3300009177 | Bacteria | 1222 |
| 249 | Ga0105248_10630500 | 3300009177 | Bacteria | 1209 |
| 250 | Ga0105237_10212465 | 3300009545 | Bacteria | 1934 |
| 251 | Ga0105237_10679567 | 3300009545 | Bacteria | 1036 |
| 252 | Ga0105238_10078324 | 3300009551 | Bacteria | 3296 |
| 253 | Ga0105238_10606787 | 3300009551 | Bacteria | 1103 |
| 254 | Ga0105249_10439956 | 3300009553 | Bacteria | 1341 |
| 255 | Ga0105239_10064107 | 3300010375 | Bacteria | 4034 |
| 256 | Ga0105239_10331024 | 3300010375 | Bacteria | 1718 |
| 257 | Ga0105239_10532982 | 3300010375 | Bacteria | 1336 |
| 258 | Ga0105239_10572321 | 3300010375 | Bacteria | 1287 |
| 259 | Ga0105239_10738217 | 3300010375 | Bacteria | 1127 |
| 260 | Ga0105246_10013882 | 3300011119 | Bacteria | 5056 |
| 261 | Ga0105246_10132797 | 3300011119 | Bacteria | 1862 |
| 262 | Ga0105246_10296835 | 3300011119 | Bacteria | 1303 |
| 263 | Ga0105246_10493005 | 3300011119 | Bacteria | 1039 |
| 264 | Ga0157347_1000563 | 3300012502 | Bacteria | 2492 |
| 265 | Ga0157373_10084081 | 3300013100 | Bacteria | 2243 |
| 266 | Ga0157373_10109007 | 3300013100 | Bacteria | 1947 |
| 267 | Ga0157373_10261534 | 3300013100 | Bacteria | 1225 |
| 268 | Ga0157371_10027537 | 3300013102 | Bacteria | 4122 |
| 269 | Ga0157370_10082149 | 3300013104 | Bacteria | 3031 |
| 270 | Ga0157370_10297837 | 3300013104 | Bacteria | 1489 |
| 271 | Ga0157370_10309710 | 3300013104 | Bacteria | 1457 |
| 272 | Ga0157369_10580726 | 3300013105 | Bacteria | 1157 |
| 273 | Ga0157374_10084414 | 3300013296 | Bacteria | 3018 |
| 274 | Ga0157374_10449028 | 3300013296 | Bacteria | 1291 |
| 275 | Ga0157378_10071357 | 3300013297 | Bacteria | 3119 |
| 276 | Ga0157378_10137756 | 3300013297 | Bacteria | 2264 |
| 277 | Ga0157378_10237392 | 3300013297 | Bacteria | 1740 |
| 278 | Ga0157372_10144063 | 3300013307 | Bacteria | 2748 |
| 279 | Ga0157375_10053283 | 3300013308 | Bacteria | 3980 |
| 280 | Ga0157375_10313441 | 3300013308 | Bacteria | 1733 |
| 281 | Ga0163163_10003252 | 3300014325 | Bacteria | 13780 |
| 282 | Ga0157380_10022495 | 3300014326 | Bacteria | 4748 |
| 283 | Ga0182008_10003688 | 3300014497 | Bacteria | 9140 |
| 284 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 285 | Ga0157377_10062758 | 3300014745 | Bacteria | 2126 |
| 286 | Ga0157379_10000301 | 3300014968 | Bacteria | 39095 |
| 287 | Ga0157379_10010265 | 3300014968 | Bacteria | 8155 |
| 288 | Ga0157379_10268739 | 3300014968 | Bacteria | 1550 |
| 289 | Ga0157376_10034048 | 3300014969 | Bacteria | 4109 |
| 290 | Ga0157376_10108770 | 3300014969 | Bacteria | 2436 |
| 291 | Ga0182006_1005503 | 3300015261 | Bacteria | 6027 |
| 292 | Ga0182007_10004544 | 3300015262 | Bacteria | 6271 |
| 293 | Ga0183362_10015 | 3300015683 | Bacteria | 36270 |
| 294 | Ga0163161_10000669 | 3300017792 | Bacteria | 27400 |
| 295 | Ga0163161_10026203 | 3300017792 | Bacteria | 4130 |
| 296 | Ga0163161_10081773 | 3300017792 | Bacteria | 2379 |
| 297 | Ga0206353_10306862 | 3300020082 | Bacteria | 4273 |
| 298 | Ga0206353_10394074 | 3300020082 | Bacteria | 5866 |
| 299 | Ga0209436_106237 | 3300025208 | Bacteria | 2636 |
| 300 | Ga0209436_107795 | 3300025208 | Bacteria | 2197 |
| 301 | Ga0209672_101344 | 3300025228 | Bacteria | 9266 |
| 302 | Ga0209147_100697 | 3300025229 | Bacteria | 17206 |
| 303 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 304 | Ga0207425_1000696 | 3300025245 | Bacteria | 18207 |
| 305 | Ga0207425_1000776 | 3300025245 | Bacteria | 16415 |
| 306 | Ga0209148_1000183 | 3300025254 | Bacteria | 122620 |
| 307 | Ga0209129_1000049 | 3300025258 | Bacteria | 268086 |
| 308 | Ga0209129_1005391 | 3300025258 | Bacteria | 4552 |
| 309 | Ga0209129_1014409 | 3300025258 | Bacteria | 1685 |
| 310 | Ga0209565_1000357 | 3300025263 | Bacteria | 39887 |
| 311 | Ga0209565_1000550 | 3300025263 | Bacteria | 26086 |
| 312 | Ga0209565_1000670 | 3300025263 | Bacteria | 21669 |
| 313 | Ga0209565_1001468 | 3300025263 | Bacteria | 10337 |
| 314 | Ga0209565_1001490 | 3300025263 | Bacteria | 10226 |
| 315 | Ga0209673_1000849 | 3300025273 | Bacteria | 39887 |
| 316 | Ga0209673_1004621 | 3300025273 | Bacteria | 7291 |
| 317 | Ga0209673_1008553 | 3300025273 | Bacteria | 4544 |
| 318 | Ga0209130_1000064 | 3300025284 | Bacteria | 196568 |
| 319 | Ga0209130_1002259 | 3300025284 | Bacteria | 9950 |
| 320 | Ga0209130_1011129 | 3300025284 | Bacteria | 2425 |
| 321 | Ga0209130_1014792 | 3300025284 | Bacteria | 1946 |
| 322 | Ga0209675_1000352 | 3300025291 | Bacteria | 39879 |
| 323 | Ga0209675_1006237 | 3300025291 | Bacteria | 4823 |
| 324 | Ga0209675_1008030 | 3300025291 | Bacteria | 3943 |
| 325 | Ga0209675_1008455 | 3300025291 | Bacteria | 3778 |
| 326 | Ga0209675_1012241 | 3300025291 | Bacteria | 2777 |
| 327 | Ga0209675_1013501 | 3300025291 | Bacteria | 2548 |
| 328 | Ga0209676_1000137 | 3300025292 | Bacteria | 179437 |
| 329 | Ga0209676_1000385 | 3300025292 | Bacteria | 81044 |
| 330 | Ga0209676_1000873 | 3300025292 | Bacteria | 38608 |
| 331 | Ga0209676_1008682 | 3300025292 | Bacteria | 4491 |
| 332 | Ga0209676_1014082 | 3300025292 | Bacteria | 3030 |
| 333 | Ga0209676_1026183 | 3300025292 | Bacteria | 1857 |
| 334 | Ga0209676_1037926 | 3300025292 | Bacteria | 1384 |
| 335 | Ga0209676_1049210 | 3300025292 | Bacteria | 1120 |
| 336 | Ga0209025_1000290 | 3300025294 | Bacteria | 113067 |
| 337 | Ga0209025_1000313 | 3300025294 | Bacteria | 107850 |
| 338 | Ga0209025_1004032 | 3300025294 | Bacteria | 13154 |
| 339 | Ga0209025_1005627 | 3300025294 | Bacteria | 10115 |
| 340 | Ga0209025_1014190 | 3300025294 | Bacteria | 4930 |
| 341 | Ga0209025_1017484 | 3300025294 | Bacteria | 4134 |
| 342 | Ga0209025_1026212 | 3300025294 | Bacteria | 2934 |
| 343 | Ga0209025_1041743 | 3300025294 | Bacteria | 1959 |
| 344 | Ga0209025_1044488 | 3300025294 | Bacteria | 1855 |
| 345 | Ga0209025_1101095 | 3300025294 | Bacteria | 912 |
| 346 | Ga0209564_1001545 | 3300025295 | Bacteria | 22749 |
| 347 | Ga0209564_1005054 | 3300025295 | Bacteria | 7708 |
| 348 | Ga0209564_1009323 | 3300025295 | Bacteria | 4691 |
| 349 | Ga0209564_1017154 | 3300025295 | Bacteria | 2839 |
| 350 | Ga0209758_1000135 | 3300025297 | Bacteria | 177753 |
| 351 | Ga0209758_1021212 | 3300025297 | Bacteria | 3038 |
| 352 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 353 | Ga0209050_1001437 | 3300025298 | Bacteria | 25610 |
| 354 | Ga0209050_1001535 | 3300025298 | Bacteria | 24230 |
| 355 | Ga0209050_1012559 | 3300025298 | Bacteria | 3871 |
| 356 | Ga0209050_1025028 | 3300025298 | Bacteria | 2043 |
| 357 | Ga0209256_1000129 | 3300025299 | Bacteria | 163766 |
| 358 | Ga0209256_1000224 | 3300025299 | Bacteria | 104436 |
| 359 | Ga0207426_1000062 | 3300025302 | Bacteria | 362040 |
| 360 | Ga0207426_1000171 | 3300025302 | Bacteria | 163766 |
| 361 | Ga0207426_1000185 | 3300025302 | Bacteria | 154146 |
| 362 | Ga0207426_1028013 | 3300025302 | Bacteria | 1870 |
| 363 | Ga0209051_1000010 | 3300025303 | Bacteria | 641298 |
| 364 | Ga0209051_1000137 | 3300025303 | Bacteria | 137784 |
| 365 | Ga0209051_1000859 | 3300025303 | Bacteria | 30952 |
| 366 | Ga0209051_1001741 | 3300025303 | Bacteria | 17359 |
| 367 | Ga0209051_1027477 | 3300025303 | Bacteria | 2266 |
| 368 | Ga0209257_1000026 | 3300025304 | Bacteria | 723225 |
| 369 | Ga0209257_1000205 | 3300025304 | Bacteria | 143735 |
| 370 | Ga0209257_1009859 | 3300025304 | Bacteria | 4989 |
| 371 | Ga0209257_1025887 | 3300025304 | Bacteria | 1992 |
| 372 | Ga0209257_1034087 | 3300025304 | Bacteria | 1593 |
| 373 | Ga0207655_1002202 | 3300025728 | Bacteria | 16179 |
| 374 | Ga0207655_1011626 | 3300025728 | Bacteria | 5220 |
| 375 | Ga0207682_10025165 | 3300025893 | Bacteria | 2360 |
| 376 | Ga0207682_10028656 | 3300025893 | Bacteria | 2224 |
| 377 | Ga0207682_10034600 | 3300025893 | Bacteria | 2037 |
| 378 | Ga0207688_10031306 | 3300025901 | Bacteria | 2936 |
| 379 | Ga0207688_10325953 | 3300025901 | Bacteria | 943 |
| 380 | Ga0207680_10000566 | 3300025903 | Bacteria | 17497 |
| 381 | Ga0207645_10003718 | 3300025907 | Bacteria | 11487 |
| 382 | Ga0207645_10006702 | 3300025907 | Bacteria | 8231 |
| 383 | Ga0207645_10079872 | 3300025907 | Bacteria | 2096 |
| 384 | Ga0207645_10169503 | 3300025907 | Bacteria | 1430 |
| 385 | Ga0207645_10189834 | 3300025907 | Bacteria | 1350 |
| 386 | Ga0207643_10064933 | 3300025908 | Bacteria | 2090 |
| 387 | Ga0207705_10076227 | 3300025909 | Bacteria | 2437 |
| 388 | Ga0207705_10304663 | 3300025909 | Bacteria | 1222 |
| 389 | Ga0207684_10049311 | 3300025910 | Bacteria | 3572 |
| 390 | Ga0207684_10065153 | 3300025910 | Bacteria | 3094 |
| 391 | Ga0207654_10071676 | 3300025911 | Bacteria | 2060 |
| 392 | Ga0207707_10121329 | 3300025912 | Bacteria | 2285 |
| 393 | Ga0207707_10351381 | 3300025912 | Bacteria | 1270 |
| 394 | Ga0207707_10364070 | 3300025912 | Bacteria | 1245 |
| 395 | Ga0207695_10255734 | 3300025913 | Bacteria | 1650 |
| 396 | Ga0207695_10273749 | 3300025913 | Bacteria | 1583 |
| 397 | Ga0207671_10323953 | 3300025914 | Bacteria | 1220 |
| 398 | Ga0207693_10249022 | 3300025915 | Bacteria | 1394 |
| 399 | Ga0207660_10026708 | 3300025917 | Bacteria | 3933 |
| 400 | Ga0207660_10107720 | 3300025917 | Bacteria | 2092 |
| 401 | Ga0207657_10020418 | 3300025919 | Bacteria | 6260 |
| 402 | Ga0207649_10085490 | 3300025920 | Bacteria | 2053 |
| 403 | Ga0207649_10321124 | 3300025920 | Bacteria | 1138 |
| 404 | Ga0207652_10417514 | 3300025921 | Bacteria | 1210 |
| 405 | Ga0207646_10279427 | 3300025922 | Bacteria | 1509 |
| 406 | Ga0207681_10433476 | 3300025923 | Bacteria | 1067 |
| 407 | Ga0207694_10008501 | 3300025924 | Bacteria | 7752 |
| 408 | Ga0207650_10077471 | 3300025925 | Bacteria | 2513 |
| 409 | Ga0207650_10233208 | 3300025925 | Bacteria | 1485 |
| 410 | Ga0207650_10386728 | 3300025925 | Bacteria | 1156 |
| 411 | Ga0207650_10394036 | 3300025925 | Bacteria | 1145 |
| 412 | Ga0207650_10552700 | 3300025925 | Bacteria | 965 |
| 413 | Ga0207659_10000413 | 3300025926 | Bacteria | 25819 |
| 414 | Ga0207659_10017569 | 3300025926 | Bacteria | 4674 |
| 415 | Ga0207659_10142919 | 3300025926 | Bacteria | 1859 |
| 416 | Ga0207687_10009580 | 3300025927 | Bacteria | 6334 |
| 417 | Ga0207687_10164241 | 3300025927 | Bacteria | 1707 |
| 418 | Ga0207687_10511087 | 3300025927 | Bacteria | 1004 |
| 419 | Ga0207700_10001789 | 3300025928 | Bacteria | 12201 |
| 420 | Ga0207700_10024086 | 3300025928 | Bacteria | 4208 |
| 421 | Ga0207664_10066473 | 3300025929 | Bacteria | 2890 |
| 422 | Ga0207664_10101440 | 3300025929 | Bacteria | 2378 |
| 423 | Ga0207644_10010403 | 3300025931 | Bacteria | 6129 |
| 424 | Ga0207706_10084575 | 3300025933 | Bacteria | 2789 |
| 425 | Ga0207706_10137470 | 3300025933 | Bacteria | 2149 |
| 426 | Ga0207706_10287226 | 3300025933 | Bacteria | 1434 |
| 427 | Ga0207709_10000497 | 3300025935 | Bacteria | 35233 |
| 428 | Ga0207709_10002246 | 3300025935 | Bacteria | 12298 |
| 429 | Ga0207709_10002795 | 3300025935 | Bacteria | 10742 |
| 430 | Ga0207709_10010832 | 3300025935 | Bacteria | 5022 |
| 431 | Ga0207709_10015245 | 3300025935 | Bacteria | 4260 |
| 432 | Ga0207709_10111539 | 3300025935 | Bacteria | 1830 |
| 433 | Ga0207709_10217002 | 3300025935 | Bacteria | 1377 |
| 434 | Ga0207670_10007925 | 3300025936 | Bacteria | 5964 |
| 435 | Ga0207669_10168371 | 3300025937 | Bacteria | 1556 |
| 436 | Ga0207704_10083490 | 3300025938 | Bacteria | 2073 |
| 437 | Ga0207691_10001908 | 3300025940 | Bacteria | 20369 |
| 438 | Ga0207691_10016734 | 3300025940 | Bacteria | 6962 |
| 439 | Ga0207691_10139896 | 3300025940 | Bacteria | 2134 |
| 440 | Ga0207691_10367217 | 3300025940 | Bacteria | 1230 |
| 441 | Ga0207711_10008859 | 3300025941 | Bacteria | 8413 |
| 442 | Ga0207711_10331264 | 3300025941 | Bacteria | 1408 |
| 443 | Ga0207689_10015963 | 3300025942 | Bacteria | 6356 |
| 444 | Ga0207689_10121373 | 3300025942 | Bacteria | 2149 |
| 445 | Ga0207689_10229528 | 3300025942 | Bacteria | 1534 |
| 446 | Ga0207689_10365115 | 3300025942 | Bacteria | 1201 |
| 447 | Ga0207661_10013534 | 3300025944 | Bacteria | 5958 |
| 448 | Ga0207661_10100682 | 3300025944 | Bacteria | 2426 |
| 449 | Ga0207679_10145615 | 3300025945 | Bacteria | 1921 |
| 450 | Ga0207679_10205848 | 3300025945 | Bacteria | 1647 |
| 451 | Ga0207679_10216171 | 3300025945 | Bacteria | 1610 |
| 452 | Ga0207667_10046884 | 3300025949 | Bacteria | 4576 |
| 453 | Ga0207667_10893316 | 3300025949 | Bacteria | 881 |
| 454 | Ga0207651_10716247 | 3300025960 | Bacteria | 883 |
| 455 | Ga0207712_10212258 | 3300025961 | Bacteria | 1542 |
| 456 | Ga0207668_10253104 | 3300025972 | Bacteria | 1431 |
| 457 | Ga0207658_10001221 | 3300025986 | Bacteria | 20333 |
| 458 | Ga0207658_10032821 | 3300025986 | Bacteria | 3699 |
| 459 | Ga0207658_10064314 | 3300025986 | Bacteria | 2751 |
| 460 | Ga0207658_10153852 | 3300025986 | Bacteria | 1877 |
| 461 | Ga0207658_10435728 | 3300025986 | Bacteria | 1158 |
| 462 | Ga0207677_10018017 | 3300026023 | Bacteria | 4229 |
| 463 | Ga0207677_10180352 | 3300026023 | Bacteria | 1660 |
| 464 | Ga0207703_10003078 | 3300026035 | Bacteria | 14106 |
| 465 | Ga0207703_10003611 | 3300026035 | Bacteria | 12912 |
| 466 | Ga0207639_10038115 | 3300026041 | Bacteria | 3574 |
| 467 | Ga0207639_10051648 | 3300026041 | Bacteria | 3128 |
| 468 | Ga0207639_10394410 | 3300026041 | Bacteria | 1246 |
| 469 | Ga0207678_10138648 | 3300026067 | Bacteria | 2076 |
| 470 | Ga0207708_10153647 | 3300026075 | Bacteria | 1814 |
| 471 | Ga0207702_10308544 | 3300026078 | Bacteria | 1504 |
| 472 | Ga0207641_10005904 | 3300026088 | Bacteria | 10385 |
| 473 | Ga0207641_10007144 | 3300026088 | Bacteria | 9325 |
| 474 | Ga0207641_10280201 | 3300026088 | Bacteria | 1568 |
| 475 | Ga0207648_10000412 | 3300026089 | Bacteria | 47573 |
| 476 | Ga0207648_10051461 | 3300026089 | Bacteria | 3600 |
| 477 | Ga0207648_10069509 | 3300026089 | Bacteria | 3068 |
| 478 | Ga0207676_10000325 | 3300026095 | Bacteria | 41139 |
| 479 | Ga0207674_10107915 | 3300026116 | Bacteria | 2761 |
| 480 | Ga0207674_10256622 | 3300026116 | Bacteria | 1695 |
| 481 | Ga0207675_100202618 | 3300026118 | Bacteria | 1906 |
| 482 | Ga0207675_100568113 | 3300026118 | Bacteria | 1135 |
| 483 | Ga0207683_10008809 | 3300026121 | Bacteria | 8612 |
| 484 | Ga0207683_10020874 | 3300026121 | Bacteria | 5604 |
| 485 | Ga0207683_10087829 | 3300026121 | Bacteria | 2765 |
| 486 | Ga0207683_10135210 | 3300026121 | Bacteria | 2219 |
| 487 | Ga0207698_10077634 | 3300026142 | Bacteria | 2664 |
| 488 | Ga0207698_10096942 | 3300026142 | Bacteria | 2432 |
| 489 | Ga0207698_10128833 | 3300026142 | Bacteria | 2158 |
| 490 | Ga0207698_10169152 | 3300026142 | Bacteria | 1922 |
| 491 | Ga0207698_10429150 | 3300026142 | Bacteria | 1270 |
| 492 | Ga0209281_1027790 | 3300027111 | Bacteria | 1033 |
| 493 | Ga0209996_1017914 | 3300027395 | Bacteria | 981 |
| 494 | Ga0209999_1032322 | 3300027543 | Bacteria | 973 |
| 495 | Ga0209970_1000334 | 3300027614 | Bacteria | 7879 |
| 496 | Ga0209282_1007723 | 3300027666 | Bacteria | 6748 |
| 497 | Ga0209971_1016084 | 3300027682 | Bacteria | 1774 |
| 498 | Ga0209974_10017668 | 3300027876 | Bacteria | 2364 |
| 499 | Ga0207428_10000824 | 3300027907 | Bacteria | 34961 |
| 500 | Ga0207428_10017418 | 3300027907 | Bacteria | 6167 |
| 501 | Ga0268266_10074109 | 3300028379 | Bacteria | 2955 |
| 502 | Ga0268266_10151507 | 3300028379 | Bacteria | 2090 |
| 503 | Ga0268265_10274912 | 3300028380 | Bacteria | 1504 |
| 504 | Ga0268264_10003593 | 3300028381 | Bacteria | 13348 |
| 505 | Ga0265337_1073786 | 3300028556 | Bacteria | 936 |
| 506 | Ga0265326_10012895 | 3300028558 | Bacteria | 2450 |
| 507 | Ga0265319_1000367 | 3300028563 | Bacteria | 32543 |
| 508 | Ga0265319_1013479 | 3300028563 | Bacteria | 3247 |
| 509 | Ga0265334_10011419 | 3300028573 | Bacteria | 3741 |
| 510 | Ga0265334_10057203 | 3300028573 | Bacteria | 1478 |
| 511 | Ga0265318_10001025 | 3300028577 | Bacteria | 17763 |
| 512 | Ga0265318_10003382 | 3300028577 | Bacteria | 8038 |
| 513 | Ga0265322_10003200 | 3300028654 | Bacteria | 4970 |
| 514 | Ga0265322_10024147 | 3300028654 | Bacteria | 1738 |
| 515 | Ga0307517_10000575 | 3300028786 | Bacteria | 62687 |
| 516 | Ga0307517_10155712 | 3300028786 | Bacteria | 1551 |
| 517 | Ga0307515_10000022 | 3300028794 | Bacteria | 404064 |
| 518 | Ga0307515_10000063 | 3300028794 | Bacteria | 245504 |
| 519 | Ga0307515_10000150 | 3300028794 | Bacteria | 169644 |
| 520 | Ga0307515_10014322 | 3300028794 | Bacteria | 14720 |
| 521 | Ga0307515_10199232 | 3300028794 | Bacteria | 1884 |
| 522 | Ga0307515_10265982 | 3300028794 | Bacteria | 1443 |
| 523 | Ga0265338_10005122 | 3300028800 | Bacteria | 17268 |
| 524 | Ga0265338_10007410 | 3300028800 | Bacteria | 13628 |
| 525 | Ga0265338_10020018 | 3300028800 | Bacteria | 7061 |
| 526 | Ga0307512_10242964 | 3300030522 | Bacteria | 908 |
| 527 | Ga0316183_1162120 | 3300030742 | Bacteria | 1332 |
| 528 | Ga0316181_1135666 | 3300030744 | Bacteria | 3382 |
| 529 | Ga0265330_10010400 | 3300031235 | Bacteria | 4387 |
| 530 | Ga0265332_10000023 | 3300031238 | Bacteria | 211994 |
| 531 | Ga0265332_10008558 | 3300031238 | Bacteria | 4597 |
| 532 | Ga0265328_10006812 | 3300031239 | Bacteria | 4803 |
| 533 | Ga0265320_10003780 | 3300031240 | Bacteria | 10062 |
| 534 | Ga0265320_10150151 | 3300031240 | Bacteria | 1052 |
| 535 | Ga0265325_10004086 | 3300031241 | Bacteria | 9296 |
| 536 | Ga0265325_10034519 | 3300031241 | Bacteria | 2690 |
| 537 | Ga0265329_10003362 | 3300031242 | Bacteria | 6989 |
| 538 | Ga0265329_10011121 | 3300031242 | Bacteria | 3278 |
| 539 | Ga0265340_10002165 | 3300031247 | Bacteria | 11257 |
| 540 | Ga0265339_10039650 | 3300031249 | Bacteria | 2621 |
| 541 | Ga0265331_10021197 | 3300031250 | Bacteria | 3328 |
| 542 | Ga0265327_10001540 | 3300031251 | Bacteria | 28437 |
| 543 | Ga0265327_10006888 | 3300031251 | Bacteria | 8940 |
| 544 | Ga0265327_10015936 | 3300031251 | Bacteria | 4812 |
| 545 | Ga0265327_10031540 | 3300031251 | Bacteria | 2975 |
| 546 | Ga0265327_10054966 | 3300031251 | Bacteria | 2058 |
| 547 | Ga0265316_10007267 | 3300031344 | Bacteria | 10451 |
| 548 | Ga0265316_10017319 | 3300031344 | Bacteria | 6234 |
| 549 | Ga0307513_10000008 | 3300031456 | Bacteria | 442128 |
| 550 | Ga0307513_10000991 | 3300031456 | Bacteria | 41018 |
| 551 | Ga0307513_10003892 | 3300031456 | Bacteria | 20086 |
| 552 | Ga0307513_10042874 | 3300031456 | Bacteria | 4976 |
| 553 | Ga0307513_10117878 | 3300031456 | Bacteria | 2631 |
| 554 | Ga0307513_10167140 | 3300031456 | Bacteria | 2082 |
| 555 | Ga0307509_10185819 | 3300031507 | Bacteria | 1937 |
| 556 | Ga0307408_100025723 | 3300031548 | Bacteria | 4033 |
| 557 | Ga0307408_100072514 | 3300031548 | Bacteria | 2549 |
| 558 | Ga0307408_100158334 | 3300031548 | Bacteria | 1796 |
| 559 | Ga0307408_100279201 | 3300031548 | Bacteria | 1390 |
| 560 | Ga0307408_100452879 | 3300031548 | Bacteria | 1113 |
| 561 | Ga0265313_10012870 | 3300031595 | Bacteria | 5075 |
| 562 | Ga0307508_10025941 | 3300031616 | Bacteria | 5314 |
| 563 | Ga0307508_10255514 | 3300031616 | Bacteria | 1348 |
| 564 | Ga0307514_10088477 | 3300031649 | Bacteria | 2266 |
| 565 | Ga0265314_10004327 | 3300031711 | Bacteria | 13245 |
| 566 | Ga0265314_10066252 | 3300031711 | Bacteria | 2436 |
| 567 | Ga0265314_10163357 | 3300031711 | Bacteria | 1352 |
| 568 | Ga0265342_10004057 | 3300031712 | Bacteria | 11681 |
| 569 | Ga0265342_10024334 | 3300031712 | Bacteria | 3824 |
| 570 | Ga0265342_10164497 | 3300031712 | Bacteria | 1224 |
| 571 | Ga0307516_10003416 | 3300031730 | Bacteria | 20413 |
| 572 | Ga0307516_10059990 | 3300031730 | Bacteria | 3697 |
| 573 | Ga0307516_10075653 | 3300031730 | Bacteria | 3221 |
| 574 | Ga0307516_10194636 | 3300031730 | Bacteria | 1751 |
| 575 | Ga0307405_10060904 | 3300031731 | Bacteria | 2383 |
| 576 | Ga0307405_10114576 | 3300031731 | Bacteria | 1832 |
| 577 | Ga0307405_10241803 | 3300031731 | Bacteria | 1337 |
| 578 | Ga0307405_10330842 | 3300031731 | Bacteria | 1167 |
| 579 | Ga0307405_10354883 | 3300031731 | Bacteria | 1132 |
| 580 | Ga0307413_10156571 | 3300031824 | Bacteria | 1595 |
| 581 | Ga0307406_10001780 | 3300031901 | Bacteria | 11779 |
| 582 | Ga0307412_10011307 | 3300031911 | Bacteria | 5164 |
| 583 | Ga0307412_10011375 | 3300031911 | Bacteria | 5153 |
| 584 | Ga0307412_10013346 | 3300031911 | Bacteria | 4814 |
| 585 | Ga0307412_10056521 | 3300031911 | Bacteria | 2615 |
| 586 | Ga0307412_10088252 | 3300031911 | Bacteria | 2163 |
| 587 | Ga0307409_100598207 | 3300031995 | Bacteria | 1090 |
| 588 | Ga0307416_100065389 | 3300032002 | Bacteria | 2988 |
| 589 | Ga0307416_100093414 | 3300032002 | Bacteria | 2591 |
| 590 | Ga0307416_100094168 | 3300032002 | Bacteria | 2582 |
| 591 | Ga0307416_100193529 | 3300032002 | Bacteria | 1921 |
| 592 | Ga0307416_100383522 | 3300032002 | Bacteria | 1436 |
| 593 | Ga0307411_10541489 | 3300032005 | Bacteria | 991 |
| 594 | Ga0307510_10007192 | 3300033180 | Bacteria | 13255 |
| 595 | Ga0307510_10009118 | 3300033180 | Bacteria | 11811 |
| 596 | Ga0373945_0087675 | 3300035116 | Bacteria | 1201 |
| 597 | Ga0373953_0122803 | 3300035117 | Bacteria | 1104 |
| 598 | Ga0373933_0607455 | 3300035724 | Bacteria | 718 |
| 599 | Ga0373937_0057398 | 3300036401 | Bacteria | 3576 |
| 600 | Ga0373937_0288848 | 3300036401 | Bacteria | 1549 |
| 601 | Ga0373925_0164444 | 3300037068 | Bacteria | 1749 |
| 602 | Ga0373925_0323310 | 3300037068 | Bacteria | 1249 |
| 603 | Ga0395899_0012760 | 3300037312 | Bacteria | 6438 |
| 604 | Ga0395899_0014438 | 3300037312 | Bacteria | 6029 |
| 605 | Ga0395900_0171716 | 3300037418 | Bacteria | 2207 |
| 606 | Ga0395900_0230152 | 3300037418 | Bacteria | 1864 |
| 607 | Ga0395898_0235391 | 3300037466 | Bacteria | 1746 |
| 608 | Ga0395905_0000027 | 3300037471 | Bacteria | 297239 |
| 609 | Ga0395905_0000042 | 3300037471 | Bacteria | 247894 |
| 610 | Ga0395905_0007865 | 3300037471 | Bacteria | 10559 |
| 611 | Ga0395905_0031330 | 3300037471 | Bacteria | 5006 |
| 612 | Ga0395905_0050716 | 3300037471 | Bacteria | 3887 |
| 613 | Ga0395905_0098863 | 3300037471 | Bacteria | 2740 |
| 614 | Ga0395905_0391802 | 3300037471 | Bacteria | 1284 |
| 615 | Ga0395901_0046478 | 3300038443 | Bacteria | 4509 |
| 616 | Ga0395901_0145661 | 3300038443 | Bacteria | 2489 |
| 617 | Ga0395901_0163945 | 3300038443 | Bacteria | 2334 |
| 618 | Ga0242420_013191 | 3300038996 | Bacteria | 1406 |
| 619 | Ga0436365_1276969 | 3300039437 | Bacteria | 1670 |
| 620 | Ga0439436_0008478 | 3300041404 | Bacteria | 3162 |
| 621 | Ga0439453_0024676 | 3300041408 | Bacteria | 1105 |
| 622 | Ga0439461_0018517 | 3300041410 | Bacteria | 1364 |
| 623 | Ga0439465_0013016 | 3300041413 | Bacteria | 2599 |
| 624 | Ga0439431_0009348 | 3300041997 | Bacteria | 2214 |
| 625 | Ga0439432_071909 | 3300042006 | Bacteria | 1054 |
| 626 | Ga0439449_0001315 | 3300042007 | Bacteria | 9735 |
| 627 | Ga0439449_0008350 | 3300042007 | Bacteria | 3938 |
| 628 | Ga0439449_0019433 | 3300042007 | Bacteria | 2546 |
| 629 | Ga0439449_0041902 | 3300042007 | Bacteria | 1702 |
| 630 | Ga0439452_011363 | 3300042010 | Bacteria | 2561 |
| 631 | Ga0439457_005550 | 3300042014 | Bacteria | 3165 |
| 632 | Ga0439462_0006722 | 3300042015 | Bacteria | 2869 |
| 633 | Ga0450894_011448 | 3300042131 | Bacteria | 1156 |
| 634 | Ga0450898_004687 | 3300042134 | Bacteria | 2034 |
| 635 | Ga0450906_004729 | 3300042145 | Bacteria | 2835 |
| 636 | Ga0450906_009634 | 3300042145 | Bacteria | 1836 |
| 637 | Ga0439446_0071353 | 3300042156 | Bacteria | 1063 |
| 638 | Ga0450908_013841 | 3300042184 | Bacteria | 1455 |
| 639 | Ga0439434_0049332 | 3300042435 | Bacteria | 1303 |
| 640 | Ga0439464_0033666 | 3300042439 | Bacteria | 1443 |
| 641 | Ga0439464_0055069 | 3300042439 | Bacteria | 1156 |
| 642 | Ga0451577_0041221 | 3300042876 | Bacteria | 4144 |
| 643 | Ga0451577_0142894 | 3300042876 | Bacteria | 2151 |
| 644 | Ga0466969_0010253 | 3300044656 | Bacteria | 4967 |
| 645 | Ga0453683_0032805 | 3300044673 | Bacteria | 3274 |
| 646 | Ga0466965_0046594 | 3300044683 | Bacteria | 2146 |
| 647 | Ga0466961_0114125 | 3300044693 | Bacteria | 1698 |
| 648 | Ga0466963_0008273 | 3300044694 | Bacteria | 6233 |
| 649 | Ga0466963_0322912 | 3300044694 | Bacteria | 1086 |
| 650 | Ga0453684_0186465 | 3300044712 | Bacteria | 2431 |
| 651 | Ga0466957_0262128 | 3300044842 | Bacteria | 1152 |
| 652 | Ga0466960_0053041 | 3300044901 | Bacteria | 1964 |
| 653 | Ga0466960_0114552 | 3300044901 | Bacteria | 1405 |
| 654 | Ga0451576_0124355 | 3300045051 | Bacteria | 2687 |
| 655 | Ga0466958_0474425 | 3300045836 | Bacteria | 811 |
| 656 | Ga0466967_0224909 | 3300045976 | Bacteria | 1785 |
| 657 | Ga0466967_0698893 | 3300045976 | Bacteria | 1004 |
| 658 | Ga0495592_0361789 | 3300046454 | Bacteria | 928 |
| 659 | Ga0495638_0019461 | 3300046460 | Bacteria | 4492 |
| 660 | Ga0495638_0031274 | 3300046460 | Bacteria | 3421 |
| 661 | Ga0495651_0072210 | 3300046462 | Bacteria | 2622 |
| 662 | Ga0495580_0157787 | 3300046472 | Bacteria | 1571 |
| 663 | Ga0495580_0203219 | 3300046472 | Bacteria | 1364 |
| 664 | Ga0495664_0143246 | 3300046477 | Bacteria | 1449 |
| 665 | Ga0495608_0189926 | 3300046511 | Bacteria | 1297 |
| 666 | Ga0495608_0243199 | 3300046511 | Bacteria | 1124 |
| 667 | Ga0495610_0011528 | 3300046512 | Bacteria | 5396 |
| 668 | Ga0495610_0032973 | 3300046512 | Bacteria | 2683 |
| 669 | Ga0495616_0001839 | 3300046513 | Bacteria | 14365 |
| 670 | Ga0495628_0095150 | 3300046516 | Bacteria | 2302 |
| 671 | Ga0495631_0025535 | 3300046518 | Bacteria | 2720 |
| 672 | Ga0495632_0004875 | 3300046519 | Bacteria | 9000 |
| 673 | Ga0495637_0026522 | 3300046520 | Bacteria | 2599 |
| 674 | Ga0495663_0056141 | 3300046525 | Bacteria | 1229 |
| 675 | Ga0495642_0119600 | 3300046528 | Bacteria | 1130 |
| 676 | Ga0495654_0004374 | 3300046530 | Bacteria | 8405 |
| 677 | Ga0495587_0046189 | 3300046536 | Bacteria | 2586 |
| 678 | Ga0495587_0366428 | 3300046536 | Bacteria | 802 |
| 679 | Ga0495621_0047681 | 3300046539 | Bacteria | 1523 |
| 680 | Ga0495656_0000047 | 3300046615 | Bacteria | 59690 |
| 681 | Ga0495668_0240129 | 3300046616 | Bacteria | 992 |
| 682 | Ga0495634_0087469 | 3300046642 | Bacteria | 2028 |
| 683 | Ga0495625_0003370 | 3300046660 | Bacteria | 16024 |
| 684 | Ga0495625_0033388 | 3300046660 | Bacteria | 3806 |
| 685 | Ga0495625_0098189 | 3300046660 | Bacteria | 2015 |
| 686 | Ga0495625_0109259 | 3300046660 | Bacteria | 1892 |
| 687 | Ga0495635_0221126 | 3300046663 | Bacteria | 1281 |
| 688 | Ga0495657_0299238 | 3300046675 | Bacteria | 960 |
| 689 | Ga0495624_0081410 | 3300046690 | Bacteria | 2005 |
| 690 | Ga0495649_0005389 | 3300046694 | Bacteria | 8144 |
| 691 | Ga0495600_0325308 | 3300046809 | Bacteria | 966 |
| 692 | Ga0495604_0363410 | 3300047317 | Bacteria | 959 |
| 693 | Ga0495636_0031751 | 3300047318 | Bacteria | 2166 |
| 694 | Ga0495676_0060279 | 3300047321 | Bacteria | 2975 |
| 695 | Ga0495680_0134425 | 3300047322 | Bacteria | 1814 |
| 696 | Ga0495680_0353949 | 3300047322 | Bacteria | 1022 |
| 697 | Ga0495687_004201 | 3300047443 | Bacteria | 9884 |
| 698 | Ga0495687_017276 | 3300047443 | Bacteria | 3603 |
| 699 | Ga0495687_024875 | 3300047443 | Bacteria | 2839 |
| 700 | Ga0495602_0360428 | 3300048088 | Bacteria | 1047 |
| 701 | Ga0496104_0101853 | 3300048907 | Bacteria | 2750 |
| 702 | Ga0496105_0009425 | 3300048908 | Bacteria | 7635 |
| 703 | Ga0496105_0296269 | 3300048908 | Bacteria | 1301 |
| 704 | Ga0496105_0340112 | 3300048908 | Bacteria | 1200 |
| 705 | Ga0496106_0266236 | 3300048909 | Bacteria | 1372 |
| 706 | Ga0496108_0071269 | 3300048911 | Bacteria | 2932 |
| 707 | Ga0496108_0121421 | 3300048911 | Bacteria | 2241 |
| 708 | Ga0496108_0291528 | 3300048911 | Bacteria | 1421 |
| 709 | Ga0496109_0467565 | 3300048912 | Bacteria | 1191 |
| 710 | Ga0496110_0027012 | 3300048913 | Bacteria | 4917 |
| 711 | Ga0496111_0093341 | 3300048914 | Bacteria | 2206 |
| 712 | Ga0496112_0001247 | 3300048915 | Bacteria | 19238 |
| 713 | Ga0496112_0110440 | 3300048915 | Bacteria | 2720 |
| 714 | Ga0496112_0176519 | 3300048915 | Bacteria | 2101 |
| 715 | Ga0496112_0328746 | 3300048915 | Bacteria | 1473 |
| 716 | Ga0496114_0455189 | 3300048917 | Bacteria | 1133 |
| 717 | Ga0496115_0146509 | 3300048918 | Bacteria | 1949 |
| 718 | Ga0496115_0160164 | 3300048918 | Bacteria | 1860 |
| 719 | Ga0496116_0017638 | 3300048919 | Bacteria | 5532 |
| 720 | Ga0496117_0025305 | 3300048920 | Bacteria | 4669 |
| 721 | Ga0496117_0088938 | 3300048920 | Bacteria | 1996 |
| 722 | Ga0496118_0005780 | 3300048921 | Bacteria | 13891 |
| 723 | Ga0496118_0038540 | 3300048921 | Bacteria | 3828 |
| 724 | Ga0496121_0002801 | 3300048924 | Bacteria | 25834 |
| 725 | Ga0496121_0013215 | 3300048924 | Bacteria | 8896 |
| 726 | Ga0496121_0042409 | 3300048924 | Bacteria | 3958 |
| 727 | Ga0496123_0061812 | 3300048926 | Bacteria | 2404 |
| 728 | Ga0496124_0055194 | 3300048927 | Bacteria | 3359 |
| 729 | Ga0496124_0222356 | 3300048927 | Bacteria | 1419 |
| 730 | Ga0496125_0021834 | 3300048928 | Bacteria | 5957 |
| 731 | Ga0501034_0015736 | 3300049571 | Bacteria | 7767 |
| 732 | Ga0501034_0169399 | 3300049571 | Bacteria | 2152 |
| 733 | Ga0501039_0043463 | 3300049575 | Bacteria | 3471 |
| 734 | Ga0501047_0148674 | 3300049581 | Bacteria | 2219 |
| 735 | Ga0501048_0337328 | 3300049582 | Bacteria | 1074 |
| 736 | Ga0501067_0023439 | 3300049583 | Bacteria | 3421 |
| 737 | Ga0501070_0009486 | 3300049586 | Bacteria | 8228 |
| 738 | Ga0501071_0031132 | 3300049587 | Bacteria | 3779 |
| 739 | Ga0501071_0071383 | 3300049587 | Bacteria | 2531 |
| 740 | Ga0501072_0041603 | 3300049588 | Bacteria | 3610 |
| 741 | Ga0501072_0057564 | 3300049588 | Bacteria | 3063 |
| 742 | Ga0501073_0007466 | 3300049589 | Bacteria | 8128 |
| 743 | Ga0501073_0075724 | 3300049589 | Bacteria | 2343 |
| 744 | Ga0501074_0007038 | 3300049590 | Bacteria | 8123 |
| 745 | Ga0501075_0022010 | 3300049591 | Bacteria | 4654 |
| 746 | Ga0501075_0095570 | 3300049591 | Bacteria | 2255 |
| 747 | Ga0501076_0006750 | 3300049592 | Bacteria | 8329 |
| 748 | Ga0501206_013213 | 3300049653 | Bacteria | 1127 |
| 749 | Ga0501207_030735 | 3300049654 | Bacteria | 902 |
| 750 | Ga0501249_011011 | 3300049679 | Bacteria | 1895 |
| 751 | Ga0501257_018518 | 3300049686 | Bacteria | 1625 |
| 752 | Ga0501079_0026176 | 3300049741 | Bacteria | 4472 |
| 753 | Ga0501079_0053698 | 3300049741 | Bacteria | 3108 |
| 754 | Ga0501079_0109339 | 3300049741 | Bacteria | 2147 |
| 755 | Ga0501080_0001046 | 3300049742 | Bacteria | 22756 |
| 756 | Ga0501080_0025808 | 3300049742 | Bacteria | 5458 |
| 757 | Ga0501080_0038620 | 3300049742 | Bacteria | 4456 |
| 758 | Ga0501083_0000684 | 3300049744 | Bacteria | 22083 |
| 759 | Ga0501262_000493 | 3300049759 | Bacteria | 4693 |
| 760 | Ga0501262_002025 | 3300049759 | Bacteria | 2282 |
| 761 | Ga0501265_002350 | 3300049762 | Bacteria | 2146 |
| 762 | Ga0501035_0203196 | 3300049822 | Bacteria | 1698 |
| 763 | Ga0501044_0119947 | 3300049823 | Bacteria | 2632 |
| 764 | nmdc:mga03683_10371_c1 | 3300050489 | Bacteria | 3340 |
| 765 | nmdc:mga03683_107368_c1 | 3300050489 | Bacteria | 1231 |
| 766 | nmdc:mga03683_6233_c1 | 3300050489 | Bacteria | 4072 |
| 767 | nmdc:mga03683_6421_c1 | 3300050489 | Bacteria | 4024 |
| 768 | nmdc:mga03n38_12480_c1 | 3300050490 | Bacteria | 3199 |
| 769 | nmdc:mga03n38_154446_c1 | 3300050490 | Bacteria | 1157 |
| 770 | nmdc:mga03n38_32739_c1 | 3300050490 | Bacteria | 2205 |
| 771 | nmdc:mga03n38_51436_c1 | 3300050490 | Bacteria | 1840 |
| 772 | nmdc:mga03n38_78368_c1 | 3300050490 | Bacteria | 1546 |
| 773 | nmdc:mga00v17_41558_c1 | 3300050491 | Bacteria | 2762 |
| 774 | nmdc:mga00v17_57650_c1 | 3300050491 | Bacteria | 2377 |
| 775 | nmdc:mga0yw44_136519_c1 | 3300050492 | Bacteria | 1591 |
| 776 | nmdc:mga0yw44_7818_c1 | 3300050492 | Bacteria | 5290 |
| 777 | nmdc:mga0k408_104058_c1 | 3300050493 | Bacteria | 1675 |
| 778 | nmdc:mga0k408_10924_c1 | 3300050493 | Bacteria | 4926 |
| 779 | nmdc:mga0k408_17775_c1 | 3300050493 | Bacteria | 3963 |
| 780 | nmdc:mga0k408_20558_c1 | 3300050493 | Bacteria | 3700 |
| 781 | nmdc:mga0k408_43322_c1 | 3300050493 | Bacteria | 2593 |
| 782 | nmdc:mga0k408_48562_c1 | 3300050493 | Bacteria | 2456 |
| 783 | nmdc:mga0k408_51154_c1 | 3300050493 | Bacteria | 2393 |
| 784 | nmdc:mga0k408_5868_c1 | 3300050493 | Bacteria | 6544 |
| 785 | nmdc:mga06z11_34469_c1 | 3300050494 | Bacteria | 2485 |
| 786 | nmdc:mga06z11_78453_c1 | 3300050494 | Bacteria | 1765 |
| 787 | nmdc:mga07m45_11400_c1 | 3300050496 | Bacteria | 4669 |
| 788 | nmdc:mga07m45_14982_c1 | 3300050496 | Bacteria | 4139 |
| 789 | nmdc:mga07m45_20133_c1 | 3300050496 | Bacteria | 3622 |
| 790 | nmdc:mga07m45_25742_c1 | 3300050496 | Bacteria | 3229 |
| 791 | nmdc:mga07m45_33529_c1 | 3300050496 | Bacteria | 2852 |
| 792 | nmdc:mga07m45_44884_c1 | 3300050496 | Bacteria | 2481 |
| 793 | nmdc:mga07m45_65409_c1 | 3300050496 | Bacteria | 2065 |
| 794 | nmdc:mga07m45_872_c1 | 3300050496 | Bacteria | 13146 |
| 795 | nmdc:mga07m45_89452_c1 | 3300050496 | Bacteria | 1763 |
| 796 | nmdc:mga05p37_481_c1 | 3300050507 | Bacteria | 43634 |
| 797 | nmdc:mga05p37_75222_c1 | 3300050507 | Bacteria | 4157 |
| 798 | nmdc:mga09592_37264_c1 | 3300050508 | Bacteria | 4079 |
| 799 | nmdc:mga09592_46511_c1 | 3300050508 | Bacteria | 3656 |
| 800 | nmdc:mga09592_61627_c1 | 3300050508 | Bacteria | 3173 |
| 801 | nmdc:mga09592_663_c1 | 3300050508 | Bacteria | 26283 |
| 802 | nmdc:mga0qj67_149614_c1 | 3300050509 | Bacteria | 1894 |
| 803 | nmdc:mga0qj67_15458_c1 | 3300050509 | Bacteria | 5779 |
| 804 | nmdc:mga0qj67_154651_c1 | 3300050509 | Bacteria | 1861 |
| 805 | nmdc:mga0qj67_39409_c1 | 3300050509 | Bacteria | 3710 |
| 806 | nmdc:mga06r32_32_c1 | 3300050510 | Bacteria | 83882 |
| 807 | nmdc:mga06r32_367195_c1 | 3300050510 | Bacteria | 1423 |
| 808 | nmdc:mga08y16_2608_c1 | 3300050511 | Bacteria | 18513 |
| 809 | nmdc:mga0n895_243544_c1 | 3300050512 | Bacteria | 1825 |
| 810 | nmdc:mga0sz30_45735_c1 | 3300050516 | Bacteria | 1846 |
| 811 | nmdc:mga0sz30_7187_c1 | 3300050516 | Bacteria | 4169 |
| 812 | Ga0500610_0043519 | 3300053079 | Bacteria | 2326 |
| 813 | Ga0500610_0173412 | 3300053079 | Bacteria | 1062 |
| 814 | Ga0500610_0210162 | 3300053079 | Bacteria | 930 |
| 815 | Ga0495619_0124531 | 3300053085 | Bacteria | 1768 |
| 816 | Ga0500644_0007182 | 3300053088 | Bacteria | 2891 |
| 817 | Ga0500644_0029832 | 3300053088 | Bacteria | 1719 |
| 818 | Ga0500651_0000169 | 3300053093 | Bacteria | 42653 |
| 819 | Ga0500651_0123118 | 3300053093 | Bacteria | 1573 |
| 820 | Ga0500651_0173684 | 3300053093 | Bacteria | 1283 |
| 821 | Ga0500641_0085904 | 3300053096 | Bacteria | 1339 |
| 822 | Ga0500592_007280 | 3300053116 | Bacteria | 1761 |
| 823 | Ga0500594_0004056 | 3300053118 | Bacteria | 3224 |
| 824 | Ga0500608_034684 | 3300053122 | Bacteria | 2404 |
| 825 | Ga0500658_0001494 | 3300053134 | Bacteria | 9361 |
| 826 | Ga0500568_0112185 | 3300053139 | Bacteria | 1018 |
| 827 | Ga0500627_0048483 | 3300053158 | Bacteria | 1845 |
| 828 | Ga0500634_0061462 | 3300053161 | Bacteria | 1992 |
| 829 | Ga0500645_000657 | 3300053730 | Bacteria | 21741 |
| 830 | Ga0500645_008657 | 3300053730 | Bacteria | 3455 |
| 831 | Ga0501084_0086944 | 3300054114 | Bacteria | 2625 |
| 832 | Ga0501082_0265591 | 3300060353 | Bacteria | 1493 |
| 833 | Ga0530510_0042453 | 3300061734 | Bacteria | 3286 |
| 834 | 2511243524 | 2511231002 | Bacteria | 5042903 |
| 835 | 2513227332 | 2513020051 | Bacteria | 6053213 |
| 836 | 2548499289 | 2547132374 | Bacteria | 5530232 |
| 837 | 2599627103 | 2599185214 | Bacteria | 8209958 |
| 838 | 2599676536 | 2599185226 | Bacteria | 8233575 |
| 839 | 2599684804 | 2599185227 | Bacteria | 8246414 |
| 840 | 2599696760 | 2599185229 | Bacteria | 8216126 |
| 841 | 2643866122 | 2643221570 | Bacteria | 5103772 |
| 842 | 2643994112 | 2643221596 | Bacteria | 5006805 |
| 843 | 2644057654 | 2643221609 | Bacteria | 6756331 |
| 844 | 2644072259 | 2643221611 | Bacteria | 6820941 |
| 845 | 2644160064 | 2643221628 | Bacteria | 5745828 |
| 846 | 2644292936 | 2643221652 | Bacteria | 5140275 |
| 847 | 2644302028 | 2643221654 | Bacteria | 5273570 |
| 848 | 2644329453 | 2643221658 | Bacteria | 6064537 |
| 849 | 2644401025 | 2643221672 | Bacteria | 6322190 |
| 850 | 2644464275 | 2643221683 | Bacteria | 5749203 |
| 851 | 2644466350 | 2643221683 | Bacteria | 5749203 |
| 852 | 2644647952 | 2643221717 | Bacteria | 5676132 |
| 853 | 2738723457 | 2738541277 | Bacteria | 7458140 |
| 854 | 2738882243 | 2738541307 | Bacteria | 8606193 |
| 855 | 2739241928 | 2738543012 | Bacteria | 7115078 |
| 856 | 2739251222 | 2738543013 | Bacteria | 5618633 |
| 857 | 2739284188 | 2738543019 | Bacteria | 7459457 |
| 858 | 2816470770 | 2816332133 | Bacteria | 7249298 |
| 859 | 2819598172 | 2818991446 | Bacteria | 7757362 |
| 860 | 2831269159 | 2831265667 | Bacteria | 7184833 |
| 861 | 2838058589 | 2838054893 | Bacteria | 7451788 |
| 862 | 2842682428 | 2842677519 | Bacteria | 5615038 |
| 863 | 2885196445 | 2885192300 | Bacteria | 5882526 |
| 864 | 2885200020 | 2885198086 | Bacteria | 7212419 |
| 865 | 2885213750 | 2885211737 | Bacteria | 7212420 |
| 866 | 2899929594 | 2899924645 | Bacteria | 7487985 |
| 867 | 2904456407 | 2904449895 | Bacteria | 6927402 |
| 868 | 2904462916 | 2904456579 | Bacteria | 6819253 |
| 869 | 2904549064 | 2904541872 | Bacteria | 8915136 |
| 870 | 2919465834 | 2919462493 | Bacteria | 5817112 |
| 871 | 2919706164 | 2919704043 | Bacteria | 5560311 |
| 872 | 2928039963 | 2928037797 | Bacteria | 7273642 |
| 873 | 2928047288 | 2928044640 | Bacteria | 7271509 |
| 874 | 2928057508 | 2928051484 | Bacteria | 7773759 |
| 875 | 2928068106 | 2928064002 | Bacteria | 7419480 |
| 876 | 2928072691 | 2928070936 | Bacteria | 8062541 |
| 877 | 2928085854 | 2928084124 | Bacteria | 7159212 |
| 878 | 2928120189 | 2928115317 | Bacteria | 6477646 |
| 879 | 2929160692 | 2929160207 | Bacteria | 9075316 |
| 880 | 2929523771 | 2929520902 | Bacteria | 6765052 |
| 881 | 2939634120 | 2939631187 | Bacteria | 6118131 |
| 882 | 2945914812 | 2945909444 | Bacteria | 7065066 |
| 883 | 2945951123 | 2945945610 | Bacteria | 5951079 |
| 884 | 2945974219 | 2945972063 | Bacteria | 6086495 |
| 885 | 2945989789 | 2945984333 | Bacteria | 7358892 |
| 886 | 2990714177 | 2990710928 | Bacteria | 5002431 |
| 887 | Ga0451577_0051213 | |||
| 888 | JGI24739J22299_10010254 | |||
| 889 | JGI25150J39212_1012314 | |||
| 890 | JGI25159J45721_1000390 | |||
| 891 | JGI25159J45721_1010269 | |||
| 892 | JGI25159J45721_1012861 | |||
| 893 | JGI25151J46595_10001225 | |||
| 894 | JGI25151J46595_10006750 | |||
| 895 | JGI25151J46595_10037321 | |||
| 896 | JGI25151J46595_10060861 | |||
| 897 | JGI25160J50197_1000587 | |||
| 898 | JGI25160J50197_1014447 | |||
| 899 | JGI25161J50226_1000046 | |||
| 900 | JGI25161J50226_1005707 | |||
| 901 | Ga0055532_1007099 | |||
| 902 | Ga0055535_1000168 | |||
| 903 | Ga0055542_1000214 | |||
| 904 | Ga0055526_1001336 | |||
| 905 | Ga0055537_1000333 | |||
| 906 | Ga0055537_1003849 | |||
| 907 | Ga0055536_1004071 | |||
| 908 | Ga0055536_1006559 | |||
| 909 | Ga0055536_1011290 | |||
| 910 | Ga0055536_1043816 | |||
| 911 | Ga0055536_1057284 | |||
| 912 | Ga0055534_1000265 | |||
| 913 | Ga0055534_1002007 | |||
| 914 | Ga0055528_1000471 | |||
| 915 | Ga0055530_10001300 | |||
| 916 | Ga0055530_10007015 | |||
| 917 | Ga0055540_1002601 | |||
| 918 | Ga0055540_1003978 | |||
| 919 | Ga0055540_1006814 | |||
| 920 | Ga0055540_1013260 | |||
| 921 | Ga0055531_10000572 | |||
| 922 | Ga0055531_10015360 | |||
| 923 | Ga0055531_10021056 | |||
| 924 | Ga0055543_1000270 | |||
| 925 | Ga0055543_1011478 | |||
| 926 | Ga0065165_1004394 | |||
| 927 | Ga0065165_1008423 | |||
| 928 | Ga0065165_1012613 | |||
| 929 | Ga0065714_10009479 | |||
| 930 | Ga0065714_10018383 | |||
| 931 | Ga0065715_10212643 | |||
| 932 | Ga0070658_10018845 | |||
| 933 | Ga0070676_10005193 | |||
| 934 | Ga0070683_100033594 | |||
| 935 | Ga0070683_100042013 | |||
| 936 | Ga0070683_100179259 | |||
| 937 | Ga0070690_100159010 | |||
| 938 | Ga0070670_100002652 | |||
| 939 | Ga0070670_100174947 | |||
| 940 | Ga0070670_100196264 | |||
| 941 | Ga0070670_100337005 | |||
| 942 | Ga0070670_100349021 | |||
| 943 | Ga0070670_100405685 | |||
| 944 | Ga0070677_10141003 | |||
| 945 | Ga0070677_10148111 | |||
| 946 | Ga0070677_10252158 | |||
| 947 | Ga0068869_100267115 | |||
| 948 | Ga0068869_100368423 | |||
| 949 | Ga0070666_10041789 | |||
| 950 | Ga0070680_100003929 | |||
| 951 | Ga0070682_100009730 | |||
| 952 | Ga0068868_100012831 | |||
| 953 | Ga0068868_100024677 | |||
| 954 | Ga0068868_100102210 | |||
| 955 | Ga0070660_100021211 | |||
| 956 | Ga0070689_100099158 | |||
| 957 | Ga0070689_100329583 | |||
| 958 | Ga0070661_100055057 | |||
| 959 | Ga0070661_100113482 | |||
| 960 | Ga0070668_100034263 | |||
| 961 | Ga0070669_100095509 | |||
| 962 | Ga0070675_100000243 | |||
| 963 | Ga0070675_100049676 | |||
| 964 | Ga0070675_100074036 | |||
| 965 | Ga0070675_100118973 | |||
| 966 | Ga0070675_100325853 | |||
| 967 | Ga0070671_100006003 | |||
| 968 | Ga0070671_100118534 | |||
| 969 | Ga0070674_100079750 | |||
| 970 | Ga0070673_100488441 | |||
| 971 | Ga0070688_100075652 | |||
| 972 | Ga0070688_100091088 | |||
| 973 | Ga0070667_100004597 | |||
| 974 | Ga0070667_100010689 | |||
| 975 | Ga0070667_100087475 | |||
| 976 | Ga0070667_100256133 | |||
| 977 | Ga0070667_100544065 | |||
| 978 | Ga0070713_100040282 | |||
| 979 | Ga0070713_100395031 | |||
| 980 | Ga0070694_100467155 | |||
| 981 | Ga0070708_100157330 | |||
| 982 | Ga0070678_100003356 | |||
| 983 | Ga0070678_100027877 | |||
| 984 | Ga0070678_100375644 | |||
| 985 | Ga0070662_100061150 | |||
| 986 | Ga0070662_100431390 | |||
| 987 | Ga0070662_100432137 | |||
| 988 | Ga0070681_10017373 | |||
| 989 | Ga0070681_10585894 | |||
| 990 | Ga0068867_100000070 | |||
| 991 | Ga0068867_100001303 | |||
| 992 | Ga0068867_100069326 | |||
| 993 | Ga0068867_100142732 | |||
| 994 | Ga0070685_10144850 | |||
| 995 | Ga0070685_10185263 | |||
| 996 | Ga0070706_100052079 | |||
| 997 | Ga0070706_100093757 | |||
| 998 | Ga0070707_100453004 | |||
| 999 | Ga0070698_100041385 | |||
| 1000 | Ga0070698_100079874 | |||
| 1001 | Ga0070698_100106590 | |||
| 1002 | Ga0070698_100227194 | |||
| 1003 | Ga0070679_100183922 | |||
| 1004 | Ga0070684_100015745 | |||
| 1005 | Ga0068853_100118500 | |||
| 1006 | Ga0068853_100336849 | |||
| 1007 | Ga0068853_100354295 | |||
| 1008 | Ga0070672_100002056 | |||
| 1009 | Ga0070672_100013934 | |||
| 1010 | Ga0070672_100073770 | |||
| 1011 | Ga0070672_100393632 | |||
| 1012 | Ga0070686_100166977 | |||
| 1013 | Ga0070665_100040676 | |||
| 1014 | Ga0070665_100365877 | |||
| 1015 | Ga0070665_100376080 | |||
| 1016 | Ga0070664_100085331 | |||
| 1017 | Ga0070664_100187735 | |||
| 1018 | Ga0070664_100210478 | |||
| 1019 | Ga0070664_100229438 | |||
| 1020 | Ga0070664_100472252 | |||
| 1021 | Ga0068857_100064216 | |||
| 1022 | Ga0068856_100024423 | |||
| 1023 | Ga0068856_100255077 | |||
| 1024 | Ga0070702_100319298 | |||
| 1025 | Ga0068852_100094926 | |||
| 1026 | Ga0068852_100100747 | |||
| 1027 | Ga0068852_100524008 | |||
| 1028 | Ga0068859_100000664 | |||
| 1029 | Ga0068859_100030244 | |||
| 1030 | Ga0068859_100136827 | |||
| 1031 | Ga0068864_100000649 | |||
| 1032 | Ga0068864_100012522 | |||
| 1033 | Ga0068861_100204172 | |||
| 1034 | Ga0068863_100029931 | |||
| 1035 | Ga0068863_100098457 | |||
| 1036 | Ga0068863_100235284 | |||
| 1037 | Ga0068863_100619755 | |||
| 1038 | Ga0068858_100000753 | |||
| 1039 | Ga0068858_100088379 | |||
| 1040 | Ga0068860_100002764 | |||
| 1041 | Ga0068862_100120065 | |||
| 1042 | Ga0068862_100290676 | |||
| 1043 | Ga0070717_10323965 | |||
| 1044 | Ga0075365_10012259 | |||
| 1045 | Ga0075365_10079420 | |||
| 1046 | Ga0075365_10096667 | |||
| 1047 | Ga0075365_10120190 | |||
| 1048 | Ga0075365_10185954 | |||
| 1049 | Ga0075363_100197864 | |||
| 1050 | Ga0075364_10005816 | |||
| 1051 | Ga0075364_10010345 | |||
| 1052 | Ga0075364_10125768 | |||
| 1053 | Ga0075432_10017095 | |||
| 1054 | Ga0075432_10020342 | |||
| 1055 | Ga0070716_100287477 | |||
| 1056 | Ga0070712_100170383 | |||
| 1057 | Ga0075362_10007426 | |||
| 1058 | Ga0075362_10027898 | |||
| 1059 | Ga0075362_10035193 | |||
| 1060 | Ga0075362_10036824 | |||
| 1061 | Ga0075362_10086376 | |||
| 1062 | Ga0075362_10095301 | |||
| 1063 | Ga0075362_10161603 | |||
| 1064 | Ga0075367_10043210 | |||
| 1065 | Ga0075367_10058404 | |||
| 1066 | Ga0075367_10092164 | |||
| 1067 | Ga0075367_10114642 | |||
| 1068 | Ga0075367_10120299 | |||
| 1069 | Ga0075369_10114381 | |||
| 1070 | Ga0075366_10002264 | |||
| 1071 | Ga0075366_10004609 | |||
| 1072 | Ga0075366_10007302 | |||
| 1073 | Ga0075366_10023123 | |||
| 1074 | Ga0075366_10048512 | |||
| 1075 | Ga0075366_10085314 | |||
| 1076 | Ga0097621_100018401 | |||
| 1077 | Ga0097621_100030835 | |||
| 1078 | Ga0097621_100292723 | |||
| 1079 | Ga0097621_100299508 | |||
| 1080 | Ga0075370_10000228 | |||
| 1081 | Ga0075370_10001803 | |||
| 1082 | Ga0075370_10003908 | |||
| 1083 | Ga0075370_10008651 | |||
| 1084 | Ga0075370_10024701 | |||
| 1085 | Ga0075370_10025174 | |||
| 1086 | Ga0068871_100220351 | |||
| 1087 | Ga0075428_100002520 | |||
| 1088 | Ga0075430_100022035 | |||
| 1089 | Ga0075430_100023654 | |||
| 1090 | Ga0075430_100066535 | |||
| 1091 | Ga0075430_100088625 | |||
| 1092 | Ga0075430_100133493 | |||
| 1093 | Ga0075431_100006591 | |||
| 1094 | Ga0075431_100014970 | |||
| 1095 | Ga0075431_100023387 | |||
| 1096 | Ga0075431_100155537 | |||
| 1097 | Ga0075429_100000655 | |||
| 1098 | Ga0075429_100035877 | |||
| 1099 | Ga0075429_100106064 | |||
| 1100 | Ga0075429_100191372 | |||
| 1101 | Ga0097620_100000664 | |||
| 1102 | Ga0097620_100030244 | |||
| 1103 | Ga0097620_100136824 | |||
| 1104 | Ga0079104_1027794 | |||
| 1105 | Ga0099826_10005686 | |||
| 1106 | Ga0105244_10007097 | |||
| 1107 | Ga0105244_10019619 | |||
| 1108 | Ga0105240_10031052 | |||
| 1109 | Ga0105240_10297992 | |||
| 1110 | Ga0105240_10447420 | |||
| 1111 | Ga0105240_10879982 | |||
| 1112 | Ga0111539_10003696 | |||
| 1113 | Ga0105245_10061457 | |||
| 1114 | Ga0105245_10431885 | |||
| 1115 | Ga0105245_10663695 | |||
| 1116 | Ga0105245_10685939 | |||
| 1117 | Ga0105245_10703366 | |||
| 1118 | Ga0105247_10051958 | |||
| 1119 | Ga0114129_10002274 | |||
| 1120 | Ga0114129_10094036 | |||
| 1121 | Ga0114129_10586999 | |||
| 1122 | Ga0105243_10001208 | |||
| 1123 | Ga0105243_10007703 | |||
| 1124 | Ga0105243_10013939 | |||
| 1125 | Ga0105243_10026405 | |||
| 1126 | Ga0105243_10041812 | |||
| 1127 | Ga0105243_10698990 | |||
| 1128 | Ga0105241_10148805 | |||
| 1129 | Ga0105241_10157151 | |||
| 1130 | Ga0105241_10532658 | |||
| 1131 | Ga0105248_10011097 | |||
| 1132 | Ga0105248_10069550 | |||
| 1133 | Ga0105248_10378799 | |||
| 1134 | Ga0105248_10618214 | |||
| 1135 | Ga0105248_10630500 | |||
| 1136 | Ga0105237_10212465 | |||
| 1137 | Ga0105237_10679567 | |||
| 1138 | Ga0105238_10078324 | |||
| 1139 | Ga0105238_10606787 | |||
| 1140 | Ga0105249_10439956 | |||
| 1141 | Ga0105239_10064107 | |||
| 1142 | Ga0105239_10331024 | |||
| 1143 | Ga0105239_10532982 | |||
| 1144 | Ga0105239_10572321 | |||
| 1145 | Ga0105239_10738217 | |||
| 1146 | Ga0105246_10013882 | |||
| 1147 | Ga0105246_10132797 | |||
| 1148 | Ga0105246_10296835 | |||
| 1149 | Ga0105246_10493005 | |||
| 1150 | Ga0157347_1000563 | |||
| 1151 | Ga0157373_10084081 | |||
| 1152 | Ga0157373_10109007 | |||
| 1153 | Ga0157373_10261534 | |||
| 1154 | Ga0157371_10027537 | |||
| 1155 | Ga0157370_10082149 | |||
| 1156 | Ga0157370_10297837 | |||
| 1157 | Ga0157370_10309710 | |||
| 1158 | Ga0157369_10580726 | |||
| 1159 | Ga0157374_10084414 | |||
| 1160 | Ga0157374_10449028 | |||
| 1161 | Ga0157378_10071357 | |||
| 1162 | Ga0157378_10137756 | |||
| 1163 | Ga0157378_10237392 | |||
| 1164 | Ga0157372_10144063 | |||
| 1165 | Ga0157375_10053283 | |||
| 1166 | Ga0157375_10313441 | |||
| 1167 | Ga0163163_10003252 | |||
| 1168 | Ga0157380_10022495 | |||
| 1169 | Ga0182008_10003688 | |||
| 1170 | Ga0157377_10000016 | |||
| 1171 | Ga0157377_10062758 | |||
| 1172 | Ga0157379_10000301 | |||
| 1173 | Ga0157379_10010265 | |||
| 1174 | Ga0157379_10268739 | |||
| 1175 | Ga0157376_10034048 | |||
| 1176 | Ga0157376_10108770 | |||
| 1177 | Ga0182006_1005503 | |||
| 1178 | Ga0182007_10004544 | |||
| 1179 | Ga0183362_10015 | |||
| 1180 | Ga0163161_10000669 | |||
| 1181 | Ga0163161_10026203 | |||
| 1182 | Ga0163161_10081773 | |||
| 1183 | Ga0206353_10306862 | |||
| 1184 | Ga0206353_10394074 | |||
| 1185 | Ga0209436_106237 | |||
| 1186 | Ga0209436_107795 | |||
| 1187 | Ga0209672_101344 | |||
| 1188 | Ga0209147_100697 | |||
| 1189 | Ga0209258_100015 | |||
| 1190 | Ga0207425_1000696 | |||
| 1191 | Ga0207425_1000776 | |||
| 1192 | Ga0209148_1000183 | |||
| 1193 | Ga0209129_1000049 | |||
| 1194 | Ga0209129_1005391 | |||
| 1195 | Ga0209129_1014409 | |||
| 1196 | Ga0209565_1000357 | |||
| 1197 | Ga0209565_1000550 | |||
| 1198 | Ga0209565_1000670 | |||
| 1199 | Ga0209565_1001468 | |||
| 1200 | Ga0209565_1001490 | |||
| 1201 | Ga0209673_1000849 | |||
| 1202 | Ga0209673_1004621 | |||
| 1203 | Ga0209673_1008553 | |||
| 1204 | Ga0209130_1000064 | |||
| 1205 | Ga0209130_1002259 | |||
| 1206 | Ga0209130_1011129 | |||
| 1207 | Ga0209130_1014792 | |||
| 1208 | Ga0209675_1000352 | |||
| 1209 | Ga0209675_1006237 | |||
| 1210 | Ga0209675_1008030 | |||
| 1211 | Ga0209675_1008455 | |||
| 1212 | Ga0209675_1012241 | |||
| 1213 | Ga0209675_1013501 | |||
| 1214 | Ga0209676_1000137 | |||
| 1215 | Ga0209676_1000385 | |||
| 1216 | Ga0209676_1000873 | |||
| 1217 | Ga0209676_1008682 | |||
| 1218 | Ga0209676_1014082 | |||
| 1219 | Ga0209676_1026183 | |||
| 1220 | Ga0209676_1037926 | |||
| 1221 | Ga0209676_1049210 | |||
| 1222 | Ga0209025_1000290 | |||
| 1223 | Ga0209025_1000313 | |||
| 1224 | Ga0209025_1004032 | |||
| 1225 | Ga0209025_1005627 | |||
| 1226 | Ga0209025_1014190 | |||
| 1227 | Ga0209025_1017484 | |||
| 1228 | Ga0209025_1026212 | |||
| 1229 | Ga0209025_1041743 | |||
| 1230 | Ga0209025_1044488 | |||
| 1231 | Ga0209025_1101095 | |||
| 1232 | Ga0209564_1001545 | |||
| 1233 | Ga0209564_1005054 | |||
| 1234 | Ga0209564_1009323 | |||
| 1235 | Ga0209564_1017154 | |||
| 1236 | Ga0209758_1000135 | |||
| 1237 | Ga0209758_1021212 | |||
| 1238 | Ga0209050_1000015 | |||
| 1239 | Ga0209050_1001437 | |||
| 1240 | Ga0209050_1001535 | |||
| 1241 | Ga0209050_1012559 | |||
| 1242 | Ga0209050_1025028 | |||
| 1243 | Ga0209256_1000129 | |||
| 1244 | Ga0209256_1000224 | |||
| 1245 | Ga0207426_1000062 | |||
| 1246 | Ga0207426_1000171 | |||
| 1247 | Ga0207426_1000185 | |||
| 1248 | Ga0207426_1028013 | |||
| 1249 | Ga0209051_1000010 | |||
| 1250 | Ga0209051_1000137 | |||
| 1251 | Ga0209051_1000859 | |||
| 1252 | Ga0209051_1001741 | |||
| 1253 | Ga0209051_1027477 | |||
| 1254 | Ga0209257_1000026 | |||
| 1255 | Ga0209257_1000205 | |||
| 1256 | Ga0209257_1009859 | |||
| 1257 | Ga0209257_1025887 | |||
| 1258 | Ga0209257_1034087 | |||
| 1259 | Ga0207655_1002202 | |||
| 1260 | Ga0207655_1011626 | |||
| 1261 | Ga0207682_10025165 | |||
| 1262 | Ga0207682_10028656 | |||
| 1263 | Ga0207682_10034600 | |||
| 1264 | Ga0207688_10031306 | |||
| 1265 | Ga0207688_10325953 | |||
| 1266 | Ga0207680_10000566 | |||
| 1267 | Ga0207645_10003718 | |||
| 1268 | Ga0207645_10006702 | |||
| 1269 | Ga0207645_10079872 | |||
| 1270 | Ga0207645_10169503 | |||
| 1271 | Ga0207645_10189834 | |||
| 1272 | Ga0207643_10064933 | |||
| 1273 | Ga0207705_10076227 | |||
| 1274 | Ga0207705_10304663 | |||
| 1275 | Ga0207684_10049311 | |||
| 1276 | Ga0207684_10065153 | |||
| 1277 | Ga0207654_10071676 | |||
| 1278 | Ga0207707_10121329 | |||
| 1279 | Ga0207707_10351381 | |||
| 1280 | Ga0207707_10364070 | |||
| 1281 | Ga0207695_10255734 | |||
| 1282 | Ga0207695_10273749 | |||
| 1283 | Ga0207671_10323953 | |||
| 1284 | Ga0207693_10249022 | |||
| 1285 | Ga0207660_10026708 | |||
| 1286 | Ga0207660_10107720 | |||
| 1287 | Ga0207657_10020418 | |||
| 1288 | Ga0207649_10085490 | |||
| 1289 | Ga0207649_10321124 | |||
| 1290 | Ga0207652_10417514 | |||
| 1291 | Ga0207646_10279427 | |||
| 1292 | Ga0207681_10433476 | |||
| 1293 | Ga0207694_10008501 | |||
| 1294 | Ga0207650_10077471 | |||
| 1295 | Ga0207650_10233208 | |||
| 1296 | Ga0207650_10386728 | |||
| 1297 | Ga0207650_10394036 | |||
| 1298 | Ga0207650_10552700 | |||
| 1299 | Ga0207659_10000413 | |||
| 1300 | Ga0207659_10017569 | |||
| 1301 | Ga0207659_10142919 | |||
| 1302 | Ga0207687_10009580 | |||
| 1303 | Ga0207687_10164241 | |||
| 1304 | Ga0207687_10511087 | |||
| 1305 | Ga0207700_10001789 | |||
| 1306 | Ga0207700_10024086 | |||
| 1307 | Ga0207664_10066473 | |||
| 1308 | Ga0207664_10101440 | |||
| 1309 | Ga0207644_10010403 | |||
| 1310 | Ga0207706_10084575 | |||
| 1311 | Ga0207706_10137470 | |||
| 1312 | Ga0207706_10287226 | |||
| 1313 | Ga0207709_10000497 | |||
| 1314 | Ga0207709_10002246 | |||
| 1315 | Ga0207709_10002795 | |||
| 1316 | Ga0207709_10010832 | |||
| 1317 | Ga0207709_10015245 | |||
| 1318 | Ga0207709_10111539 | |||
| 1319 | Ga0207709_10217002 | |||
| 1320 | Ga0207670_10007925 | |||
| 1321 | Ga0207669_10168371 | |||
| 1322 | Ga0207704_10083490 | |||
| 1323 | Ga0207691_10001908 | |||
| 1324 | Ga0207691_10016734 | |||
| 1325 | Ga0207691_10139896 | |||
| 1326 | Ga0207691_10367217 | |||
| 1327 | Ga0207711_10008859 | |||
| 1328 | Ga0207711_10331264 | |||
| 1329 | Ga0207689_10015963 | |||
| 1330 | Ga0207689_10121373 | |||
| 1331 | Ga0207689_10229528 | |||
| 1332 | Ga0207689_10365115 | |||
| 1333 | Ga0207661_10013534 | |||
| 1334 | Ga0207661_10100682 | |||
| 1335 | Ga0207679_10145615 | |||
| 1336 | Ga0207679_10205848 | |||
| 1337 | Ga0207679_10216171 | |||
| 1338 | Ga0207667_10046884 | |||
| 1339 | Ga0207667_10893316 | |||
| 1340 | Ga0207651_10716247 | |||
| 1341 | Ga0207712_10212258 | |||
| 1342 | Ga0207668_10253104 | |||
| 1343 | Ga0207658_10001221 | |||
| 1344 | Ga0207658_10032821 | |||
| 1345 | Ga0207658_10064314 | |||
| 1346 | Ga0207658_10153852 | |||
| 1347 | Ga0207658_10435728 | |||
| 1348 | Ga0207677_10018017 | |||
| 1349 | Ga0207677_10180352 | |||
| 1350 | Ga0207703_10003078 | |||
| 1351 | Ga0207703_10003611 | |||
| 1352 | Ga0207639_10038115 | |||
| 1353 | Ga0207639_10051648 | |||
| 1354 | Ga0207639_10394410 | |||
| 1355 | Ga0207678_10138648 | |||
| 1356 | Ga0207708_10153647 | |||
| 1357 | Ga0207702_10308544 | |||
| 1358 | Ga0207641_10005904 | |||
| 1359 | Ga0207641_10007144 | |||
| 1360 | Ga0207641_10280201 | |||
| 1361 | Ga0207648_10000412 | |||
| 1362 | Ga0207648_10051461 | |||
| 1363 | Ga0207648_10069509 | |||
| 1364 | Ga0207676_10000325 | |||
| 1365 | Ga0207674_10107915 | |||
| 1366 | Ga0207674_10256622 | |||
| 1367 | Ga0207675_100202618 | |||
| 1368 | Ga0207675_100568113 | |||
| 1369 | Ga0207683_10008809 | |||
| 1370 | Ga0207683_10020874 | |||
| 1371 | Ga0207683_10087829 | |||
| 1372 | Ga0207683_10135210 | |||
| 1373 | Ga0207698_10077634 | |||
| 1374 | Ga0207698_10096942 | |||
| 1375 | Ga0207698_10128833 | |||
| 1376 | Ga0207698_10169152 | |||
| 1377 | Ga0207698_10429150 | |||
| 1378 | Ga0209281_1027790 | |||
| 1379 | Ga0209996_1017914 | |||
| 1380 | Ga0209999_1032322 | |||
| 1381 | Ga0209970_1000334 | |||
| 1382 | Ga0209282_1007723 | |||
| 1383 | Ga0209971_1016084 | |||
| 1384 | Ga0209974_10017668 | |||
| 1385 | Ga0207428_10000824 | |||
| 1386 | Ga0207428_10017418 | |||
| 1387 | Ga0268266_10074109 | |||
| 1388 | Ga0268266_10151507 | |||
| 1389 | Ga0268265_10274912 | |||
| 1390 | Ga0268264_10003593 | |||
| 1391 | Ga0265337_1073786 | |||
| 1392 | Ga0265326_10012895 | |||
| 1393 | Ga0265319_1000367 | |||
| 1394 | Ga0265319_1013479 | |||
| 1395 | Ga0265334_10011419 | |||
| 1396 | Ga0265334_10057203 | |||
| 1397 | Ga0265318_10001025 | |||
| 1398 | Ga0265318_10003382 | |||
| 1399 | Ga0265322_10003200 | |||
| 1400 | Ga0265322_10024147 | |||
| 1401 | Ga0307517_10000575 | |||
| 1402 | Ga0307517_10155712 | |||
| 1403 | Ga0307515_10000022 | |||
| 1404 | Ga0307515_10000063 | |||
| 1405 | Ga0307515_10000150 | |||
| 1406 | Ga0307515_10014322 | |||
| 1407 | Ga0307515_10199232 | |||
| 1408 | Ga0307515_10265982 | |||
| 1409 | Ga0265338_10005122 | |||
| 1410 | Ga0265338_10007410 | |||
| 1411 | Ga0265338_10020018 | |||
| 1412 | Ga0307512_10242964 | |||
| 1413 | Ga0316183_1162120 | |||
| 1414 | Ga0316181_1135666 | |||
| 1415 | Ga0265330_10010400 | |||
| 1416 | Ga0265332_10000023 | |||
| 1417 | Ga0265332_10008558 | |||
| 1418 | Ga0265328_10006812 | |||
| 1419 | Ga0265320_10003780 | |||
| 1420 | Ga0265320_10150151 | |||
| 1421 | Ga0265325_10004086 | |||
| 1422 | Ga0265325_10034519 | |||
| 1423 | Ga0265329_10003362 | |||
| 1424 | Ga0265329_10011121 | |||
| 1425 | Ga0265340_10002165 | |||
| 1426 | Ga0265339_10039650 | |||
| 1427 | Ga0265331_10021197 | |||
| 1428 | Ga0265327_10001540 | |||
| 1429 | Ga0265327_10006888 | |||
| 1430 | Ga0265327_10015936 | |||
| 1431 | Ga0265327_10031540 | |||
| 1432 | Ga0265327_10054966 | |||
| 1433 | Ga0265316_10007267 | |||
| 1434 | Ga0265316_10017319 | |||
| 1435 | Ga0307513_10000008 | |||
| 1436 | Ga0307513_10000991 | |||
| 1437 | Ga0307513_10003892 | |||
| 1438 | Ga0307513_10042874 | |||
| 1439 | Ga0307513_10117878 | |||
| 1440 | Ga0307513_10167140 | |||
| 1441 | Ga0307509_10185819 | |||
| 1442 | Ga0307408_100025723 | |||
| 1443 | Ga0307408_100072514 | |||
| 1444 | Ga0307408_100158334 | |||
| 1445 | Ga0307408_100279201 | |||
| 1446 | Ga0307408_100452879 | |||
| 1447 | Ga0265313_10012870 | |||
| 1448 | Ga0307508_10025941 | |||
| 1449 | Ga0307508_10255514 | |||
| 1450 | Ga0307514_10088477 | |||
| 1451 | Ga0265314_10004327 | |||
| 1452 | Ga0265314_10066252 | |||
| 1453 | Ga0265314_10163357 | |||
| 1454 | Ga0265342_10004057 | |||
| 1455 | Ga0265342_10024334 | |||
| 1456 | Ga0265342_10164497 | |||
| 1457 | Ga0307516_10003416 | |||
| 1458 | Ga0307516_10059990 | |||
| 1459 | Ga0307516_10075653 | |||
| 1460 | Ga0307516_10194636 | |||
| 1461 | Ga0307405_10060904 | |||
| 1462 | Ga0307405_10114576 | |||
| 1463 | Ga0307405_10241803 | |||
| 1464 | Ga0307405_10330842 | |||
| 1465 | Ga0307405_10354883 | |||
| 1466 | Ga0307413_10156571 | |||
| 1467 | Ga0307406_10001780 | |||
| 1468 | Ga0307412_10011307 | |||
| 1469 | Ga0307412_10011375 | |||
| 1470 | Ga0307412_10013346 | |||
| 1471 | Ga0307412_10056521 | |||
| 1472 | Ga0307412_10088252 | |||
| 1473 | Ga0307409_100598207 | |||
| 1474 | Ga0307416_100065389 | |||
| 1475 | Ga0307416_100093414 | |||
| 1476 | Ga0307416_100094168 | |||
| 1477 | Ga0307416_100193529 | |||
| 1478 | Ga0307416_100383522 | |||
| 1479 | Ga0307411_10541489 | |||
| 1480 | Ga0307510_10007192 | |||
| 1481 | Ga0307510_10009118 | |||
| 1482 | Ga0373945_0087675 | |||
| 1483 | Ga0373953_0122803 | |||
| 1484 | Ga0373933_0607455 | |||
| 1485 | Ga0373937_0057398 | |||
| 1486 | Ga0373937_0288848 | |||
| 1487 | Ga0373925_0164444 | |||
| 1488 | Ga0373925_0323310 | |||
| 1489 | Ga0395899_0012760 | |||
| 1490 | Ga0395899_0014438 | |||
| 1491 | Ga0395900_0171716 | |||
| 1492 | Ga0395900_0230152 | |||
| 1493 | Ga0395898_0235391 | |||
| 1494 | Ga0395905_0000027 | |||
| 1495 | Ga0395905_0000042 | |||
| 1496 | Ga0395905_0007865 | |||
| 1497 | Ga0395905_0031330 | |||
| 1498 | Ga0395905_0050716 | |||
| 1499 | Ga0395905_0098863 | |||
| 1500 | Ga0395905_0391802 | |||
| 1501 | Ga0395901_0046478 | |||
| 1502 | Ga0395901_0145661 | |||
| 1503 | Ga0395901_0163945 | |||
| 1504 | Ga0242420_013191 | |||
| 1505 | Ga0436365_1276969 | |||
| 1506 | Ga0439436_0008478 | |||
| 1507 | Ga0439453_0024676 | |||
| 1508 | Ga0439461_0018517 | |||
| 1509 | Ga0439465_0013016 | |||
| 1510 | Ga0439431_0009348 | |||
| 1511 | Ga0439432_071909 | |||
| 1512 | Ga0439449_0001315 | |||
| 1513 | Ga0439449_0008350 | |||
| 1514 | Ga0439449_0019433 | |||
| 1515 | Ga0439449_0041902 | |||
| 1516 | Ga0439452_011363 | |||
| 1517 | Ga0439457_005550 | |||
| 1518 | Ga0439462_0006722 | |||
| 1519 | Ga0450894_011448 | |||
| 1520 | Ga0450898_004687 | |||
| 1521 | Ga0450906_004729 | |||
| 1522 | Ga0450906_009634 | |||
| 1523 | Ga0439446_0071353 | |||
| 1524 | Ga0450908_013841 | |||
| 1525 | Ga0439434_0049332 | |||
| 1526 | Ga0439464_0033666 | |||
| 1527 | Ga0439464_0055069 | |||
| 1528 | Ga0451577_0041221 | |||
| 1529 | Ga0451577_0142894 | |||
| 1530 | Ga0466969_0010253 | |||
| 1531 | Ga0453683_0032805 | |||
| 1532 | Ga0466965_0046594 | |||
| 1533 | Ga0466961_0114125 | |||
| 1534 | Ga0466963_0008273 | |||
| 1535 | Ga0466963_0322912 | |||
| 1536 | Ga0453684_0186465 | |||
| 1537 | Ga0466957_0262128 | |||
| 1538 | Ga0466960_0053041 | |||
| 1539 | Ga0466960_0114552 | |||
| 1540 | Ga0451576_0124355 | |||
| 1541 | Ga0466958_0474425 | |||
| 1542 | Ga0466967_0224909 | |||
| 1543 | Ga0466967_0698893 | |||
| 1544 | Ga0495592_0361789 | |||
| 1545 | Ga0495638_0019461 | |||
| 1546 | Ga0495638_0031274 | |||
| 1547 | Ga0495651_0072210 | |||
| 1548 | Ga0495580_0157787 | |||
| 1549 | Ga0495580_0203219 | |||
| 1550 | Ga0495664_0143246 | |||
| 1551 | Ga0495608_0189926 | |||
| 1552 | Ga0495608_0243199 | |||
| 1553 | Ga0495610_0011528 | |||
| 1554 | Ga0495610_0032973 | |||
| 1555 | Ga0495616_0001839 | |||
| 1556 | Ga0495628_0095150 | |||
| 1557 | Ga0495631_0025535 | |||
| 1558 | Ga0495632_0004875 | |||
| 1559 | Ga0495637_0026522 | |||
| 1560 | Ga0495663_0056141 | |||
| 1561 | Ga0495642_0119600 | |||
| 1562 | Ga0495654_0004374 | |||
| 1563 | Ga0495587_0046189 | |||
| 1564 | Ga0495587_0366428 | |||
| 1565 | Ga0495621_0047681 | |||
| 1566 | Ga0495656_0000047 | |||
| 1567 | Ga0495668_0240129 | |||
| 1568 | Ga0495634_0087469 | |||
| 1569 | Ga0495625_0003370 | |||
| 1570 | Ga0495625_0033388 | |||
| 1571 | Ga0495625_0098189 | |||
| 1572 | Ga0495625_0109259 | |||
| 1573 | Ga0495635_0221126 | |||
| 1574 | Ga0495657_0299238 | |||
| 1575 | Ga0495624_0081410 | |||
| 1576 | Ga0495649_0005389 | |||
| 1577 | Ga0495600_0325308 | |||
| 1578 | Ga0495604_0363410 | |||
| 1579 | Ga0495636_0031751 | |||
| 1580 | Ga0495676_0060279 | |||
| 1581 | Ga0495680_0134425 | |||
| 1582 | Ga0495680_0353949 | |||
| 1583 | Ga0495687_004201 | |||
| 1584 | Ga0495687_017276 | |||
| 1585 | Ga0495687_024875 | |||
| 1586 | Ga0495602_0360428 | |||
| 1587 | Ga0496104_0101853 | |||
| 1588 | Ga0496105_0009425 | |||
| 1589 | Ga0496105_0296269 | |||
| 1590 | Ga0496105_0340112 | |||
| 1591 | Ga0496106_0266236 | |||
| 1592 | Ga0496108_0071269 | |||
| 1593 | Ga0496108_0121421 | |||
| 1594 | Ga0496108_0291528 | |||
| 1595 | Ga0496109_0467565 | |||
| 1596 | Ga0496110_0027012 | |||
| 1597 | Ga0496111_0093341 | |||
| 1598 | Ga0496112_0001247 | |||
| 1599 | Ga0496112_0110440 | |||
| 1600 | Ga0496112_0176519 | |||
| 1601 | Ga0496112_0328746 | |||
| 1602 | Ga0496114_0455189 | |||
| 1603 | Ga0496115_0146509 | |||
| 1604 | Ga0496115_0160164 | |||
| 1605 | Ga0496116_0017638 | |||
| 1606 | Ga0496117_0025305 | |||
| 1607 | Ga0496117_0088938 | |||
| 1608 | Ga0496118_0005780 | |||
| 1609 | Ga0496118_0038540 | |||
| 1610 | Ga0496121_0002801 | |||
| 1611 | Ga0496121_0013215 | |||
| 1612 | Ga0496121_0042409 | |||
| 1613 | Ga0496123_0061812 | |||
| 1614 | Ga0496124_0055194 | |||
| 1615 | Ga0496124_0222356 | |||
| 1616 | Ga0496125_0021834 | |||
| 1617 | Ga0501034_0015736 | |||
| 1618 | Ga0501034_0169399 | |||
| 1619 | Ga0501039_0043463 | |||
| 1620 | Ga0501047_0148674 | |||
| 1621 | Ga0501048_0337328 | |||
| 1622 | Ga0501067_0023439 | |||
| 1623 | Ga0501070_0009486 | |||
| 1624 | Ga0501071_0031132 | |||
| 1625 | Ga0501071_0071383 | |||
| 1626 | Ga0501072_0041603 | |||
| 1627 | Ga0501072_0057564 | |||
| 1628 | Ga0501073_0007466 | |||
| 1629 | Ga0501073_0075724 | |||
| 1630 | Ga0501074_0007038 | |||
| 1631 | Ga0501075_0022010 | |||
| 1632 | Ga0501075_0095570 | |||
| 1633 | Ga0501076_0006750 | |||
| 1634 | Ga0501206_013213 | |||
| 1635 | Ga0501207_030735 | |||
| 1636 | Ga0501249_011011 | |||
| 1637 | Ga0501257_018518 | |||
| 1638 | Ga0501079_0026176 | |||
| 1639 | Ga0501079_0053698 | |||
| 1640 | Ga0501079_0109339 | |||
| 1641 | Ga0501080_0001046 | |||
| 1642 | Ga0501080_0025808 | |||
| 1643 | Ga0501080_0038620 | |||
| 1644 | Ga0501083_0000684 | |||
| 1645 | Ga0501262_000493 | |||
| 1646 | Ga0501262_002025 | |||
| 1647 | Ga0501265_002350 | |||
| 1648 | Ga0501035_0203196 | |||
| 1649 | Ga0501044_0119947 | |||
| 1650 | nmdc:mga03683_10371_c1 | |||
| 1651 | nmdc:mga03683_107368_c1 | |||
| 1652 | nmdc:mga03683_6233_c1 | |||
| 1653 | nmdc:mga03683_6421_c1 | |||
| 1654 | nmdc:mga03n38_12480_c1 | |||
| 1655 | nmdc:mga03n38_154446_c1 | |||
| 1656 | nmdc:mga03n38_32739_c1 | |||
| 1657 | nmdc:mga03n38_51436_c1 | |||
| 1658 | nmdc:mga03n38_78368_c1 | |||
| 1659 | nmdc:mga00v17_41558_c1 | |||
| 1660 | nmdc:mga00v17_57650_c1 | |||
| 1661 | nmdc:mga0yw44_136519_c1 | |||
| 1662 | nmdc:mga0yw44_7818_c1 | |||
| 1663 | nmdc:mga0k408_104058_c1 | |||
| 1664 | nmdc:mga0k408_10924_c1 | |||
| 1665 | nmdc:mga0k408_17775_c1 | |||
| 1666 | nmdc:mga0k408_20558_c1 | |||
| 1667 | nmdc:mga0k408_43322_c1 | |||
| 1668 | nmdc:mga0k408_48562_c1 | |||
| 1669 | nmdc:mga0k408_51154_c1 | |||
| 1670 | nmdc:mga0k408_5868_c1 | |||
| 1671 | nmdc:mga06z11_34469_c1 | |||
| 1672 | nmdc:mga06z11_78453_c1 | |||
| 1673 | nmdc:mga07m45_11400_c1 | |||
| 1674 | nmdc:mga07m45_14982_c1 | |||
| 1675 | nmdc:mga07m45_20133_c1 | |||
| 1676 | nmdc:mga07m45_25742_c1 | |||
| 1677 | nmdc:mga07m45_33529_c1 | |||
| 1678 | nmdc:mga07m45_44884_c1 | |||
| 1679 | nmdc:mga07m45_65409_c1 | |||
| 1680 | nmdc:mga07m45_872_c1 | |||
| 1681 | nmdc:mga07m45_89452_c1 | |||
| 1682 | nmdc:mga05p37_481_c1 | |||
| 1683 | nmdc:mga05p37_75222_c1 | |||
| 1684 | nmdc:mga09592_37264_c1 | |||
| 1685 | nmdc:mga09592_46511_c1 | |||
| 1686 | nmdc:mga09592_61627_c1 | |||
| 1687 | nmdc:mga09592_663_c1 | |||
| 1688 | nmdc:mga0qj67_149614_c1 | |||
| 1689 | nmdc:mga0qj67_15458_c1 | |||
| 1690 | nmdc:mga0qj67_154651_c1 | |||
| 1691 | nmdc:mga0qj67_39409_c1 | |||
| 1692 | nmdc:mga06r32_32_c1 | |||
| 1693 | nmdc:mga06r32_367195_c1 | |||
| 1694 | nmdc:mga08y16_2608_c1 | |||
| 1695 | nmdc:mga0n895_243544_c1 | |||
| 1696 | nmdc:mga0sz30_45735_c1 | |||
| 1697 | nmdc:mga0sz30_7187_c1 | |||
| 1698 | Ga0500610_0043519 | |||
| 1699 | Ga0500610_0173412 | |||
| 1700 | Ga0500610_0210162 | |||
| 1701 | Ga0495619_0124531 | |||
| 1702 | Ga0500644_0007182 | |||
| 1703 | Ga0500644_0029832 | |||
| 1704 | Ga0500651_0000169 | |||
| 1705 | Ga0500651_0123118 | |||
| 1706 | Ga0500651_0173684 | |||
| 1707 | Ga0500641_0085904 | |||
| 1708 | Ga0500592_007280 | |||
| 1709 | Ga0500594_0004056 | |||
| 1710 | Ga0500608_034684 | |||
| 1711 | Ga0500658_0001494 | |||
| 1712 | Ga0500568_0112185 | |||
| 1713 | Ga0500627_0048483 | |||
| 1714 | Ga0500634_0061462 | |||
| 1715 | Ga0500645_000657 | |||
| 1716 | Ga0500645_008657 | |||
| 1717 | Ga0501084_0086944 | |||
| 1718 | Ga0501082_0265591 | |||
| 1719 | Ga0530510_0042453 | |||
| 1720 | 2511243524 | |||
| 1721 | 2513227332 | |||
| 1722 | 2548499289 | |||
| 1723 | 2599627103 | |||
| 1724 | 2599676536 | |||
| 1725 | 2599684804 | |||
| 1726 | 2599696760 | |||
| 1727 | 2643866122 | |||
| 1728 | 2643994112 | |||
| 1729 | 2644057654 | |||
| 1730 | 2644072259 | |||
| 1731 | 2644160064 | |||
| 1732 | 2644292936 | |||
| 1733 | 2644302028 | |||
| 1734 | 2644329453 | |||
| 1735 | 2644401025 | |||
| 1736 | 2644464275 | |||
| 1737 | 2644466350 | |||
| 1738 | 2644647952 | |||
| 1739 | 2738723457 | |||
| 1740 | 2738882243 | |||
| 1741 | 2739241928 | |||
| 1742 | 2739251222 | |||
| 1743 | 2739284188 | |||
| 1744 | 2816470770 | |||
| 1745 | 2819598172 | |||
| 1746 | 2831269159 | |||
| 1747 | 2838058589 | |||
| 1748 | 2842682428 | |||
| 1749 | 2885196445 | |||
| 1750 | 2885200020 | |||
| 1751 | 2885213750 | |||
| 1752 | 2899929594 | |||
| 1753 | 2904456407 | |||
| 1754 | 2904462916 | |||
| 1755 | 2904549064 | |||
| 1756 | 2919465834 | |||
| 1757 | 2919706164 | |||
| 1758 | 2928039963 | |||
| 1759 | 2928047288 | |||
| 1760 | 2928057508 | |||
| 1761 | 2928068106 | |||
| 1762 | 2928072691 | |||
| 1763 | 2928085854 | |||
| 1764 | 2928120189 | |||
| 1765 | 2929160692 | |||
| 1766 | 2929523771 | |||
| 1767 | 2939634120 | |||
| 1768 | 2945914812 | |||
| 1769 | 2945951123 | |||
| 1770 | 2945974219 | |||
| 1771 | 2945989789 | |||
| 1772 | 2990714177 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9706 | 1 | 240 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9627 | 1 | 240 |
| 3d31-assembly1.cif.gz_A | modbc from methanosarcina acetivorans | 0.936 | 6 | 229 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9358 | 6 | 226 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9231 | 5 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9672 | 1 | 239 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9632 | 1 | 239 | 3.40.50.300 |
| 1ji0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9622 | 1 | 240 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9612 | 6 | 238 | 3.40.50.300 |
| 1ji0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9582 | 1 | 240 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S3EXW3-F1-model_v4 | ABC transporter ATP-binding protein | 0.9797 | 6 | 238 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A417Z7G5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9782 | 4 | 240 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A496QUQ5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9761 | 5 | 239 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A7W1N4U0-F1-model_v4 | ABC transporter ATP-binding protein | 0.9724 | 4 | 239 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A3S3EXW3-F1-model_v4 | ABC transporter ATP-binding protein | 0.9715 | 6 | 238 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |