F484699

General Info

Members Datasets Scaffolds Average Seq Length
886 447 1772 254

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0051213|Ga0451577_0051213_456_1244
Length 262
Sequence MSDEVQSILQLNNVEAAYGAVKAIRGVSLAVPTGSIVTVLGSNGAGKTTILKTISGILDPQKGSIVFRHDKLEGRDPAWIVRQGLVHVPEGREIFPLLTVRENLLMGAYTRPASQREQVAKDIEDVFAYFPILKERRDQQAGLLSGGQQQMLAISRALLANPTMMLLDEPSLGLSPKLTREIFEIIVRINRERGVTLLVVEQNAHIALQYADYGYVLEIGRIVMHDTCAALREKDDIKEFYLGVKEAGVREGRRWKKKKQWR

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
204 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
208 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
215 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
216 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
217 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
218 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
219 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
220 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
224 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
225 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
226 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
230 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
231 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
235 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
236 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
237 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
238 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
239 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
240 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
241 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
242 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
248 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
253 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
265 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
266 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
267 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
268 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
269 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
270 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
271 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
272 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
273 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
274 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
275 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
276 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
277 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
278 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
279 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
280 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
281 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
282 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
283 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
284 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
285 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
286 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
287 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
290 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
293 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
294 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
299 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
300 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
307 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
308 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
313 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
319 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
333 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
337 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
338 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
341 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
342 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
356 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
357 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
358 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
363 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
375 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
380 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
383 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
384 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
385 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
386 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
387 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
388 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
389 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
390 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
391 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
392 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
396 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
397 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
398 2547132374 Acidovorax radicis N35 Isolate Unclassified
399 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
400 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
401 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
402 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
403 2643221570 Acidovorax sp. Root568 Isolate Unclassified
404 2643221596 Acidovorax sp. Root70 Isolate Unclassified
405 2643221609 Acidovorax sp. Root217 Isolate Unclassified
406 2643221611 Acidovorax sp. Root219 Isolate Unclassified
407 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
408 2643221652 Acidovorax sp. Root402 Isolate Unclassified
409 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
410 2643221658 Variovorax sp. Root411 Isolate Unclassified
411 2643221672 Variovorax sp. Root434 Isolate Unclassified
412 2643221683 Variovorax sp. Root473 Isolate Unclassified
413 2643221717 Acidovorax sp. Root267 Isolate Unclassified
414 2738541277 Variovorax sp. GV051 Isolate Unclassified
415 2738541307 Variovorax sp. GV008 Isolate Unclassified
416 2738543012 Acidovorax sp. CF301 Isolate Unclassified
417 2738543013 Variovorax sp. BT01 Isolate Unclassified
418 2738543019 Variovorax sp. GV040 Isolate Unclassified
419 2816332133 Acidovorax radicis 2721A Isolate Unclassified
420 2818991446 Variovorax sp. 1180 Isolate Unclassified
421 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
422 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
423 2842677519 Variovorax sp. R-72495 Isolate Unclassified
424 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
425 2885198086 Variovorax sp. 679 Isolate Unclassified
426 2885211737 Variovorax sp. 553 Isolate Unclassified
427 2899924645 Variovorax sp. 369 Isolate Unclassified
428 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
429 2904456579 Variovorax sp. 2002 Isolate Unclassified
430 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
431 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
432 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
433 2928037797 Variovorax sp. 1126 Isolate Unclassified
434 2928044640 Variovorax sp. 1128 Isolate Unclassified
435 2928051484 Variovorax sp. 1133 Isolate Unclassified
436 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
437 2928070936 Variovorax gossypii 1167 Isolate Unclassified
438 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
439 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
440 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
441 2929520902 Variovorax beijingensis 502 Isolate Unclassified
442 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
443 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
444 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
445 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
446 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
447 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.79
Metatranscriptomes 0.23
Isolates 5.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.69
Nodule 0.56
Rhizoplane 2.37
Rhizosphere 66.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0051213 3300042876 Bacteria 3686
2 JGI24739J22299_10010254 3300001989 Bacteria 3479
3 JGI25150J39212_1012314 3300002774 Bacteria 1518
4 JGI25159J45721_1000390 3300002987 Bacteria 20396
5 JGI25159J45721_1010269 3300002987 Bacteria 2399
6 JGI25159J45721_1012861 3300002987 Bacteria 1970
7 JGI25151J46595_10001225 3300003187 Bacteria 18346
8 JGI25151J46595_10006750 3300003187 Bacteria 5715
9 JGI25151J46595_10037321 3300003187 Bacteria 1823
10 JGI25151J46595_10060861 3300003187 Bacteria 1205
11 JGI25160J50197_1000587 3300003354 Bacteria 20382
12 JGI25160J50197_1014447 3300003354 Bacteria 2642
13 JGI25161J50226_1000046 3300003374 Bacteria 116165
14 JGI25161J50226_1005707 3300003374 Bacteria 2365
15 Ga0055532_1007099 3300003758 Bacteria 1460
16 Ga0055535_1000168 3300003761 Bacteria 70666
17 Ga0055542_1000214 3300003762 Bacteria 70682
18 Ga0055526_1001336 3300003771 Bacteria 17664
19 Ga0055537_1000333 3300003773 Bacteria 32239
20 Ga0055537_1003849 3300003773 Bacteria 4486
21 Ga0055536_1004071 3300003781 Bacteria 7608
22 Ga0055536_1006559 3300003781 Bacteria 5398
23 Ga0055536_1011290 3300003781 Bacteria 3442
24 Ga0055536_1043816 3300003781 Bacteria 1037
25 Ga0055536_1057284 3300003781 Bacteria 823
26 Ga0055534_1000265 3300003784 Bacteria 36441
27 Ga0055534_1002007 3300003784 Bacteria 7407
28 Ga0055528_1000471 3300003790 Bacteria 32238
29 Ga0055530_10001300 3300003791 Bacteria 18811
30 Ga0055530_10007015 3300003791 Bacteria 4852
31 Ga0055540_1002601 3300003792 Bacteria 9395
32 Ga0055540_1003978 3300003792 Bacteria 6882
33 Ga0055540_1006814 3300003792 Bacteria 4454
34 Ga0055540_1013260 3300003792 Bacteria 2531
35 Ga0055531_10000572 3300003794 Bacteria 32155
36 Ga0055531_10015360 3300003794 Bacteria 3380
37 Ga0055531_10021056 3300003794 Bacteria 2547
38 Ga0055543_1000270 3300004625 Bacteria 38712
39 Ga0055543_1011478 3300004625 Bacteria 1811
40 Ga0065165_1004394 3300005262 Bacteria 8786
41 Ga0065165_1008423 3300005262 Bacteria 4828
42 Ga0065165_1012613 3300005262 Bacteria 3426
43 Ga0065714_10009479 3300005288 Bacteria 2571
44 Ga0065714_10018383 3300005288 Bacteria 1653
45 Ga0065715_10212643 3300005293 Bacteria 1307
46 Ga0070658_10018845 3300005327 Bacteria 5529
47 Ga0070676_10005193 3300005328 Bacteria 6916
48 Ga0070683_100033594 3300005329 Bacteria 4679
49 Ga0070683_100042013 3300005329 Bacteria 4209
50 Ga0070683_100179259 3300005329 Bacteria 2011
51 Ga0070690_100159010 3300005330 Bacteria 1547
52 Ga0070670_100002652 3300005331 Bacteria 14794
53 Ga0070670_100174947 3300005331 Bacteria 1863
54 Ga0070670_100196264 3300005331 Bacteria 1753
55 Ga0070670_100337005 3300005331 Bacteria 1323
56 Ga0070670_100349021 3300005331 Bacteria 1300
57 Ga0070670_100405685 3300005331 Bacteria 1204
58 Ga0070677_10141003 3300005333 Bacteria 1112
59 Ga0070677_10148111 3300005333 Bacteria 1089
60 Ga0070677_10252158 3300005333 Bacteria 876
61 Ga0068869_100267115 3300005334 Bacteria 1371
62 Ga0068869_100368423 3300005334 Bacteria 1175
63 Ga0070666_10041789 3300005335 Bacteria 3065
64 Ga0070680_100003929 3300005336 Bacteria 11112
65 Ga0070682_100009730 3300005337 Bacteria 5444
66 Ga0068868_100012831 3300005338 Bacteria 6130
67 Ga0068868_100024677 3300005338 Bacteria 4564
68 Ga0068868_100102210 3300005338 Bacteria 2320
69 Ga0070660_100021211 3300005339 Bacteria 4787
70 Ga0070689_100099158 3300005340 Bacteria 2305
71 Ga0070689_100329583 3300005340 Bacteria 1277
72 Ga0070661_100055057 3300005344 Bacteria 2913
73 Ga0070661_100113482 3300005344 Bacteria 2025
74 Ga0070668_100034263 3300005347 Bacteria 3869
75 Ga0070669_100095509 3300005353 Bacteria 2235
76 Ga0070675_100000243 3300005354 Bacteria 35354
77 Ga0070675_100049676 3300005354 Bacteria 3443
78 Ga0070675_100074036 3300005354 Bacteria 2828
79 Ga0070675_100118973 3300005354 Bacteria 2243
80 Ga0070675_100325853 3300005354 Bacteria 1357
81 Ga0070671_100006003 3300005355 Bacteria 9679
82 Ga0070671_100118534 3300005355 Bacteria 2226
83 Ga0070674_100079750 3300005356 Bacteria 2336
84 Ga0070673_100488441 3300005364 Bacteria 1112
85 Ga0070688_100075652 3300005365 Bacteria 2165
86 Ga0070688_100091088 3300005365 Bacteria 1992
87 Ga0070667_100004597 3300005367 Bacteria 11595
88 Ga0070667_100010689 3300005367 Bacteria 7584
89 Ga0070667_100087475 3300005367 Bacteria 2674
90 Ga0070667_100256133 3300005367 Bacteria 1566
91 Ga0070667_100544065 3300005367 Bacteria 1067
92 Ga0070713_100040282 3300005436 Bacteria 3797
93 Ga0070713_100395031 3300005436 Bacteria 1290
94 Ga0070694_100467155 3300005444 Bacteria 999
95 Ga0070708_100157330 3300005445 Bacteria 2116
96 Ga0070678_100003356 3300005456 Bacteria 8919
97 Ga0070678_100027877 3300005456 Bacteria 3842
98 Ga0070678_100375644 3300005456 Bacteria 1229
99 Ga0070662_100061150 3300005457 Bacteria 2749
100 Ga0070662_100431390 3300005457 Bacteria 1092
101 Ga0070662_100432137 3300005457 Bacteria 1091
102 Ga0070681_10017373 3300005458 Bacteria 7189
103 Ga0070681_10585894 3300005458 Bacteria 1029
104 Ga0068867_100000070 3300005459 Bacteria 61892
105 Ga0068867_100001303 3300005459 Bacteria 17238
106 Ga0068867_100069326 3300005459 Bacteria 2633
107 Ga0068867_100142732 3300005459 Bacteria 1873
108 Ga0070685_10144850 3300005466 Bacteria 1500
109 Ga0070685_10185263 3300005466 Bacteria 1343
110 Ga0070706_100052079 3300005467 Bacteria 3779
111 Ga0070706_100093757 3300005467 Bacteria 2786
112 Ga0070707_100453004 3300005468 Bacteria 1244
113 Ga0070698_100041385 3300005471 Bacteria 4729
114 Ga0070698_100079874 3300005471 Bacteria 3267
115 Ga0070698_100106590 3300005471 Bacteria 2771
116 Ga0070698_100227194 3300005471 Bacteria 1800
117 Ga0070679_100183922 3300005530 Bacteria 2061
118 Ga0070684_100015745 3300005535 Bacteria 6171
119 Ga0068853_100118500 3300005539 Bacteria 2359
120 Ga0068853_100336849 3300005539 Bacteria 1401
121 Ga0068853_100354295 3300005539 Bacteria 1366
122 Ga0070672_100002056 3300005543 Bacteria 12677
123 Ga0070672_100013934 3300005543 Bacteria 5688
124 Ga0070672_100073770 3300005543 Bacteria 2720
125 Ga0070672_100393632 3300005543 Bacteria 1187
126 Ga0070686_100166977 3300005544 Bacteria 1554
127 Ga0070665_100040676 3300005548 Bacteria 4672
128 Ga0070665_100365877 3300005548 Bacteria 1448
129 Ga0070665_100376080 3300005548 Bacteria 1427
130 Ga0070664_100085331 3300005564 Bacteria 2727
131 Ga0070664_100187735 3300005564 Bacteria 1840
132 Ga0070664_100210478 3300005564 Bacteria 1737
133 Ga0070664_100229438 3300005564 Bacteria 1664
134 Ga0070664_100472252 3300005564 Bacteria 1153
135 Ga0068857_100064216 3300005577 Bacteria 3264
136 Ga0068856_100024423 3300005614 Bacteria 5884
137 Ga0068856_100255077 3300005614 Bacteria 1769
138 Ga0070702_100319298 3300005615 Bacteria 1082
139 Ga0068852_100094926 3300005616 Bacteria 2677
140 Ga0068852_100100747 3300005616 Bacteria 2607
141 Ga0068852_100524008 3300005616 Bacteria 1183
142 Ga0068859_100000664 3300005617 Bacteria 34524
143 Ga0068859_100030244 3300005617 Bacteria 5434
144 Ga0068859_100136827 3300005617 Bacteria 2523
145 Ga0068864_100000649 3300005618 Bacteria 29069
146 Ga0068864_100012522 3300005618 Bacteria 7015
147 Ga0068861_100204172 3300005719 Bacteria 1661
148 Ga0068863_100029931 3300005841 Bacteria 5201
149 Ga0068863_100098457 3300005841 Bacteria 2777
150 Ga0068863_100235284 3300005841 Bacteria 1767
151 Ga0068863_100619755 3300005841 Bacteria 1072
152 Ga0068858_100000753 3300005842 Bacteria 33946
153 Ga0068858_100088379 3300005842 Bacteria 2883
154 Ga0068860_100002764 3300005843 Bacteria 18265
155 Ga0068862_100120065 3300005844 Bacteria 2316
156 Ga0068862_100290676 3300005844 Bacteria 1501
157 Ga0070717_10323965 3300006028 Bacteria 1373
158 Ga0075365_10012259 3300006038 Bacteria 5082
159 Ga0075365_10079420 3300006038 Bacteria 2220
160 Ga0075365_10096667 3300006038 Bacteria 2018
161 Ga0075365_10120190 3300006038 Bacteria 1812
162 Ga0075365_10185954 3300006038 Bacteria 1453
163 Ga0075363_100197864 3300006048 Bacteria 1148
164 Ga0075364_10005816 3300006051 Bacteria 7198
165 Ga0075364_10010345 3300006051 Bacteria 5632
166 Ga0075364_10125768 3300006051 Bacteria 1718
167 Ga0075432_10017095 3300006058 Bacteria 2475
168 Ga0075432_10020342 3300006058 Bacteria 2270
169 Ga0070716_100287477 3300006173 Bacteria 1138
170 Ga0070712_100170383 3300006175 Bacteria 1689
171 Ga0075362_10007426 3300006177 Bacteria 4151
172 Ga0075362_10027898 3300006177 Bacteria 2420
173 Ga0075362_10035193 3300006177 Bacteria 2185
174 Ga0075362_10036824 3300006177 Bacteria 2142
175 Ga0075362_10086376 3300006177 Bacteria 1452
176 Ga0075362_10095301 3300006177 Bacteria 1385
177 Ga0075362_10161603 3300006177 Bacteria 1079
178 Ga0075367_10043210 3300006178 Bacteria 2639
179 Ga0075367_10058404 3300006178 Bacteria 2295
180 Ga0075367_10092164 3300006178 Bacteria 1844
181 Ga0075367_10114642 3300006178 Bacteria 1657
182 Ga0075367_10120299 3300006178 Bacteria 1618
183 Ga0075369_10114381 3300006186 Bacteria 1218
184 Ga0075366_10002264 3300006195 Bacteria 9825
185 Ga0075366_10004609 3300006195 Bacteria 7406
186 Ga0075366_10007302 3300006195 Bacteria 6096
187 Ga0075366_10023123 3300006195 Bacteria 3620
188 Ga0075366_10048512 3300006195 Bacteria 2518
189 Ga0075366_10085314 3300006195 Bacteria 1889
190 Ga0097621_100018401 3300006237 Bacteria 5335
191 Ga0097621_100030835 3300006237 Bacteria 4248
192 Ga0097621_100292723 3300006237 Bacteria 1436
193 Ga0097621_100299508 3300006237 Bacteria 1420
194 Ga0075370_10000228 3300006353 Bacteria 20029
195 Ga0075370_10001803 3300006353 Bacteria 9581
196 Ga0075370_10003908 3300006353 Bacteria 7151
197 Ga0075370_10008651 3300006353 Bacteria 5247
198 Ga0075370_10024701 3300006353 Bacteria 3321
199 Ga0075370_10025174 3300006353 Bacteria 3289
200 Ga0068871_100220351 3300006358 Bacteria 1644
201 Ga0075428_100002520 3300006844 Bacteria 19906
202 Ga0075430_100022035 3300006846 Bacteria 5415
203 Ga0075430_100023654 3300006846 Bacteria 5232
204 Ga0075430_100066535 3300006846 Bacteria 3026
205 Ga0075430_100088625 3300006846 Bacteria 2589
206 Ga0075430_100133493 3300006846 Bacteria 2069
207 Ga0075431_100006591 3300006847 Bacteria 11533
208 Ga0075431_100014970 3300006847 Bacteria 7851
209 Ga0075431_100023387 3300006847 Bacteria 6322
210 Ga0075431_100155537 3300006847 Bacteria 2352
211 Ga0075429_100000655 3300006880 Bacteria 26788
212 Ga0075429_100035877 3300006880 Bacteria 4312
213 Ga0075429_100106064 3300006880 Bacteria 2455
214 Ga0075429_100191372 3300006880 Bacteria 1792
215 Ga0097620_100000664 3300006931 Bacteria 34524
216 Ga0097620_100030244 3300006931 Bacteria 5434
217 Ga0097620_100136824 3300006931 Bacteria 2523
218 Ga0079104_1027794 3300006946 Bacteria 1445
219 Ga0099826_10005686 3300006948 Bacteria 8978
220 Ga0105244_10007097 3300009036 Bacteria 7162
221 Ga0105244_10019619 3300009036 Bacteria 3770
222 Ga0105240_10031052 3300009093 Bacteria 6933
223 Ga0105240_10297992 3300009093 Bacteria 1845
224 Ga0105240_10447420 3300009093 Bacteria 1446
225 Ga0105240_10879982 3300009093 Bacteria 965
226 Ga0111539_10003696 3300009094 Bacteria 20130
227 Ga0105245_10061457 3300009098 Bacteria 3387
228 Ga0105245_10431885 3300009098 Bacteria 1322
229 Ga0105245_10663695 3300009098 Bacteria 1074
230 Ga0105245_10685939 3300009098 Bacteria 1057
231 Ga0105245_10703366 3300009098 Bacteria 1044
232 Ga0105247_10051958 3300009101 Bacteria 2525
233 Ga0114129_10002274 3300009147 Bacteria 26581
234 Ga0114129_10094036 3300009147 Bacteria 4152
235 Ga0114129_10586999 3300009147 Bacteria 1445
236 Ga0105243_10001208 3300009148 Bacteria 23242
237 Ga0105243_10007703 3300009148 Bacteria 8278
238 Ga0105243_10013939 3300009148 Bacteria 6082
239 Ga0105243_10026405 3300009148 Bacteria 4444
240 Ga0105243_10041812 3300009148 Bacteria 3585
241 Ga0105243_10698990 3300009148 Bacteria 988
242 Ga0105241_10148805 3300009174 Bacteria 1913
243 Ga0105241_10157151 3300009174 Bacteria 1866
244 Ga0105241_10532658 3300009174 Bacteria 1052
245 Ga0105248_10011097 3300009177 Bacteria 9940
246 Ga0105248_10069550 3300009177 Bacteria 3952
247 Ga0105248_10378799 3300009177 Bacteria 1593
248 Ga0105248_10618214 3300009177 Bacteria 1222
249 Ga0105248_10630500 3300009177 Bacteria 1209
250 Ga0105237_10212465 3300009545 Bacteria 1934
251 Ga0105237_10679567 3300009545 Bacteria 1036
252 Ga0105238_10078324 3300009551 Bacteria 3296
253 Ga0105238_10606787 3300009551 Bacteria 1103
254 Ga0105249_10439956 3300009553 Bacteria 1341
255 Ga0105239_10064107 3300010375 Bacteria 4034
256 Ga0105239_10331024 3300010375 Bacteria 1718
257 Ga0105239_10532982 3300010375 Bacteria 1336
258 Ga0105239_10572321 3300010375 Bacteria 1287
259 Ga0105239_10738217 3300010375 Bacteria 1127
260 Ga0105246_10013882 3300011119 Bacteria 5056
261 Ga0105246_10132797 3300011119 Bacteria 1862
262 Ga0105246_10296835 3300011119 Bacteria 1303
263 Ga0105246_10493005 3300011119 Bacteria 1039
264 Ga0157347_1000563 3300012502 Bacteria 2492
265 Ga0157373_10084081 3300013100 Bacteria 2243
266 Ga0157373_10109007 3300013100 Bacteria 1947
267 Ga0157373_10261534 3300013100 Bacteria 1225
268 Ga0157371_10027537 3300013102 Bacteria 4122
269 Ga0157370_10082149 3300013104 Bacteria 3031
270 Ga0157370_10297837 3300013104 Bacteria 1489
271 Ga0157370_10309710 3300013104 Bacteria 1457
272 Ga0157369_10580726 3300013105 Bacteria 1157
273 Ga0157374_10084414 3300013296 Bacteria 3018
274 Ga0157374_10449028 3300013296 Bacteria 1291
275 Ga0157378_10071357 3300013297 Bacteria 3119
276 Ga0157378_10137756 3300013297 Bacteria 2264
277 Ga0157378_10237392 3300013297 Bacteria 1740
278 Ga0157372_10144063 3300013307 Bacteria 2748
279 Ga0157375_10053283 3300013308 Bacteria 3980
280 Ga0157375_10313441 3300013308 Bacteria 1733
281 Ga0163163_10003252 3300014325 Bacteria 13780
282 Ga0157380_10022495 3300014326 Bacteria 4748
283 Ga0182008_10003688 3300014497 Bacteria 9140
284 Ga0157377_10000016 3300014745 Bacteria 190613
285 Ga0157377_10062758 3300014745 Bacteria 2126
286 Ga0157379_10000301 3300014968 Bacteria 39095
287 Ga0157379_10010265 3300014968 Bacteria 8155
288 Ga0157379_10268739 3300014968 Bacteria 1550
289 Ga0157376_10034048 3300014969 Bacteria 4109
290 Ga0157376_10108770 3300014969 Bacteria 2436
291 Ga0182006_1005503 3300015261 Bacteria 6027
292 Ga0182007_10004544 3300015262 Bacteria 6271
293 Ga0183362_10015 3300015683 Bacteria 36270
294 Ga0163161_10000669 3300017792 Bacteria 27400
295 Ga0163161_10026203 3300017792 Bacteria 4130
296 Ga0163161_10081773 3300017792 Bacteria 2379
297 Ga0206353_10306862 3300020082 Bacteria 4273
298 Ga0206353_10394074 3300020082 Bacteria 5866
299 Ga0209436_106237 3300025208 Bacteria 2636
300 Ga0209436_107795 3300025208 Bacteria 2197
301 Ga0209672_101344 3300025228 Bacteria 9266
302 Ga0209147_100697 3300025229 Bacteria 17206
303 Ga0209258_100015 3300025242 Bacteria 706310
304 Ga0207425_1000696 3300025245 Bacteria 18207
305 Ga0207425_1000776 3300025245 Bacteria 16415
306 Ga0209148_1000183 3300025254 Bacteria 122620
307 Ga0209129_1000049 3300025258 Bacteria 268086
308 Ga0209129_1005391 3300025258 Bacteria 4552
309 Ga0209129_1014409 3300025258 Bacteria 1685
310 Ga0209565_1000357 3300025263 Bacteria 39887
311 Ga0209565_1000550 3300025263 Bacteria 26086
312 Ga0209565_1000670 3300025263 Bacteria 21669
313 Ga0209565_1001468 3300025263 Bacteria 10337
314 Ga0209565_1001490 3300025263 Bacteria 10226
315 Ga0209673_1000849 3300025273 Bacteria 39887
316 Ga0209673_1004621 3300025273 Bacteria 7291
317 Ga0209673_1008553 3300025273 Bacteria 4544
318 Ga0209130_1000064 3300025284 Bacteria 196568
319 Ga0209130_1002259 3300025284 Bacteria 9950
320 Ga0209130_1011129 3300025284 Bacteria 2425
321 Ga0209130_1014792 3300025284 Bacteria 1946
322 Ga0209675_1000352 3300025291 Bacteria 39879
323 Ga0209675_1006237 3300025291 Bacteria 4823
324 Ga0209675_1008030 3300025291 Bacteria 3943
325 Ga0209675_1008455 3300025291 Bacteria 3778
326 Ga0209675_1012241 3300025291 Bacteria 2777
327 Ga0209675_1013501 3300025291 Bacteria 2548
328 Ga0209676_1000137 3300025292 Bacteria 179437
329 Ga0209676_1000385 3300025292 Bacteria 81044
330 Ga0209676_1000873 3300025292 Bacteria 38608
331 Ga0209676_1008682 3300025292 Bacteria 4491
332 Ga0209676_1014082 3300025292 Bacteria 3030
333 Ga0209676_1026183 3300025292 Bacteria 1857
334 Ga0209676_1037926 3300025292 Bacteria 1384
335 Ga0209676_1049210 3300025292 Bacteria 1120
336 Ga0209025_1000290 3300025294 Bacteria 113067
337 Ga0209025_1000313 3300025294 Bacteria 107850
338 Ga0209025_1004032 3300025294 Bacteria 13154
339 Ga0209025_1005627 3300025294 Bacteria 10115
340 Ga0209025_1014190 3300025294 Bacteria 4930
341 Ga0209025_1017484 3300025294 Bacteria 4134
342 Ga0209025_1026212 3300025294 Bacteria 2934
343 Ga0209025_1041743 3300025294 Bacteria 1959
344 Ga0209025_1044488 3300025294 Bacteria 1855
345 Ga0209025_1101095 3300025294 Bacteria 912
346 Ga0209564_1001545 3300025295 Bacteria 22749
347 Ga0209564_1005054 3300025295 Bacteria 7708
348 Ga0209564_1009323 3300025295 Bacteria 4691
349 Ga0209564_1017154 3300025295 Bacteria 2839
350 Ga0209758_1000135 3300025297 Bacteria 177753
351 Ga0209758_1021212 3300025297 Bacteria 3038
352 Ga0209050_1000015 3300025298 Bacteria 759102
353 Ga0209050_1001437 3300025298 Bacteria 25610
354 Ga0209050_1001535 3300025298 Bacteria 24230
355 Ga0209050_1012559 3300025298 Bacteria 3871
356 Ga0209050_1025028 3300025298 Bacteria 2043
357 Ga0209256_1000129 3300025299 Bacteria 163766
358 Ga0209256_1000224 3300025299 Bacteria 104436
359 Ga0207426_1000062 3300025302 Bacteria 362040
360 Ga0207426_1000171 3300025302 Bacteria 163766
361 Ga0207426_1000185 3300025302 Bacteria 154146
362 Ga0207426_1028013 3300025302 Bacteria 1870
363 Ga0209051_1000010 3300025303 Bacteria 641298
364 Ga0209051_1000137 3300025303 Bacteria 137784
365 Ga0209051_1000859 3300025303 Bacteria 30952
366 Ga0209051_1001741 3300025303 Bacteria 17359
367 Ga0209051_1027477 3300025303 Bacteria 2266
368 Ga0209257_1000026 3300025304 Bacteria 723225
369 Ga0209257_1000205 3300025304 Bacteria 143735
370 Ga0209257_1009859 3300025304 Bacteria 4989
371 Ga0209257_1025887 3300025304 Bacteria 1992
372 Ga0209257_1034087 3300025304 Bacteria 1593
373 Ga0207655_1002202 3300025728 Bacteria 16179
374 Ga0207655_1011626 3300025728 Bacteria 5220
375 Ga0207682_10025165 3300025893 Bacteria 2360
376 Ga0207682_10028656 3300025893 Bacteria 2224
377 Ga0207682_10034600 3300025893 Bacteria 2037
378 Ga0207688_10031306 3300025901 Bacteria 2936
379 Ga0207688_10325953 3300025901 Bacteria 943
380 Ga0207680_10000566 3300025903 Bacteria 17497
381 Ga0207645_10003718 3300025907 Bacteria 11487
382 Ga0207645_10006702 3300025907 Bacteria 8231
383 Ga0207645_10079872 3300025907 Bacteria 2096
384 Ga0207645_10169503 3300025907 Bacteria 1430
385 Ga0207645_10189834 3300025907 Bacteria 1350
386 Ga0207643_10064933 3300025908 Bacteria 2090
387 Ga0207705_10076227 3300025909 Bacteria 2437
388 Ga0207705_10304663 3300025909 Bacteria 1222
389 Ga0207684_10049311 3300025910 Bacteria 3572
390 Ga0207684_10065153 3300025910 Bacteria 3094
391 Ga0207654_10071676 3300025911 Bacteria 2060
392 Ga0207707_10121329 3300025912 Bacteria 2285
393 Ga0207707_10351381 3300025912 Bacteria 1270
394 Ga0207707_10364070 3300025912 Bacteria 1245
395 Ga0207695_10255734 3300025913 Bacteria 1650
396 Ga0207695_10273749 3300025913 Bacteria 1583
397 Ga0207671_10323953 3300025914 Bacteria 1220
398 Ga0207693_10249022 3300025915 Bacteria 1394
399 Ga0207660_10026708 3300025917 Bacteria 3933
400 Ga0207660_10107720 3300025917 Bacteria 2092
401 Ga0207657_10020418 3300025919 Bacteria 6260
402 Ga0207649_10085490 3300025920 Bacteria 2053
403 Ga0207649_10321124 3300025920 Bacteria 1138
404 Ga0207652_10417514 3300025921 Bacteria 1210
405 Ga0207646_10279427 3300025922 Bacteria 1509
406 Ga0207681_10433476 3300025923 Bacteria 1067
407 Ga0207694_10008501 3300025924 Bacteria 7752
408 Ga0207650_10077471 3300025925 Bacteria 2513
409 Ga0207650_10233208 3300025925 Bacteria 1485
410 Ga0207650_10386728 3300025925 Bacteria 1156
411 Ga0207650_10394036 3300025925 Bacteria 1145
412 Ga0207650_10552700 3300025925 Bacteria 965
413 Ga0207659_10000413 3300025926 Bacteria 25819
414 Ga0207659_10017569 3300025926 Bacteria 4674
415 Ga0207659_10142919 3300025926 Bacteria 1859
416 Ga0207687_10009580 3300025927 Bacteria 6334
417 Ga0207687_10164241 3300025927 Bacteria 1707
418 Ga0207687_10511087 3300025927 Bacteria 1004
419 Ga0207700_10001789 3300025928 Bacteria 12201
420 Ga0207700_10024086 3300025928 Bacteria 4208
421 Ga0207664_10066473 3300025929 Bacteria 2890
422 Ga0207664_10101440 3300025929 Bacteria 2378
423 Ga0207644_10010403 3300025931 Bacteria 6129
424 Ga0207706_10084575 3300025933 Bacteria 2789
425 Ga0207706_10137470 3300025933 Bacteria 2149
426 Ga0207706_10287226 3300025933 Bacteria 1434
427 Ga0207709_10000497 3300025935 Bacteria 35233
428 Ga0207709_10002246 3300025935 Bacteria 12298
429 Ga0207709_10002795 3300025935 Bacteria 10742
430 Ga0207709_10010832 3300025935 Bacteria 5022
431 Ga0207709_10015245 3300025935 Bacteria 4260
432 Ga0207709_10111539 3300025935 Bacteria 1830
433 Ga0207709_10217002 3300025935 Bacteria 1377
434 Ga0207670_10007925 3300025936 Bacteria 5964
435 Ga0207669_10168371 3300025937 Bacteria 1556
436 Ga0207704_10083490 3300025938 Bacteria 2073
437 Ga0207691_10001908 3300025940 Bacteria 20369
438 Ga0207691_10016734 3300025940 Bacteria 6962
439 Ga0207691_10139896 3300025940 Bacteria 2134
440 Ga0207691_10367217 3300025940 Bacteria 1230
441 Ga0207711_10008859 3300025941 Bacteria 8413
442 Ga0207711_10331264 3300025941 Bacteria 1408
443 Ga0207689_10015963 3300025942 Bacteria 6356
444 Ga0207689_10121373 3300025942 Bacteria 2149
445 Ga0207689_10229528 3300025942 Bacteria 1534
446 Ga0207689_10365115 3300025942 Bacteria 1201
447 Ga0207661_10013534 3300025944 Bacteria 5958
448 Ga0207661_10100682 3300025944 Bacteria 2426
449 Ga0207679_10145615 3300025945 Bacteria 1921
450 Ga0207679_10205848 3300025945 Bacteria 1647
451 Ga0207679_10216171 3300025945 Bacteria 1610
452 Ga0207667_10046884 3300025949 Bacteria 4576
453 Ga0207667_10893316 3300025949 Bacteria 881
454 Ga0207651_10716247 3300025960 Bacteria 883
455 Ga0207712_10212258 3300025961 Bacteria 1542
456 Ga0207668_10253104 3300025972 Bacteria 1431
457 Ga0207658_10001221 3300025986 Bacteria 20333
458 Ga0207658_10032821 3300025986 Bacteria 3699
459 Ga0207658_10064314 3300025986 Bacteria 2751
460 Ga0207658_10153852 3300025986 Bacteria 1877
461 Ga0207658_10435728 3300025986 Bacteria 1158
462 Ga0207677_10018017 3300026023 Bacteria 4229
463 Ga0207677_10180352 3300026023 Bacteria 1660
464 Ga0207703_10003078 3300026035 Bacteria 14106
465 Ga0207703_10003611 3300026035 Bacteria 12912
466 Ga0207639_10038115 3300026041 Bacteria 3574
467 Ga0207639_10051648 3300026041 Bacteria 3128
468 Ga0207639_10394410 3300026041 Bacteria 1246
469 Ga0207678_10138648 3300026067 Bacteria 2076
470 Ga0207708_10153647 3300026075 Bacteria 1814
471 Ga0207702_10308544 3300026078 Bacteria 1504
472 Ga0207641_10005904 3300026088 Bacteria 10385
473 Ga0207641_10007144 3300026088 Bacteria 9325
474 Ga0207641_10280201 3300026088 Bacteria 1568
475 Ga0207648_10000412 3300026089 Bacteria 47573
476 Ga0207648_10051461 3300026089 Bacteria 3600
477 Ga0207648_10069509 3300026089 Bacteria 3068
478 Ga0207676_10000325 3300026095 Bacteria 41139
479 Ga0207674_10107915 3300026116 Bacteria 2761
480 Ga0207674_10256622 3300026116 Bacteria 1695
481 Ga0207675_100202618 3300026118 Bacteria 1906
482 Ga0207675_100568113 3300026118 Bacteria 1135
483 Ga0207683_10008809 3300026121 Bacteria 8612
484 Ga0207683_10020874 3300026121 Bacteria 5604
485 Ga0207683_10087829 3300026121 Bacteria 2765
486 Ga0207683_10135210 3300026121 Bacteria 2219
487 Ga0207698_10077634 3300026142 Bacteria 2664
488 Ga0207698_10096942 3300026142 Bacteria 2432
489 Ga0207698_10128833 3300026142 Bacteria 2158
490 Ga0207698_10169152 3300026142 Bacteria 1922
491 Ga0207698_10429150 3300026142 Bacteria 1270
492 Ga0209281_1027790 3300027111 Bacteria 1033
493 Ga0209996_1017914 3300027395 Bacteria 981
494 Ga0209999_1032322 3300027543 Bacteria 973
495 Ga0209970_1000334 3300027614 Bacteria 7879
496 Ga0209282_1007723 3300027666 Bacteria 6748
497 Ga0209971_1016084 3300027682 Bacteria 1774
498 Ga0209974_10017668 3300027876 Bacteria 2364
499 Ga0207428_10000824 3300027907 Bacteria 34961
500 Ga0207428_10017418 3300027907 Bacteria 6167
501 Ga0268266_10074109 3300028379 Bacteria 2955
502 Ga0268266_10151507 3300028379 Bacteria 2090
503 Ga0268265_10274912 3300028380 Bacteria 1504
504 Ga0268264_10003593 3300028381 Bacteria 13348
505 Ga0265337_1073786 3300028556 Bacteria 936
506 Ga0265326_10012895 3300028558 Bacteria 2450
507 Ga0265319_1000367 3300028563 Bacteria 32543
508 Ga0265319_1013479 3300028563 Bacteria 3247
509 Ga0265334_10011419 3300028573 Bacteria 3741
510 Ga0265334_10057203 3300028573 Bacteria 1478
511 Ga0265318_10001025 3300028577 Bacteria 17763
512 Ga0265318_10003382 3300028577 Bacteria 8038
513 Ga0265322_10003200 3300028654 Bacteria 4970
514 Ga0265322_10024147 3300028654 Bacteria 1738
515 Ga0307517_10000575 3300028786 Bacteria 62687
516 Ga0307517_10155712 3300028786 Bacteria 1551
517 Ga0307515_10000022 3300028794 Bacteria 404064
518 Ga0307515_10000063 3300028794 Bacteria 245504
519 Ga0307515_10000150 3300028794 Bacteria 169644
520 Ga0307515_10014322 3300028794 Bacteria 14720
521 Ga0307515_10199232 3300028794 Bacteria 1884
522 Ga0307515_10265982 3300028794 Bacteria 1443
523 Ga0265338_10005122 3300028800 Bacteria 17268
524 Ga0265338_10007410 3300028800 Bacteria 13628
525 Ga0265338_10020018 3300028800 Bacteria 7061
526 Ga0307512_10242964 3300030522 Bacteria 908
527 Ga0316183_1162120 3300030742 Bacteria 1332
528 Ga0316181_1135666 3300030744 Bacteria 3382
529 Ga0265330_10010400 3300031235 Bacteria 4387
530 Ga0265332_10000023 3300031238 Bacteria 211994
531 Ga0265332_10008558 3300031238 Bacteria 4597
532 Ga0265328_10006812 3300031239 Bacteria 4803
533 Ga0265320_10003780 3300031240 Bacteria 10062
534 Ga0265320_10150151 3300031240 Bacteria 1052
535 Ga0265325_10004086 3300031241 Bacteria 9296
536 Ga0265325_10034519 3300031241 Bacteria 2690
537 Ga0265329_10003362 3300031242 Bacteria 6989
538 Ga0265329_10011121 3300031242 Bacteria 3278
539 Ga0265340_10002165 3300031247 Bacteria 11257
540 Ga0265339_10039650 3300031249 Bacteria 2621
541 Ga0265331_10021197 3300031250 Bacteria 3328
542 Ga0265327_10001540 3300031251 Bacteria 28437
543 Ga0265327_10006888 3300031251 Bacteria 8940
544 Ga0265327_10015936 3300031251 Bacteria 4812
545 Ga0265327_10031540 3300031251 Bacteria 2975
546 Ga0265327_10054966 3300031251 Bacteria 2058
547 Ga0265316_10007267 3300031344 Bacteria 10451
548 Ga0265316_10017319 3300031344 Bacteria 6234
549 Ga0307513_10000008 3300031456 Bacteria 442128
550 Ga0307513_10000991 3300031456 Bacteria 41018
551 Ga0307513_10003892 3300031456 Bacteria 20086
552 Ga0307513_10042874 3300031456 Bacteria 4976
553 Ga0307513_10117878 3300031456 Bacteria 2631
554 Ga0307513_10167140 3300031456 Bacteria 2082
555 Ga0307509_10185819 3300031507 Bacteria 1937
556 Ga0307408_100025723 3300031548 Bacteria 4033
557 Ga0307408_100072514 3300031548 Bacteria 2549
558 Ga0307408_100158334 3300031548 Bacteria 1796
559 Ga0307408_100279201 3300031548 Bacteria 1390
560 Ga0307408_100452879 3300031548 Bacteria 1113
561 Ga0265313_10012870 3300031595 Bacteria 5075
562 Ga0307508_10025941 3300031616 Bacteria 5314
563 Ga0307508_10255514 3300031616 Bacteria 1348
564 Ga0307514_10088477 3300031649 Bacteria 2266
565 Ga0265314_10004327 3300031711 Bacteria 13245
566 Ga0265314_10066252 3300031711 Bacteria 2436
567 Ga0265314_10163357 3300031711 Bacteria 1352
568 Ga0265342_10004057 3300031712 Bacteria 11681
569 Ga0265342_10024334 3300031712 Bacteria 3824
570 Ga0265342_10164497 3300031712 Bacteria 1224
571 Ga0307516_10003416 3300031730 Bacteria 20413
572 Ga0307516_10059990 3300031730 Bacteria 3697
573 Ga0307516_10075653 3300031730 Bacteria 3221
574 Ga0307516_10194636 3300031730 Bacteria 1751
575 Ga0307405_10060904 3300031731 Bacteria 2383
576 Ga0307405_10114576 3300031731 Bacteria 1832
577 Ga0307405_10241803 3300031731 Bacteria 1337
578 Ga0307405_10330842 3300031731 Bacteria 1167
579 Ga0307405_10354883 3300031731 Bacteria 1132
580 Ga0307413_10156571 3300031824 Bacteria 1595
581 Ga0307406_10001780 3300031901 Bacteria 11779
582 Ga0307412_10011307 3300031911 Bacteria 5164
583 Ga0307412_10011375 3300031911 Bacteria 5153
584 Ga0307412_10013346 3300031911 Bacteria 4814
585 Ga0307412_10056521 3300031911 Bacteria 2615
586 Ga0307412_10088252 3300031911 Bacteria 2163
587 Ga0307409_100598207 3300031995 Bacteria 1090
588 Ga0307416_100065389 3300032002 Bacteria 2988
589 Ga0307416_100093414 3300032002 Bacteria 2591
590 Ga0307416_100094168 3300032002 Bacteria 2582
591 Ga0307416_100193529 3300032002 Bacteria 1921
592 Ga0307416_100383522 3300032002 Bacteria 1436
593 Ga0307411_10541489 3300032005 Bacteria 991
594 Ga0307510_10007192 3300033180 Bacteria 13255
595 Ga0307510_10009118 3300033180 Bacteria 11811
596 Ga0373945_0087675 3300035116 Bacteria 1201
597 Ga0373953_0122803 3300035117 Bacteria 1104
598 Ga0373933_0607455 3300035724 Bacteria 718
599 Ga0373937_0057398 3300036401 Bacteria 3576
600 Ga0373937_0288848 3300036401 Bacteria 1549
601 Ga0373925_0164444 3300037068 Bacteria 1749
602 Ga0373925_0323310 3300037068 Bacteria 1249
603 Ga0395899_0012760 3300037312 Bacteria 6438
604 Ga0395899_0014438 3300037312 Bacteria 6029
605 Ga0395900_0171716 3300037418 Bacteria 2207
606 Ga0395900_0230152 3300037418 Bacteria 1864
607 Ga0395898_0235391 3300037466 Bacteria 1746
608 Ga0395905_0000027 3300037471 Bacteria 297239
609 Ga0395905_0000042 3300037471 Bacteria 247894
610 Ga0395905_0007865 3300037471 Bacteria 10559
611 Ga0395905_0031330 3300037471 Bacteria 5006
612 Ga0395905_0050716 3300037471 Bacteria 3887
613 Ga0395905_0098863 3300037471 Bacteria 2740
614 Ga0395905_0391802 3300037471 Bacteria 1284
615 Ga0395901_0046478 3300038443 Bacteria 4509
616 Ga0395901_0145661 3300038443 Bacteria 2489
617 Ga0395901_0163945 3300038443 Bacteria 2334
618 Ga0242420_013191 3300038996 Bacteria 1406
619 Ga0436365_1276969 3300039437 Bacteria 1670
620 Ga0439436_0008478 3300041404 Bacteria 3162
621 Ga0439453_0024676 3300041408 Bacteria 1105
622 Ga0439461_0018517 3300041410 Bacteria 1364
623 Ga0439465_0013016 3300041413 Bacteria 2599
624 Ga0439431_0009348 3300041997 Bacteria 2214
625 Ga0439432_071909 3300042006 Bacteria 1054
626 Ga0439449_0001315 3300042007 Bacteria 9735
627 Ga0439449_0008350 3300042007 Bacteria 3938
628 Ga0439449_0019433 3300042007 Bacteria 2546
629 Ga0439449_0041902 3300042007 Bacteria 1702
630 Ga0439452_011363 3300042010 Bacteria 2561
631 Ga0439457_005550 3300042014 Bacteria 3165
632 Ga0439462_0006722 3300042015 Bacteria 2869
633 Ga0450894_011448 3300042131 Bacteria 1156
634 Ga0450898_004687 3300042134 Bacteria 2034
635 Ga0450906_004729 3300042145 Bacteria 2835
636 Ga0450906_009634 3300042145 Bacteria 1836
637 Ga0439446_0071353 3300042156 Bacteria 1063
638 Ga0450908_013841 3300042184 Bacteria 1455
639 Ga0439434_0049332 3300042435 Bacteria 1303
640 Ga0439464_0033666 3300042439 Bacteria 1443
641 Ga0439464_0055069 3300042439 Bacteria 1156
642 Ga0451577_0041221 3300042876 Bacteria 4144
643 Ga0451577_0142894 3300042876 Bacteria 2151
644 Ga0466969_0010253 3300044656 Bacteria 4967
645 Ga0453683_0032805 3300044673 Bacteria 3274
646 Ga0466965_0046594 3300044683 Bacteria 2146
647 Ga0466961_0114125 3300044693 Bacteria 1698
648 Ga0466963_0008273 3300044694 Bacteria 6233
649 Ga0466963_0322912 3300044694 Bacteria 1086
650 Ga0453684_0186465 3300044712 Bacteria 2431
651 Ga0466957_0262128 3300044842 Bacteria 1152
652 Ga0466960_0053041 3300044901 Bacteria 1964
653 Ga0466960_0114552 3300044901 Bacteria 1405
654 Ga0451576_0124355 3300045051 Bacteria 2687
655 Ga0466958_0474425 3300045836 Bacteria 811
656 Ga0466967_0224909 3300045976 Bacteria 1785
657 Ga0466967_0698893 3300045976 Bacteria 1004
658 Ga0495592_0361789 3300046454 Bacteria 928
659 Ga0495638_0019461 3300046460 Bacteria 4492
660 Ga0495638_0031274 3300046460 Bacteria 3421
661 Ga0495651_0072210 3300046462 Bacteria 2622
662 Ga0495580_0157787 3300046472 Bacteria 1571
663 Ga0495580_0203219 3300046472 Bacteria 1364
664 Ga0495664_0143246 3300046477 Bacteria 1449
665 Ga0495608_0189926 3300046511 Bacteria 1297
666 Ga0495608_0243199 3300046511 Bacteria 1124
667 Ga0495610_0011528 3300046512 Bacteria 5396
668 Ga0495610_0032973 3300046512 Bacteria 2683
669 Ga0495616_0001839 3300046513 Bacteria 14365
670 Ga0495628_0095150 3300046516 Bacteria 2302
671 Ga0495631_0025535 3300046518 Bacteria 2720
672 Ga0495632_0004875 3300046519 Bacteria 9000
673 Ga0495637_0026522 3300046520 Bacteria 2599
674 Ga0495663_0056141 3300046525 Bacteria 1229
675 Ga0495642_0119600 3300046528 Bacteria 1130
676 Ga0495654_0004374 3300046530 Bacteria 8405
677 Ga0495587_0046189 3300046536 Bacteria 2586
678 Ga0495587_0366428 3300046536 Bacteria 802
679 Ga0495621_0047681 3300046539 Bacteria 1523
680 Ga0495656_0000047 3300046615 Bacteria 59690
681 Ga0495668_0240129 3300046616 Bacteria 992
682 Ga0495634_0087469 3300046642 Bacteria 2028
683 Ga0495625_0003370 3300046660 Bacteria 16024
684 Ga0495625_0033388 3300046660 Bacteria 3806
685 Ga0495625_0098189 3300046660 Bacteria 2015
686 Ga0495625_0109259 3300046660 Bacteria 1892
687 Ga0495635_0221126 3300046663 Bacteria 1281
688 Ga0495657_0299238 3300046675 Bacteria 960
689 Ga0495624_0081410 3300046690 Bacteria 2005
690 Ga0495649_0005389 3300046694 Bacteria 8144
691 Ga0495600_0325308 3300046809 Bacteria 966
692 Ga0495604_0363410 3300047317 Bacteria 959
693 Ga0495636_0031751 3300047318 Bacteria 2166
694 Ga0495676_0060279 3300047321 Bacteria 2975
695 Ga0495680_0134425 3300047322 Bacteria 1814
696 Ga0495680_0353949 3300047322 Bacteria 1022
697 Ga0495687_004201 3300047443 Bacteria 9884
698 Ga0495687_017276 3300047443 Bacteria 3603
699 Ga0495687_024875 3300047443 Bacteria 2839
700 Ga0495602_0360428 3300048088 Bacteria 1047
701 Ga0496104_0101853 3300048907 Bacteria 2750
702 Ga0496105_0009425 3300048908 Bacteria 7635
703 Ga0496105_0296269 3300048908 Bacteria 1301
704 Ga0496105_0340112 3300048908 Bacteria 1200
705 Ga0496106_0266236 3300048909 Bacteria 1372
706 Ga0496108_0071269 3300048911 Bacteria 2932
707 Ga0496108_0121421 3300048911 Bacteria 2241
708 Ga0496108_0291528 3300048911 Bacteria 1421
709 Ga0496109_0467565 3300048912 Bacteria 1191
710 Ga0496110_0027012 3300048913 Bacteria 4917
711 Ga0496111_0093341 3300048914 Bacteria 2206
712 Ga0496112_0001247 3300048915 Bacteria 19238
713 Ga0496112_0110440 3300048915 Bacteria 2720
714 Ga0496112_0176519 3300048915 Bacteria 2101
715 Ga0496112_0328746 3300048915 Bacteria 1473
716 Ga0496114_0455189 3300048917 Bacteria 1133
717 Ga0496115_0146509 3300048918 Bacteria 1949
718 Ga0496115_0160164 3300048918 Bacteria 1860
719 Ga0496116_0017638 3300048919 Bacteria 5532
720 Ga0496117_0025305 3300048920 Bacteria 4669
721 Ga0496117_0088938 3300048920 Bacteria 1996
722 Ga0496118_0005780 3300048921 Bacteria 13891
723 Ga0496118_0038540 3300048921 Bacteria 3828
724 Ga0496121_0002801 3300048924 Bacteria 25834
725 Ga0496121_0013215 3300048924 Bacteria 8896
726 Ga0496121_0042409 3300048924 Bacteria 3958
727 Ga0496123_0061812 3300048926 Bacteria 2404
728 Ga0496124_0055194 3300048927 Bacteria 3359
729 Ga0496124_0222356 3300048927 Bacteria 1419
730 Ga0496125_0021834 3300048928 Bacteria 5957
731 Ga0501034_0015736 3300049571 Bacteria 7767
732 Ga0501034_0169399 3300049571 Bacteria 2152
733 Ga0501039_0043463 3300049575 Bacteria 3471
734 Ga0501047_0148674 3300049581 Bacteria 2219
735 Ga0501048_0337328 3300049582 Bacteria 1074
736 Ga0501067_0023439 3300049583 Bacteria 3421
737 Ga0501070_0009486 3300049586 Bacteria 8228
738 Ga0501071_0031132 3300049587 Bacteria 3779
739 Ga0501071_0071383 3300049587 Bacteria 2531
740 Ga0501072_0041603 3300049588 Bacteria 3610
741 Ga0501072_0057564 3300049588 Bacteria 3063
742 Ga0501073_0007466 3300049589 Bacteria 8128
743 Ga0501073_0075724 3300049589 Bacteria 2343
744 Ga0501074_0007038 3300049590 Bacteria 8123
745 Ga0501075_0022010 3300049591 Bacteria 4654
746 Ga0501075_0095570 3300049591 Bacteria 2255
747 Ga0501076_0006750 3300049592 Bacteria 8329
748 Ga0501206_013213 3300049653 Bacteria 1127
749 Ga0501207_030735 3300049654 Bacteria 902
750 Ga0501249_011011 3300049679 Bacteria 1895
751 Ga0501257_018518 3300049686 Bacteria 1625
752 Ga0501079_0026176 3300049741 Bacteria 4472
753 Ga0501079_0053698 3300049741 Bacteria 3108
754 Ga0501079_0109339 3300049741 Bacteria 2147
755 Ga0501080_0001046 3300049742 Bacteria 22756
756 Ga0501080_0025808 3300049742 Bacteria 5458
757 Ga0501080_0038620 3300049742 Bacteria 4456
758 Ga0501083_0000684 3300049744 Bacteria 22083
759 Ga0501262_000493 3300049759 Bacteria 4693
760 Ga0501262_002025 3300049759 Bacteria 2282
761 Ga0501265_002350 3300049762 Bacteria 2146
762 Ga0501035_0203196 3300049822 Bacteria 1698
763 Ga0501044_0119947 3300049823 Bacteria 2632
764 nmdc:mga03683_10371_c1 3300050489 Bacteria 3340
765 nmdc:mga03683_107368_c1 3300050489 Bacteria 1231
766 nmdc:mga03683_6233_c1 3300050489 Bacteria 4072
767 nmdc:mga03683_6421_c1 3300050489 Bacteria 4024
768 nmdc:mga03n38_12480_c1 3300050490 Bacteria 3199
769 nmdc:mga03n38_154446_c1 3300050490 Bacteria 1157
770 nmdc:mga03n38_32739_c1 3300050490 Bacteria 2205
771 nmdc:mga03n38_51436_c1 3300050490 Bacteria 1840
772 nmdc:mga03n38_78368_c1 3300050490 Bacteria 1546
773 nmdc:mga00v17_41558_c1 3300050491 Bacteria 2762
774 nmdc:mga00v17_57650_c1 3300050491 Bacteria 2377
775 nmdc:mga0yw44_136519_c1 3300050492 Bacteria 1591
776 nmdc:mga0yw44_7818_c1 3300050492 Bacteria 5290
777 nmdc:mga0k408_104058_c1 3300050493 Bacteria 1675
778 nmdc:mga0k408_10924_c1 3300050493 Bacteria 4926
779 nmdc:mga0k408_17775_c1 3300050493 Bacteria 3963
780 nmdc:mga0k408_20558_c1 3300050493 Bacteria 3700
781 nmdc:mga0k408_43322_c1 3300050493 Bacteria 2593
782 nmdc:mga0k408_48562_c1 3300050493 Bacteria 2456
783 nmdc:mga0k408_51154_c1 3300050493 Bacteria 2393
784 nmdc:mga0k408_5868_c1 3300050493 Bacteria 6544
785 nmdc:mga06z11_34469_c1 3300050494 Bacteria 2485
786 nmdc:mga06z11_78453_c1 3300050494 Bacteria 1765
787 nmdc:mga07m45_11400_c1 3300050496 Bacteria 4669
788 nmdc:mga07m45_14982_c1 3300050496 Bacteria 4139
789 nmdc:mga07m45_20133_c1 3300050496 Bacteria 3622
790 nmdc:mga07m45_25742_c1 3300050496 Bacteria 3229
791 nmdc:mga07m45_33529_c1 3300050496 Bacteria 2852
792 nmdc:mga07m45_44884_c1 3300050496 Bacteria 2481
793 nmdc:mga07m45_65409_c1 3300050496 Bacteria 2065
794 nmdc:mga07m45_872_c1 3300050496 Bacteria 13146
795 nmdc:mga07m45_89452_c1 3300050496 Bacteria 1763
796 nmdc:mga05p37_481_c1 3300050507 Bacteria 43634
797 nmdc:mga05p37_75222_c1 3300050507 Bacteria 4157
798 nmdc:mga09592_37264_c1 3300050508 Bacteria 4079
799 nmdc:mga09592_46511_c1 3300050508 Bacteria 3656
800 nmdc:mga09592_61627_c1 3300050508 Bacteria 3173
801 nmdc:mga09592_663_c1 3300050508 Bacteria 26283
802 nmdc:mga0qj67_149614_c1 3300050509 Bacteria 1894
803 nmdc:mga0qj67_15458_c1 3300050509 Bacteria 5779
804 nmdc:mga0qj67_154651_c1 3300050509 Bacteria 1861
805 nmdc:mga0qj67_39409_c1 3300050509 Bacteria 3710
806 nmdc:mga06r32_32_c1 3300050510 Bacteria 83882
807 nmdc:mga06r32_367195_c1 3300050510 Bacteria 1423
808 nmdc:mga08y16_2608_c1 3300050511 Bacteria 18513
809 nmdc:mga0n895_243544_c1 3300050512 Bacteria 1825
810 nmdc:mga0sz30_45735_c1 3300050516 Bacteria 1846
811 nmdc:mga0sz30_7187_c1 3300050516 Bacteria 4169
812 Ga0500610_0043519 3300053079 Bacteria 2326
813 Ga0500610_0173412 3300053079 Bacteria 1062
814 Ga0500610_0210162 3300053079 Bacteria 930
815 Ga0495619_0124531 3300053085 Bacteria 1768
816 Ga0500644_0007182 3300053088 Bacteria 2891
817 Ga0500644_0029832 3300053088 Bacteria 1719
818 Ga0500651_0000169 3300053093 Bacteria 42653
819 Ga0500651_0123118 3300053093 Bacteria 1573
820 Ga0500651_0173684 3300053093 Bacteria 1283
821 Ga0500641_0085904 3300053096 Bacteria 1339
822 Ga0500592_007280 3300053116 Bacteria 1761
823 Ga0500594_0004056 3300053118 Bacteria 3224
824 Ga0500608_034684 3300053122 Bacteria 2404
825 Ga0500658_0001494 3300053134 Bacteria 9361
826 Ga0500568_0112185 3300053139 Bacteria 1018
827 Ga0500627_0048483 3300053158 Bacteria 1845
828 Ga0500634_0061462 3300053161 Bacteria 1992
829 Ga0500645_000657 3300053730 Bacteria 21741
830 Ga0500645_008657 3300053730 Bacteria 3455
831 Ga0501084_0086944 3300054114 Bacteria 2625
832 Ga0501082_0265591 3300060353 Bacteria 1493
833 Ga0530510_0042453 3300061734 Bacteria 3286
834 2511243524 2511231002 Bacteria 5042903
835 2513227332 2513020051 Bacteria 6053213
836 2548499289 2547132374 Bacteria 5530232
837 2599627103 2599185214 Bacteria 8209958
838 2599676536 2599185226 Bacteria 8233575
839 2599684804 2599185227 Bacteria 8246414
840 2599696760 2599185229 Bacteria 8216126
841 2643866122 2643221570 Bacteria 5103772
842 2643994112 2643221596 Bacteria 5006805
843 2644057654 2643221609 Bacteria 6756331
844 2644072259 2643221611 Bacteria 6820941
845 2644160064 2643221628 Bacteria 5745828
846 2644292936 2643221652 Bacteria 5140275
847 2644302028 2643221654 Bacteria 5273570
848 2644329453 2643221658 Bacteria 6064537
849 2644401025 2643221672 Bacteria 6322190
850 2644464275 2643221683 Bacteria 5749203
851 2644466350 2643221683 Bacteria 5749203
852 2644647952 2643221717 Bacteria 5676132
853 2738723457 2738541277 Bacteria 7458140
854 2738882243 2738541307 Bacteria 8606193
855 2739241928 2738543012 Bacteria 7115078
856 2739251222 2738543013 Bacteria 5618633
857 2739284188 2738543019 Bacteria 7459457
858 2816470770 2816332133 Bacteria 7249298
859 2819598172 2818991446 Bacteria 7757362
860 2831269159 2831265667 Bacteria 7184833
861 2838058589 2838054893 Bacteria 7451788
862 2842682428 2842677519 Bacteria 5615038
863 2885196445 2885192300 Bacteria 5882526
864 2885200020 2885198086 Bacteria 7212419
865 2885213750 2885211737 Bacteria 7212420
866 2899929594 2899924645 Bacteria 7487985
867 2904456407 2904449895 Bacteria 6927402
868 2904462916 2904456579 Bacteria 6819253
869 2904549064 2904541872 Bacteria 8915136
870 2919465834 2919462493 Bacteria 5817112
871 2919706164 2919704043 Bacteria 5560311
872 2928039963 2928037797 Bacteria 7273642
873 2928047288 2928044640 Bacteria 7271509
874 2928057508 2928051484 Bacteria 7773759
875 2928068106 2928064002 Bacteria 7419480
876 2928072691 2928070936 Bacteria 8062541
877 2928085854 2928084124 Bacteria 7159212
878 2928120189 2928115317 Bacteria 6477646
879 2929160692 2929160207 Bacteria 9075316
880 2929523771 2929520902 Bacteria 6765052
881 2939634120 2939631187 Bacteria 6118131
882 2945914812 2945909444 Bacteria 7065066
883 2945951123 2945945610 Bacteria 5951079
884 2945974219 2945972063 Bacteria 6086495
885 2945989789 2945984333 Bacteria 7358892
886 2990714177 2990710928 Bacteria 5002431
887 Ga0451577_0051213
888 JGI24739J22299_10010254
889 JGI25150J39212_1012314
890 JGI25159J45721_1000390
891 JGI25159J45721_1010269
892 JGI25159J45721_1012861
893 JGI25151J46595_10001225
894 JGI25151J46595_10006750
895 JGI25151J46595_10037321
896 JGI25151J46595_10060861
897 JGI25160J50197_1000587
898 JGI25160J50197_1014447
899 JGI25161J50226_1000046
900 JGI25161J50226_1005707
901 Ga0055532_1007099
902 Ga0055535_1000168
903 Ga0055542_1000214
904 Ga0055526_1001336
905 Ga0055537_1000333
906 Ga0055537_1003849
907 Ga0055536_1004071
908 Ga0055536_1006559
909 Ga0055536_1011290
910 Ga0055536_1043816
911 Ga0055536_1057284
912 Ga0055534_1000265
913 Ga0055534_1002007
914 Ga0055528_1000471
915 Ga0055530_10001300
916 Ga0055530_10007015
917 Ga0055540_1002601
918 Ga0055540_1003978
919 Ga0055540_1006814
920 Ga0055540_1013260
921 Ga0055531_10000572
922 Ga0055531_10015360
923 Ga0055531_10021056
924 Ga0055543_1000270
925 Ga0055543_1011478
926 Ga0065165_1004394
927 Ga0065165_1008423
928 Ga0065165_1012613
929 Ga0065714_10009479
930 Ga0065714_10018383
931 Ga0065715_10212643
932 Ga0070658_10018845
933 Ga0070676_10005193
934 Ga0070683_100033594
935 Ga0070683_100042013
936 Ga0070683_100179259
937 Ga0070690_100159010
938 Ga0070670_100002652
939 Ga0070670_100174947
940 Ga0070670_100196264
941 Ga0070670_100337005
942 Ga0070670_100349021
943 Ga0070670_100405685
944 Ga0070677_10141003
945 Ga0070677_10148111
946 Ga0070677_10252158
947 Ga0068869_100267115
948 Ga0068869_100368423
949 Ga0070666_10041789
950 Ga0070680_100003929
951 Ga0070682_100009730
952 Ga0068868_100012831
953 Ga0068868_100024677
954 Ga0068868_100102210
955 Ga0070660_100021211
956 Ga0070689_100099158
957 Ga0070689_100329583
958 Ga0070661_100055057
959 Ga0070661_100113482
960 Ga0070668_100034263
961 Ga0070669_100095509
962 Ga0070675_100000243
963 Ga0070675_100049676
964 Ga0070675_100074036
965 Ga0070675_100118973
966 Ga0070675_100325853
967 Ga0070671_100006003
968 Ga0070671_100118534
969 Ga0070674_100079750
970 Ga0070673_100488441
971 Ga0070688_100075652
972 Ga0070688_100091088
973 Ga0070667_100004597
974 Ga0070667_100010689
975 Ga0070667_100087475
976 Ga0070667_100256133
977 Ga0070667_100544065
978 Ga0070713_100040282
979 Ga0070713_100395031
980 Ga0070694_100467155
981 Ga0070708_100157330
982 Ga0070678_100003356
983 Ga0070678_100027877
984 Ga0070678_100375644
985 Ga0070662_100061150
986 Ga0070662_100431390
987 Ga0070662_100432137
988 Ga0070681_10017373
989 Ga0070681_10585894
990 Ga0068867_100000070
991 Ga0068867_100001303
992 Ga0068867_100069326
993 Ga0068867_100142732
994 Ga0070685_10144850
995 Ga0070685_10185263
996 Ga0070706_100052079
997 Ga0070706_100093757
998 Ga0070707_100453004
999 Ga0070698_100041385
1000 Ga0070698_100079874
1001 Ga0070698_100106590
1002 Ga0070698_100227194
1003 Ga0070679_100183922
1004 Ga0070684_100015745
1005 Ga0068853_100118500
1006 Ga0068853_100336849
1007 Ga0068853_100354295
1008 Ga0070672_100002056
1009 Ga0070672_100013934
1010 Ga0070672_100073770
1011 Ga0070672_100393632
1012 Ga0070686_100166977
1013 Ga0070665_100040676
1014 Ga0070665_100365877
1015 Ga0070665_100376080
1016 Ga0070664_100085331
1017 Ga0070664_100187735
1018 Ga0070664_100210478
1019 Ga0070664_100229438
1020 Ga0070664_100472252
1021 Ga0068857_100064216
1022 Ga0068856_100024423
1023 Ga0068856_100255077
1024 Ga0070702_100319298
1025 Ga0068852_100094926
1026 Ga0068852_100100747
1027 Ga0068852_100524008
1028 Ga0068859_100000664
1029 Ga0068859_100030244
1030 Ga0068859_100136827
1031 Ga0068864_100000649
1032 Ga0068864_100012522
1033 Ga0068861_100204172
1034 Ga0068863_100029931
1035 Ga0068863_100098457
1036 Ga0068863_100235284
1037 Ga0068863_100619755
1038 Ga0068858_100000753
1039 Ga0068858_100088379
1040 Ga0068860_100002764
1041 Ga0068862_100120065
1042 Ga0068862_100290676
1043 Ga0070717_10323965
1044 Ga0075365_10012259
1045 Ga0075365_10079420
1046 Ga0075365_10096667
1047 Ga0075365_10120190
1048 Ga0075365_10185954
1049 Ga0075363_100197864
1050 Ga0075364_10005816
1051 Ga0075364_10010345
1052 Ga0075364_10125768
1053 Ga0075432_10017095
1054 Ga0075432_10020342
1055 Ga0070716_100287477
1056 Ga0070712_100170383
1057 Ga0075362_10007426
1058 Ga0075362_10027898
1059 Ga0075362_10035193
1060 Ga0075362_10036824
1061 Ga0075362_10086376
1062 Ga0075362_10095301
1063 Ga0075362_10161603
1064 Ga0075367_10043210
1065 Ga0075367_10058404
1066 Ga0075367_10092164
1067 Ga0075367_10114642
1068 Ga0075367_10120299
1069 Ga0075369_10114381
1070 Ga0075366_10002264
1071 Ga0075366_10004609
1072 Ga0075366_10007302
1073 Ga0075366_10023123
1074 Ga0075366_10048512
1075 Ga0075366_10085314
1076 Ga0097621_100018401
1077 Ga0097621_100030835
1078 Ga0097621_100292723
1079 Ga0097621_100299508
1080 Ga0075370_10000228
1081 Ga0075370_10001803
1082 Ga0075370_10003908
1083 Ga0075370_10008651
1084 Ga0075370_10024701
1085 Ga0075370_10025174
1086 Ga0068871_100220351
1087 Ga0075428_100002520
1088 Ga0075430_100022035
1089 Ga0075430_100023654
1090 Ga0075430_100066535
1091 Ga0075430_100088625
1092 Ga0075430_100133493
1093 Ga0075431_100006591
1094 Ga0075431_100014970
1095 Ga0075431_100023387
1096 Ga0075431_100155537
1097 Ga0075429_100000655
1098 Ga0075429_100035877
1099 Ga0075429_100106064
1100 Ga0075429_100191372
1101 Ga0097620_100000664
1102 Ga0097620_100030244
1103 Ga0097620_100136824
1104 Ga0079104_1027794
1105 Ga0099826_10005686
1106 Ga0105244_10007097
1107 Ga0105244_10019619
1108 Ga0105240_10031052
1109 Ga0105240_10297992
1110 Ga0105240_10447420
1111 Ga0105240_10879982
1112 Ga0111539_10003696
1113 Ga0105245_10061457
1114 Ga0105245_10431885
1115 Ga0105245_10663695
1116 Ga0105245_10685939
1117 Ga0105245_10703366
1118 Ga0105247_10051958
1119 Ga0114129_10002274
1120 Ga0114129_10094036
1121 Ga0114129_10586999
1122 Ga0105243_10001208
1123 Ga0105243_10007703
1124 Ga0105243_10013939
1125 Ga0105243_10026405
1126 Ga0105243_10041812
1127 Ga0105243_10698990
1128 Ga0105241_10148805
1129 Ga0105241_10157151
1130 Ga0105241_10532658
1131 Ga0105248_10011097
1132 Ga0105248_10069550
1133 Ga0105248_10378799
1134 Ga0105248_10618214
1135 Ga0105248_10630500
1136 Ga0105237_10212465
1137 Ga0105237_10679567
1138 Ga0105238_10078324
1139 Ga0105238_10606787
1140 Ga0105249_10439956
1141 Ga0105239_10064107
1142 Ga0105239_10331024
1143 Ga0105239_10532982
1144 Ga0105239_10572321
1145 Ga0105239_10738217
1146 Ga0105246_10013882
1147 Ga0105246_10132797
1148 Ga0105246_10296835
1149 Ga0105246_10493005
1150 Ga0157347_1000563
1151 Ga0157373_10084081
1152 Ga0157373_10109007
1153 Ga0157373_10261534
1154 Ga0157371_10027537
1155 Ga0157370_10082149
1156 Ga0157370_10297837
1157 Ga0157370_10309710
1158 Ga0157369_10580726
1159 Ga0157374_10084414
1160 Ga0157374_10449028
1161 Ga0157378_10071357
1162 Ga0157378_10137756
1163 Ga0157378_10237392
1164 Ga0157372_10144063
1165 Ga0157375_10053283
1166 Ga0157375_10313441
1167 Ga0163163_10003252
1168 Ga0157380_10022495
1169 Ga0182008_10003688
1170 Ga0157377_10000016
1171 Ga0157377_10062758
1172 Ga0157379_10000301
1173 Ga0157379_10010265
1174 Ga0157379_10268739
1175 Ga0157376_10034048
1176 Ga0157376_10108770
1177 Ga0182006_1005503
1178 Ga0182007_10004544
1179 Ga0183362_10015
1180 Ga0163161_10000669
1181 Ga0163161_10026203
1182 Ga0163161_10081773
1183 Ga0206353_10306862
1184 Ga0206353_10394074
1185 Ga0209436_106237
1186 Ga0209436_107795
1187 Ga0209672_101344
1188 Ga0209147_100697
1189 Ga0209258_100015
1190 Ga0207425_1000696
1191 Ga0207425_1000776
1192 Ga0209148_1000183
1193 Ga0209129_1000049
1194 Ga0209129_1005391
1195 Ga0209129_1014409
1196 Ga0209565_1000357
1197 Ga0209565_1000550
1198 Ga0209565_1000670
1199 Ga0209565_1001468
1200 Ga0209565_1001490
1201 Ga0209673_1000849
1202 Ga0209673_1004621
1203 Ga0209673_1008553
1204 Ga0209130_1000064
1205 Ga0209130_1002259
1206 Ga0209130_1011129
1207 Ga0209130_1014792
1208 Ga0209675_1000352
1209 Ga0209675_1006237
1210 Ga0209675_1008030
1211 Ga0209675_1008455
1212 Ga0209675_1012241
1213 Ga0209675_1013501
1214 Ga0209676_1000137
1215 Ga0209676_1000385
1216 Ga0209676_1000873
1217 Ga0209676_1008682
1218 Ga0209676_1014082
1219 Ga0209676_1026183
1220 Ga0209676_1037926
1221 Ga0209676_1049210
1222 Ga0209025_1000290
1223 Ga0209025_1000313
1224 Ga0209025_1004032
1225 Ga0209025_1005627
1226 Ga0209025_1014190
1227 Ga0209025_1017484
1228 Ga0209025_1026212
1229 Ga0209025_1041743
1230 Ga0209025_1044488
1231 Ga0209025_1101095
1232 Ga0209564_1001545
1233 Ga0209564_1005054
1234 Ga0209564_1009323
1235 Ga0209564_1017154
1236 Ga0209758_1000135
1237 Ga0209758_1021212
1238 Ga0209050_1000015
1239 Ga0209050_1001437
1240 Ga0209050_1001535
1241 Ga0209050_1012559
1242 Ga0209050_1025028
1243 Ga0209256_1000129
1244 Ga0209256_1000224
1245 Ga0207426_1000062
1246 Ga0207426_1000171
1247 Ga0207426_1000185
1248 Ga0207426_1028013
1249 Ga0209051_1000010
1250 Ga0209051_1000137
1251 Ga0209051_1000859
1252 Ga0209051_1001741
1253 Ga0209051_1027477
1254 Ga0209257_1000026
1255 Ga0209257_1000205
1256 Ga0209257_1009859
1257 Ga0209257_1025887
1258 Ga0209257_1034087
1259 Ga0207655_1002202
1260 Ga0207655_1011626
1261 Ga0207682_10025165
1262 Ga0207682_10028656
1263 Ga0207682_10034600
1264 Ga0207688_10031306
1265 Ga0207688_10325953
1266 Ga0207680_10000566
1267 Ga0207645_10003718
1268 Ga0207645_10006702
1269 Ga0207645_10079872
1270 Ga0207645_10169503
1271 Ga0207645_10189834
1272 Ga0207643_10064933
1273 Ga0207705_10076227
1274 Ga0207705_10304663
1275 Ga0207684_10049311
1276 Ga0207684_10065153
1277 Ga0207654_10071676
1278 Ga0207707_10121329
1279 Ga0207707_10351381
1280 Ga0207707_10364070
1281 Ga0207695_10255734
1282 Ga0207695_10273749
1283 Ga0207671_10323953
1284 Ga0207693_10249022
1285 Ga0207660_10026708
1286 Ga0207660_10107720
1287 Ga0207657_10020418
1288 Ga0207649_10085490
1289 Ga0207649_10321124
1290 Ga0207652_10417514
1291 Ga0207646_10279427
1292 Ga0207681_10433476
1293 Ga0207694_10008501
1294 Ga0207650_10077471
1295 Ga0207650_10233208
1296 Ga0207650_10386728
1297 Ga0207650_10394036
1298 Ga0207650_10552700
1299 Ga0207659_10000413
1300 Ga0207659_10017569
1301 Ga0207659_10142919
1302 Ga0207687_10009580
1303 Ga0207687_10164241
1304 Ga0207687_10511087
1305 Ga0207700_10001789
1306 Ga0207700_10024086
1307 Ga0207664_10066473
1308 Ga0207664_10101440
1309 Ga0207644_10010403
1310 Ga0207706_10084575
1311 Ga0207706_10137470
1312 Ga0207706_10287226
1313 Ga0207709_10000497
1314 Ga0207709_10002246
1315 Ga0207709_10002795
1316 Ga0207709_10010832
1317 Ga0207709_10015245
1318 Ga0207709_10111539
1319 Ga0207709_10217002
1320 Ga0207670_10007925
1321 Ga0207669_10168371
1322 Ga0207704_10083490
1323 Ga0207691_10001908
1324 Ga0207691_10016734
1325 Ga0207691_10139896
1326 Ga0207691_10367217
1327 Ga0207711_10008859
1328 Ga0207711_10331264
1329 Ga0207689_10015963
1330 Ga0207689_10121373
1331 Ga0207689_10229528
1332 Ga0207689_10365115
1333 Ga0207661_10013534
1334 Ga0207661_10100682
1335 Ga0207679_10145615
1336 Ga0207679_10205848
1337 Ga0207679_10216171
1338 Ga0207667_10046884
1339 Ga0207667_10893316
1340 Ga0207651_10716247
1341 Ga0207712_10212258
1342 Ga0207668_10253104
1343 Ga0207658_10001221
1344 Ga0207658_10032821
1345 Ga0207658_10064314
1346 Ga0207658_10153852
1347 Ga0207658_10435728
1348 Ga0207677_10018017
1349 Ga0207677_10180352
1350 Ga0207703_10003078
1351 Ga0207703_10003611
1352 Ga0207639_10038115
1353 Ga0207639_10051648
1354 Ga0207639_10394410
1355 Ga0207678_10138648
1356 Ga0207708_10153647
1357 Ga0207702_10308544
1358 Ga0207641_10005904
1359 Ga0207641_10007144
1360 Ga0207641_10280201
1361 Ga0207648_10000412
1362 Ga0207648_10051461
1363 Ga0207648_10069509
1364 Ga0207676_10000325
1365 Ga0207674_10107915
1366 Ga0207674_10256622
1367 Ga0207675_100202618
1368 Ga0207675_100568113
1369 Ga0207683_10008809
1370 Ga0207683_10020874
1371 Ga0207683_10087829
1372 Ga0207683_10135210
1373 Ga0207698_10077634
1374 Ga0207698_10096942
1375 Ga0207698_10128833
1376 Ga0207698_10169152
1377 Ga0207698_10429150
1378 Ga0209281_1027790
1379 Ga0209996_1017914
1380 Ga0209999_1032322
1381 Ga0209970_1000334
1382 Ga0209282_1007723
1383 Ga0209971_1016084
1384 Ga0209974_10017668
1385 Ga0207428_10000824
1386 Ga0207428_10017418
1387 Ga0268266_10074109
1388 Ga0268266_10151507
1389 Ga0268265_10274912
1390 Ga0268264_10003593
1391 Ga0265337_1073786
1392 Ga0265326_10012895
1393 Ga0265319_1000367
1394 Ga0265319_1013479
1395 Ga0265334_10011419
1396 Ga0265334_10057203
1397 Ga0265318_10001025
1398 Ga0265318_10003382
1399 Ga0265322_10003200
1400 Ga0265322_10024147
1401 Ga0307517_10000575
1402 Ga0307517_10155712
1403 Ga0307515_10000022
1404 Ga0307515_10000063
1405 Ga0307515_10000150
1406 Ga0307515_10014322
1407 Ga0307515_10199232
1408 Ga0307515_10265982
1409 Ga0265338_10005122
1410 Ga0265338_10007410
1411 Ga0265338_10020018
1412 Ga0307512_10242964
1413 Ga0316183_1162120
1414 Ga0316181_1135666
1415 Ga0265330_10010400
1416 Ga0265332_10000023
1417 Ga0265332_10008558
1418 Ga0265328_10006812
1419 Ga0265320_10003780
1420 Ga0265320_10150151
1421 Ga0265325_10004086
1422 Ga0265325_10034519
1423 Ga0265329_10003362
1424 Ga0265329_10011121
1425 Ga0265340_10002165
1426 Ga0265339_10039650
1427 Ga0265331_10021197
1428 Ga0265327_10001540
1429 Ga0265327_10006888
1430 Ga0265327_10015936
1431 Ga0265327_10031540
1432 Ga0265327_10054966
1433 Ga0265316_10007267
1434 Ga0265316_10017319
1435 Ga0307513_10000008
1436 Ga0307513_10000991
1437 Ga0307513_10003892
1438 Ga0307513_10042874
1439 Ga0307513_10117878
1440 Ga0307513_10167140
1441 Ga0307509_10185819
1442 Ga0307408_100025723
1443 Ga0307408_100072514
1444 Ga0307408_100158334
1445 Ga0307408_100279201
1446 Ga0307408_100452879
1447 Ga0265313_10012870
1448 Ga0307508_10025941
1449 Ga0307508_10255514
1450 Ga0307514_10088477
1451 Ga0265314_10004327
1452 Ga0265314_10066252
1453 Ga0265314_10163357
1454 Ga0265342_10004057
1455 Ga0265342_10024334
1456 Ga0265342_10164497
1457 Ga0307516_10003416
1458 Ga0307516_10059990
1459 Ga0307516_10075653
1460 Ga0307516_10194636
1461 Ga0307405_10060904
1462 Ga0307405_10114576
1463 Ga0307405_10241803
1464 Ga0307405_10330842
1465 Ga0307405_10354883
1466 Ga0307413_10156571
1467 Ga0307406_10001780
1468 Ga0307412_10011307
1469 Ga0307412_10011375
1470 Ga0307412_10013346
1471 Ga0307412_10056521
1472 Ga0307412_10088252
1473 Ga0307409_100598207
1474 Ga0307416_100065389
1475 Ga0307416_100093414
1476 Ga0307416_100094168
1477 Ga0307416_100193529
1478 Ga0307416_100383522
1479 Ga0307411_10541489
1480 Ga0307510_10007192
1481 Ga0307510_10009118
1482 Ga0373945_0087675
1483 Ga0373953_0122803
1484 Ga0373933_0607455
1485 Ga0373937_0057398
1486 Ga0373937_0288848
1487 Ga0373925_0164444
1488 Ga0373925_0323310
1489 Ga0395899_0012760
1490 Ga0395899_0014438
1491 Ga0395900_0171716
1492 Ga0395900_0230152
1493 Ga0395898_0235391
1494 Ga0395905_0000027
1495 Ga0395905_0000042
1496 Ga0395905_0007865
1497 Ga0395905_0031330
1498 Ga0395905_0050716
1499 Ga0395905_0098863
1500 Ga0395905_0391802
1501 Ga0395901_0046478
1502 Ga0395901_0145661
1503 Ga0395901_0163945
1504 Ga0242420_013191
1505 Ga0436365_1276969
1506 Ga0439436_0008478
1507 Ga0439453_0024676
1508 Ga0439461_0018517
1509 Ga0439465_0013016
1510 Ga0439431_0009348
1511 Ga0439432_071909
1512 Ga0439449_0001315
1513 Ga0439449_0008350
1514 Ga0439449_0019433
1515 Ga0439449_0041902
1516 Ga0439452_011363
1517 Ga0439457_005550
1518 Ga0439462_0006722
1519 Ga0450894_011448
1520 Ga0450898_004687
1521 Ga0450906_004729
1522 Ga0450906_009634
1523 Ga0439446_0071353
1524 Ga0450908_013841
1525 Ga0439434_0049332
1526 Ga0439464_0033666
1527 Ga0439464_0055069
1528 Ga0451577_0041221
1529 Ga0451577_0142894
1530 Ga0466969_0010253
1531 Ga0453683_0032805
1532 Ga0466965_0046594
1533 Ga0466961_0114125
1534 Ga0466963_0008273
1535 Ga0466963_0322912
1536 Ga0453684_0186465
1537 Ga0466957_0262128
1538 Ga0466960_0053041
1539 Ga0466960_0114552
1540 Ga0451576_0124355
1541 Ga0466958_0474425
1542 Ga0466967_0224909
1543 Ga0466967_0698893
1544 Ga0495592_0361789
1545 Ga0495638_0019461
1546 Ga0495638_0031274
1547 Ga0495651_0072210
1548 Ga0495580_0157787
1549 Ga0495580_0203219
1550 Ga0495664_0143246
1551 Ga0495608_0189926
1552 Ga0495608_0243199
1553 Ga0495610_0011528
1554 Ga0495610_0032973
1555 Ga0495616_0001839
1556 Ga0495628_0095150
1557 Ga0495631_0025535
1558 Ga0495632_0004875
1559 Ga0495637_0026522
1560 Ga0495663_0056141
1561 Ga0495642_0119600
1562 Ga0495654_0004374
1563 Ga0495587_0046189
1564 Ga0495587_0366428
1565 Ga0495621_0047681
1566 Ga0495656_0000047
1567 Ga0495668_0240129
1568 Ga0495634_0087469
1569 Ga0495625_0003370
1570 Ga0495625_0033388
1571 Ga0495625_0098189
1572 Ga0495625_0109259
1573 Ga0495635_0221126
1574 Ga0495657_0299238
1575 Ga0495624_0081410
1576 Ga0495649_0005389
1577 Ga0495600_0325308
1578 Ga0495604_0363410
1579 Ga0495636_0031751
1580 Ga0495676_0060279
1581 Ga0495680_0134425
1582 Ga0495680_0353949
1583 Ga0495687_004201
1584 Ga0495687_017276
1585 Ga0495687_024875
1586 Ga0495602_0360428
1587 Ga0496104_0101853
1588 Ga0496105_0009425
1589 Ga0496105_0296269
1590 Ga0496105_0340112
1591 Ga0496106_0266236
1592 Ga0496108_0071269
1593 Ga0496108_0121421
1594 Ga0496108_0291528
1595 Ga0496109_0467565
1596 Ga0496110_0027012
1597 Ga0496111_0093341
1598 Ga0496112_0001247
1599 Ga0496112_0110440
1600 Ga0496112_0176519
1601 Ga0496112_0328746
1602 Ga0496114_0455189
1603 Ga0496115_0146509
1604 Ga0496115_0160164
1605 Ga0496116_0017638
1606 Ga0496117_0025305
1607 Ga0496117_0088938
1608 Ga0496118_0005780
1609 Ga0496118_0038540
1610 Ga0496121_0002801
1611 Ga0496121_0013215
1612 Ga0496121_0042409
1613 Ga0496123_0061812
1614 Ga0496124_0055194
1615 Ga0496124_0222356
1616 Ga0496125_0021834
1617 Ga0501034_0015736
1618 Ga0501034_0169399
1619 Ga0501039_0043463
1620 Ga0501047_0148674
1621 Ga0501048_0337328
1622 Ga0501067_0023439
1623 Ga0501070_0009486
1624 Ga0501071_0031132
1625 Ga0501071_0071383
1626 Ga0501072_0041603
1627 Ga0501072_0057564
1628 Ga0501073_0007466
1629 Ga0501073_0075724
1630 Ga0501074_0007038
1631 Ga0501075_0022010
1632 Ga0501075_0095570
1633 Ga0501076_0006750
1634 Ga0501206_013213
1635 Ga0501207_030735
1636 Ga0501249_011011
1637 Ga0501257_018518
1638 Ga0501079_0026176
1639 Ga0501079_0053698
1640 Ga0501079_0109339
1641 Ga0501080_0001046
1642 Ga0501080_0025808
1643 Ga0501080_0038620
1644 Ga0501083_0000684
1645 Ga0501262_000493
1646 Ga0501262_002025
1647 Ga0501265_002350
1648 Ga0501035_0203196
1649 Ga0501044_0119947
1650 nmdc:mga03683_10371_c1
1651 nmdc:mga03683_107368_c1
1652 nmdc:mga03683_6233_c1
1653 nmdc:mga03683_6421_c1
1654 nmdc:mga03n38_12480_c1
1655 nmdc:mga03n38_154446_c1
1656 nmdc:mga03n38_32739_c1
1657 nmdc:mga03n38_51436_c1
1658 nmdc:mga03n38_78368_c1
1659 nmdc:mga00v17_41558_c1
1660 nmdc:mga00v17_57650_c1
1661 nmdc:mga0yw44_136519_c1
1662 nmdc:mga0yw44_7818_c1
1663 nmdc:mga0k408_104058_c1
1664 nmdc:mga0k408_10924_c1
1665 nmdc:mga0k408_17775_c1
1666 nmdc:mga0k408_20558_c1
1667 nmdc:mga0k408_43322_c1
1668 nmdc:mga0k408_48562_c1
1669 nmdc:mga0k408_51154_c1
1670 nmdc:mga0k408_5868_c1
1671 nmdc:mga06z11_34469_c1
1672 nmdc:mga06z11_78453_c1
1673 nmdc:mga07m45_11400_c1
1674 nmdc:mga07m45_14982_c1
1675 nmdc:mga07m45_20133_c1
1676 nmdc:mga07m45_25742_c1
1677 nmdc:mga07m45_33529_c1
1678 nmdc:mga07m45_44884_c1
1679 nmdc:mga07m45_65409_c1
1680 nmdc:mga07m45_872_c1
1681 nmdc:mga07m45_89452_c1
1682 nmdc:mga05p37_481_c1
1683 nmdc:mga05p37_75222_c1
1684 nmdc:mga09592_37264_c1
1685 nmdc:mga09592_46511_c1
1686 nmdc:mga09592_61627_c1
1687 nmdc:mga09592_663_c1
1688 nmdc:mga0qj67_149614_c1
1689 nmdc:mga0qj67_15458_c1
1690 nmdc:mga0qj67_154651_c1
1691 nmdc:mga0qj67_39409_c1
1692 nmdc:mga06r32_32_c1
1693 nmdc:mga06r32_367195_c1
1694 nmdc:mga08y16_2608_c1
1695 nmdc:mga0n895_243544_c1
1696 nmdc:mga0sz30_45735_c1
1697 nmdc:mga0sz30_7187_c1
1698 Ga0500610_0043519
1699 Ga0500610_0173412
1700 Ga0500610_0210162
1701 Ga0495619_0124531
1702 Ga0500644_0007182
1703 Ga0500644_0029832
1704 Ga0500651_0000169
1705 Ga0500651_0123118
1706 Ga0500651_0173684
1707 Ga0500641_0085904
1708 Ga0500592_007280
1709 Ga0500594_0004056
1710 Ga0500608_034684
1711 Ga0500658_0001494
1712 Ga0500568_0112185
1713 Ga0500627_0048483
1714 Ga0500634_0061462
1715 Ga0500645_000657
1716 Ga0500645_008657
1717 Ga0501084_0086944
1718 Ga0501082_0265591
1719 Ga0530510_0042453
1720 2511243524
1721 2513227332
1722 2548499289
1723 2599627103
1724 2599676536
1725 2599684804
1726 2599696760
1727 2643866122
1728 2643994112
1729 2644057654
1730 2644072259
1731 2644160064
1732 2644292936
1733 2644302028
1734 2644329453
1735 2644401025
1736 2644464275
1737 2644466350
1738 2644647952
1739 2738723457
1740 2738882243
1741 2739241928
1742 2739251222
1743 2739284188
1744 2816470770
1745 2819598172
1746 2831269159
1747 2838058589
1748 2842682428
1749 2885196445
1750 2885200020
1751 2885213750
1752 2899929594
1753 2904456407
1754 2904462916
1755 2904549064
1756 2919465834
1757 2919706164
1758 2928039963
1759 2928047288
1760 2928057508
1761 2928068106
1762 2928072691
1763 2928085854
1764 2928120189
1765 2929160692
1766 2929523771
1767 2939634120
1768 2945914812
1769 2945951123
1770 2945974219
1771 2945989789
1772 2990714177

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

24

172

0.89

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

92

200

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9706 1 240
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9627 1 240
3d31-assembly1.cif.gz_A modbc from methanosarcina acetivorans 0.936 6 229
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9358 6 226
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9231 5 226
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9672 1 239 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9632 1 239 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9622 1 240 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9612 6 238 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9582 1 240 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3S3EXW3-F1-model_v4 ABC transporter ATP-binding protein 0.9797 6 238 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A417Z7G5-F1-model_v4 ABC transporter ATP-binding protein 0.9782 4 240 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A496QUQ5-F1-model_v4 ABC transporter ATP-binding protein 0.9761 5 239 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A7W1N4U0-F1-model_v4 ABC transporter ATP-binding protein 0.9724 4 239 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A3S3EXW3-F1-model_v4 ABC transporter ATP-binding protein 0.9715 6 238 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map