F484718
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 887 | 368 | 856 | 463 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100034542|Ga0070659_1000345423 |
| Length | 496 |
| Sequence | MTRARRGWGEDIMSNTRNGVNMALISAIVAVATIGGLLFGYDSGAVNGTQTGLTAEFDLTPASLGFTVGSLLIGCAFGAALAGRLADVMGRRNVMLVAAALFVAGALTQGLTHDHTIFVIARFFGGMAVGAASVLSPLYISEVAPANIRGRLTTVQQVMIITGLTAAFVVNYFVANAAGDSLGELAGVKAWRWMYLAQALPAVVFLIALFFIPESPRFLVSKGRKAEALKVLTSLFGSAEAERKVGEIQASFADDHRPRLSDVTAPGTVFRPIVWAGLLLATFQQFVGINIIFYYGETLWKLAGVSESAALERNVVSGLVSIAAVFAAILLIDKIGRKPLLLIGSVGMAVTLGAMTWAFSAAGTDAAGNLMLAPTQGWVALVAANLYVIFFNFSWGPVMWVMLGEMFPNQIRGSALAVAGFAQWAANFLVVQIFPWMADSLGLAATYAFYTASAVISFFLVRAFIKETKGKELEEMEGWTAPAAAGDAEVATTKLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 4 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 5 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 6 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 7 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 8 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 9 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 10 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 11 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 12 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 13 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 14 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 15 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 16 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 17 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 18 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 19 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 20 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 21 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 22 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 23 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 24 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 25 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 26 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 27 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 28 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 29 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 30 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 31 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 32 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 33 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 34 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 35 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 36 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 37 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 38 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 39 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 40 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 57 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 61 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 138 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 139 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 230 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 248 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 249 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 250 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 251 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 255 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 256 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 257 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 258 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 259 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 260 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 261 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 262 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 263 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 264 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 265 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 266 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 267 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 268 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 269 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 270 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 271 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 272 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 273 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 274 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 275 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 276 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 277 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 278 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 279 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 280 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 281 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 282 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 283 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 284 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 330 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 341 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 342 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 344 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 348 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 349 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 350 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 351 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 352 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 353 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 354 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 355 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 356 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 357 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 361 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 363 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 364 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 367 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 368 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.39 |
| Metatranscriptomes | 0.11 |
| Isolates | 3.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 11.05 |
| Nodule | 0 |
| Rhizoplane | 3.27 |
| Rhizosphere | 80.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1372803 | 2162886007 | Bacteria | 5865 |
| 2 | JGI24736J21556_1000754 | 3300001904 | Bacteria | 5922 |
| 3 | JGI24736J21556_1002528 | 3300001904 | Bacteria | 3230 |
| 4 | JGI24740J21852_10021675 | 3300001979 | Bacteria | 2224 |
| 5 | JGI24739J22299_10000471 | 3300001989 | Bacteria | 14184 |
| 6 | JGI24737J22298_10001146 | 3300001990 | Bacteria | 9321 |
| 7 | JGI24737J22298_10002102 | 3300001990 | Bacteria | 7108 |
| 8 | JGI24737J22298_10005103 | 3300001990 | Bacteria | 4544 |
| 9 | JGI24737J22298_10005783 | 3300001990 | Bacteria | 4260 |
| 10 | JGI24737J22298_10009895 | 3300001990 | Bacteria | 3156 |
| 11 | JGI24737J22298_10021942 | 3300001990 | Bacteria | 2030 |
| 12 | JGI24743J22301_10000488 | 3300001991 | Bacteria | 4591 |
| 13 | JGI24738J21930_10001044 | 3300002075 | Bacteria | 7893 |
| 14 | JGI24738J21930_10010652 | 3300002075 | Bacteria | 2041 |
| 15 | JGI25165J46597_1000106 | 3300003214 | Bacteria | 151139 |
| 16 | JGI25165J46597_1000138 | 3300003214 | Bacteria | 121773 |
| 17 | JGI25153J46596_10000006 | 3300003215 | Bacteria | 447760 |
| 18 | JGI25153J46596_10000260 | 3300003215 | Bacteria | 42298 |
| 19 | JGI25153J46596_10008006 | 3300003215 | Bacteria | 5112 |
| 20 | Ga0055542_1004480 | 3300003762 | Bacteria | 3381 |
| 21 | Ga0055537_1000161 | 3300003773 | Bacteria | 50226 |
| 22 | Ga0055537_1001708 | 3300003773 | Bacteria | 8119 |
| 23 | Ga0055537_1008784 | 3300003773 | Bacteria | 2291 |
| 24 | Ga0055524_1000110 | 3300003775 | Bacteria | 99255 |
| 25 | Ga0055536_1001906 | 3300003781 | Bacteria | 12089 |
| 26 | Ga0055536_1002035 | 3300003781 | Bacteria | 11584 |
| 27 | Ga0055536_1005768 | 3300003781 | Bacteria | 5965 |
| 28 | Ga0055536_1018772 | 3300003781 | Bacteria | 2201 |
| 29 | Ga0055528_1004276 | 3300003790 | Bacteria | 6909 |
| 30 | Ga0055530_10000074 | 3300003791 | Bacteria | 85116 |
| 31 | Ga0055530_10000579 | 3300003791 | Bacteria | 31675 |
| 32 | Ga0055530_10002421 | 3300003791 | Bacteria | 12077 |
| 33 | Ga0055530_10008021 | 3300003791 | Bacteria | 4309 |
| 34 | Ga0055540_1000943 | 3300003792 | Bacteria | 18909 |
| 35 | Ga0055531_10000374 | 3300003794 | Bacteria | 43198 |
| 36 | Ga0055531_10002640 | 3300003794 | Bacteria | 11857 |
| 37 | Ga0055531_10003045 | 3300003794 | Bacteria | 10862 |
| 38 | Ga0055531_10003351 | 3300003794 | Bacteria | 10242 |
| 39 | Ga0065165_1000459 | 3300005262 | Bacteria | 63870 |
| 40 | Ga0065165_1001720 | 3300005262 | Bacteria | 21926 |
| 41 | Ga0065165_1001878 | 3300005262 | Bacteria | 20322 |
| 42 | Ga0065165_1008312 | 3300005262 | Bacteria | 4888 |
| 43 | Ga0065704_10005955 | 3300005289 | Bacteria | 5174 |
| 44 | Ga0065704_10070205 | 3300005289 | Bacteria | 83747 |
| 45 | Ga0070658_10000002 | 3300005327 | Bacteria | 637290 |
| 46 | Ga0070658_10000262 | 3300005327 | Bacteria | 46229 |
| 47 | Ga0070658_10002456 | 3300005327 | Bacteria | 15507 |
| 48 | Ga0070658_10007785 | 3300005327 | Bacteria | 8636 |
| 49 | Ga0070658_10012376 | 3300005327 | Bacteria | 6850 |
| 50 | Ga0070658_10014970 | 3300005327 | Bacteria | 6208 |
| 51 | Ga0070658_10021972 | 3300005327 | Bacteria | 5117 |
| 52 | Ga0070658_10071614 | 3300005327 | Bacteria | 2839 |
| 53 | Ga0070658_10081087 | 3300005327 | Bacteria | 2665 |
| 54 | Ga0070676_10000052 | 3300005328 | Bacteria | 37236 |
| 55 | Ga0070676_10000442 | 3300005328 | Bacteria | 19744 |
| 56 | Ga0070676_10030693 | 3300005328 | Bacteria | 3067 |
| 57 | Ga0070676_10066819 | 3300005328 | Bacteria | 2149 |
| 58 | Ga0070676_10069457 | 3300005328 | Bacteria | 2111 |
| 59 | Ga0070683_100026592 | 3300005329 | Bacteria | 5213 |
| 60 | Ga0070683_100091902 | 3300005329 | Bacteria | 2850 |
| 61 | Ga0070683_100139833 | 3300005329 | Bacteria | 2294 |
| 62 | Ga0070690_100002605 | 3300005330 | Bacteria | 9721 |
| 63 | Ga0070690_100023434 | 3300005330 | Bacteria | 3786 |
| 64 | Ga0070670_100000539 | 3300005331 | Bacteria | 30116 |
| 65 | Ga0070670_100052103 | 3300005331 | Bacteria | 3515 |
| 66 | Ga0070670_100068086 | 3300005331 | Bacteria | 3055 |
| 67 | Ga0070677_10000627 | 3300005333 | Bacteria | 11833 |
| 68 | Ga0068869_100001639 | 3300005334 | Bacteria | 13350 |
| 69 | Ga0068869_100002806 | 3300005334 | Bacteria | 10561 |
| 70 | Ga0068869_100016693 | 3300005334 | Bacteria | 4953 |
| 71 | Ga0070666_10000317 | 3300005335 | Bacteria | 30840 |
| 72 | Ga0070666_10001618 | 3300005335 | Bacteria | 13694 |
| 73 | Ga0070666_10077527 | 3300005335 | Bacteria | 2268 |
| 74 | Ga0070680_100000409 | 3300005336 | Bacteria | 29285 |
| 75 | Ga0070680_100089477 | 3300005336 | Bacteria | 2547 |
| 76 | Ga0070680_100199122 | 3300005336 | Bacteria | 1689 |
| 77 | Ga0070682_100067716 | 3300005337 | Bacteria | 2274 |
| 78 | Ga0068868_100000350 | 3300005338 | Bacteria | 31314 |
| 79 | Ga0068868_100002542 | 3300005338 | Bacteria | 12673 |
| 80 | Ga0068868_100020478 | 3300005338 | Bacteria | 4971 |
| 81 | Ga0070660_100000469 | 3300005339 | Bacteria | 26907 |
| 82 | Ga0070660_100001869 | 3300005339 | Bacteria | 14498 |
| 83 | Ga0070660_100002093 | 3300005339 | Bacteria | 13769 |
| 84 | Ga0070660_100008383 | 3300005339 | Bacteria | 7225 |
| 85 | Ga0070660_100010936 | 3300005339 | Bacteria | 6426 |
| 86 | Ga0070660_100013720 | 3300005339 | Bacteria | 5824 |
| 87 | Ga0070660_100018676 | 3300005339 | Bacteria | 5070 |
| 88 | Ga0070660_100055816 | 3300005339 | Bacteria | 3053 |
| 89 | Ga0070689_100017077 | 3300005340 | Bacteria | 5324 |
| 90 | Ga0070689_100041597 | 3300005340 | Bacteria | 3528 |
| 91 | Ga0070687_100087279 | 3300005343 | Bacteria | 1717 |
| 92 | Ga0070661_100000006 | 3300005344 | Bacteria | 216544 |
| 93 | Ga0070661_100001715 | 3300005344 | Bacteria | 15192 |
| 94 | Ga0070661_100011226 | 3300005344 | Bacteria | 6241 |
| 95 | Ga0070661_100015312 | 3300005344 | Bacteria | 5411 |
| 96 | Ga0070661_100126596 | 3300005344 | Bacteria | 1917 |
| 97 | Ga0070692_10000464 | 3300005345 | Bacteria | 12400 |
| 98 | Ga0070668_100016356 | 3300005347 | Bacteria | 5547 |
| 99 | Ga0070668_100078339 | 3300005347 | Bacteria | 2584 |
| 100 | Ga0070669_100002036 | 3300005353 | Bacteria | 14622 |
| 101 | Ga0070669_100024685 | 3300005353 | Bacteria | 4312 |
| 102 | Ga0070669_100063440 | 3300005353 | Bacteria | 2719 |
| 103 | Ga0070675_100002779 | 3300005354 | Bacteria | 13172 |
| 104 | Ga0070675_100019406 | 3300005354 | Bacteria | 5417 |
| 105 | Ga0070675_100024531 | 3300005354 | Bacteria | 4830 |
| 106 | Ga0070675_100046511 | 3300005354 | Bacteria | 3553 |
| 107 | Ga0070671_100002716 | 3300005355 | Bacteria | 13731 |
| 108 | Ga0070671_100009319 | 3300005355 | Bacteria | 7883 |
| 109 | Ga0070671_100016223 | 3300005355 | Bacteria | 6024 |
| 110 | Ga0070671_100022126 | 3300005355 | Bacteria | 5193 |
| 111 | Ga0070671_100022652 | 3300005355 | Bacteria | 5131 |
| 112 | Ga0070671_100079600 | 3300005355 | Bacteria | 2739 |
| 113 | Ga0070674_100005130 | 3300005356 | Bacteria | 7530 |
| 114 | Ga0070674_100044185 | 3300005356 | Bacteria | 3036 |
| 115 | Ga0070674_100058485 | 3300005356 | Bacteria | 2680 |
| 116 | Ga0070674_100129450 | 3300005356 | Bacteria | 1880 |
| 117 | Ga0070673_100000004 | 3300005364 | Bacteria | 199809 |
| 118 | Ga0070673_100002361 | 3300005364 | Bacteria | 11476 |
| 119 | Ga0070673_100002611 | 3300005364 | Bacteria | 11012 |
| 120 | Ga0070673_100030150 | 3300005364 | Bacteria | 4054 |
| 121 | Ga0070673_100044044 | 3300005364 | Bacteria | 3453 |
| 122 | Ga0070659_100004577 | 3300005366 | Bacteria | 9891 |
| 123 | Ga0070659_100007934 | 3300005366 | Bacteria | 7734 |
| 124 | Ga0070659_100034542 | 3300005366 | Bacteria | 3933 |
| 125 | Ga0070659_100075616 | 3300005366 | Bacteria | 2684 |
| 126 | Ga0070659_100083956 | 3300005366 | Bacteria | 2546 |
| 127 | Ga0070659_100128932 | 3300005366 | Bacteria | 2053 |
| 128 | Ga0070659_100137070 | 3300005366 | Bacteria | 1990 |
| 129 | Ga0070667_100001019 | 3300005367 | Bacteria | 25569 |
| 130 | Ga0070667_100010643 | 3300005367 | Bacteria | 7596 |
| 131 | Ga0070667_100118785 | 3300005367 | Bacteria | 2298 |
| 132 | Ga0070667_100172986 | 3300005367 | Bacteria | 1907 |
| 133 | Ga0070714_100239072 | 3300005435 | Bacteria | 1676 |
| 134 | Ga0070713_100005111 | 3300005436 | Bacteria | 8928 |
| 135 | Ga0070663_100001446 | 3300005455 | Bacteria | 13027 |
| 136 | Ga0070663_100003936 | 3300005455 | Bacteria | 8661 |
| 137 | Ga0070663_100025519 | 3300005455 | Bacteria | 3991 |
| 138 | Ga0070678_100013770 | 3300005456 | Bacteria | 5082 |
| 139 | Ga0070678_100031379 | 3300005456 | Bacteria | 3665 |
| 140 | Ga0070678_100122039 | 3300005456 | Bacteria | 2056 |
| 141 | Ga0070662_100002273 | 3300005457 | Bacteria | 11785 |
| 142 | Ga0070662_100009072 | 3300005457 | Bacteria | 6489 |
| 143 | Ga0070662_100023282 | 3300005457 | Bacteria | 4253 |
| 144 | Ga0070662_100043802 | 3300005457 | Bacteria | 3204 |
| 145 | Ga0070662_100083374 | 3300005457 | Bacteria | 2386 |
| 146 | Ga0070662_100219477 | 3300005457 | Bacteria | 1516 |
| 147 | Ga0070681_10012780 | 3300005458 | Bacteria | 8332 |
| 148 | Ga0068867_100000028 | 3300005459 | Bacteria | 87716 |
| 149 | Ga0068867_100004200 | 3300005459 | Bacteria | 10133 |
| 150 | Ga0068867_100004228 | 3300005459 | Bacteria | 10103 |
| 151 | Ga0068867_100007450 | 3300005459 | Bacteria | 7741 |
| 152 | Ga0068867_100125532 | 3300005459 | Bacteria | 1988 |
| 153 | Ga0070679_100009569 | 3300005530 | Bacteria | 9165 |
| 154 | Ga0070679_100020025 | 3300005530 | Bacteria | 6519 |
| 155 | Ga0070679_100063132 | 3300005530 | Bacteria | 3692 |
| 156 | Ga0070679_100146989 | 3300005530 | Bacteria | 2334 |
| 157 | Ga0070679_100244435 | 3300005530 | Bacteria | 1751 |
| 158 | Ga0070684_100003155 | 3300005535 | Bacteria | 12311 |
| 159 | Ga0070684_100020722 | 3300005535 | Bacteria | 5454 |
| 160 | Ga0068853_100007512 | 3300005539 | Bacteria | 8724 |
| 161 | Ga0068853_100010686 | 3300005539 | Bacteria | 7433 |
| 162 | Ga0068853_100041339 | 3300005539 | Bacteria | 3937 |
| 163 | Ga0068853_100154195 | 3300005539 | Bacteria | 2069 |
| 164 | Ga0070672_100000098 | 3300005543 | Bacteria | 43239 |
| 165 | Ga0070672_100010344 | 3300005543 | Bacteria | 6470 |
| 166 | Ga0070672_100015697 | 3300005543 | Bacteria | 5406 |
| 167 | Ga0070686_100000128 | 3300005544 | Bacteria | 53245 |
| 168 | Ga0070665_100000123 | 3300005548 | Bacteria | 147463 |
| 169 | Ga0070665_100002188 | 3300005548 | Bacteria | 21801 |
| 170 | Ga0070665_100092381 | 3300005548 | Bacteria | 3031 |
| 171 | Ga0068855_100002440 | 3300005563 | Bacteria | 22956 |
| 172 | Ga0068855_100016089 | 3300005563 | Bacteria | 8997 |
| 173 | Ga0068855_100018131 | 3300005563 | Bacteria | 8459 |
| 174 | Ga0068855_100019593 | 3300005563 | Bacteria | 8127 |
| 175 | Ga0068855_100069849 | 3300005563 | Bacteria | 4087 |
| 176 | Ga0070664_100000811 | 3300005564 | Bacteria | 24038 |
| 177 | Ga0070664_100010114 | 3300005564 | Bacteria | 7647 |
| 178 | Ga0068857_100001431 | 3300005577 | Bacteria | 18899 |
| 179 | Ga0068857_100002408 | 3300005577 | Bacteria | 15252 |
| 180 | Ga0068857_100017127 | 3300005577 | Bacteria | 6348 |
| 181 | Ga0068857_100106544 | 3300005577 | Bacteria | 2517 |
| 182 | Ga0068854_100004750 | 3300005578 | Bacteria | 8567 |
| 183 | Ga0068854_100017047 | 3300005578 | Bacteria | 4855 |
| 184 | Ga0068854_100045945 | 3300005578 | Bacteria | 3107 |
| 185 | Ga0068854_100092980 | 3300005578 | Bacteria | 2247 |
| 186 | Ga0068854_100101741 | 3300005578 | Bacteria | 2155 |
| 187 | Ga0068856_100022031 | 3300005614 | Bacteria | 6196 |
| 188 | Ga0068856_100241377 | 3300005614 | Bacteria | 1822 |
| 189 | Ga0068852_100000968 | 3300005616 | Bacteria | 18862 |
| 190 | Ga0068852_100025664 | 3300005616 | Bacteria | 4777 |
| 191 | Ga0068852_100042719 | 3300005616 | Bacteria | 3839 |
| 192 | Ga0068852_100129571 | 3300005616 | Bacteria | 2321 |
| 193 | Ga0068852_100139777 | 3300005616 | Bacteria | 2240 |
| 194 | Ga0068852_100146978 | 3300005616 | Bacteria | 2187 |
| 195 | Ga0068852_100188373 | 3300005616 | Bacteria | 1945 |
| 196 | Ga0068859_100002646 | 3300005617 | Bacteria | 18230 |
| 197 | Ga0068859_100009383 | 3300005617 | Bacteria | 9881 |
| 198 | Ga0068859_100033133 | 3300005617 | Bacteria | 5189 |
| 199 | Ga0068859_100082236 | 3300005617 | Bacteria | 3263 |
| 200 | Ga0068864_100000835 | 3300005618 | Bacteria | 25979 |
| 201 | Ga0068864_100000948 | 3300005618 | Bacteria | 24272 |
| 202 | Ga0068864_100005111 | 3300005618 | Bacteria | 10750 |
| 203 | Ga0068864_100007745 | 3300005618 | Bacteria | 8851 |
| 204 | Ga0068861_100000084 | 3300005719 | Bacteria | 45078 |
| 205 | Ga0068861_100040697 | 3300005719 | Bacteria | 3477 |
| 206 | Ga0068851_10039346 | 3300005834 | Bacteria | 2374 |
| 207 | Ga0068863_100000331 | 3300005841 | Bacteria | 48023 |
| 208 | Ga0068863_100001531 | 3300005841 | Bacteria | 22856 |
| 209 | Ga0068863_100005902 | 3300005841 | Bacteria | 12004 |
| 210 | Ga0068863_100107891 | 3300005841 | Bacteria | 2650 |
| 211 | Ga0068858_100000378 | 3300005842 | Bacteria | 46589 |
| 212 | Ga0068858_100001485 | 3300005842 | Bacteria | 24146 |
| 213 | Ga0068858_100008478 | 3300005842 | Bacteria | 9879 |
| 214 | Ga0068858_100018540 | 3300005842 | Bacteria | 6516 |
| 215 | Ga0068858_100162476 | 3300005842 | Bacteria | 2103 |
| 216 | Ga0068858_100192089 | 3300005842 | Bacteria | 1929 |
| 217 | Ga0068860_100020775 | 3300005843 | Bacteria | 6360 |
| 218 | Ga0068860_100039947 | 3300005843 | Bacteria | 4486 |
| 219 | Ga0068860_100120419 | 3300005843 | Bacteria | 2513 |
| 220 | Ga0068860_100292328 | 3300005843 | Bacteria | 1594 |
| 221 | Ga0068862_100005817 | 3300005844 | Bacteria | 10279 |
| 222 | Ga0068862_100071812 | 3300005844 | Bacteria | 2989 |
| 223 | Ga0081539_10018358 | 3300005985 | Bacteria | 4859 |
| 224 | Ga0081539_10031379 | 3300005985 | Bacteria | 3275 |
| 225 | Ga0070717_10027825 | 3300006028 | Bacteria | 4520 |
| 226 | Ga0075364_10040415 | 3300006051 | Bacteria | 3025 |
| 227 | Ga0097621_100115330 | 3300006237 | Bacteria | 2273 |
| 228 | Ga0097621_100115700 | 3300006237 | Bacteria | 2270 |
| 229 | Ga0075370_10021394 | 3300006353 | Bacteria | 3543 |
| 230 | Ga0068871_100005489 | 3300006358 | Bacteria | 8894 |
| 231 | Ga0068871_100027867 | 3300006358 | Bacteria | 4423 |
| 232 | Ga0075431_100031857 | 3300006847 | Bacteria | 5430 |
| 233 | Ga0068865_100000006 | 3300006881 | Bacteria | 201186 |
| 234 | Ga0068865_100008898 | 3300006881 | Bacteria | 6209 |
| 235 | Ga0068865_100039088 | 3300006881 | Bacteria | 3216 |
| 236 | Ga0068865_100047801 | 3300006881 | Bacteria | 2942 |
| 237 | Ga0068865_100093027 | 3300006881 | Bacteria | 2191 |
| 238 | Ga0097620_100002646 | 3300006931 | Bacteria | 18230 |
| 239 | Ga0097620_100009383 | 3300006931 | Bacteria | 9881 |
| 240 | Ga0097620_100033133 | 3300006931 | Bacteria | 5189 |
| 241 | Ga0097620_100082237 | 3300006931 | Bacteria | 3263 |
| 242 | Ga0105250_10042131 | 3300009092 | Bacteria | 1830 |
| 243 | Ga0105240_10020240 | 3300009093 | Bacteria | 8882 |
| 244 | Ga0105240_10025879 | 3300009093 | Bacteria | 7705 |
| 245 | Ga0105240_10076181 | 3300009093 | Bacteria | 4136 |
| 246 | Ga0105240_10203977 | 3300009093 | Bacteria | 2316 |
| 247 | Ga0111539_10264290 | 3300009094 | Bacteria | 2003 |
| 248 | Ga0105245_10001138 | 3300009098 | Bacteria | 24035 |
| 249 | Ga0105245_10001700 | 3300009098 | Bacteria | 20029 |
| 250 | Ga0105245_10003162 | 3300009098 | Bacteria | 14721 |
| 251 | Ga0105245_10046500 | 3300009098 | Bacteria | 3878 |
| 252 | Ga0105247_10002615 | 3300009101 | Bacteria | 12154 |
| 253 | Ga0105243_10000477 | 3300009148 | Bacteria | 41078 |
| 254 | Ga0105243_10083358 | 3300009148 | Bacteria | 2616 |
| 255 | Ga0105243_10088678 | 3300009148 | Bacteria | 2541 |
| 256 | Ga0105241_10011807 | 3300009174 | Bacteria | 6416 |
| 257 | Ga0105242_10076374 | 3300009176 | Bacteria | 2792 |
| 258 | Ga0105248_10000119 | 3300009177 | Bacteria | 89987 |
| 259 | Ga0105248_10002873 | 3300009177 | Bacteria | 19111 |
| 260 | Ga0105248_10003056 | 3300009177 | Bacteria | 18559 |
| 261 | Ga0105248_10004347 | 3300009177 | Bacteria | 15674 |
| 262 | Ga0105248_10025820 | 3300009177 | Bacteria | 6533 |
| 263 | Ga0105248_10110320 | 3300009177 | Bacteria | 3102 |
| 264 | Ga0105248_10216861 | 3300009177 | Bacteria | 2155 |
| 265 | Ga0105238_10037320 | 3300009551 | Bacteria | 4940 |
| 266 | Ga0105238_10192522 | 3300009551 | Bacteria | 2015 |
| 267 | Ga0105249_10017455 | 3300009553 | Bacteria | 6371 |
| 268 | Ga0105239_10010602 | 3300010375 | Bacteria | 10307 |
| 269 | Ga0105239_10042582 | 3300010375 | Bacteria | 4975 |
| 270 | Ga0105239_10087005 | 3300010375 | Bacteria | 3444 |
| 271 | Ga0105239_10155730 | 3300010375 | Bacteria | 2551 |
| 272 | Ga0105246_10000868 | 3300011119 | Bacteria | 17301 |
| 273 | Ga0105246_10035142 | 3300011119 | Bacteria | 3347 |
| 274 | Ga0105246_10089630 | 3300011119 | Bacteria | 2213 |
| 275 | Ga0157373_10017332 | 3300013100 | Bacteria | 5244 |
| 276 | Ga0157373_10028129 | 3300013100 | Bacteria | 4056 |
| 277 | Ga0157373_10042658 | 3300013100 | Bacteria | 3242 |
| 278 | Ga0157373_10107898 | 3300013100 | Bacteria | 1958 |
| 279 | Ga0157371_10004369 | 3300013102 | Bacteria | 12366 |
| 280 | Ga0157371_10007400 | 3300013102 | Bacteria | 8895 |
| 281 | Ga0157371_10070956 | 3300013102 | Bacteria | 2466 |
| 282 | Ga0157371_10080734 | 3300013102 | Bacteria | 2303 |
| 283 | Ga0157370_10000462 | 3300013104 | Bacteria | 50795 |
| 284 | Ga0157370_10011758 | 3300013104 | Bacteria | 9139 |
| 285 | Ga0157370_10060861 | 3300013104 | Bacteria | 3584 |
| 286 | Ga0157370_10218036 | 3300013104 | Bacteria | 1767 |
| 287 | Ga0157369_10001381 | 3300013105 | Bacteria | 29880 |
| 288 | Ga0157369_10003304 | 3300013105 | Bacteria | 19175 |
| 289 | Ga0157369_10015230 | 3300013105 | Bacteria | 8678 |
| 290 | Ga0157369_10025039 | 3300013105 | Bacteria | 6627 |
| 291 | Ga0157369_10230356 | 3300013105 | Bacteria | 1937 |
| 292 | Ga0157374_10002874 | 3300013296 | Bacteria | 14449 |
| 293 | Ga0157374_10008172 | 3300013296 | Bacteria | 8940 |
| 294 | Ga0157378_10001586 | 3300013297 | Bacteria | 20552 |
| 295 | Ga0157378_10002395 | 3300013297 | Bacteria | 16664 |
| 296 | Ga0157378_10062120 | 3300013297 | Bacteria | 3335 |
| 297 | Ga0163162_10009616 | 3300013306 | Bacteria | 9407 |
| 298 | Ga0163162_10032344 | 3300013306 | Bacteria | 5195 |
| 299 | Ga0163162_10173719 | 3300013306 | Bacteria | 2279 |
| 300 | Ga0157372_10006300 | 3300013307 | Bacteria | 12615 |
| 301 | Ga0157372_10062562 | 3300013307 | Bacteria | 4170 |
| 302 | Ga0157372_10209583 | 3300013307 | Bacteria | 2258 |
| 303 | Ga0157375_10006898 | 3300013308 | Bacteria | 9909 |
| 304 | Ga0157375_10027560 | 3300013308 | Bacteria | 5311 |
| 305 | Ga0157375_10102974 | 3300013308 | Bacteria | 2941 |
| 306 | Ga0157375_10190745 | 3300013308 | Bacteria | 2204 |
| 307 | Ga0163163_10026418 | 3300014325 | Bacteria | 5550 |
| 308 | Ga0157380_10070680 | 3300014326 | Bacteria | 2821 |
| 309 | Ga0157379_10057311 | 3300014968 | Bacteria | 3482 |
| 310 | Ga0157379_10126916 | 3300014968 | Bacteria | 2296 |
| 311 | Ga0157376_10000113 | 3300014969 | Bacteria | 58033 |
| 312 | Ga0157376_10142341 | 3300014969 | Bacteria | 2153 |
| 313 | Ga0163161_10015335 | 3300017792 | Bacteria | 5342 |
| 314 | Ga0213873_10000006 | 3300021358 | Bacteria | 408723 |
| 315 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 316 | Ga0213876_10001359 | 3300021384 | Bacteria | 15304 |
| 317 | Ga0207427_100586 | 3300025231 | Bacteria | 18316 |
| 318 | Ga0207425_1000072 | 3300025245 | Bacteria | 115017 |
| 319 | Ga0209026_1000483 | 3300025250 | Bacteria | 29654 |
| 320 | Ga0209148_1000059 | 3300025254 | Bacteria | 350224 |
| 321 | Ga0209148_1001365 | 3300025254 | Bacteria | 12736 |
| 322 | Ga0209129_1003291 | 3300025258 | Bacteria | 7146 |
| 323 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 324 | Ga0209233_1000182 | 3300025261 | Bacteria | 137671 |
| 325 | Ga0209565_1000030 | 3300025263 | Bacteria | 325058 |
| 326 | Ga0209565_1000132 | 3300025263 | Bacteria | 104716 |
| 327 | Ga0209565_1000140 | 3300025263 | Bacteria | 101561 |
| 328 | Ga0209455_1000265 | 3300025272 | Bacteria | 59804 |
| 329 | Ga0209673_1000630 | 3300025273 | Bacteria | 53635 |
| 330 | Ga0209673_1002418 | 3300025273 | Bacteria | 13001 |
| 331 | Ga0209675_1007212 | 3300025291 | Bacteria | 4304 |
| 332 | Ga0209676_1000043 | 3300025292 | Bacteria | 418680 |
| 333 | Ga0209676_1000063 | 3300025292 | Bacteria | 322025 |
| 334 | Ga0209676_1000712 | 3300025292 | Bacteria | 46015 |
| 335 | Ga0209676_1001967 | 3300025292 | Bacteria | 16408 |
| 336 | Ga0209676_1006661 | 3300025292 | Bacteria | 5633 |
| 337 | Ga0209025_1000721 | 3300025294 | Bacteria | 56094 |
| 338 | Ga0209564_1000502 | 3300025295 | Bacteria | 64443 |
| 339 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 340 | Ga0209758_1000009 | 3300025297 | Bacteria | 1123483 |
| 341 | Ga0209758_1000924 | 3300025297 | Bacteria | 39688 |
| 342 | Ga0209758_1008272 | 3300025297 | Bacteria | 6805 |
| 343 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 344 | Ga0209050_1000039 | 3300025298 | Bacteria | 410069 |
| 345 | Ga0209050_1000049 | 3300025298 | Bacteria | 364096 |
| 346 | Ga0209050_1000559 | 3300025298 | Bacteria | 60902 |
| 347 | Ga0209050_1001103 | 3300025298 | Bacteria | 32702 |
| 348 | Ga0209256_1000046 | 3300025299 | Bacteria | 325040 |
| 349 | Ga0209256_1004121 | 3300025299 | Bacteria | 9403 |
| 350 | Ga0209256_1006103 | 3300025299 | Bacteria | 6540 |
| 351 | Ga0209051_1000377 | 3300025303 | Bacteria | 63522 |
| 352 | Ga0209051_1002278 | 3300025303 | Bacteria | 14056 |
| 353 | Ga0209257_1000051 | 3300025304 | Bacteria | 434166 |
| 354 | Ga0209257_1000134 | 3300025304 | Bacteria | 207628 |
| 355 | Ga0209257_1000692 | 3300025304 | Bacteria | 52346 |
| 356 | Ga0209257_1001876 | 3300025304 | Bacteria | 22762 |
| 357 | Ga0209257_1017792 | 3300025304 | Bacteria | 2777 |
| 358 | Ga0207697_10001089 | 3300025315 | Bacteria | 14992 |
| 359 | Ga0207682_10000393 | 3300025893 | Bacteria | 20101 |
| 360 | Ga0207642_10016176 | 3300025899 | Bacteria | 2803 |
| 361 | Ga0207688_10000334 | 3300025901 | Bacteria | 21842 |
| 362 | Ga0207680_10000146 | 3300025903 | Bacteria | 33944 |
| 363 | Ga0207680_10016584 | 3300025903 | Bacteria | 3872 |
| 364 | Ga0207680_10040712 | 3300025903 | Bacteria | 2706 |
| 365 | Ga0207647_10000164 | 3300025904 | Bacteria | 52343 |
| 366 | Ga0207647_10002600 | 3300025904 | Bacteria | 13643 |
| 367 | Ga0207647_10008931 | 3300025904 | Bacteria | 7147 |
| 368 | Ga0207647_10018563 | 3300025904 | Bacteria | 4699 |
| 369 | Ga0207645_10003767 | 3300025907 | Bacteria | 11388 |
| 370 | Ga0207645_10013362 | 3300025907 | Bacteria | 5535 |
| 371 | Ga0207645_10042493 | 3300025907 | Bacteria | 2909 |
| 372 | Ga0207705_10000008 | 3300025909 | Bacteria | 589717 |
| 373 | Ga0207705_10000049 | 3300025909 | Bacteria | 170616 |
| 374 | Ga0207705_10000096 | 3300025909 | Bacteria | 105775 |
| 375 | Ga0207705_10000119 | 3300025909 | Bacteria | 88108 |
| 376 | Ga0207705_10001719 | 3300025909 | Bacteria | 17362 |
| 377 | Ga0207705_10002489 | 3300025909 | Bacteria | 14195 |
| 378 | Ga0207705_10014833 | 3300025909 | Bacteria | 5603 |
| 379 | Ga0207705_10027202 | 3300025909 | Bacteria | 4077 |
| 380 | Ga0207705_10065423 | 3300025909 | Bacteria | 2628 |
| 381 | Ga0207705_10105185 | 3300025909 | Bacteria | 2080 |
| 382 | Ga0207705_10166194 | 3300025909 | Bacteria | 1659 |
| 383 | Ga0207705_10198847 | 3300025909 | Bacteria | 1518 |
| 384 | Ga0207705_10201488 | 3300025909 | Bacteria | 1508 |
| 385 | Ga0207695_10020117 | 3300025913 | Bacteria | 7657 |
| 386 | Ga0207695_10077465 | 3300025913 | Bacteria | 3377 |
| 387 | Ga0207671_10132848 | 3300025914 | Bacteria | 1912 |
| 388 | Ga0207660_10000281 | 3300025917 | Bacteria | 33675 |
| 389 | Ga0207660_10016391 | 3300025917 | Bacteria | 4904 |
| 390 | Ga0207660_10076546 | 3300025917 | Bacteria | 2447 |
| 391 | Ga0207662_10088552 | 3300025918 | Bacteria | 1901 |
| 392 | Ga0207657_10000742 | 3300025919 | Bacteria | 34615 |
| 393 | Ga0207657_10003143 | 3300025919 | Bacteria | 17668 |
| 394 | Ga0207657_10006615 | 3300025919 | Bacteria | 11997 |
| 395 | Ga0207657_10007434 | 3300025919 | Bacteria | 11237 |
| 396 | Ga0207657_10012059 | 3300025919 | Bacteria | 8548 |
| 397 | Ga0207657_10026275 | 3300025919 | Bacteria | 5353 |
| 398 | Ga0207657_10026961 | 3300025919 | Bacteria | 5269 |
| 399 | Ga0207657_10033965 | 3300025919 | Bacteria | 4593 |
| 400 | Ga0207657_10066554 | 3300025919 | Bacteria | 3066 |
| 401 | Ga0207649_10000058 | 3300025920 | Bacteria | 100911 |
| 402 | Ga0207649_10006083 | 3300025920 | Bacteria | 6552 |
| 403 | Ga0207649_10014623 | 3300025920 | Bacteria | 4397 |
| 404 | Ga0207649_10038795 | 3300025920 | Bacteria | 2886 |
| 405 | Ga0207649_10062053 | 3300025920 | Bacteria | 2355 |
| 406 | Ga0207652_10005962 | 3300025921 | Bacteria | 9860 |
| 407 | Ga0207652_10020011 | 3300025921 | Bacteria | 5510 |
| 408 | Ga0207652_10027153 | 3300025921 | Bacteria | 4770 |
| 409 | Ga0207652_10059575 | 3300025921 | Bacteria | 3291 |
| 410 | Ga0207681_10049823 | 3300025923 | Bacteria | 2832 |
| 411 | Ga0207694_10108870 | 3300025924 | Bacteria | 2202 |
| 412 | Ga0207650_10026483 | 3300025925 | Bacteria | 4137 |
| 413 | Ga0207659_10004748 | 3300025926 | Bacteria | 8243 |
| 414 | Ga0207659_10022052 | 3300025926 | Bacteria | 4237 |
| 415 | Ga0207659_10027459 | 3300025926 | Bacteria | 3854 |
| 416 | Ga0207687_10000956 | 3300025927 | Bacteria | 19651 |
| 417 | Ga0207687_10002400 | 3300025927 | Bacteria | 12708 |
| 418 | Ga0207664_10053737 | 3300025929 | Bacteria | 3190 |
| 419 | Ga0207664_10080006 | 3300025929 | Bacteria | 2655 |
| 420 | Ga0207644_10001983 | 3300025931 | Bacteria | 13239 |
| 421 | Ga0207644_10005102 | 3300025931 | Bacteria | 8576 |
| 422 | Ga0207644_10017258 | 3300025931 | Bacteria | 4871 |
| 423 | Ga0207644_10034448 | 3300025931 | Bacteria | 3543 |
| 424 | Ga0207644_10108669 | 3300025931 | Bacteria | 2094 |
| 425 | Ga0207690_10006289 | 3300025932 | Bacteria | 7034 |
| 426 | Ga0207690_10015611 | 3300025932 | Bacteria | 4605 |
| 427 | Ga0207690_10043130 | 3300025932 | Bacteria | 2967 |
| 428 | Ga0207690_10083913 | 3300025932 | Bacteria | 2232 |
| 429 | Ga0207690_10172506 | 3300025932 | Bacteria | 1622 |
| 430 | Ga0207706_10000764 | 3300025933 | Bacteria | 33452 |
| 431 | Ga0207706_10004774 | 3300025933 | Bacteria | 12692 |
| 432 | Ga0207706_10005164 | 3300025933 | Bacteria | 12186 |
| 433 | Ga0207706_10006596 | 3300025933 | Bacteria | 10749 |
| 434 | Ga0207706_10013864 | 3300025933 | Bacteria | 7311 |
| 435 | Ga0207706_10024573 | 3300025933 | Bacteria | 5401 |
| 436 | Ga0207706_10036451 | 3300025933 | Bacteria | 4368 |
| 437 | Ga0207709_10000182 | 3300025935 | Bacteria | 83442 |
| 438 | Ga0207670_10098722 | 3300025936 | Bacteria | 2082 |
| 439 | Ga0207669_10007965 | 3300025937 | Bacteria | 4944 |
| 440 | Ga0207669_10029249 | 3300025937 | Bacteria | 3044 |
| 441 | Ga0207704_10000022 | 3300025938 | Bacteria | 146109 |
| 442 | Ga0207704_10031621 | 3300025938 | Bacteria | 2985 |
| 443 | Ga0207704_10036648 | 3300025938 | Bacteria | 2824 |
| 444 | Ga0207691_10000364 | 3300025940 | Bacteria | 45561 |
| 445 | Ga0207691_10004514 | 3300025940 | Bacteria | 13464 |
| 446 | Ga0207691_10044587 | 3300025940 | Bacteria | 4080 |
| 447 | Ga0207691_10200964 | 3300025940 | Bacteria | 1735 |
| 448 | Ga0207711_10000047 | 3300025941 | Bacteria | 150849 |
| 449 | Ga0207711_10000055 | 3300025941 | Bacteria | 136126 |
| 450 | Ga0207711_10001846 | 3300025941 | Bacteria | 19327 |
| 451 | Ga0207711_10148625 | 3300025941 | Bacteria | 2113 |
| 452 | Ga0207711_10152617 | 3300025941 | Bacteria | 2085 |
| 453 | Ga0207689_10002559 | 3300025942 | Bacteria | 16870 |
| 454 | Ga0207689_10005187 | 3300025942 | Bacteria | 11699 |
| 455 | Ga0207689_10009094 | 3300025942 | Bacteria | 8600 |
| 456 | Ga0207661_10014773 | 3300025944 | Bacteria | 5728 |
| 457 | Ga0207661_10026409 | 3300025944 | Bacteria | 4425 |
| 458 | Ga0207679_10008353 | 3300025945 | Bacteria | 6591 |
| 459 | Ga0207679_10086166 | 3300025945 | Bacteria | 2415 |
| 460 | Ga0207679_10175427 | 3300025945 | Bacteria | 1769 |
| 461 | Ga0207679_10212549 | 3300025945 | Bacteria | 1623 |
| 462 | Ga0207667_10000029 | 3300025949 | Bacteria | 329192 |
| 463 | Ga0207667_10019369 | 3300025949 | Bacteria | 7599 |
| 464 | Ga0207667_10023353 | 3300025949 | Bacteria | 6809 |
| 465 | Ga0207667_10026270 | 3300025949 | Bacteria | 6363 |
| 466 | Ga0207667_10047624 | 3300025949 | Bacteria | 4537 |
| 467 | Ga0207667_10092667 | 3300025949 | Bacteria | 3120 |
| 468 | Ga0207651_10000009 | 3300025960 | Bacteria | 199913 |
| 469 | Ga0207651_10002797 | 3300025960 | Bacteria | 8385 |
| 470 | Ga0207651_10004624 | 3300025960 | Bacteria | 6970 |
| 471 | Ga0207651_10026085 | 3300025960 | Bacteria | 3644 |
| 472 | Ga0207712_10030564 | 3300025961 | Bacteria | 3622 |
| 473 | Ga0207668_10000361 | 3300025972 | Bacteria | 29201 |
| 474 | Ga0207640_10000359 | 3300025981 | Bacteria | 29690 |
| 475 | Ga0207640_10016281 | 3300025981 | Bacteria | 4322 |
| 476 | Ga0207640_10028087 | 3300025981 | Bacteria | 3435 |
| 477 | Ga0207640_10095104 | 3300025981 | Bacteria | 2074 |
| 478 | Ga0207640_10165011 | 3300025981 | Bacteria | 1644 |
| 479 | Ga0207658_10029705 | 3300025986 | Bacteria | 3863 |
| 480 | Ga0207658_10045240 | 3300025986 | Bacteria | 3208 |
| 481 | Ga0207658_10068577 | 3300025986 | Bacteria | 2677 |
| 482 | Ga0207658_10143835 | 3300025986 | Bacteria | 1934 |
| 483 | Ga0207677_10000268 | 3300026023 | Bacteria | 39315 |
| 484 | Ga0207677_10000342 | 3300026023 | Bacteria | 33136 |
| 485 | Ga0207677_10004212 | 3300026023 | Bacteria | 7700 |
| 486 | Ga0207677_10004573 | 3300026023 | Bacteria | 7439 |
| 487 | Ga0207703_10000399 | 3300026035 | Bacteria | 46666 |
| 488 | Ga0207703_10001319 | 3300026035 | Bacteria | 22802 |
| 489 | Ga0207703_10001416 | 3300026035 | Bacteria | 21856 |
| 490 | Ga0207703_10100419 | 3300026035 | Bacteria | 2452 |
| 491 | Ga0207639_10000730 | 3300026041 | Bacteria | 22439 |
| 492 | Ga0207639_10008852 | 3300026041 | Bacteria | 6923 |
| 493 | Ga0207639_10023392 | 3300026041 | Bacteria | 4462 |
| 494 | Ga0207639_10049818 | 3300026041 | Bacteria | 3178 |
| 495 | Ga0207639_10175877 | 3300026041 | Bacteria | 1817 |
| 496 | Ga0207639_10184815 | 3300026041 | Bacteria | 1776 |
| 497 | Ga0207678_10000084 | 3300026067 | Bacteria | 76874 |
| 498 | Ga0207678_10000723 | 3300026067 | Bacteria | 30159 |
| 499 | Ga0207678_10007111 | 3300026067 | Bacteria | 9928 |
| 500 | Ga0207678_10048579 | 3300026067 | Bacteria | 3667 |
| 501 | Ga0207678_10050950 | 3300026067 | Bacteria | 3575 |
| 502 | Ga0207708_10050546 | 3300026075 | Bacteria | 3164 |
| 503 | Ga0207702_10009817 | 3300026078 | Bacteria | 8027 |
| 504 | Ga0207702_10017845 | 3300026078 | Bacteria | 5874 |
| 505 | Ga0207702_10084128 | 3300026078 | Bacteria | 2769 |
| 506 | Ga0207702_10087415 | 3300026078 | Bacteria | 2721 |
| 507 | Ga0207702_10201994 | 3300026078 | Bacteria | 1843 |
| 508 | Ga0207702_10221941 | 3300026078 | Bacteria | 1761 |
| 509 | Ga0207641_10000070 | 3300026088 | Bacteria | 152598 |
| 510 | Ga0207641_10006890 | 3300026088 | Bacteria | 9510 |
| 511 | Ga0207641_10033244 | 3300026088 | Bacteria | 4285 |
| 512 | Ga0207641_10098395 | 3300026088 | Bacteria | 2572 |
| 513 | Ga0207641_10182843 | 3300026088 | Bacteria | 1921 |
| 514 | Ga0207641_10219441 | 3300026088 | Bacteria | 1762 |
| 515 | Ga0207648_10000084 | 3300026089 | Bacteria | 88578 |
| 516 | Ga0207648_10000781 | 3300026089 | Bacteria | 35889 |
| 517 | Ga0207648_10002133 | 3300026089 | Bacteria | 21513 |
| 518 | Ga0207648_10002612 | 3300026089 | Bacteria | 19310 |
| 519 | Ga0207648_10007899 | 3300026089 | Bacteria | 10376 |
| 520 | Ga0207676_10000602 | 3300026095 | Bacteria | 29493 |
| 521 | Ga0207676_10001627 | 3300026095 | Bacteria | 16557 |
| 522 | Ga0207676_10010480 | 3300026095 | Bacteria | 6602 |
| 523 | Ga0207674_10000324 | 3300026116 | Bacteria | 60949 |
| 524 | Ga0207674_10002039 | 3300026116 | Bacteria | 25644 |
| 525 | Ga0207674_10002832 | 3300026116 | Bacteria | 21570 |
| 526 | Ga0207674_10010710 | 3300026116 | Bacteria | 10355 |
| 527 | Ga0207674_10019779 | 3300026116 | Bacteria | 7286 |
| 528 | Ga0207674_10036251 | 3300026116 | Bacteria | 5141 |
| 529 | Ga0207674_10108811 | 3300026116 | Bacteria | 2748 |
| 530 | Ga0207675_100000166 | 3300026118 | Bacteria | 58837 |
| 531 | Ga0207675_100024191 | 3300026118 | Bacteria | 5647 |
| 532 | Ga0207675_100117205 | 3300026118 | Bacteria | 2517 |
| 533 | Ga0207683_10009065 | 3300026121 | Bacteria | 8477 |
| 534 | Ga0207683_10035180 | 3300026121 | Bacteria | 4356 |
| 535 | Ga0207698_10002973 | 3300026142 | Bacteria | 10156 |
| 536 | Ga0207698_10003462 | 3300026142 | Bacteria | 9502 |
| 537 | Ga0207698_10042168 | 3300026142 | Bacteria | 3407 |
| 538 | Ga0268266_10000262 | 3300028379 | Bacteria | 88235 |
| 539 | Ga0268266_10004783 | 3300028379 | Bacteria | 12871 |
| 540 | Ga0268266_10079967 | 3300028379 | Bacteria | 2847 |
| 541 | Ga0268265_10007983 | 3300028380 | Bacteria | 7144 |
| 542 | Ga0268264_10010864 | 3300028381 | Bacteria | 7524 |
| 543 | Ga0265319_1011045 | 3300028563 | Bacteria | 3729 |
| 544 | Ga0265318_10001295 | 3300028577 | Bacteria | 15034 |
| 545 | Ga0307517_10026956 | 3300028786 | Bacteria | 6928 |
| 546 | Ga0265338_10013094 | 3300028800 | Bacteria | 9399 |
| 547 | Ga0265338_10044028 | 3300028800 | Bacteria | 4128 |
| 548 | Ga0265332_10007734 | 3300031238 | Bacteria | 4855 |
| 549 | Ga0265328_10054735 | 3300031239 | Bacteria | 1464 |
| 550 | Ga0265320_10039594 | 3300031240 | Bacteria | 2355 |
| 551 | Ga0265325_10001334 | 3300031241 | Bacteria | 17487 |
| 552 | Ga0265339_10032246 | 3300031249 | Bacteria | 2956 |
| 553 | Ga0265331_10003659 | 3300031250 | Bacteria | 9810 |
| 554 | Ga0265316_10039927 | 3300031344 | Bacteria | 3766 |
| 555 | Ga0265316_10048829 | 3300031344 | Bacteria | 3337 |
| 556 | Ga0307408_100054374 | 3300031548 | Bacteria | 2894 |
| 557 | Ga0307408_100111185 | 3300031548 | Bacteria | 2105 |
| 558 | Ga0265313_10003424 | 3300031595 | Bacteria | 12840 |
| 559 | Ga0307508_10003032 | 3300031616 | Bacteria | 17301 |
| 560 | Ga0265314_10027660 | 3300031711 | Bacteria | 4244 |
| 561 | Ga0265342_10005743 | 3300031712 | Bacteria | 9379 |
| 562 | Ga0307405_10002622 | 3300031731 | Bacteria | 7994 |
| 563 | Ga0307413_10001788 | 3300031824 | Bacteria | 8414 |
| 564 | Ga0307413_10044149 | 3300031824 | Bacteria | 2632 |
| 565 | Ga0307410_10000189 | 3300031852 | Bacteria | 22788 |
| 566 | Ga0307410_10000344 | 3300031852 | Bacteria | 18010 |
| 567 | Ga0307410_10006990 | 3300031852 | Bacteria | 6143 |
| 568 | Ga0307406_10011939 | 3300031901 | Bacteria | 4939 |
| 569 | Ga0307407_10000110 | 3300031903 | Bacteria | 26440 |
| 570 | Ga0307412_10002246 | 3300031911 | Bacteria | 10709 |
| 571 | Ga0307412_10021096 | 3300031911 | Bacteria | 3974 |
| 572 | Ga0307412_10058556 | 3300031911 | Bacteria | 2578 |
| 573 | Ga0307409_100000222 | 3300031995 | Bacteria | 22725 |
| 574 | Ga0307409_100002352 | 3300031995 | Bacteria | 9830 |
| 575 | Ga0307409_100104619 | 3300031995 | Bacteria | 2358 |
| 576 | Ga0307409_100132847 | 3300031995 | Bacteria | 2130 |
| 577 | Ga0307416_100027476 | 3300032002 | Bacteria | 4215 |
| 578 | Ga0307414_10000801 | 3300032004 | Bacteria | 16098 |
| 579 | Ga0307414_10004490 | 3300032004 | Bacteria | 7582 |
| 580 | Ga0307414_10007172 | 3300032004 | Bacteria | 6254 |
| 581 | Ga0307414_10041911 | 3300032004 | Bacteria | 3105 |
| 582 | Ga0307414_10062749 | 3300032004 | Bacteria | 2638 |
| 583 | Ga0307414_10160366 | 3300032004 | Bacteria | 1785 |
| 584 | Ga0307411_10000098 | 3300032005 | Bacteria | 26810 |
| 585 | Ga0307411_10000888 | 3300032005 | Bacteria | 11320 |
| 586 | Ga0307411_10112684 | 3300032005 | Bacteria | 1950 |
| 587 | Ga0307415_100005305 | 3300032126 | Bacteria | 6824 |
| 588 | Ga0307415_100017355 | 3300032126 | Bacteria | 4314 |
| 589 | Ga0316587_1006815 | 3300033529 | Bacteria | 1758 |
| 590 | Ga0373923_0008534 | 3300035111 | Bacteria | 3660 |
| 591 | Ga0373954_0020173 | 3300035118 | Bacteria | 3013 |
| 592 | Ga0373957_0003306 | 3300035120 | Bacteria | 4751 |
| 593 | Ga0373943_0007056 | 3300035170 | Bacteria | 5039 |
| 594 | Ga0373955_0005811 | 3300035172 | Bacteria | 5570 |
| 595 | Ga0373937_0004175 | 3300036401 | Bacteria | 12248 |
| 596 | Ga0373925_0083063 | 3300037068 | Bacteria | 2439 |
| 597 | Ga0395899_0001153 | 3300037312 | Bacteria | 23326 |
| 598 | Ga0395899_0015175 | 3300037312 | Bacteria | 5874 |
| 599 | Ga0395899_0040477 | 3300037312 | Bacteria | 3484 |
| 600 | Ga0395899_0049976 | 3300037312 | Bacteria | 3106 |
| 601 | Ga0395899_0051958 | 3300037312 | Bacteria | 3040 |
| 602 | Ga0395899_0062427 | 3300037312 | Bacteria | 2744 |
| 603 | Ga0395899_0079032 | 3300037312 | Bacteria | 2396 |
| 604 | Ga0395899_0079549 | 3300037312 | Bacteria | 2387 |
| 605 | Ga0395899_0087340 | 3300037312 | Bacteria | 2263 |
| 606 | Ga0395899_0110216 | 3300037312 | Bacteria | 1980 |
| 607 | Ga0395900_0000589 | 3300037418 | Bacteria | 49868 |
| 608 | Ga0395900_0012851 | 3300037418 | Bacteria | 8555 |
| 609 | Ga0395900_0031874 | 3300037418 | Bacteria | 5418 |
| 610 | Ga0395900_0057745 | 3300037418 | Bacteria | 3995 |
| 611 | Ga0395900_0141496 | 3300037418 | Bacteria | 2463 |
| 612 | Ga0395900_0146981 | 3300037418 | Bacteria | 2410 |
| 613 | Ga0395900_0148665 | 3300037418 | Bacteria | 2394 |
| 614 | Ga0395900_0185153 | 3300037418 | Bacteria | 2114 |
| 615 | Ga0395900_0338227 | 3300037418 | Bacteria | 1481 |
| 616 | Ga0395898_0019495 | 3300037466 | Bacteria | 6901 |
| 617 | Ga0395898_0024761 | 3300037466 | Bacteria | 6051 |
| 618 | Ga0395898_0039431 | 3300037466 | Bacteria | 4675 |
| 619 | Ga0395898_0044228 | 3300037466 | Bacteria | 4386 |
| 620 | Ga0395898_0091024 | 3300037466 | Bacteria | 2935 |
| 621 | Ga0395898_0091503 | 3300037466 | Bacteria | 2926 |
| 622 | Ga0395898_0128522 | 3300037466 | Bacteria | 2427 |
| 623 | Ga0395898_0243140 | 3300037466 | Bacteria | 1716 |
| 624 | Ga0395898_0391618 | 3300037466 | Bacteria | 1325 |
| 625 | Ga0395905_0010941 | 3300037471 | Bacteria | 8781 |
| 626 | Ga0395905_0014753 | 3300037471 | Bacteria | 7449 |
| 627 | Ga0395905_0015114 | 3300037471 | Bacteria | 7346 |
| 628 | Ga0395905_0017221 | 3300037471 | Bacteria | 6864 |
| 629 | Ga0395905_0017945 | 3300037471 | Bacteria | 6721 |
| 630 | Ga0395905_0025568 | 3300037471 | Bacteria | 5567 |
| 631 | Ga0395905_0029097 | 3300037471 | Bacteria | 5206 |
| 632 | Ga0395905_0066713 | 3300037471 | Bacteria | 3370 |
| 633 | Ga0395905_0080347 | 3300037471 | Bacteria | 3055 |
| 634 | Ga0395905_0085798 | 3300037471 | Bacteria | 2950 |
| 635 | Ga0395905_0094585 | 3300037471 | Bacteria | 2803 |
| 636 | Ga0395905_0096056 | 3300037471 | Bacteria | 2782 |
| 637 | Ga0395905_0115708 | 3300037471 | Bacteria | 2520 |
| 638 | Ga0395905_0127673 | 3300037471 | Bacteria | 2391 |
| 639 | Ga0395905_0165506 | 3300037471 | Bacteria | 2078 |
| 640 | Ga0395905_0190283 | 3300037471 | Bacteria | 1925 |
| 641 | Ga0395905_0261484 | 3300037471 | Bacteria | 1616 |
| 642 | Ga0395905_0284314 | 3300037471 | Bacteria | 1541 |
| 643 | Ga0395905_0297016 | 3300037471 | Bacteria | 1502 |
| 644 | Ga0436364_0322741 | 3300037853 | Bacteria | 22847 |
| 645 | Ga0395901_0002032 | 3300038443 | Bacteria | 20806 |
| 646 | Ga0395901_0014089 | 3300038443 | Bacteria | 8141 |
| 647 | Ga0395901_0018693 | 3300038443 | Bacteria | 7078 |
| 648 | Ga0395901_0018907 | 3300038443 | Bacteria | 7044 |
| 649 | Ga0395901_0023927 | 3300038443 | Bacteria | 6266 |
| 650 | Ga0395901_0045429 | 3300038443 | Bacteria | 4558 |
| 651 | Ga0395901_0058906 | 3300038443 | Bacteria | 3995 |
| 652 | Ga0395901_0095651 | 3300038443 | Bacteria | 3112 |
| 653 | Ga0395901_0102178 | 3300038443 | Bacteria | 3008 |
| 654 | Ga0395901_0126271 | 3300038443 | Bacteria | 2688 |
| 655 | Ga0395901_0166357 | 3300038443 | Bacteria | 2315 |
| 656 | Ga0395901_0206571 | 3300038443 | Bacteria | 2057 |
| 657 | Ga0395901_0217784 | 3300038443 | Bacteria | 1996 |
| 658 | Ga0436365_0862833 | 3300039437 | Bacteria | 88455 |
| 659 | Ga0436365_1058137 | 3300039437 | Bacteria | 63934 |
| 660 | Ga0436365_1289842 | 3300039437 | Bacteria | 27584 |
| 661 | Ga0436363_0441596 | 3300039450 | Bacteria | 3186 |
| 662 | Ga0436362_0554113 | 3300039453 | Bacteria | 162652 |
| 663 | Ga0439436_0005769 | 3300041404 | Bacteria | 3793 |
| 664 | Ga0439439_0013658 | 3300041406 | Bacteria | 1970 |
| 665 | Ga0439461_0000015 | 3300041410 | Bacteria | 22241 |
| 666 | Ga0439465_0000240 | 3300041413 | Bacteria | 15013 |
| 667 | Ga0439431_0000089 | 3300041997 | Bacteria | 14969 |
| 668 | Ga0439445_0000017 | 3300042004 | Bacteria | 22138 |
| 669 | Ga0439445_0001011 | 3300042004 | Bacteria | 5997 |
| 670 | Ga0439448_0010647 | 3300042005 | Bacteria | 2731 |
| 671 | Ga0439432_001016 | 3300042006 | Bacteria | 10605 |
| 672 | Ga0439455_0000734 | 3300042012 | Bacteria | 4889 |
| 673 | Ga0439455_0002013 | 3300042012 | Bacteria | 3593 |
| 674 | Ga0439455_0005821 | 3300042012 | Bacteria | 2525 |
| 675 | Ga0439457_005071 | 3300042014 | Bacteria | 3357 |
| 676 | Ga0439462_0001597 | 3300042015 | Bacteria | 5087 |
| 677 | Ga0439462_0025685 | 3300042015 | Bacteria | 1551 |
| 678 | Ga0450920_001437 | 3300042122 | Bacteria | 3936 |
| 679 | Ga0439446_0005043 | 3300042156 | Bacteria | 3379 |
| 680 | Ga0439458_0001070 | 3300042157 | Bacteria | 6974 |
| 681 | Ga0439458_0003199 | 3300042157 | Bacteria | 3880 |
| 682 | Ga0439458_0004008 | 3300042157 | Bacteria | 3401 |
| 683 | Ga0439434_0000049 | 3300042435 | Bacteria | 29298 |
| 684 | Ga0439434_0011967 | 3300042435 | Bacteria | 2564 |
| 685 | Ga0451577_0000287 | 3300042876 | Bacteria | 98086 |
| 686 | Ga0466969_0018424 | 3300044656 | Bacteria | 3637 |
| 687 | Ga0466972_0015501 | 3300044658 | Bacteria | 3809 |
| 688 | Ga0453683_0001021 | 3300044673 | Bacteria | 26284 |
| 689 | Ga0466965_0006835 | 3300044683 | Bacteria | 5211 |
| 690 | Ga0466965_0148607 | 3300044683 | Bacteria | 1224 |
| 691 | Ga0466966_0000001 | 3300044684 | Bacteria | 410376 |
| 692 | Ga0466966_0022066 | 3300044684 | Bacteria | 4180 |
| 693 | Ga0466966_0078859 | 3300044684 | Bacteria | 2053 |
| 694 | Ga0466961_0014915 | 3300044693 | Bacteria | 4990 |
| 695 | Ga0466961_0045507 | 3300044693 | Bacteria | 2808 |
| 696 | Ga0466961_0085861 | 3300044693 | Bacteria | 1989 |
| 697 | Ga0466963_0004459 | 3300044694 | Bacteria | 8142 |
| 698 | Ga0466963_0009953 | 3300044694 | Bacteria | 5743 |
| 699 | Ga0466963_0015391 | 3300044694 | Bacteria | 4735 |
| 700 | Ga0466963_0034283 | 3300044694 | Bacteria | 3302 |
| 701 | Ga0466963_0066888 | 3300044694 | Bacteria | 2411 |
| 702 | Ga0453684_0000335 | 3300044712 | Bacteria | 196328 |
| 703 | Ga0453684_0001362 | 3300044712 | Bacteria | 71077 |
| 704 | Ga0453684_0002060 | 3300044712 | Bacteria | 51082 |
| 705 | Ga0453684_0002091 | 3300044712 | Bacteria | 50553 |
| 706 | Ga0466971_0002712 | 3300044719 | Bacteria | 7486 |
| 707 | Ga0466971_0010174 | 3300044719 | Bacteria | 4107 |
| 708 | Ga0466968_0001227 | 3300044735 | Bacteria | 9077 |
| 709 | Ga0466970_0011106 | 3300044765 | Bacteria | 4586 |
| 710 | Ga0466970_0012832 | 3300044765 | Bacteria | 4289 |
| 711 | Ga0466970_0014513 | 3300044765 | Bacteria | 4046 |
| 712 | Ga0466970_0072803 | 3300044765 | Bacteria | 1849 |
| 713 | Ga0466957_0000504 | 3300044842 | Bacteria | 19597 |
| 714 | Ga0466957_0044557 | 3300044842 | Bacteria | 2688 |
| 715 | Ga0466957_0058337 | 3300044842 | Bacteria | 2365 |
| 716 | Ga0466957_0147613 | 3300044842 | Bacteria | 1519 |
| 717 | Ga0466960_0024108 | 3300044901 | Bacteria | 2741 |
| 718 | Ga0466959_0003186 | 3300045049 | Bacteria | 10654 |
| 719 | Ga0466959_0020078 | 3300045049 | Bacteria | 4919 |
| 720 | Ga0451576_0000122 | 3300045051 | Bacteria | 197797 |
| 721 | Ga0451576_0000732 | 3300045051 | Bacteria | 65825 |
| 722 | Ga0466958_0003823 | 3300045836 | Bacteria | 7863 |
| 723 | Ga0466967_0000149 | 3300045976 | Bacteria | 27415 |
| 724 | Ga0466967_0005507 | 3300045976 | Bacteria | 8785 |
| 725 | Ga0466967_0017259 | 3300045976 | Bacteria | 5723 |
| 726 | Ga0466967_0039894 | 3300045976 | Bacteria | 4040 |
| 727 | Ga0495638_0000440 | 3300046460 | Bacteria | 50160 |
| 728 | Ga0495638_0000633 | 3300046460 | Bacteria | 38772 |
| 729 | Ga0495638_0016451 | 3300046460 | Bacteria | 4954 |
| 730 | Ga0495650_0000068 | 3300046471 | Bacteria | 266671 |
| 731 | Ga0495650_0000083 | 3300046471 | Bacteria | 237725 |
| 732 | Ga0495583_0000351 | 3300046506 | Bacteria | 72601 |
| 733 | Ga0495583_0000696 | 3300046506 | Bacteria | 43409 |
| 734 | Ga0495610_0000131 | 3300046512 | Bacteria | 82558 |
| 735 | Ga0495620_0053703 | 3300046515 | Bacteria | 1705 |
| 736 | Ga0495637_0015019 | 3300046520 | Bacteria | 3641 |
| 737 | Ga0495648_0003568 | 3300046524 | Bacteria | 13615 |
| 738 | Ga0495648_0055353 | 3300046524 | Bacteria | 2392 |
| 739 | Ga0495663_0016170 | 3300046525 | Bacteria | 2108 |
| 740 | Ga0495654_0000042 | 3300046530 | Bacteria | 164346 |
| 741 | Ga0495587_0017448 | 3300046536 | Bacteria | 4459 |
| 742 | Ga0495598_0003551 | 3300046537 | Bacteria | 3324 |
| 743 | Ga0495598_0014638 | 3300046537 | Bacteria | 1965 |
| 744 | Ga0495621_0000236 | 3300046539 | Bacteria | 13011 |
| 745 | Ga0495622_0000745 | 3300046557 | Bacteria | 18213 |
| 746 | Ga0495633_0078334 | 3300046558 | Bacteria | 1538 |
| 747 | Ga0495668_0000587 | 3300046616 | Bacteria | 44244 |
| 748 | Ga0495668_0014216 | 3300046616 | Bacteria | 4674 |
| 749 | Ga0495668_0021480 | 3300046616 | Bacteria | 3701 |
| 750 | Ga0495625_0004911 | 3300046660 | Bacteria | 12447 |
| 751 | Ga0495625_0041223 | 3300046660 | Bacteria | 3361 |
| 752 | Ga0495625_0058819 | 3300046660 | Bacteria | 2729 |
| 753 | Ga0495669_0005168 | 3300046684 | Bacteria | 5428 |
| 754 | Ga0495670_0000003 | 3300046691 | Bacteria | 326779 |
| 755 | Ga0495670_0007460 | 3300046691 | Bacteria | 5370 |
| 756 | Ga0495670_0017915 | 3300046691 | Bacteria | 3488 |
| 757 | Ga0495670_0070065 | 3300046691 | Bacteria | 1774 |
| 758 | Ga0495649_0000092 | 3300046694 | Bacteria | 77734 |
| 759 | Ga0495600_0016538 | 3300046809 | Bacteria | 4683 |
| 760 | Ga0495672_0005693 | 3300047320 | Bacteria | 9820 |
| 761 | Ga0495687_000973 | 3300047443 | Bacteria | 29058 |
| 762 | Ga0495673_0017813 | 3300047469 | Bacteria | 3595 |
| 763 | Ga0495673_0018706 | 3300047469 | Bacteria | 3487 |
| 764 | Ga0495686_0000661 | 3300047472 | Bacteria | 46810 |
| 765 | Ga0495686_0004063 | 3300047472 | Bacteria | 12221 |
| 766 | Ga0495686_0017773 | 3300047472 | Bacteria | 4786 |
| 767 | Ga0495686_0020591 | 3300047472 | Bacteria | 4396 |
| 768 | Ga0495602_0083170 | 3300048088 | Bacteria | 2683 |
| 769 | Ga0496100_0071060 | 3300048903 | Bacteria | 2323 |
| 770 | Ga0496101_0003459 | 3300048904 | Bacteria | 9850 |
| 771 | Ga0496101_0148093 | 3300048904 | Bacteria | 1794 |
| 772 | Ga0496102_0062683 | 3300048905 | Bacteria | 3405 |
| 773 | Ga0496104_0002627 | 3300048907 | Bacteria | 15455 |
| 774 | Ga0496104_0029517 | 3300048907 | Bacteria | 5088 |
| 775 | Ga0496105_0000678 | 3300048908 | Bacteria | 22865 |
| 776 | Ga0496105_0052690 | 3300048908 | Bacteria | 3361 |
| 777 | Ga0496106_0049050 | 3300048909 | Bacteria | 3180 |
| 778 | Ga0496107_0001705 | 3300048910 | Bacteria | 13777 |
| 779 | Ga0496108_0000315 | 3300048911 | Bacteria | 41163 |
| 780 | Ga0496108_0002157 | 3300048911 | Bacteria | 15762 |
| 781 | Ga0496108_0059920 | 3300048911 | Bacteria | 3201 |
| 782 | Ga0496109_0000617 | 3300048912 | Bacteria | 29636 |
| 783 | Ga0496110_0003274 | 3300048913 | Bacteria | 12352 |
| 784 | Ga0496110_0111650 | 3300048913 | Bacteria | 2457 |
| 785 | Ga0496111_0009315 | 3300048914 | Bacteria | 6547 |
| 786 | Ga0496111_0038978 | 3300048914 | Bacteria | 3405 |
| 787 | Ga0496111_0090034 | 3300048914 | Bacteria | 2248 |
| 788 | Ga0496112_0000133 | 3300048915 | Bacteria | 46286 |
| 789 | Ga0496112_0019749 | 3300048915 | Bacteria | 6369 |
| 790 | Ga0496112_0049824 | 3300048915 | Bacteria | 4105 |
| 791 | Ga0496113_0011396 | 3300048916 | Bacteria | 5928 |
| 792 | Ga0496113_0078648 | 3300048916 | Bacteria | 2523 |
| 793 | Ga0496114_0006615 | 3300048917 | Bacteria | 9137 |
| 794 | Ga0496114_0078383 | 3300048917 | Bacteria | 2787 |
| 795 | Ga0496115_0000657 | 3300048918 | Bacteria | 25751 |
| 796 | Ga0496115_0021090 | 3300048918 | Bacteria | 5028 |
| 797 | Ga0496116_0000116 | 3300048919 | Bacteria | 172374 |
| 798 | Ga0496117_0037622 | 3300048920 | Bacteria | 3603 |
| 799 | Ga0496117_0047821 | 3300048920 | Bacteria | 3063 |
| 800 | Ga0496118_0018893 | 3300048921 | Bacteria | 6183 |
| 801 | Ga0496118_0029306 | 3300048921 | Bacteria | 4619 |
| 802 | Ga0496120_0048321 | 3300048923 | Bacteria | 2449 |
| 803 | Ga0496120_0059929 | 3300048923 | Bacteria | 2131 |
| 804 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 805 | Ga0496121_0000714 | 3300048924 | Bacteria | 61634 |
| 806 | Ga0496121_0004591 | 3300048924 | Bacteria | 18409 |
| 807 | Ga0496121_0077575 | 3300048924 | Bacteria | 2645 |
| 808 | Ga0496123_0039498 | 3300048926 | Bacteria | 3300 |
| 809 | Ga0496124_0000817 | 3300048927 | Bacteria | 50627 |
| 810 | Ga0496124_0002298 | 3300048927 | Bacteria | 25241 |
| 811 | Ga0496124_0019689 | 3300048927 | Bacteria | 6269 |
| 812 | Ga0496125_0018732 | 3300048928 | Bacteria | 6564 |
| 813 | Ga0496125_0021737 | 3300048928 | Bacteria | 5972 |
| 814 | Ga0496125_0095714 | 3300048928 | Bacteria | 2208 |
| 815 | Ga0496126_0000428 | 3300048929 | Bacteria | 84757 |
| 816 | Ga0496126_0009898 | 3300048929 | Bacteria | 10074 |
| 817 | Ga0496126_0021811 | 3300048929 | Bacteria | 6248 |
| 818 | Ga0496126_0093798 | 3300048929 | Bacteria | 2635 |
| 819 | Ga0501034_0091134 | 3300049571 | Bacteria | 3046 |
| 820 | Ga0501034_0191477 | 3300049571 | Bacteria | 2007 |
| 821 | Ga0501223_000106 | 3300049663 | Bacteria | 24016 |
| 822 | Ga0501224_000007 | 3300049664 | Bacteria | 127654 |
| 823 | Ga0501233_000050 | 3300049668 | Bacteria | 16101 |
| 824 | Ga0501235_000245 | 3300049669 | Bacteria | 9923 |
| 825 | Ga0501225_0000100 | 3300049705 | Bacteria | 27639 |
| 826 | Ga0501226_000025 | 3300049853 | Bacteria | 91197 |
| 827 | nmdc:mga06r32_4573_c1 | 3300050510 | Bacteria | 12403 |
| 828 | Ga0500644_0000738 | 3300053088 | Bacteria | 11431 |
| 829 | Ga0500566_0000788 | 3300053094 | Bacteria | 17996 |
| 830 | Ga0500641_0013425 | 3300053096 | Bacteria | 3010 |
| 831 | Ga0500555_000086 | 3300053103 | Bacteria | 44938 |
| 832 | Ga0500556_0000013 | 3300053104 | Bacteria | 243797 |
| 833 | Ga0500556_0001960 | 3300053104 | Bacteria | 7268 |
| 834 | Ga0500562_014063 | 3300053108 | Bacteria | 2048 |
| 835 | Ga0500595_001269 | 3300053119 | Bacteria | 13814 |
| 836 | Ga0500607_092075 | 3300053121 | Bacteria | 1523 |
| 837 | Ga0500608_000079 | 3300053122 | Bacteria | 41088 |
| 838 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 839 | Ga0500655_004136 | 3300053133 | Bacteria | 2611 |
| 840 | Ga0500559_0000412 | 3300053136 | Bacteria | 30720 |
| 841 | Ga0500564_002850 | 3300053138 | Bacteria | 6521 |
| 842 | Ga0500568_0005719 | 3300053139 | Bacteria | 6373 |
| 843 | Ga0500568_0018758 | 3300053139 | Bacteria | 3019 |
| 844 | Ga0500604_0000021 | 3300053151 | Bacteria | 72909 |
| 845 | Ga0500616_0000101 | 3300053153 | Bacteria | 172722 |
| 846 | Ga0500616_0009393 | 3300053153 | Bacteria | 5953 |
| 847 | Ga0500622_0006445 | 3300053156 | Bacteria | 6801 |
| 848 | Ga0500622_0087674 | 3300053156 | Bacteria | 1549 |
| 849 | Ga0500624_000101 | 3300053157 | Bacteria | 41193 |
| 850 | Ga0500627_0015259 | 3300053158 | Bacteria | 2964 |
| 851 | Ga0500636_0004742 | 3300053177 | Bacteria | 7710 |
| 852 | Ga0500645_000105 | 3300053730 | Bacteria | 67078 |
| 853 | Ga0500645_001424 | 3300053730 | Bacteria | 12167 |
| 854 | Ga0500645_001636 | 3300053730 | Bacteria | 11047 |
| 855 | Ga0500645_004093 | 3300053730 | Bacteria | 5707 |
| 856 | Ga0466962_0000862 | 3300061719 | Bacteria | 13747 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001990 | JGI24737J22298_10021942 | JGI24737J22298_100219422 | 333 |
| 2 | 3300025940 | Ga0207691_10200964 | Ga0207691_102009642 | 339 |
| 3 | 3300046558 | Ga0495633_0078334 | Ga0495633_0078334_25_1188 | 347 |
| 4 | 3300037418 | Ga0395900_0185153 | Ga0395900_0185153_21_1190 | 355 |
| 5 | 3300046515 | Ga0495620_0053703 | Ga0495620_0053703_539_1693 | 356 |
| 6 | 3300031344 | Ga0265316_10039927 | Ga0265316_100399273 | 358 |
| 7 | 3300053730 | Ga0500645_001636 | Ga0500645_001636_2860_4020 | 358 |
| 8 | 3300044683 | Ga0466965_0148607 | Ga0466965_0148607_39_1214 | 361 |
| 9 | 3300037466 | Ga0395898_0391618 | Ga0395898_0391618_36_1274 | 365 |
| 10 | 3300025918 | Ga0207662_10088552 | Ga0207662_100885522 | 376 |
| 11 | 3300005719 | Ga0068861_100000084 | Ga0068861_10000008424 | 380 |
| 12 | 3300009177 | Ga0105248_10003056 | Ga0105248_1000305610 | 380 |
| 13 | 3300026118 | Ga0207675_100000166 | Ga0207675_10000016646 | 380 |
| 14 | 3300046660 | Ga0495625_0058819 | Ga0495625_0058819_1389_2717 | 381 |
| 15 | 3300037418 | Ga0395900_0338227 | Ga0395900_0338227_137_1441 | 385 |
| 16 | 3300005617 | Ga0068859_100002646 | Ga0068859_1000026466 | 387 |
| 17 | 3300006931 | Ga0097620_100002646 | Ga0097620_1000026466 | 387 |
| 18 | 3300025941 | Ga0207711_10001846 | Ga0207711_1000184610 | 387 |
| 19 | 3300042876 | Ga0451577_0000287 | Ga0451577_0000287_4805_6199 | 391 |
| 20 | 3300044673 | Ga0453683_0001021 | Ga0453683_0001021_24245_25639 | 391 |
| 21 | 3300044712 | Ga0453684_0000335 | Ga0453684_0000335_103014_104408 | 391 |
| 22 | 3300045051 | Ga0451576_0000732 | Ga0451576_0000732_42297_43691 | 391 |
| 23 | 3300048924 | Ga0496121_0004591 | Ga0496121_0004591_15197_16600 | 392 |
| 24 | 3300048908 | Ga0496105_0052690 | Ga0496105_0052690_1875_3215 | 397 |
| 25 | 3300001979 | JGI24740J21852_10021675 | JGI24740J21852_100216752 | 398 |
| 26 | 3300001990 | JGI24737J22298_10001146 | JGI24737J22298_100011464 | 398 |
| 27 | 3300002075 | JGI24738J21930_10001044 | JGI24738J21930_100010444 | 398 |
| 28 | 3300005328 | Ga0070676_10030693 | Ga0070676_100306932 | 398 |
| 29 | 3300005331 | Ga0070670_100068086 | Ga0070670_1000680862 | 398 |
| 30 | 3300005338 | Ga0068868_100020478 | Ga0068868_1000204783 | 398 |
| 31 | 3300005339 | Ga0070660_100018676 | Ga0070660_1000186762 | 398 |
| 32 | 3300005340 | Ga0070689_100017077 | Ga0070689_1000170773 | 398 |
| 33 | 3300005343 | Ga0070687_100087279 | Ga0070687_1000872792 | 398 |
| 34 | 3300005344 | Ga0070661_100126596 | Ga0070661_1001265961 | 398 |
| 35 | 3300005353 | Ga0070669_100002036 | Ga0070669_1000020366 | 398 |
| 36 | 3300005354 | Ga0070675_100024531 | Ga0070675_1000245312 | 398 |
| 37 | 3300005355 | Ga0070671_100022126 | Ga0070671_1000221262 | 398 |
| 38 | 3300005364 | Ga0070673_100002611 | Ga0070673_1000026114 | 398 |
| 39 | 3300005459 | Ga0068867_100004228 | Ga0068867_1000042286 | 398 |
| 40 | 3300005539 | Ga0068853_100007512 | Ga0068853_1000075123 | 398 |
| 41 | 3300005543 | Ga0070672_100000098 | Ga0070672_10000009828 | 398 |
| 42 | 3300005563 | Ga0068855_100019593 | Ga0068855_1000195933 | 398 |
| 43 | 3300005564 | Ga0070664_100010114 | Ga0070664_1000101145 | 398 |
| 44 | 3300005577 | Ga0068857_100017127 | Ga0068857_1000171274 | 398 |
| 45 | 3300005616 | Ga0068852_100042719 | Ga0068852_1000427193 | 398 |
| 46 | 3300005617 | Ga0068859_100009383 | Ga0068859_1000093835 | 398 |
| 47 | 3300005618 | Ga0068864_100000835 | Ga0068864_10000083510 | 398 |
| 48 | 3300005842 | Ga0068858_100018540 | Ga0068858_1000185404 | 398 |
| 49 | 3300005843 | Ga0068860_100039947 | Ga0068860_1000399472 | 398 |
| 50 | 3300005844 | Ga0068862_100071812 | Ga0068862_1000718122 | 398 |
| 51 | 3300006881 | Ga0068865_100008898 | Ga0068865_1000088984 | 398 |
| 52 | 3300006931 | Ga0097620_100009383 | Ga0097620_1000093833 | 398 |
| 53 | 3300009098 | Ga0105245_10001138 | Ga0105245_100011384 | 398 |
| 54 | 3300009177 | Ga0105248_10004347 | Ga0105248_100043476 | 398 |
| 55 | 3300013102 | Ga0157371_10070956 | Ga0157371_100709562 | 398 |
| 56 | 3300013297 | Ga0157378_10002395 | Ga0157378_100023957 | 398 |
| 57 | 3300025315 | Ga0207697_10001089 | Ga0207697_1000108910 | 398 |
| 58 | 3300025901 | Ga0207688_10000334 | Ga0207688_100003348 | 398 |
| 59 | 3300025904 | Ga0207647_10000164 | Ga0207647_1000016430 | 398 |
| 60 | 3300025907 | Ga0207645_10013362 | Ga0207645_100133622 | 398 |
| 61 | 3300025919 | Ga0207657_10000742 | Ga0207657_100007423 | 398 |
| 62 | 3300025923 | Ga0207681_10049823 | Ga0207681_100498232 | 398 |
| 63 | 3300025926 | Ga0207659_10027459 | Ga0207659_100274592 | 398 |
| 64 | 3300025933 | Ga0207706_10000764 | Ga0207706_1000076422 | 398 |
| 65 | 3300025940 | Ga0207691_10000364 | Ga0207691_1000036424 | 398 |
| 66 | 3300025941 | Ga0207711_10152617 | Ga0207711_101526172 | 398 |
| 67 | 3300025945 | Ga0207679_10008353 | Ga0207679_100083535 | 398 |
| 68 | 3300025949 | Ga0207667_10026270 | Ga0207667_100262703 | 398 |
| 69 | 3300025960 | Ga0207651_10002797 | Ga0207651_100027975 | 398 |
| 70 | 3300025986 | Ga0207658_10045240 | Ga0207658_100452402 | 398 |
| 71 | 3300026088 | Ga0207641_10219441 | Ga0207641_102194411 | 398 |
| 72 | 3300026089 | Ga0207648_10000781 | Ga0207648_1000078124 | 398 |
| 73 | 3300026095 | Ga0207676_10010480 | Ga0207676_100104803 | 398 |
| 74 | 3300026116 | Ga0207674_10002039 | Ga0207674_100020399 | 398 |
| 75 | 3300026118 | Ga0207675_100117205 | Ga0207675_1001172052 | 398 |
| 76 | 3300048924 | Ga0496121_0000022 | Ga0496121_0000022_367798_369231 | 398 |
| 77 | 3300031344 | Ga0265316_10048829 | Ga0265316_100488293 | 399 |
| 78 | 3300048920 | Ga0496117_0047821 | Ga0496117_0047821_1639_3021 | 399 |
| 79 | 3300009177 | Ga0105248_10216861 | Ga0105248_102168612 | 400 |
| 80 | 3300025941 | Ga0207711_10148625 | Ga0207711_101486252 | 400 |
| 81 | 3300009098 | Ga0105245_10003162 | Ga0105245_1000316210 | 401 |
| 82 | 3300009148 | Ga0105243_10088678 | Ga0105243_100886782 | 401 |
| 83 | 3300011119 | Ga0105246_10089630 | Ga0105246_100896302 | 401 |
| 84 | 3300025927 | Ga0207687_10002400 | Ga0207687_100024006 | 401 |
| 85 | 3300047472 | Ga0495686_0000661 | Ga0495686_0000661_40819_42222 | 401 |
| 86 | 3300005614 | Ga0068856_100022031 | Ga0068856_1000220315 | 402 |
| 87 | 3300026078 | Ga0207702_10009817 | Ga0207702_100098175 | 402 |
| 88 | 3300047472 | Ga0495686_0004063 | Ga0495686_0004063_654_2060 | 402 |
| 89 | 3300005618 | Ga0068864_100000948 | Ga0068864_10000094826 | 403 |
| 90 | 3300005841 | Ga0068863_100000331 | Ga0068863_10000033136 | 403 |
| 91 | 3300005842 | Ga0068858_100000378 | Ga0068858_10000037834 | 403 |
| 92 | 3300009092 | Ga0105250_10042131 | Ga0105250_100421312 | 403 |
| 93 | 3300014968 | Ga0157379_10057311 | Ga0157379_100573114 | 403 |
| 94 | 3300026035 | Ga0207703_10000399 | Ga0207703_1000039933 | 403 |
| 95 | 3300026088 | Ga0207641_10000070 | Ga0207641_1000007068 | 403 |
| 96 | 3300026095 | Ga0207676_10000602 | Ga0207676_1000060224 | 403 |
| 97 | 3300005548 | Ga0070665_100092381 | Ga0070665_1000923812 | 404 |
| 98 | 3300047469 | Ga0495673_0018706 | Ga0495673_0018706_1331_2749 | 404 |
| 99 | 3300001904 | JGI24736J21556_1000754 | JGI24736J21556_10007544 | 405 |
| 100 | 3300005334 | Ga0068869_100002806 | Ga0068869_1000028062 | 405 |
| 101 | 3300046460 | Ga0495638_0000633 | Ga0495638_0000633_19092_20498 | 406 |
| 102 | 3300013102 | Ga0157371_10080734 | Ga0157371_100807342 | 407 |
| 103 | 3300028563 | Ga0265319_1011045 | Ga0265319_10110453 | 407 |
| 104 | 3300028577 | Ga0265318_10001295 | Ga0265318_100012956 | 407 |
| 105 | 3300028800 | Ga0265338_10013094 | Ga0265338_100130943 | 407 |
| 106 | 3300031238 | Ga0265332_10007734 | Ga0265332_100077343 | 407 |
| 107 | 3300031239 | Ga0265328_10054735 | Ga0265328_100547351 | 407 |
| 108 | 3300031240 | Ga0265320_10039594 | Ga0265320_100395942 | 407 |
| 109 | 3300031241 | Ga0265325_10001334 | Ga0265325_100013345 | 407 |
| 110 | 3300031249 | Ga0265339_10032246 | Ga0265339_100322462 | 407 |
| 111 | 3300031250 | Ga0265331_10003659 | Ga0265331_100036597 | 407 |
| 112 | 3300031595 | Ga0265313_10003424 | Ga0265313_1000342411 | 407 |
| 113 | 3300031616 | Ga0307508_10003032 | Ga0307508_100030327 | 407 |
| 114 | 3300031711 | Ga0265314_10027660 | Ga0265314_100276602 | 407 |
| 115 | 3300031712 | Ga0265342_10005743 | Ga0265342_100057436 | 407 |
| 116 | 3300046616 | Ga0495668_0021480 | Ga0495668_0021480_282_1697 | 407 |
| 117 | 3300046660 | Ga0495625_0004911 | Ga0495625_0004911_1143_2558 | 407 |
| 118 | 3300053104 | Ga0500556_0000013 | Ga0500556_0000013_89869_91284 | 407 |
| 119 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_318269_319684 | 407 |
| 120 | 3300053730 | Ga0500645_000105 | Ga0500645_000105_3971_5386 | 407 |
| 121 | 3300048928 | Ga0496125_0095714 | Ga0496125_0095714_15_1445 | 408 |
| 122 | 3300001990 | JGI24737J22298_10002102 | JGI24737J22298_100021026 | 409 |
| 123 | 3300005327 | Ga0070658_10071614 | Ga0070658_100716142 | 409 |
| 124 | 3300005366 | Ga0070659_100083956 | Ga0070659_1000839562 | 409 |
| 125 | 3300005455 | Ga0070663_100003936 | Ga0070663_1000039366 | 409 |
| 126 | 3300005563 | Ga0068855_100069849 | Ga0068855_1000698492 | 409 |
| 127 | 3300005834 | Ga0068851_10039346 | Ga0068851_100393462 | 409 |
| 128 | 3300009093 | Ga0105240_10076181 | Ga0105240_100761813 | 409 |
| 129 | 3300009174 | Ga0105241_10011807 | Ga0105241_100118076 | 409 |
| 130 | 3300010375 | Ga0105239_10155730 | Ga0105239_101557302 | 409 |
| 131 | 3300013100 | Ga0157373_10107898 | Ga0157373_101078982 | 409 |
| 132 | 3300013104 | Ga0157370_10218036 | Ga0157370_102180362 | 409 |
| 133 | 3300025913 | Ga0207695_10077465 | Ga0207695_100774653 | 409 |
| 134 | 3300025933 | Ga0207706_10036451 | Ga0207706_100364514 | 409 |
| 135 | 3300025949 | Ga0207667_10092667 | Ga0207667_100926673 | 409 |
| 136 | 3300026041 | Ga0207639_10000730 | Ga0207639_100007306 | 409 |
| 137 | 3300026067 | Ga0207678_10000084 | Ga0207678_1000008466 | 409 |
| 138 | 3300026116 | Ga0207674_10019779 | Ga0207674_100197795 | 409 |
| 139 | 3300031548 | Ga0307408_100054374 | Ga0307408_1000543741 | 409 |
| 140 | 3300037471 | Ga0395905_0297016 | Ga0395905_0297016_73_1473 | 409 |
| 141 | 3300047472 | Ga0495686_0020591 | Ga0495686_0020591_296_1675 | 409 |
| 142 | 3300048919 | Ga0496116_0000116 | Ga0496116_0000116_99487_100920 | 409 |
| 143 | 3300005328 | Ga0070676_10066819 | Ga0070676_100668192 | 410 |
| 144 | 3300005328 | Ga0070676_10069457 | Ga0070676_100694572 | 410 |
| 145 | 3300005330 | Ga0070690_100002605 | Ga0070690_1000026056 | 410 |
| 146 | 3300005330 | Ga0070690_100023434 | Ga0070690_1000234342 | 410 |
| 147 | 3300005338 | Ga0068868_100002542 | Ga0068868_1000025424 | 410 |
| 148 | 3300005339 | Ga0070660_100055816 | Ga0070660_1000558163 | 410 |
| 149 | 3300005340 | Ga0070689_100041597 | Ga0070689_1000415972 | 410 |
| 150 | 3300005355 | Ga0070671_100079600 | Ga0070671_1000796001 | 410 |
| 151 | 3300005356 | Ga0070674_100129450 | Ga0070674_1001294502 | 410 |
| 152 | 3300005367 | Ga0070667_100118785 | Ga0070667_1001187852 | 410 |
| 153 | 3300005456 | Ga0070678_100122039 | Ga0070678_1001220392 | 410 |
| 154 | 3300005457 | Ga0070662_100083374 | Ga0070662_1000833741 | 410 |
| 155 | 3300005457 | Ga0070662_100219477 | Ga0070662_1002194771 | 410 |
| 156 | 3300005459 | Ga0068867_100004200 | Ga0068867_1000042004 | 410 |
| 157 | 3300005459 | Ga0068867_100125532 | Ga0068867_1001255322 | 410 |
| 158 | 3300005539 | Ga0068853_100154195 | Ga0068853_1001541952 | 410 |
| 159 | 3300005617 | Ga0068859_100082236 | Ga0068859_1000822362 | 410 |
| 160 | 3300005843 | Ga0068860_100292328 | Ga0068860_1002923281 | 410 |
| 161 | 3300006237 | Ga0097621_100115330 | Ga0097621_1001153302 | 410 |
| 162 | 3300006881 | Ga0068865_100093027 | Ga0068865_1000930271 | 410 |
| 163 | 3300006931 | Ga0097620_100082237 | Ga0097620_1000822372 | 410 |
| 164 | 3300009093 | Ga0105240_10203977 | Ga0105240_102039772 | 410 |
| 165 | 3300009177 | Ga0105248_10000119 | Ga0105248_100001193 | 410 |
| 166 | 3300009177 | Ga0105248_10002873 | Ga0105248_1000287310 | 410 |
| 167 | 3300009177 | Ga0105248_10110320 | Ga0105248_101103201 | 410 |
| 168 | 3300009551 | Ga0105238_10037320 | Ga0105238_100373202 | 410 |
| 169 | 3300013100 | Ga0157373_10017332 | Ga0157373_100173322 | 410 |
| 170 | 3300013100 | Ga0157373_10042658 | Ga0157373_100426582 | 410 |
| 171 | 3300013104 | Ga0157370_10060861 | Ga0157370_100608613 | 410 |
| 172 | 3300013105 | Ga0157369_10003304 | Ga0157369_100033047 | 410 |
| 173 | 3300013105 | Ga0157369_10015230 | Ga0157369_100152301 | 410 |
| 174 | 3300013296 | Ga0157374_10008172 | Ga0157374_100081728 | 410 |
| 175 | 3300013306 | Ga0163162_10173719 | Ga0163162_101737192 | 410 |
| 176 | 3300025909 | Ga0207705_10166194 | Ga0207705_101661942 | 410 |
| 177 | 3300025936 | Ga0207670_10098722 | Ga0207670_100987221 | 410 |
| 178 | 3300025981 | Ga0207640_10165011 | Ga0207640_101650111 | 410 |
| 179 | 3300033529 | Ga0316587_1006815 | Ga0316587_10068151 | 410 |
| 180 | 3300037312 | Ga0395899_0049976 | Ga0395899_0049976_452_1855 | 410 |
| 181 | 3300037312 | Ga0395899_0062427 | Ga0395899_0062427_1133_2527 | 410 |
| 182 | 3300037418 | Ga0395900_0012851 | Ga0395900_0012851_3046_4440 | 410 |
| 183 | 3300037418 | Ga0395900_0141496 | Ga0395900_0141496_386_1789 | 410 |
| 184 | 3300037466 | Ga0395898_0024761 | Ga0395898_0024761_3061_4464 | 410 |
| 185 | 3300037466 | Ga0395898_0128522 | Ga0395898_0128522_228_1622 | 410 |
| 186 | 3300037471 | Ga0395905_0015114 | Ga0395905_0015114_2001_3395 | 410 |
| 187 | 3300037471 | Ga0395905_0284314 | Ga0395905_0284314_55_1515 | 410 |
| 188 | 3300038443 | Ga0395901_0018907 | Ga0395901_0018907_3268_4662 | 410 |
| 189 | 3300039450 | Ga0436363_0441596 | Ga0436363_0441596_1701_3113 | 410 |
| 190 | 3300042004 | Ga0439445_0000017 | Ga0439445_0000017_12863_14266 | 410 |
| 191 | 3300044694 | Ga0466963_0009953 | Ga0466963_0009953_1216_2619 | 410 |
| 192 | 3300044719 | Ga0466971_0010174 | Ga0466971_0010174_2035_3426 | 410 |
| 193 | 3300044765 | Ga0466970_0011106 | Ga0466970_0011106_408_1799 | 410 |
| 194 | 3300044842 | Ga0466957_0000504 | Ga0466957_0000504_15556_16947 | 410 |
| 195 | 3300046691 | Ga0495670_0070065 | Ga0495670_0070065_44_1441 | 410 |
| 196 | 3300048903 | Ga0496100_0071060 | Ga0496100_0071060_107_1501 | 410 |
| 197 | 3300048904 | Ga0496101_0148093 | Ga0496101_0148093_168_1562 | 410 |
| 198 | 3300048911 | Ga0496108_0002157 | Ga0496108_0002157_6608_7987 | 410 |
| 199 | 3300048914 | Ga0496111_0038978 | Ga0496111_0038978_221_1600 | 410 |
| 200 | 3300048915 | Ga0496112_0019749 | Ga0496112_0019749_917_2311 | 410 |
| 201 | 3300048915 | Ga0496112_0049824 | Ga0496112_0049824_367_1746 | 410 |
| 202 | 3300053153 | Ga0500616_0000101 | Ga0500616_0000101_140919_142337 | 410 |
| 203 | 3300003773 | Ga0055537_1001708 | Ga0055537_10017084 | 411 |
| 204 | 3300003790 | Ga0055528_1004276 | Ga0055528_10042762 | 411 |
| 205 | 3300005356 | Ga0070674_100044185 | Ga0070674_1000441852 | 411 |
| 206 | 3300025263 | Ga0209565_1000140 | Ga0209565_100014039 | 411 |
| 207 | 3300025273 | Ga0209673_1000630 | Ga0209673_100063045 | 411 |
| 208 | 3300025299 | Ga0209256_1006103 | Ga0209256_10061032 | 411 |
| 209 | 3300025303 | Ga0209051_1002278 | Ga0209051_10022782 | 411 |
| 210 | 3300025937 | Ga0207669_10029249 | Ga0207669_100292491 | 411 |
| 211 | 3300026118 | Ga0207675_100024191 | Ga0207675_1000241913 | 411 |
| 212 | 3300045976 | Ga0466967_0039894 | Ga0466967_0039894_232_1629 | 411 |
| 213 | 3300046616 | Ga0495668_0000587 | Ga0495668_0000587_7677_9077 | 411 |
| 214 | 3300048923 | Ga0496120_0048321 | Ga0496120_0048321_37_1428 | 411 |
| 215 | 3300048924 | Ga0496121_0077575 | Ga0496121_0077575_603_2003 | 411 |
| 216 | 3300053122 | Ga0500608_000079 | Ga0500608_000079_12567_13967 | 411 |
| 217 | 3300044694 | Ga0466963_0004459 | Ga0466963_0004459_5119_6522 | 412 |
| 218 | 3300045976 | Ga0466967_0000149 | Ga0466967_0000149_23534_24937 | 412 |
| 219 | 3300053156 | Ga0500622_0006445 | Ga0500622_0006445_2746_4146 | 412 |
| 220 | 3300001904 | JGI24736J21556_1002528 | JGI24736J21556_10025282 | 413 |
| 221 | 3300003215 | JGI25153J46596_10000260 | JGI25153J46596_100002601 | 413 |
| 222 | 3300003773 | Ga0055537_1008784 | Ga0055537_10087843 | 413 |
| 223 | 3300003781 | Ga0055536_1001906 | Ga0055536_10019062 | 413 |
| 224 | 3300003781 | Ga0055536_1002035 | Ga0055536_10020354 | 413 |
| 225 | 3300003781 | Ga0055536_1018772 | Ga0055536_10187722 | 413 |
| 226 | 3300003791 | Ga0055530_10002421 | Ga0055530_100024219 | 413 |
| 227 | 3300003791 | Ga0055530_10008021 | Ga0055530_100080212 | 413 |
| 228 | 3300003792 | Ga0055540_1000943 | Ga0055540_100094317 | 413 |
| 229 | 3300003794 | Ga0055531_10003045 | Ga0055531_100030454 | 413 |
| 230 | 3300005333 | Ga0070677_10000627 | Ga0070677_100006277 | 413 |
| 231 | 3300005347 | Ga0070668_100078339 | Ga0070668_1000783393 | 413 |
| 232 | 3300005353 | Ga0070669_100063440 | Ga0070669_1000634402 | 413 |
| 233 | 3300005354 | Ga0070675_100002779 | Ga0070675_10000277910 | 413 |
| 234 | 3300006353 | Ga0075370_10021394 | Ga0075370_100213941 | 413 |
| 235 | 3300025245 | Ga0207425_1000072 | Ga0207425_10000722 | 413 |
| 236 | 3300025258 | Ga0209129_1003291 | Ga0209129_10032913 | 413 |
| 237 | 3300025263 | Ga0209565_1000132 | Ga0209565_100013268 | 413 |
| 238 | 3300025292 | Ga0209676_1000043 | Ga0209676_100004327 | 413 |
| 239 | 3300025292 | Ga0209676_1000712 | Ga0209676_10007129 | 413 |
| 240 | 3300025292 | Ga0209676_1006661 | Ga0209676_10066612 | 413 |
| 241 | 3300025294 | Ga0209025_1000721 | Ga0209025_100072137 | 413 |
| 242 | 3300025295 | Ga0209564_1000502 | Ga0209564_100050225 | 413 |
| 243 | 3300025297 | Ga0209758_1000009 | Ga0209758_1000009638 | 413 |
| 244 | 3300025298 | Ga0209050_1000005 | Ga0209050_1000005531 | 413 |
| 245 | 3300025298 | Ga0209050_1000559 | Ga0209050_10005599 | 413 |
| 246 | 3300025298 | Ga0209050_1001103 | Ga0209050_100110324 | 413 |
| 247 | 3300025303 | Ga0209051_1000377 | Ga0209051_100037748 | 413 |
| 248 | 3300025304 | Ga0209257_1000134 | Ga0209257_100013489 | 413 |
| 249 | 3300025304 | Ga0209257_1017792 | Ga0209257_10177922 | 413 |
| 250 | 3300025893 | Ga0207682_10000393 | Ga0207682_1000039312 | 413 |
| 251 | 3300025926 | Ga0207659_10004748 | Ga0207659_100047485 | 413 |
| 252 | 3300025929 | Ga0207664_10053737 | Ga0207664_100537373 | 413 |
| 253 | 3300025933 | Ga0207706_10013864 | Ga0207706_100138645 | 413 |
| 254 | 3300025945 | Ga0207679_10212549 | Ga0207679_102125492 | 413 |
| 255 | 3300031548 | Ga0307408_100111185 | Ga0307408_1001111852 | 413 |
| 256 | 3300031852 | Ga0307410_10006990 | Ga0307410_100069906 | 413 |
| 257 | 3300031911 | Ga0307412_10002246 | Ga0307412_100022464 | 413 |
| 258 | 3300031911 | Ga0307412_10058556 | Ga0307412_100585561 | 413 |
| 259 | 3300031995 | Ga0307409_100132847 | Ga0307409_1001328473 | 413 |
| 260 | 3300032004 | Ga0307414_10007172 | Ga0307414_100071724 | 413 |
| 261 | 3300032005 | Ga0307411_10000888 | Ga0307411_1000088810 | 413 |
| 262 | 3300035111 | Ga0373923_0008534 | Ga0373923_0008534_984_2390 | 413 |
| 263 | 3300035118 | Ga0373954_0020173 | Ga0373954_0020173_1071_2477 | 413 |
| 264 | 3300035120 | Ga0373957_0003306 | Ga0373957_0003306_767_2173 | 413 |
| 265 | 3300035172 | Ga0373955_0005811 | Ga0373955_0005811_1863_3269 | 413 |
| 266 | 3300036401 | Ga0373937_0004175 | Ga0373937_0004175_6749_8155 | 413 |
| 267 | 3300037471 | Ga0395905_0261484 | Ga0395905_0261484_25_1428 | 413 |
| 268 | 3300042122 | Ga0450920_001437 | Ga0450920_001437_1688_3094 | 413 |
| 269 | 3300042157 | Ga0439458_0004008 | Ga0439458_0004008_1368_2771 | 413 |
| 270 | 3300048088 | Ga0495602_0083170 | Ga0495602_0083170_818_2224 | 413 |
| 271 | 3300049571 | Ga0501034_0091134 | Ga0501034_0091134_1422_2801 | 413 |
| 272 | 3300049663 | Ga0501223_000106 | Ga0501223_000106_4259_5638 | 413 |
| 273 | 3300049664 | Ga0501224_000007 | Ga0501224_000007_85390_86769 | 413 |
| 274 | 3300049668 | Ga0501233_000050 | Ga0501233_000050_4229_5608 | 413 |
| 275 | 3300049669 | Ga0501235_000245 | Ga0501235_000245_3157_4536 | 413 |
| 276 | 3300049705 | Ga0501225_0000100 | Ga0501225_0000100_26067_27446 | 413 |
| 277 | 3300049853 | Ga0501226_000025 | Ga0501226_000025_4423_5802 | 413 |
| 278 | 3300005289 | Ga0065704_10070205 | Ga0065704_100702059 | 414 |
| 279 | 3300005616 | Ga0068852_100139777 | Ga0068852_1001397772 | 414 |
| 280 | 3300042012 | Ga0439455_0002013 | Ga0439455_0002013_797_2200 | 414 |
| 281 | 3300042157 | Ga0439458_0003199 | Ga0439458_0003199_997_2400 | 414 |
| 282 | iso_pu_bacteria | 2848297114 | 2848298060 | 414 |
| 283 | 3300003791 | Ga0055530_10000074 | Ga0055530_1000007443 | 415 |
| 284 | 3300003791 | Ga0055530_10000579 | Ga0055530_1000057925 | 415 |
| 285 | 3300003794 | Ga0055531_10000374 | Ga0055531_100003741 | 415 |
| 286 | 3300003794 | Ga0055531_10003351 | Ga0055531_100033518 | 415 |
| 287 | 3300005262 | Ga0065165_1000459 | Ga0065165_100045923 | 415 |
| 288 | 3300025292 | Ga0209676_1001967 | Ga0209676_10019672 | 415 |
| 289 | 3300025297 | Ga0209758_1000924 | Ga0209758_10009247 | 415 |
| 290 | 3300025298 | Ga0209050_1000039 | Ga0209050_1000039158 | 415 |
| 291 | 3300025298 | Ga0209050_1000049 | Ga0209050_100004934 | 415 |
| 292 | 3300025304 | Ga0209257_1000051 | Ga0209257_1000051158 | 415 |
| 293 | 3300025304 | Ga0209257_1000692 | Ga0209257_100069238 | 415 |
| 294 | 3300025986 | Ga0207658_10143835 | Ga0207658_101438352 | 415 |
| 295 | 3300026116 | Ga0207674_10010710 | Ga0207674_100107108 | 415 |
| 296 | 3300028786 | Ga0307517_10026956 | Ga0307517_100269565 | 415 |
| 297 | 3300031995 | Ga0307409_100104619 | Ga0307409_1001046192 | 415 |
| 298 | 3300032004 | Ga0307414_10160366 | Ga0307414_101603662 | 415 |
| 299 | 3300037312 | Ga0395899_0079549 | Ga0395899_0079549_913_2334 | 415 |
| 300 | 3300037418 | Ga0395900_0000589 | Ga0395900_0000589_24937_26358 | 415 |
| 301 | 3300037466 | Ga0395898_0044228 | Ga0395898_0044228_1808_3229 | 415 |
| 302 | 3300037471 | Ga0395905_0014753 | Ga0395905_0014753_2255_3676 | 415 |
| 303 | 3300037471 | Ga0395905_0025568 | Ga0395905_0025568_3993_5414 | 415 |
| 304 | 3300037471 | Ga0395905_0080347 | Ga0395905_0080347_994_2415 | 415 |
| 305 | 3300044712 | Ga0453684_0001362 | Ga0453684_0001362_20987_22381 | 415 |
| 306 | 3300044712 | Ga0453684_0002060 | Ga0453684_0002060_11053_12450 | 415 |
| 307 | 3300044712 | Ga0453684_0002091 | Ga0453684_0002091_38918_40315 | 415 |
| 308 | 3300048907 | Ga0496104_0002627 | Ga0496104_0002627_7628_9034 | 415 |
| 309 | 3300048908 | Ga0496105_0000678 | Ga0496105_0000678_19191_20597 | 415 |
| 310 | 3300048917 | Ga0496114_0006615 | Ga0496114_0006615_5552_6958 | 415 |
| 311 | 3300048918 | Ga0496115_0000657 | Ga0496115_0000657_6470_7894 | 415 |
| 312 | 3300048918 | Ga0496115_0021090 | Ga0496115_0021090_444_1850 | 415 |
| 313 | iso_pu_bacteria | 2599185359 | 2600228696 | 415 |
| 314 | iso_pu_bacteria | 2643221588 | 2643951523 | 415 |
| 315 | iso_pu_bacteria | 2643221663 | 2644353833 | 415 |
| 316 | iso_pu_bacteria | 2818991466 | 2819714506 | 415 |
| 317 | iso_pu_bacteria | 2879163058 | 2879164946 | 415 |
| 318 | iso_pu_bacteria | 2928526807 | 2928529008 | 415 |
| 319 | iso_pu_bacteria | 2928968154 | 2928968526 | 415 |
| 320 | iso_pu_bacteria | 3000865235 | 3000867187 | 415 |
| 321 | 3300002075 | JGI24738J21930_10010652 | JGI24738J21930_100106521 | 416 |
| 322 | 3300003214 | JGI25165J46597_1000106 | JGI25165J46597_100010662 | 416 |
| 323 | 3300003215 | JGI25153J46596_10008006 | JGI25153J46596_100080062 | 416 |
| 324 | 3300003762 | Ga0055542_1004480 | Ga0055542_10044803 | 416 |
| 325 | 3300003773 | Ga0055537_1000161 | Ga0055537_100016126 | 416 |
| 326 | 3300003775 | Ga0055524_1000110 | Ga0055524_100011055 | 416 |
| 327 | 3300003781 | Ga0055536_1005768 | Ga0055536_10057682 | 416 |
| 328 | 3300003794 | Ga0055531_10002640 | Ga0055531_100026407 | 416 |
| 329 | 3300005262 | Ga0065165_1001720 | Ga0065165_10017202 | 416 |
| 330 | 3300005262 | Ga0065165_1008312 | Ga0065165_10083123 | 416 |
| 331 | 3300005327 | Ga0070658_10000262 | Ga0070658_1000026233 | 416 |
| 332 | 3300005327 | Ga0070658_10002456 | Ga0070658_100024569 | 416 |
| 333 | 3300005327 | Ga0070658_10007785 | Ga0070658_100077852 | 416 |
| 334 | 3300005327 | Ga0070658_10014970 | Ga0070658_100149702 | 416 |
| 335 | 3300005328 | Ga0070676_10000052 | Ga0070676_1000005235 | 416 |
| 336 | 3300005328 | Ga0070676_10000442 | Ga0070676_1000044210 | 416 |
| 337 | 3300005329 | Ga0070683_100091902 | Ga0070683_1000919021 | 416 |
| 338 | 3300005329 | Ga0070683_100139833 | Ga0070683_1001398331 | 416 |
| 339 | 3300005334 | Ga0068869_100001639 | Ga0068869_1000016391 | 416 |
| 340 | 3300005336 | Ga0070680_100089477 | Ga0070680_1000894771 | 416 |
| 341 | 3300005336 | Ga0070680_100199122 | Ga0070680_1001991221 | 416 |
| 342 | 3300005338 | Ga0068868_100000350 | Ga0068868_1000003508 | 416 |
| 343 | 3300005339 | Ga0070660_100001869 | Ga0070660_10000186911 | 416 |
| 344 | 3300005339 | Ga0070660_100002093 | Ga0070660_1000020937 | 416 |
| 345 | 3300005344 | Ga0070661_100011226 | Ga0070661_1000112265 | 416 |
| 346 | 3300005347 | Ga0070668_100016356 | Ga0070668_1000163564 | 416 |
| 347 | 3300005353 | Ga0070669_100024685 | Ga0070669_1000246852 | 416 |
| 348 | 3300005354 | Ga0070675_100046511 | Ga0070675_1000465114 | 416 |
| 349 | 3300005355 | Ga0070671_100022652 | Ga0070671_1000226522 | 416 |
| 350 | 3300005356 | Ga0070674_100058485 | Ga0070674_1000584852 | 416 |
| 351 | 3300005364 | Ga0070673_100000004 | Ga0070673_10000000421 | 416 |
| 352 | 3300005366 | Ga0070659_100137070 | Ga0070659_1001370702 | 416 |
| 353 | 3300005367 | Ga0070667_100172986 | Ga0070667_1001729861 | 416 |
| 354 | 3300005455 | Ga0070663_100001446 | Ga0070663_1000014462 | 416 |
| 355 | 3300005456 | Ga0070678_100013770 | Ga0070678_1000137703 | 416 |
| 356 | 3300005457 | Ga0070662_100009072 | Ga0070662_1000090722 | 416 |
| 357 | 3300005458 | Ga0070681_10012780 | Ga0070681_100127806 | 416 |
| 358 | 3300005459 | Ga0068867_100000028 | Ga0068867_10000002856 | 416 |
| 359 | 3300005459 | Ga0068867_100007450 | Ga0068867_1000074505 | 416 |
| 360 | 3300005530 | Ga0070679_100020025 | Ga0070679_1000200255 | 416 |
| 361 | 3300005530 | Ga0070679_100063132 | Ga0070679_1000631323 | 416 |
| 362 | 3300005535 | Ga0070684_100020722 | Ga0070684_1000207223 | 416 |
| 363 | 3300005539 | Ga0068853_100010686 | Ga0068853_1000106864 | 416 |
| 364 | 3300005543 | Ga0070672_100015697 | Ga0070672_1000156974 | 416 |
| 365 | 3300005563 | Ga0068855_100002440 | Ga0068855_1000024409 | 416 |
| 366 | 3300005578 | Ga0068854_100004750 | Ga0068854_1000047503 | 416 |
| 367 | 3300005578 | Ga0068854_100017047 | Ga0068854_1000170471 | 416 |
| 368 | 3300005616 | Ga0068852_100025664 | Ga0068852_1000256643 | 416 |
| 369 | 3300005719 | Ga0068861_100040697 | Ga0068861_1000406973 | 416 |
| 370 | 3300005842 | Ga0068858_100162476 | Ga0068858_1001624762 | 416 |
| 371 | 3300005843 | Ga0068860_100020775 | Ga0068860_1000207754 | 416 |
| 372 | 3300005844 | Ga0068862_100005817 | Ga0068862_1000058174 | 416 |
| 373 | 3300006237 | Ga0097621_100115700 | Ga0097621_1001157002 | 416 |
| 374 | 3300006358 | Ga0068871_100005489 | Ga0068871_1000054895 | 416 |
| 375 | 3300006881 | Ga0068865_100000006 | Ga0068865_10000000621 | 416 |
| 376 | 3300006881 | Ga0068865_100039088 | Ga0068865_1000390882 | 416 |
| 377 | 3300009093 | Ga0105240_10020240 | Ga0105240_100202403 | 416 |
| 378 | 3300009098 | Ga0105245_10001700 | Ga0105245_1000170011 | 416 |
| 379 | 3300009148 | Ga0105243_10000477 | Ga0105243_1000047711 | 416 |
| 380 | 3300009177 | Ga0105248_10025820 | Ga0105248_100258202 | 416 |
| 381 | 3300009551 | Ga0105238_10192522 | Ga0105238_101925222 | 416 |
| 382 | 3300009553 | Ga0105249_10017455 | Ga0105249_100174552 | 416 |
| 383 | 3300010375 | Ga0105239_10010602 | Ga0105239_100106023 | 416 |
| 384 | 3300010375 | Ga0105239_10042582 | Ga0105239_100425822 | 416 |
| 385 | 3300010375 | Ga0105239_10087005 | Ga0105239_100870053 | 416 |
| 386 | 3300011119 | Ga0105246_10000868 | Ga0105246_1000086810 | 416 |
| 387 | 3300013102 | Ga0157371_10007400 | Ga0157371_100074007 | 416 |
| 388 | 3300013104 | Ga0157370_10000462 | Ga0157370_1000046211 | 416 |
| 389 | 3300013104 | Ga0157370_10011758 | Ga0157370_100117585 | 416 |
| 390 | 3300013105 | Ga0157369_10025039 | Ga0157369_100250393 | 416 |
| 391 | 3300013105 | Ga0157369_10230356 | Ga0157369_102303561 | 416 |
| 392 | 3300013296 | Ga0157374_10002874 | Ga0157374_1000287411 | 416 |
| 393 | 3300013297 | Ga0157378_10001586 | Ga0157378_100015868 | 416 |
| 394 | 3300013297 | Ga0157378_10062120 | Ga0157378_100621201 | 416 |
| 395 | 3300013306 | Ga0163162_10032344 | Ga0163162_100323442 | 416 |
| 396 | 3300013307 | Ga0157372_10062562 | Ga0157372_100625621 | 416 |
| 397 | 3300013307 | Ga0157372_10209583 | Ga0157372_102095831 | 416 |
| 398 | 3300013308 | Ga0157375_10006898 | Ga0157375_100068986 | 416 |
| 399 | 3300013308 | Ga0157375_10027560 | Ga0157375_100275602 | 416 |
| 400 | 3300014326 | Ga0157380_10070680 | Ga0157380_100706802 | 416 |
| 401 | 3300014969 | Ga0157376_10000113 | Ga0157376_1000011321 | 416 |
| 402 | 3300017792 | Ga0163161_10015335 | Ga0163161_100153354 | 416 |
| 403 | 3300021384 | Ga0213876_10001359 | Ga0213876_1000135910 | 416 |
| 404 | 3300025231 | Ga0207427_100586 | Ga0207427_10058610 | 416 |
| 405 | 3300025250 | Ga0209026_1000483 | Ga0209026_100048320 | 416 |
| 406 | 3300025254 | Ga0209148_1000059 | Ga0209148_1000059122 | 416 |
| 407 | 3300025254 | Ga0209148_1001365 | Ga0209148_10013655 | 416 |
| 408 | 3300025261 | Ga0209233_1000003 | Ga0209233_1000003703 | 416 |
| 409 | 3300025263 | Ga0209565_1000030 | Ga0209565_100003078 | 416 |
| 410 | 3300025272 | Ga0209455_1000265 | Ga0209455_100026530 | 416 |
| 411 | 3300025273 | Ga0209673_1002418 | Ga0209673_10024184 | 416 |
| 412 | 3300025291 | Ga0209675_1007212 | Ga0209675_10072123 | 416 |
| 413 | 3300025292 | Ga0209676_1000063 | Ga0209676_1000063271 | 416 |
| 414 | 3300025297 | Ga0209758_1008272 | Ga0209758_10082723 | 416 |
| 415 | 3300025299 | Ga0209256_1000046 | Ga0209256_1000046207 | 416 |
| 416 | 3300025304 | Ga0209257_1001876 | Ga0209257_10018769 | 416 |
| 417 | 3300025899 | Ga0207642_10016176 | Ga0207642_100161762 | 416 |
| 418 | 3300025907 | Ga0207645_10003767 | Ga0207645_100037675 | 416 |
| 419 | 3300025907 | Ga0207645_10042493 | Ga0207645_100424932 | 416 |
| 420 | 3300025909 | Ga0207705_10000049 | Ga0207705_1000004927 | 416 |
| 421 | 3300025909 | Ga0207705_10000119 | Ga0207705_1000011915 | 416 |
| 422 | 3300025909 | Ga0207705_10001719 | Ga0207705_1000171910 | 416 |
| 423 | 3300025914 | Ga0207671_10132848 | Ga0207671_101328482 | 416 |
| 424 | 3300025919 | Ga0207657_10003143 | Ga0207657_100031437 | 416 |
| 425 | 3300025919 | Ga0207657_10006615 | Ga0207657_100066155 | 416 |
| 426 | 3300025921 | Ga0207652_10059575 | Ga0207652_100595752 | 416 |
| 427 | 3300025927 | Ga0207687_10000956 | Ga0207687_1000095614 | 416 |
| 428 | 3300025931 | Ga0207644_10034448 | Ga0207644_100344482 | 416 |
| 429 | 3300025932 | Ga0207690_10015611 | Ga0207690_100156112 | 416 |
| 430 | 3300025932 | Ga0207690_10172506 | Ga0207690_101725061 | 416 |
| 431 | 3300025933 | Ga0207706_10004774 | Ga0207706_100047746 | 416 |
| 432 | 3300025933 | Ga0207706_10006596 | Ga0207706_100065965 | 416 |
| 433 | 3300025935 | Ga0207709_10000182 | Ga0207709_1000018221 | 416 |
| 434 | 3300025938 | Ga0207704_10000022 | Ga0207704_1000002221 | 416 |
| 435 | 3300025942 | Ga0207689_10002559 | Ga0207689_1000255912 | 416 |
| 436 | 3300025942 | Ga0207689_10009094 | Ga0207689_100090944 | 416 |
| 437 | 3300025945 | Ga0207679_10175427 | Ga0207679_101754272 | 416 |
| 438 | 3300025949 | Ga0207667_10000029 | Ga0207667_10000029131 | 416 |
| 439 | 3300025949 | Ga0207667_10023353 | Ga0207667_100233535 | 416 |
| 440 | 3300025949 | Ga0207667_10047624 | Ga0207667_100476244 | 416 |
| 441 | 3300025960 | Ga0207651_10000009 | Ga0207651_1000000921 | 416 |
| 442 | 3300025961 | Ga0207712_10030564 | Ga0207712_100305643 | 416 |
| 443 | 3300025972 | Ga0207668_10000361 | Ga0207668_1000036112 | 416 |
| 444 | 3300025981 | Ga0207640_10000359 | Ga0207640_1000035922 | 416 |
| 445 | 3300025981 | Ga0207640_10028087 | Ga0207640_100280872 | 416 |
| 446 | 3300026023 | Ga0207677_10000342 | Ga0207677_100003428 | 416 |
| 447 | 3300026035 | Ga0207703_10100419 | Ga0207703_101004192 | 416 |
| 448 | 3300026041 | Ga0207639_10008852 | Ga0207639_100088522 | 416 |
| 449 | 3300026041 | Ga0207639_10049818 | Ga0207639_100498182 | 416 |
| 450 | 3300026041 | Ga0207639_10175877 | Ga0207639_101758772 | 416 |
| 451 | 3300026041 | Ga0207639_10184815 | Ga0207639_101848151 | 416 |
| 452 | 3300026067 | Ga0207678_10000723 | Ga0207678_1000072310 | 416 |
| 453 | 3300026078 | Ga0207702_10084128 | Ga0207702_100841283 | 416 |
| 454 | 3300026089 | Ga0207648_10000084 | Ga0207648_1000008457 | 416 |
| 455 | 3300026089 | Ga0207648_10002133 | Ga0207648_100021335 | 416 |
| 456 | 3300026142 | Ga0207698_10003462 | Ga0207698_100034624 | 416 |
| 457 | 3300028380 | Ga0268265_10007983 | Ga0268265_100079835 | 416 |
| 458 | 3300028381 | Ga0268264_10010864 | Ga0268264_100108642 | 416 |
| 459 | 3300031824 | Ga0307413_10044149 | Ga0307413_100441492 | 416 |
| 460 | 3300031852 | Ga0307410_10000344 | Ga0307410_100003447 | 416 |
| 461 | 3300031901 | Ga0307406_10011939 | Ga0307406_100119393 | 416 |
| 462 | 3300031911 | Ga0307412_10021096 | Ga0307412_100210963 | 416 |
| 463 | 3300031995 | Ga0307409_100002352 | Ga0307409_1000023523 | 416 |
| 464 | 3300032002 | Ga0307416_100027476 | Ga0307416_1000274763 | 416 |
| 465 | 3300032004 | Ga0307414_10004490 | Ga0307414_100044904 | 416 |
| 466 | 3300032004 | Ga0307414_10041911 | Ga0307414_100419112 | 416 |
| 467 | 3300032005 | Ga0307411_10112684 | Ga0307411_101126841 | 416 |
| 468 | 3300032126 | Ga0307415_100005305 | Ga0307415_1000053054 | 416 |
| 469 | 3300037312 | Ga0395899_0001153 | Ga0395899_0001153_5056_6459 | 416 |
| 470 | 3300037471 | Ga0395905_0017945 | Ga0395905_0017945_1472_2875 | 416 |
| 471 | 3300039437 | Ga0436365_1058137 | Ga0436365_1058137_28387_29802 | 416 |
| 472 | 3300041404 | Ga0439436_0005769 | Ga0439436_0005769_1701_3116 | 416 |
| 473 | 3300041406 | Ga0439439_0013658 | Ga0439439_0013658_356_1771 | 416 |
| 474 | 3300041410 | Ga0439461_0000015 | Ga0439461_0000015_9741_11159 | 416 |
| 475 | 3300041413 | Ga0439465_0000240 | Ga0439465_0000240_7364_8782 | 416 |
| 476 | 3300041997 | Ga0439431_0000089 | Ga0439431_0000089_8671_10089 | 416 |
| 477 | 3300042004 | Ga0439445_0001011 | Ga0439445_0001011_2821_4239 | 416 |
| 478 | 3300042006 | Ga0439432_001016 | Ga0439432_001016_645_2063 | 416 |
| 479 | 3300042012 | Ga0439455_0000734 | Ga0439455_0000734_2928_4331 | 416 |
| 480 | 3300042012 | Ga0439455_0005821 | Ga0439455_0005821_207_1610 | 416 |
| 481 | 3300042014 | Ga0439457_005071 | Ga0439457_005071_1557_2972 | 416 |
| 482 | 3300042015 | Ga0439462_0001597 | Ga0439462_0001597_2145_3563 | 416 |
| 483 | 3300042015 | Ga0439462_0025685 | Ga0439462_0025685_86_1495 | 416 |
| 484 | 3300042156 | Ga0439446_0005043 | Ga0439446_0005043_198_1613 | 416 |
| 485 | 3300042435 | Ga0439434_0000049 | Ga0439434_0000049_16160_17578 | 416 |
| 486 | 3300042435 | Ga0439434_0011967 | Ga0439434_0011967_1076_2491 | 416 |
| 487 | 3300044658 | Ga0466972_0015501 | Ga0466972_0015501_2214_3617 | 416 |
| 488 | 3300044683 | Ga0466965_0006835 | Ga0466965_0006835_1050_2453 | 416 |
| 489 | 3300044693 | Ga0466961_0014915 | Ga0466961_0014915_1947_3350 | 416 |
| 490 | 3300044693 | Ga0466961_0045507 | Ga0466961_0045507_462_1886 | 416 |
| 491 | 3300044694 | Ga0466963_0034283 | Ga0466963_0034283_1094_2497 | 416 |
| 492 | 3300045049 | Ga0466959_0003186 | Ga0466959_0003186_6800_8203 | 416 |
| 493 | 3300045836 | Ga0466958_0003823 | Ga0466958_0003823_38_1441 | 416 |
| 494 | 3300046471 | Ga0495650_0000083 | Ga0495650_0000083_168206_169612 | 416 |
| 495 | 3300046506 | Ga0495583_0000351 | Ga0495583_0000351_66453_67859 | 416 |
| 496 | 3300046536 | Ga0495587_0017448 | Ga0495587_0017448_1580_2995 | 416 |
| 497 | 3300046537 | Ga0495598_0014638 | Ga0495598_0014638_425_1834 | 416 |
| 498 | 3300046557 | Ga0495622_0000745 | Ga0495622_0000745_11496_12911 | 416 |
| 499 | 3300046616 | Ga0495668_0014216 | Ga0495668_0014216_424_1869 | 416 |
| 500 | 3300046691 | Ga0495670_0000003 | Ga0495670_0000003_181968_183383 | 416 |
| 501 | 3300046809 | Ga0495600_0016538 | Ga0495600_0016538_2862_4277 | 416 |
| 502 | 3300047472 | Ga0495686_0017773 | Ga0495686_0017773_2508_3923 | 416 |
| 503 | 3300048917 | Ga0496114_0078383 | Ga0496114_0078383_613_2067 | 416 |
| 504 | 3300048921 | Ga0496118_0018893 | Ga0496118_0018893_124_1527 | 416 |
| 505 | 3300048921 | Ga0496118_0029306 | Ga0496118_0029306_2226_3629 | 416 |
| 506 | 3300048923 | Ga0496120_0059929 | Ga0496120_0059929_387_1790 | 416 |
| 507 | 3300048926 | Ga0496123_0039498 | Ga0496123_0039498_1828_3231 | 416 |
| 508 | 3300048927 | Ga0496124_0000817 | Ga0496124_0000817_19237_20643 | 416 |
| 509 | 3300048927 | Ga0496124_0002298 | Ga0496124_0002298_13137_14543 | 416 |
| 510 | 3300048928 | Ga0496125_0018732 | Ga0496125_0018732_1564_2967 | 416 |
| 511 | 3300048929 | Ga0496126_0000428 | Ga0496126_0000428_7229_8662 | 416 |
| 512 | 3300048929 | Ga0496126_0093798 | Ga0496126_0093798_10_1413 | 416 |
| 513 | 3300053094 | Ga0500566_0000788 | Ga0500566_0000788_15585_17000 | 416 |
| 514 | 3300053096 | Ga0500641_0013425 | Ga0500641_0013425_1461_2876 | 416 |
| 515 | 3300053108 | Ga0500562_014063 | Ga0500562_014063_217_1632 | 416 |
| 516 | 3300053119 | Ga0500595_001269 | Ga0500595_001269_10575_11990 | 416 |
| 517 | 3300053121 | Ga0500607_092075 | Ga0500607_092075_30_1445 | 416 |
| 518 | 3300053133 | Ga0500655_004136 | Ga0500655_004136_173_1576 | 416 |
| 519 | 3300053139 | Ga0500568_0018758 | Ga0500568_0018758_481_1896 | 416 |
| 520 | 3300053177 | Ga0500636_0004742 | Ga0500636_0004742_2544_3950 | 416 |
| 521 | 3300053730 | Ga0500645_001424 | Ga0500645_001424_9963_11378 | 416 |
| 522 | 3300061719 | Ga0466962_0000862 | Ga0466962_0000862_1503_2906 | 416 |
| 523 | iso_pu_bacteria | 2643221579 | 2643905952 | 416 |
| 524 | iso_pu_bacteria | 2643221622 | 2644128482 | 416 |
| 525 | iso_pu_bacteria | 2739367664 | 2739651435 | 416 |
| 526 | iso_pu_bacteria | 2739367865 | 2740029908 | 416 |
| 527 | iso_pu_bacteria | 2843744320 | 2843744573 | 416 |
| 528 | iso_pu_bacteria | 2849573788 | 2849575656 | 416 |
| 529 | iso_pu_bacteria | 2857504554 | 2857507152 | 416 |
| 530 | iso_pu_bacteria | 2896429255 | 2896429318 | 416 |
| 531 | iso_pu_bacteria | 8002869464 | 8002870106 | 416 |
| 532 | 3300001989 | JGI24739J22299_10000471 | JGI24739J22299_100004712 | 417 |
| 533 | 3300001990 | JGI24737J22298_10005103 | JGI24737J22298_100051032 | 417 |
| 534 | 3300001990 | JGI24737J22298_10005783 | JGI24737J22298_100057833 | 417 |
| 535 | 3300001990 | JGI24737J22298_10009895 | JGI24737J22298_100098952 | 417 |
| 536 | 3300001991 | JGI24743J22301_10000488 | JGI24743J22301_100004882 | 417 |
| 537 | 3300003215 | JGI25153J46596_10000006 | JGI25153J46596_1000000612 | 417 |
| 538 | 3300005262 | Ga0065165_1001878 | Ga0065165_10018786 | 417 |
| 539 | 3300005327 | Ga0070658_10000002 | Ga0070658_10000002442 | 417 |
| 540 | 3300005327 | Ga0070658_10012376 | Ga0070658_100123762 | 417 |
| 541 | 3300005327 | Ga0070658_10021972 | Ga0070658_100219723 | 417 |
| 542 | 3300005327 | Ga0070658_10081087 | Ga0070658_100810873 | 417 |
| 543 | 3300005329 | Ga0070683_100026592 | Ga0070683_1000265922 | 417 |
| 544 | 3300005331 | Ga0070670_100000539 | Ga0070670_10000053918 | 417 |
| 545 | 3300005331 | Ga0070670_100052103 | Ga0070670_1000521031 | 417 |
| 546 | 3300005334 | Ga0068869_100016693 | Ga0068869_1000166933 | 417 |
| 547 | 3300005335 | Ga0070666_10000317 | Ga0070666_100003175 | 417 |
| 548 | 3300005335 | Ga0070666_10001618 | Ga0070666_100016182 | 417 |
| 549 | 3300005335 | Ga0070666_10077527 | Ga0070666_100775272 | 417 |
| 550 | 3300005336 | Ga0070680_100000409 | Ga0070680_1000004099 | 417 |
| 551 | 3300005337 | Ga0070682_100067716 | Ga0070682_1000677162 | 417 |
| 552 | 3300005339 | Ga0070660_100000469 | Ga0070660_10000046913 | 417 |
| 553 | 3300005339 | Ga0070660_100008383 | Ga0070660_1000083832 | 417 |
| 554 | 3300005339 | Ga0070660_100010936 | Ga0070660_1000109363 | 417 |
| 555 | 3300005339 | Ga0070660_100013720 | Ga0070660_1000137204 | 417 |
| 556 | 3300005344 | Ga0070661_100000006 | Ga0070661_10000000665 | 417 |
| 557 | 3300005344 | Ga0070661_100001715 | Ga0070661_1000017159 | 417 |
| 558 | 3300005344 | Ga0070661_100015312 | Ga0070661_1000153121 | 417 |
| 559 | 3300005345 | Ga0070692_10000464 | Ga0070692_1000046410 | 417 |
| 560 | 3300005354 | Ga0070675_100019406 | Ga0070675_1000194062 | 417 |
| 561 | 3300005355 | Ga0070671_100002716 | Ga0070671_10000271618 | 417 |
| 562 | 3300005355 | Ga0070671_100009319 | Ga0070671_1000093191 | 417 |
| 563 | 3300005355 | Ga0070671_100016223 | Ga0070671_1000162233 | 417 |
| 564 | 3300005356 | Ga0070674_100005130 | Ga0070674_1000051306 | 417 |
| 565 | 3300005364 | Ga0070673_100002361 | Ga0070673_1000023613 | 417 |
| 566 | 3300005364 | Ga0070673_100030150 | Ga0070673_1000301503 | 417 |
| 567 | 3300005364 | Ga0070673_100044044 | Ga0070673_1000440443 | 417 |
| 568 | 3300005366 | Ga0070659_100004577 | Ga0070659_1000045773 | 417 |
| 569 | 3300005366 | Ga0070659_100007934 | Ga0070659_1000079342 | 417 |
| 570 | 3300005366 | Ga0070659_100075616 | Ga0070659_1000756162 | 417 |
| 571 | 3300005366 | Ga0070659_100128932 | Ga0070659_1001289322 | 417 |
| 572 | 3300005367 | Ga0070667_100001019 | Ga0070667_10000101914 | 417 |
| 573 | 3300005367 | Ga0070667_100010643 | Ga0070667_1000106432 | 417 |
| 574 | 3300005435 | Ga0070714_100239072 | Ga0070714_1002390721 | 417 |
| 575 | 3300005436 | Ga0070713_100005111 | Ga0070713_1000051115 | 417 |
| 576 | 3300005455 | Ga0070663_100025519 | Ga0070663_1000255193 | 417 |
| 577 | 3300005456 | Ga0070678_100031379 | Ga0070678_1000313792 | 417 |
| 578 | 3300005457 | Ga0070662_100002273 | Ga0070662_1000022736 | 417 |
| 579 | 3300005457 | Ga0070662_100023282 | Ga0070662_1000232823 | 417 |
| 580 | 3300005457 | Ga0070662_100043802 | Ga0070662_1000438022 | 417 |
| 581 | 3300005530 | Ga0070679_100009569 | Ga0070679_1000095696 | 417 |
| 582 | 3300005530 | Ga0070679_100146989 | Ga0070679_1001469892 | 417 |
| 583 | 3300005530 | Ga0070679_100244435 | Ga0070679_1002444351 | 417 |
| 584 | 3300005535 | Ga0070684_100003155 | Ga0070684_1000031552 | 417 |
| 585 | 3300005539 | Ga0068853_100041339 | Ga0068853_1000413393 | 417 |
| 586 | 3300005543 | Ga0070672_100010344 | Ga0070672_1000103444 | 417 |
| 587 | 3300005544 | Ga0070686_100000128 | Ga0070686_10000012817 | 417 |
| 588 | 3300005548 | Ga0070665_100000123 | Ga0070665_10000012328 | 417 |
| 589 | 3300005548 | Ga0070665_100002188 | Ga0070665_1000021882 | 417 |
| 590 | 3300005563 | Ga0068855_100016089 | Ga0068855_1000160891 | 417 |
| 591 | 3300005563 | Ga0068855_100018131 | Ga0068855_1000181312 | 417 |
| 592 | 3300005564 | Ga0070664_100000811 | Ga0070664_10000081110 | 417 |
| 593 | 3300005577 | Ga0068857_100001431 | Ga0068857_1000014313 | 417 |
| 594 | 3300005577 | Ga0068857_100002408 | Ga0068857_1000024083 | 417 |
| 595 | 3300005577 | Ga0068857_100106544 | Ga0068857_1001065442 | 417 |
| 596 | 3300005578 | Ga0068854_100045945 | Ga0068854_1000459452 | 417 |
| 597 | 3300005578 | Ga0068854_100092980 | Ga0068854_1000929802 | 417 |
| 598 | 3300005578 | Ga0068854_100101741 | Ga0068854_1001017412 | 417 |
| 599 | 3300005614 | Ga0068856_100241377 | Ga0068856_1002413772 | 417 |
| 600 | 3300005616 | Ga0068852_100000968 | Ga0068852_1000009683 | 417 |
| 601 | 3300005616 | Ga0068852_100129571 | Ga0068852_1001295712 | 417 |
| 602 | 3300005616 | Ga0068852_100146978 | Ga0068852_1001469782 | 417 |
| 603 | 3300005616 | Ga0068852_100188373 | Ga0068852_1001883731 | 417 |
| 604 | 3300005618 | Ga0068864_100005111 | Ga0068864_10000511110 | 417 |
| 605 | 3300005618 | Ga0068864_100007745 | Ga0068864_1000077452 | 417 |
| 606 | 3300005841 | Ga0068863_100001531 | Ga0068863_10000153114 | 417 |
| 607 | 3300005841 | Ga0068863_100005902 | Ga0068863_1000059023 | 417 |
| 608 | 3300005841 | Ga0068863_100107891 | Ga0068863_1001078912 | 417 |
| 609 | 3300005842 | Ga0068858_100001485 | Ga0068858_10000148510 | 417 |
| 610 | 3300005842 | Ga0068858_100008478 | Ga0068858_1000084781 | 417 |
| 611 | 3300005842 | Ga0068858_100192089 | Ga0068858_1001920892 | 417 |
| 612 | 3300005843 | Ga0068860_100120419 | Ga0068860_1001204192 | 417 |
| 613 | 3300005985 | Ga0081539_10031379 | Ga0081539_100313792 | 417 |
| 614 | 3300006028 | Ga0070717_10027825 | Ga0070717_100278253 | 417 |
| 615 | 3300006358 | Ga0068871_100027867 | Ga0068871_1000278673 | 417 |
| 616 | 3300006847 | Ga0075431_100031857 | Ga0075431_1000318572 | 417 |
| 617 | 3300006881 | Ga0068865_100047801 | Ga0068865_1000478012 | 417 |
| 618 | 3300009094 | Ga0111539_10264290 | Ga0111539_102642902 | 417 |
| 619 | 3300009098 | Ga0105245_10046500 | Ga0105245_100465003 | 417 |
| 620 | 3300009148 | Ga0105243_10083358 | Ga0105243_100833582 | 417 |
| 621 | 3300009176 | Ga0105242_10076374 | Ga0105242_100763741 | 417 |
| 622 | 3300011119 | Ga0105246_10035142 | Ga0105246_100351421 | 417 |
| 623 | 3300013100 | Ga0157373_10028129 | Ga0157373_100281293 | 417 |
| 624 | 3300013102 | Ga0157371_10004369 | Ga0157371_100043693 | 417 |
| 625 | 3300013105 | Ga0157369_10001381 | Ga0157369_1000138118 | 417 |
| 626 | 3300013306 | Ga0163162_10009616 | Ga0163162_100096164 | 417 |
| 627 | 3300013307 | Ga0157372_10006300 | Ga0157372_100063007 | 417 |
| 628 | 3300013308 | Ga0157375_10102974 | Ga0157375_101029742 | 417 |
| 629 | 3300013308 | Ga0157375_10190745 | Ga0157375_101907452 | 417 |
| 630 | 3300014325 | Ga0163163_10026418 | Ga0163163_100264184 | 417 |
| 631 | 3300014968 | Ga0157379_10126916 | Ga0157379_101269162 | 417 |
| 632 | 3300014969 | Ga0157376_10142341 | Ga0157376_101423412 | 417 |
| 633 | 3300021358 | Ga0213873_10000006 | Ga0213873_10000006117 | 417 |
| 634 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004623 | 417 |
| 635 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011814 | 417 |
| 636 | 3300025903 | Ga0207680_10000146 | Ga0207680_100001469 | 417 |
| 637 | 3300025903 | Ga0207680_10016584 | Ga0207680_100165842 | 417 |
| 638 | 3300025903 | Ga0207680_10040712 | Ga0207680_100407121 | 417 |
| 639 | 3300025904 | Ga0207647_10002600 | Ga0207647_100026007 | 417 |
| 640 | 3300025904 | Ga0207647_10008931 | Ga0207647_100089312 | 417 |
| 641 | 3300025904 | Ga0207647_10018563 | Ga0207647_100185633 | 417 |
| 642 | 3300025909 | Ga0207705_10000008 | Ga0207705_10000008349 | 417 |
| 643 | 3300025909 | Ga0207705_10000096 | Ga0207705_1000009650 | 417 |
| 644 | 3300025909 | Ga0207705_10002489 | Ga0207705_1000248910 | 417 |
| 645 | 3300025909 | Ga0207705_10014833 | Ga0207705_100148333 | 417 |
| 646 | 3300025909 | Ga0207705_10027202 | Ga0207705_100272022 | 417 |
| 647 | 3300025909 | Ga0207705_10065423 | Ga0207705_100654232 | 417 |
| 648 | 3300025909 | Ga0207705_10105185 | Ga0207705_101051852 | 417 |
| 649 | 3300025909 | Ga0207705_10198847 | Ga0207705_101988471 | 417 |
| 650 | 3300025909 | Ga0207705_10201488 | Ga0207705_102014881 | 417 |
| 651 | 3300025913 | Ga0207695_10020117 | Ga0207695_100201174 | 417 |
| 652 | 3300025917 | Ga0207660_10000281 | Ga0207660_1000028120 | 417 |
| 653 | 3300025917 | Ga0207660_10016391 | Ga0207660_100163912 | 417 |
| 654 | 3300025917 | Ga0207660_10076546 | Ga0207660_100765462 | 417 |
| 655 | 3300025919 | Ga0207657_10007434 | Ga0207657_100074347 | 417 |
| 656 | 3300025919 | Ga0207657_10012059 | Ga0207657_100120594 | 417 |
| 657 | 3300025919 | Ga0207657_10026275 | Ga0207657_100262752 | 417 |
| 658 | 3300025919 | Ga0207657_10026961 | Ga0207657_100269612 | 417 |
| 659 | 3300025919 | Ga0207657_10033965 | Ga0207657_100339653 | 417 |
| 660 | 3300025919 | Ga0207657_10066554 | Ga0207657_100665543 | 417 |
| 661 | 3300025920 | Ga0207649_10000058 | Ga0207649_1000005868 | 417 |
| 662 | 3300025920 | Ga0207649_10006083 | Ga0207649_100060832 | 417 |
| 663 | 3300025920 | Ga0207649_10014623 | Ga0207649_100146233 | 417 |
| 664 | 3300025920 | Ga0207649_10038795 | Ga0207649_100387952 | 417 |
| 665 | 3300025920 | Ga0207649_10062053 | Ga0207649_100620532 | 417 |
| 666 | 3300025921 | Ga0207652_10005962 | Ga0207652_100059627 | 417 |
| 667 | 3300025921 | Ga0207652_10020011 | Ga0207652_100200112 | 417 |
| 668 | 3300025921 | Ga0207652_10027153 | Ga0207652_100271533 | 417 |
| 669 | 3300025924 | Ga0207694_10108870 | Ga0207694_101088702 | 417 |
| 670 | 3300025925 | Ga0207650_10026483 | Ga0207650_100264833 | 417 |
| 671 | 3300025926 | Ga0207659_10022052 | Ga0207659_100220522 | 417 |
| 672 | 3300025929 | Ga0207664_10080006 | Ga0207664_100800062 | 417 |
| 673 | 3300025931 | Ga0207644_10001983 | Ga0207644_100019832 | 417 |
| 674 | 3300025931 | Ga0207644_10005102 | Ga0207644_100051022 | 417 |
| 675 | 3300025931 | Ga0207644_10017258 | Ga0207644_100172582 | 417 |
| 676 | 3300025931 | Ga0207644_10108669 | Ga0207644_101086692 | 417 |
| 677 | 3300025932 | Ga0207690_10006289 | Ga0207690_100062893 | 417 |
| 678 | 3300025932 | Ga0207690_10043130 | Ga0207690_100431302 | 417 |
| 679 | 3300025932 | Ga0207690_10083913 | Ga0207690_100839132 | 417 |
| 680 | 3300025933 | Ga0207706_10005164 | Ga0207706_100051646 | 417 |
| 681 | 3300025933 | Ga0207706_10024573 | Ga0207706_100245732 | 417 |
| 682 | 3300025937 | Ga0207669_10007965 | Ga0207669_100079653 | 417 |
| 683 | 3300025938 | Ga0207704_10031621 | Ga0207704_100316212 | 417 |
| 684 | 3300025938 | Ga0207704_10036648 | Ga0207704_100366481 | 417 |
| 685 | 3300025940 | Ga0207691_10004514 | Ga0207691_100045144 | 417 |
| 686 | 3300025940 | Ga0207691_10044587 | Ga0207691_100445874 | 417 |
| 687 | 3300025941 | Ga0207711_10000047 | Ga0207711_10000047128 | 417 |
| 688 | 3300025941 | Ga0207711_10000055 | Ga0207711_1000005528 | 417 |
| 689 | 3300025942 | Ga0207689_10005187 | Ga0207689_100051877 | 417 |
| 690 | 3300025944 | Ga0207661_10014773 | Ga0207661_100147732 | 417 |
| 691 | 3300025944 | Ga0207661_10026409 | Ga0207661_100264094 | 417 |
| 692 | 3300025945 | Ga0207679_10086166 | Ga0207679_100861662 | 417 |
| 693 | 3300025949 | Ga0207667_10019369 | Ga0207667_100193693 | 417 |
| 694 | 3300025960 | Ga0207651_10004624 | Ga0207651_100046244 | 417 |
| 695 | 3300025960 | Ga0207651_10026085 | Ga0207651_100260853 | 417 |
| 696 | 3300025981 | Ga0207640_10016281 | Ga0207640_100162813 | 417 |
| 697 | 3300025981 | Ga0207640_10095104 | Ga0207640_100951042 | 417 |
| 698 | 3300025986 | Ga0207658_10029705 | Ga0207658_100297052 | 417 |
| 699 | 3300025986 | Ga0207658_10068577 | Ga0207658_100685772 | 417 |
| 700 | 3300026023 | Ga0207677_10000268 | Ga0207677_1000026823 | 417 |
| 701 | 3300026023 | Ga0207677_10004212 | Ga0207677_100042124 | 417 |
| 702 | 3300026023 | Ga0207677_10004573 | Ga0207677_100045734 | 417 |
| 703 | 3300026035 | Ga0207703_10001319 | Ga0207703_1000131910 | 417 |
| 704 | 3300026035 | Ga0207703_10001416 | Ga0207703_1000141611 | 417 |
| 705 | 3300026041 | Ga0207639_10023392 | Ga0207639_100233922 | 417 |
| 706 | 3300026067 | Ga0207678_10007111 | Ga0207678_100071113 | 417 |
| 707 | 3300026067 | Ga0207678_10048579 | Ga0207678_100485792 | 417 |
| 708 | 3300026067 | Ga0207678_10050950 | Ga0207678_100509502 | 417 |
| 709 | 3300026078 | Ga0207702_10017845 | Ga0207702_100178454 | 417 |
| 710 | 3300026078 | Ga0207702_10087415 | Ga0207702_100874151 | 417 |
| 711 | 3300026078 | Ga0207702_10201994 | Ga0207702_102019941 | 417 |
| 712 | 3300026078 | Ga0207702_10221941 | Ga0207702_102219412 | 417 |
| 713 | 3300026088 | Ga0207641_10006890 | Ga0207641_100068903 | 417 |
| 714 | 3300026088 | Ga0207641_10033244 | Ga0207641_100332443 | 417 |
| 715 | 3300026088 | Ga0207641_10098395 | Ga0207641_100983952 | 417 |
| 716 | 3300026088 | Ga0207641_10182843 | Ga0207641_101828432 | 417 |
| 717 | 3300026089 | Ga0207648_10002612 | Ga0207648_100026122 | 417 |
| 718 | 3300026089 | Ga0207648_10007899 | Ga0207648_100078995 | 417 |
| 719 | 3300026095 | Ga0207676_10001627 | Ga0207676_1000162715 | 417 |
| 720 | 3300026116 | Ga0207674_10000324 | Ga0207674_1000032421 | 417 |
| 721 | 3300026116 | Ga0207674_10002832 | Ga0207674_100028329 | 417 |
| 722 | 3300026116 | Ga0207674_10036251 | Ga0207674_100362512 | 417 |
| 723 | 3300026116 | Ga0207674_10108811 | Ga0207674_101088112 | 417 |
| 724 | 3300026121 | Ga0207683_10009065 | Ga0207683_100090654 | 417 |
| 725 | 3300026121 | Ga0207683_10035180 | Ga0207683_100351803 | 417 |
| 726 | 3300026142 | Ga0207698_10002973 | Ga0207698_100029736 | 417 |
| 727 | 3300026142 | Ga0207698_10042168 | Ga0207698_100421682 | 417 |
| 728 | 3300028379 | Ga0268266_10000262 | Ga0268266_1000026230 | 417 |
| 729 | 3300028379 | Ga0268266_10004783 | Ga0268266_100047836 | 417 |
| 730 | 3300028379 | Ga0268266_10079967 | Ga0268266_100799672 | 417 |
| 731 | 3300031731 | Ga0307405_10002622 | Ga0307405_100026222 | 417 |
| 732 | 3300031824 | Ga0307413_10001788 | Ga0307413_100017883 | 417 |
| 733 | 3300031852 | Ga0307410_10000189 | Ga0307410_100001894 | 417 |
| 734 | 3300031903 | Ga0307407_10000110 | Ga0307407_100001106 | 417 |
| 735 | 3300031995 | Ga0307409_100000222 | Ga0307409_1000002227 | 417 |
| 736 | 3300032004 | Ga0307414_10000801 | Ga0307414_100008017 | 417 |
| 737 | 3300032005 | Ga0307411_10000098 | Ga0307411_100000987 | 417 |
| 738 | 3300032126 | Ga0307415_100017355 | Ga0307415_1000173553 | 417 |
| 739 | 3300035170 | Ga0373943_0007056 | Ga0373943_0007056_1240_2661 | 417 |
| 740 | 3300037068 | Ga0373925_0083063 | Ga0373925_0083063_633_2054 | 417 |
| 741 | 3300037312 | Ga0395899_0015175 | Ga0395899_0015175_3824_5266 | 417 |
| 742 | 3300037312 | Ga0395899_0040477 | Ga0395899_0040477_1531_2961 | 417 |
| 743 | 3300037312 | Ga0395899_0051958 | Ga0395899_0051958_406_1833 | 417 |
| 744 | 3300037312 | Ga0395899_0079032 | Ga0395899_0079032_949_2376 | 417 |
| 745 | 3300037312 | Ga0395899_0087340 | Ga0395899_0087340_744_2177 | 417 |
| 746 | 3300037312 | Ga0395899_0110216 | Ga0395899_0110216_52_1473 | 417 |
| 747 | 3300037418 | Ga0395900_0031874 | Ga0395900_0031874_2583_3992 | 417 |
| 748 | 3300037418 | Ga0395900_0057745 | Ga0395900_0057745_2422_3864 | 417 |
| 749 | 3300037418 | Ga0395900_0146981 | Ga0395900_0146981_259_1686 | 417 |
| 750 | 3300037418 | Ga0395900_0148665 | Ga0395900_0148665_605_2044 | 417 |
| 751 | 3300037466 | Ga0395898_0019495 | Ga0395898_0019495_4595_6034 | 417 |
| 752 | 3300037466 | Ga0395898_0039431 | Ga0395898_0039431_2771_4180 | 417 |
| 753 | 3300037466 | Ga0395898_0091024 | Ga0395898_0091024_1360_2787 | 417 |
| 754 | 3300037466 | Ga0395898_0091503 | Ga0395898_0091503_21_1448 | 417 |
| 755 | 3300037466 | Ga0395898_0243140 | Ga0395898_0243140_191_1633 | 417 |
| 756 | 3300037471 | Ga0395905_0010941 | Ga0395905_0010941_5588_7009 | 417 |
| 757 | 3300037471 | Ga0395905_0017221 | Ga0395905_0017221_5233_6657 | 417 |
| 758 | 3300037471 | Ga0395905_0029097 | Ga0395905_0029097_2246_3676 | 417 |
| 759 | 3300037471 | Ga0395905_0066713 | Ga0395905_0066713_1251_2660 | 417 |
| 760 | 3300037471 | Ga0395905_0085798 | Ga0395905_0085798_24_1433 | 417 |
| 761 | 3300037471 | Ga0395905_0094585 | Ga0395905_0094585_640_2079 | 417 |
| 762 | 3300037471 | Ga0395905_0096056 | Ga0395905_0096056_948_2357 | 417 |
| 763 | 3300037471 | Ga0395905_0115708 | Ga0395905_0115708_1021_2448 | 417 |
| 764 | 3300037471 | Ga0395905_0127673 | Ga0395905_0127673_887_2296 | 417 |
| 765 | 3300037471 | Ga0395905_0165506 | Ga0395905_0165506_215_1654 | 417 |
| 766 | 3300037471 | Ga0395905_0190283 | Ga0395905_0190283_206_1615 | 417 |
| 767 | 3300037853 | Ga0436364_0322741 | Ga0436364_0322741_7443_8882 | 417 |
| 768 | 3300038443 | Ga0395901_0002032 | Ga0395901_0002032_16725_18155 | 417 |
| 769 | 3300038443 | Ga0395901_0014089 | Ga0395901_0014089_2753_4174 | 417 |
| 770 | 3300038443 | Ga0395901_0018693 | Ga0395901_0018693_1918_3345 | 417 |
| 771 | 3300038443 | Ga0395901_0023927 | Ga0395901_0023927_929_2356 | 417 |
| 772 | 3300038443 | Ga0395901_0045429 | Ga0395901_0045429_2052_3479 | 417 |
| 773 | 3300038443 | Ga0395901_0058906 | Ga0395901_0058906_132_1574 | 417 |
| 774 | 3300038443 | Ga0395901_0095651 | Ga0395901_0095651_1225_2664 | 417 |
| 775 | 3300038443 | Ga0395901_0102178 | Ga0395901_0102178_590_2023 | 417 |
| 776 | 3300038443 | Ga0395901_0126271 | Ga0395901_0126271_1077_2486 | 417 |
| 777 | 3300038443 | Ga0395901_0166357 | Ga0395901_0166357_173_1603 | 417 |
| 778 | 3300038443 | Ga0395901_0206571 | Ga0395901_0206571_145_1554 | 417 |
| 779 | 3300038443 | Ga0395901_0217784 | Ga0395901_0217784_495_1934 | 417 |
| 780 | 3300039437 | Ga0436365_0862833 | Ga0436365_0862833_3566_5020 | 417 |
| 781 | 3300039437 | Ga0436365_1289842 | Ga0436365_1289842_2954_4381 | 417 |
| 782 | 3300039453 | Ga0436362_0554113 | Ga0436362_0554113_10447_11901 | 417 |
| 783 | 3300042005 | Ga0439448_0010647 | Ga0439448_0010647_240_1649 | 417 |
| 784 | 3300042157 | Ga0439458_0001070 | Ga0439458_0001070_1866_3275 | 417 |
| 785 | 3300044656 | Ga0466969_0018424 | Ga0466969_0018424_896_2317 | 417 |
| 786 | 3300044684 | Ga0466966_0000001 | Ga0466966_0000001_81755_83173 | 417 |
| 787 | 3300044684 | Ga0466966_0022066 | Ga0466966_0022066_1045_2466 | 417 |
| 788 | 3300044684 | Ga0466966_0078859 | Ga0466966_0078859_436_1857 | 417 |
| 789 | 3300044693 | Ga0466961_0085861 | Ga0466961_0085861_535_1959 | 417 |
| 790 | 3300044694 | Ga0466963_0015391 | Ga0466963_0015391_79_1500 | 417 |
| 791 | 3300044694 | Ga0466963_0066888 | Ga0466963_0066888_365_1789 | 417 |
| 792 | 3300044719 | Ga0466971_0002712 | Ga0466971_0002712_5956_7377 | 417 |
| 793 | 3300044735 | Ga0466968_0001227 | Ga0466968_0001227_5712_7133 | 417 |
| 794 | 3300044765 | Ga0466970_0012832 | Ga0466970_0012832_2102_3523 | 417 |
| 795 | 3300044765 | Ga0466970_0014513 | Ga0466970_0014513_721_2142 | 417 |
| 796 | 3300044765 | Ga0466970_0072803 | Ga0466970_0072803_180_1601 | 417 |
| 797 | 3300044842 | Ga0466957_0044557 | Ga0466957_0044557_39_1463 | 417 |
| 798 | 3300044842 | Ga0466957_0058337 | Ga0466957_0058337_356_1777 | 417 |
| 799 | 3300044842 | Ga0466957_0147613 | Ga0466957_0147613_52_1476 | 417 |
| 800 | 3300044901 | Ga0466960_0024108 | Ga0466960_0024108_371_1795 | 417 |
| 801 | 3300045049 | Ga0466959_0020078 | Ga0466959_0020078_1925_3346 | 417 |
| 802 | 3300045051 | Ga0451576_0000122 | Ga0451576_0000122_142519_143940 | 417 |
| 803 | 3300045976 | Ga0466967_0005507 | Ga0466967_0005507_2402_3835 | 417 |
| 804 | 3300045976 | Ga0466967_0017259 | Ga0466967_0017259_3464_4885 | 417 |
| 805 | 3300046537 | Ga0495598_0003551 | Ga0495598_0003551_998_2422 | 417 |
| 806 | 3300046539 | Ga0495621_0000236 | Ga0495621_0000236_4451_5875 | 417 |
| 807 | 3300046684 | Ga0495669_0005168 | Ga0495669_0005168_2395_3819 | 417 |
| 808 | 3300046691 | Ga0495670_0007460 | Ga0495670_0007460_2940_4364 | 417 |
| 809 | 3300046691 | Ga0495670_0017915 | Ga0495670_0017915_1299_2702 | 417 |
| 810 | 3300047443 | Ga0495687_000973 | Ga0495687_000973_13546_14976 | 417 |
| 811 | 3300048904 | Ga0496101_0003459 | Ga0496101_0003459_4187_5614 | 417 |
| 812 | 3300048905 | Ga0496102_0062683 | Ga0496102_0062683_1681_3108 | 417 |
| 813 | 3300048907 | Ga0496104_0029517 | Ga0496104_0029517_116_1543 | 417 |
| 814 | 3300048909 | Ga0496106_0049050 | Ga0496106_0049050_749_2176 | 417 |
| 815 | 3300048910 | Ga0496107_0001705 | Ga0496107_0001705_9646_11070 | 417 |
| 816 | 3300048911 | Ga0496108_0059920 | Ga0496108_0059920_1561_2988 | 417 |
| 817 | 3300048912 | Ga0496109_0000617 | Ga0496109_0000617_25787_27211 | 417 |
| 818 | 3300048913 | Ga0496110_0003274 | Ga0496110_0003274_7248_8672 | 417 |
| 819 | 3300048913 | Ga0496110_0111650 | Ga0496110_0111650_235_1662 | 417 |
| 820 | 3300048914 | Ga0496111_0009315 | Ga0496111_0009315_2845_4269 | 417 |
| 821 | 3300048914 | Ga0496111_0090034 | Ga0496111_0090034_359_1783 | 417 |
| 822 | 3300048915 | Ga0496112_0000133 | Ga0496112_0000133_4184_5608 | 417 |
| 823 | 3300048916 | Ga0496113_0011396 | Ga0496113_0011396_3819_5243 | 417 |
| 824 | 3300048916 | Ga0496113_0078648 | Ga0496113_0078648_792_2219 | 417 |
| 825 | 3300049571 | Ga0501034_0191477 | Ga0501034_0191477_180_1607 | 417 |
| 826 | 3300050510 | nmdc:mga06r32_4573_c1 | nmdc:mga06r32_4573_c1_8128_9534 | 417 |
| 827 | 3300053139 | Ga0500568_0005719 | Ga0500568_0005719_4430_5878 | 417 |
| 828 | 3300005985 | Ga0081539_10018358 | Ga0081539_100183585 | 418 |
| 829 | 3300025299 | Ga0209256_1004121 | Ga0209256_10041217 | 418 |
| 830 | 3300046460 | Ga0495638_0000440 | Ga0495638_0000440_28002_29402 | 418 |
| 831 | 3300046471 | Ga0495650_0000068 | Ga0495650_0000068_99_1499 | 418 |
| 832 | 3300046520 | Ga0495637_0015019 | Ga0495637_0015019_1928_3328 | 418 |
| 833 | 3300046524 | Ga0495648_0003568 | Ga0495648_0003568_1867_3267 | 418 |
| 834 | 3300046525 | Ga0495663_0016170 | Ga0495663_0016170_22_1422 | 418 |
| 835 | 3300046530 | Ga0495654_0000042 | Ga0495654_0000042_39900_41300 | 418 |
| 836 | 3300046660 | Ga0495625_0041223 | Ga0495625_0041223_943_2343 | 418 |
| 837 | 3300046694 | Ga0495649_0000092 | Ga0495649_0000092_65417_66850 | 418 |
| 838 | 3300047320 | Ga0495672_0005693 | Ga0495672_0005693_8291_9691 | 418 |
| 839 | 3300047469 | Ga0495673_0017813 | Ga0495673_0017813_253_1653 | 418 |
| 840 | 3300048927 | Ga0496124_0019689 | Ga0496124_0019689_1234_2634 | 418 |
| 841 | 3300048929 | Ga0496126_0009898 | Ga0496126_0009898_8592_9992 | 418 |
| 842 | 3300053088 | Ga0500644_0000738 | Ga0500644_0000738_6598_7998 | 418 |
| 843 | 3300053104 | Ga0500556_0001960 | Ga0500556_0001960_2442_3842 | 418 |
| 844 | 3300053136 | Ga0500559_0000412 | Ga0500559_0000412_22067_23467 | 418 |
| 845 | 3300053138 | Ga0500564_002850 | Ga0500564_002850_1936_3336 | 418 |
| 846 | 3300053151 | Ga0500604_0000021 | Ga0500604_0000021_31191_32642 | 418 |
| 847 | 3300053153 | Ga0500616_0009393 | Ga0500616_0009393_3175_4575 | 418 |
| 848 | 3300053156 | Ga0500622_0087674 | Ga0500622_0087674_29_1462 | 418 |
| 849 | 3300053158 | Ga0500627_0015259 | Ga0500627_0015259_221_1621 | 418 |
| 850 | 3300053730 | Ga0500645_004093 | Ga0500645_004093_2776_4176 | 418 |
| 851 | iso_pu_bacteria | 2582581279 | 2585147647 | 418 |
| 852 | iso_pu_bacteria | 2791355048 | 2792460479 | 418 |
| 853 | iso_pu_bacteria | 2849560528 | 2849565541 | 418 |
| 854 | iso_pu_bacteria | 2851153111 | 2851153255 | 418 |
| 855 | iso_pu_bacteria | 2884960567 | 2884961854 | 418 |
| 856 | iso_pu_bacteria | 2898329390 | 2898331719 | 418 |
| 857 | 3300005366 | Ga0070659_100034542 | Ga0070659_1000345423 | 419 |
| 858 | 3300005617 | Ga0068859_100033133 | Ga0068859_1000331333 | 419 |
| 859 | 3300006931 | Ga0097620_100033133 | Ga0097620_1000331333 | 419 |
| 860 | 3300026075 | Ga0207708_10050546 | Ga0207708_100505462 | 419 |
| 861 | 3300046506 | Ga0495583_0000696 | Ga0495583_0000696_14718_16130 | 419 |
| 862 | 3300053103 | Ga0500555_000086 | Ga0500555_000086_13613_15025 | 419 |
| 863 | iso_pu_bacteria | 2643221699 | 2644552196 | 419 |
| 864 | iso_pu_bacteria | 2775507255 | 2778123639 | 419 |
| 865 | iso_pu_bacteria | 2808606401 | 2809061991 | 419 |
| 866 | iso_pu_bacteria | 2852680915 | 2852684510 | 419 |
| 867 | 3300009093 | Ga0105240_10025879 | Ga0105240_100258795 | 420 |
| 868 | 3300032004 | Ga0307414_10062749 | Ga0307414_100627492 | 420 |
| 869 | 3300046460 | Ga0495638_0016451 | Ga0495638_0016451_1557_2963 | 420 |
| 870 | 3300046524 | Ga0495648_0055353 | Ga0495648_0055353_78_1487 | 420 |
| 871 | 3300048920 | Ga0496117_0037622 | Ga0496117_0037622_249_1667 | 420 |
| 872 | iso_pu_bacteria | 2946787523 | 2946788976 | 420 |
| 873 | iso_pu_bacteria | 2585428106 | 2587917597 | 421 |
| 874 | 3300003214 | JGI25165J46597_1000138 | JGI25165J46597_100013894 | 422 |
| 875 | 3300025261 | Ga0209233_1000182 | Ga0209233_1000182103 | 422 |
| 876 | 2162886007 | SwRhRL2b_contig_1372803 | SwRhRL2b_0969.00010520 | 423 |
| 877 | 3300005289 | Ga0065704_10005955 | Ga0065704_100059555 | 423 |
| 878 | 3300006051 | Ga0075364_10040415 | Ga0075364_100404152 | 423 |
| 879 | 3300009101 | Ga0105247_10002615 | Ga0105247_100026159 | 423 |
| 880 | 3300028800 | Ga0265338_10044028 | Ga0265338_100440283 | 423 |
| 881 | 3300046512 | Ga0495610_0000131 | Ga0495610_0000131_59878_61290 | 423 |
| 882 | 3300048911 | Ga0496108_0000315 | Ga0496108_0000315_7355_8767 | 423 |
| 883 | 3300048924 | Ga0496121_0000714 | Ga0496121_0000714_31206_32618 | 423 |
| 884 | 3300048928 | Ga0496125_0021737 | Ga0496125_0021737_2467_3879 | 423 |
| 885 | 3300048929 | Ga0496126_0021811 | Ga0496126_0021811_2147_3559 | 423 |
| 886 | 3300053157 | Ga0500624_000101 | Ga0500624_000101_32082_33497 | 423 |
| 887 | iso_pu_bacteria | 2990265787 | 2990266822 | 423 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lds-assembly1.cif.gz_A | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.824 | 17 | 415 |
| 4yb9-assembly1.cif.gz_D | crystal structure of the bovine fructose transporter glut5 in an open inward-facing conformation | 0.8229 | 18 | 412 |
| 4gby-assembly1.cif.gz_A | the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose | 0.8179 | 10 | 421 |
| 4ja3-assembly2.cif.gz_B | partially occluded inward open conformation of the xylose transporter xyle from e. coli | 0.8088 | 12 | 417 |
| 6rw3-assembly1.cif.gz_A | the molecular basis for sugar import in malaria parasites. | 0.8073 | 14 | 417 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54UC8_260_478_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9146 | 221 | 414 | 1.20.1250.20 |
| af_Q54YF6_394_628_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8988 | 206 | 421 | 1.20.1250.20 |
| af_K7K432_481_729_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8978 | 209 | 421 | 1.20.1250.20 |
| af_C7J4X0_2_217_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8959 | 231 | 421 | 1.20.1250.20 |
| af_C0PE06_523_755_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8909 | 230 | 421 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S0J6I8-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.8933 | 215 | 421 |
GO:0016020
GO:0022857 |
| AF-A0A842H0Q1-F1-model_v4 | deleted | 0.8834 | 14 | 421 |
|
| AF-X1DEU3-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.8824 | 149 | 414 |
GO:0016020
GO:0022857 GO:1904659 |
| AF-A0A642UL38-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.876 | 13 | 421 |
GO:0015791
GO:0015798 GO:0016020 GO:0022857 |
| AF-A0A0A2L2V9-F1-model_v4 | Major facilitator superfamily domain, general substrate transporter | 0.8671 | 13 | 421 |
GO:0015791
GO:0015798 GO:0016020 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar