F484718

General Info

Members Datasets Scaffolds Average Seq Length
887 368 856 463

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100034542|Ga0070659_1000345423
Length 496
Sequence MTRARRGWGEDIMSNTRNGVNMALISAIVAVATIGGLLFGYDSGAVNGTQTGLTAEFDLTPASLGFTVGSLLIGCAFGAALAGRLADVMGRRNVMLVAAALFVAGALTQGLTHDHTIFVIARFFGGMAVGAASVLSPLYISEVAPANIRGRLTTVQQVMIITGLTAAFVVNYFVANAAGDSLGELAGVKAWRWMYLAQALPAVVFLIALFFIPESPRFLVSKGRKAEALKVLTSLFGSAEAERKVGEIQASFADDHRPRLSDVTAPGTVFRPIVWAGLLLATFQQFVGINIIFYYGETLWKLAGVSESAALERNVVSGLVSIAAVFAAILLIDKIGRKPLLLIGSVGMAVTLGAMTWAFSAAGTDAAGNLMLAPTQGWVALVAANLYVIFFNFSWGPVMWVMLGEMFPNQIRGSALAVAGFAQWAANFLVVQIFPWMADSLGLAATYAFYTASAVISFFLVRAFIKETKGKELEEMEGWTAPAAAGDAEVATTKLS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
6 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
7 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
8 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
9 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
10 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
11 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
12 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
15 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
16 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
17 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
18 2849560528 Caulobacter zeae 410 Isolate Unclassified
19 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
20 2851153111 Caulobacter radicis 736 Isolate Unclassified
21 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
22 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
23 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
24 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
25 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
26 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
27 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
28 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
29 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
30 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
31 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
32 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
33 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
34 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
35 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
36 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
37 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
38 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
47 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
63 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
75 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
213 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
218 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
229 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
256 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
257 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
258 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
259 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
260 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
261 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
262 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
263 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
264 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
265 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
266 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
267 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
268 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
269 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
270 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
273 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
274 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
275 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
276 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
277 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
278 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
279 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
280 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
281 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
282 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
291 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
294 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
297 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
300 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
310 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
330 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
340 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
341 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
342 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
343 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
344 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
347 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
348 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
349 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
350 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
351 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
352 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
353 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
354 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
355 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
356 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
357 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
358 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
359 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
360 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
361 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
362 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
363 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
364 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
365 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
366 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
367 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
368 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 0.11
Isolates 3.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 11.05
Nodule 0
Rhizoplane 3.27
Rhizosphere 80.16
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1372803 2162886007 Bacteria 5865
2 JGI24736J21556_1000754 3300001904 Bacteria 5922
3 JGI24736J21556_1002528 3300001904 Bacteria 3230
4 JGI24740J21852_10021675 3300001979 Bacteria 2224
5 JGI24739J22299_10000471 3300001989 Bacteria 14184
6 JGI24737J22298_10001146 3300001990 Bacteria 9321
7 JGI24737J22298_10002102 3300001990 Bacteria 7108
8 JGI24737J22298_10005103 3300001990 Bacteria 4544
9 JGI24737J22298_10005783 3300001990 Bacteria 4260
10 JGI24737J22298_10009895 3300001990 Bacteria 3156
11 JGI24737J22298_10021942 3300001990 Bacteria 2030
12 JGI24743J22301_10000488 3300001991 Bacteria 4591
13 JGI24738J21930_10001044 3300002075 Bacteria 7893
14 JGI24738J21930_10010652 3300002075 Bacteria 2041
15 JGI25165J46597_1000106 3300003214 Bacteria 151139
16 JGI25165J46597_1000138 3300003214 Bacteria 121773
17 JGI25153J46596_10000006 3300003215 Bacteria 447760
18 JGI25153J46596_10000260 3300003215 Bacteria 42298
19 JGI25153J46596_10008006 3300003215 Bacteria 5112
20 Ga0055542_1004480 3300003762 Bacteria 3381
21 Ga0055537_1000161 3300003773 Bacteria 50226
22 Ga0055537_1001708 3300003773 Bacteria 8119
23 Ga0055537_1008784 3300003773 Bacteria 2291
24 Ga0055524_1000110 3300003775 Bacteria 99255
25 Ga0055536_1001906 3300003781 Bacteria 12089
26 Ga0055536_1002035 3300003781 Bacteria 11584
27 Ga0055536_1005768 3300003781 Bacteria 5965
28 Ga0055536_1018772 3300003781 Bacteria 2201
29 Ga0055528_1004276 3300003790 Bacteria 6909
30 Ga0055530_10000074 3300003791 Bacteria 85116
31 Ga0055530_10000579 3300003791 Bacteria 31675
32 Ga0055530_10002421 3300003791 Bacteria 12077
33 Ga0055530_10008021 3300003791 Bacteria 4309
34 Ga0055540_1000943 3300003792 Bacteria 18909
35 Ga0055531_10000374 3300003794 Bacteria 43198
36 Ga0055531_10002640 3300003794 Bacteria 11857
37 Ga0055531_10003045 3300003794 Bacteria 10862
38 Ga0055531_10003351 3300003794 Bacteria 10242
39 Ga0065165_1000459 3300005262 Bacteria 63870
40 Ga0065165_1001720 3300005262 Bacteria 21926
41 Ga0065165_1001878 3300005262 Bacteria 20322
42 Ga0065165_1008312 3300005262 Bacteria 4888
43 Ga0065704_10005955 3300005289 Bacteria 5174
44 Ga0065704_10070205 3300005289 Bacteria 83747
45 Ga0070658_10000002 3300005327 Bacteria 637290
46 Ga0070658_10000262 3300005327 Bacteria 46229
47 Ga0070658_10002456 3300005327 Bacteria 15507
48 Ga0070658_10007785 3300005327 Bacteria 8636
49 Ga0070658_10012376 3300005327 Bacteria 6850
50 Ga0070658_10014970 3300005327 Bacteria 6208
51 Ga0070658_10021972 3300005327 Bacteria 5117
52 Ga0070658_10071614 3300005327 Bacteria 2839
53 Ga0070658_10081087 3300005327 Bacteria 2665
54 Ga0070676_10000052 3300005328 Bacteria 37236
55 Ga0070676_10000442 3300005328 Bacteria 19744
56 Ga0070676_10030693 3300005328 Bacteria 3067
57 Ga0070676_10066819 3300005328 Bacteria 2149
58 Ga0070676_10069457 3300005328 Bacteria 2111
59 Ga0070683_100026592 3300005329 Bacteria 5213
60 Ga0070683_100091902 3300005329 Bacteria 2850
61 Ga0070683_100139833 3300005329 Bacteria 2294
62 Ga0070690_100002605 3300005330 Bacteria 9721
63 Ga0070690_100023434 3300005330 Bacteria 3786
64 Ga0070670_100000539 3300005331 Bacteria 30116
65 Ga0070670_100052103 3300005331 Bacteria 3515
66 Ga0070670_100068086 3300005331 Bacteria 3055
67 Ga0070677_10000627 3300005333 Bacteria 11833
68 Ga0068869_100001639 3300005334 Bacteria 13350
69 Ga0068869_100002806 3300005334 Bacteria 10561
70 Ga0068869_100016693 3300005334 Bacteria 4953
71 Ga0070666_10000317 3300005335 Bacteria 30840
72 Ga0070666_10001618 3300005335 Bacteria 13694
73 Ga0070666_10077527 3300005335 Bacteria 2268
74 Ga0070680_100000409 3300005336 Bacteria 29285
75 Ga0070680_100089477 3300005336 Bacteria 2547
76 Ga0070680_100199122 3300005336 Bacteria 1689
77 Ga0070682_100067716 3300005337 Bacteria 2274
78 Ga0068868_100000350 3300005338 Bacteria 31314
79 Ga0068868_100002542 3300005338 Bacteria 12673
80 Ga0068868_100020478 3300005338 Bacteria 4971
81 Ga0070660_100000469 3300005339 Bacteria 26907
82 Ga0070660_100001869 3300005339 Bacteria 14498
83 Ga0070660_100002093 3300005339 Bacteria 13769
84 Ga0070660_100008383 3300005339 Bacteria 7225
85 Ga0070660_100010936 3300005339 Bacteria 6426
86 Ga0070660_100013720 3300005339 Bacteria 5824
87 Ga0070660_100018676 3300005339 Bacteria 5070
88 Ga0070660_100055816 3300005339 Bacteria 3053
89 Ga0070689_100017077 3300005340 Bacteria 5324
90 Ga0070689_100041597 3300005340 Bacteria 3528
91 Ga0070687_100087279 3300005343 Bacteria 1717
92 Ga0070661_100000006 3300005344 Bacteria 216544
93 Ga0070661_100001715 3300005344 Bacteria 15192
94 Ga0070661_100011226 3300005344 Bacteria 6241
95 Ga0070661_100015312 3300005344 Bacteria 5411
96 Ga0070661_100126596 3300005344 Bacteria 1917
97 Ga0070692_10000464 3300005345 Bacteria 12400
98 Ga0070668_100016356 3300005347 Bacteria 5547
99 Ga0070668_100078339 3300005347 Bacteria 2584
100 Ga0070669_100002036 3300005353 Bacteria 14622
101 Ga0070669_100024685 3300005353 Bacteria 4312
102 Ga0070669_100063440 3300005353 Bacteria 2719
103 Ga0070675_100002779 3300005354 Bacteria 13172
104 Ga0070675_100019406 3300005354 Bacteria 5417
105 Ga0070675_100024531 3300005354 Bacteria 4830
106 Ga0070675_100046511 3300005354 Bacteria 3553
107 Ga0070671_100002716 3300005355 Bacteria 13731
108 Ga0070671_100009319 3300005355 Bacteria 7883
109 Ga0070671_100016223 3300005355 Bacteria 6024
110 Ga0070671_100022126 3300005355 Bacteria 5193
111 Ga0070671_100022652 3300005355 Bacteria 5131
112 Ga0070671_100079600 3300005355 Bacteria 2739
113 Ga0070674_100005130 3300005356 Bacteria 7530
114 Ga0070674_100044185 3300005356 Bacteria 3036
115 Ga0070674_100058485 3300005356 Bacteria 2680
116 Ga0070674_100129450 3300005356 Bacteria 1880
117 Ga0070673_100000004 3300005364 Bacteria 199809
118 Ga0070673_100002361 3300005364 Bacteria 11476
119 Ga0070673_100002611 3300005364 Bacteria 11012
120 Ga0070673_100030150 3300005364 Bacteria 4054
121 Ga0070673_100044044 3300005364 Bacteria 3453
122 Ga0070659_100004577 3300005366 Bacteria 9891
123 Ga0070659_100007934 3300005366 Bacteria 7734
124 Ga0070659_100034542 3300005366 Bacteria 3933
125 Ga0070659_100075616 3300005366 Bacteria 2684
126 Ga0070659_100083956 3300005366 Bacteria 2546
127 Ga0070659_100128932 3300005366 Bacteria 2053
128 Ga0070659_100137070 3300005366 Bacteria 1990
129 Ga0070667_100001019 3300005367 Bacteria 25569
130 Ga0070667_100010643 3300005367 Bacteria 7596
131 Ga0070667_100118785 3300005367 Bacteria 2298
132 Ga0070667_100172986 3300005367 Bacteria 1907
133 Ga0070714_100239072 3300005435 Bacteria 1676
134 Ga0070713_100005111 3300005436 Bacteria 8928
135 Ga0070663_100001446 3300005455 Bacteria 13027
136 Ga0070663_100003936 3300005455 Bacteria 8661
137 Ga0070663_100025519 3300005455 Bacteria 3991
138 Ga0070678_100013770 3300005456 Bacteria 5082
139 Ga0070678_100031379 3300005456 Bacteria 3665
140 Ga0070678_100122039 3300005456 Bacteria 2056
141 Ga0070662_100002273 3300005457 Bacteria 11785
142 Ga0070662_100009072 3300005457 Bacteria 6489
143 Ga0070662_100023282 3300005457 Bacteria 4253
144 Ga0070662_100043802 3300005457 Bacteria 3204
145 Ga0070662_100083374 3300005457 Bacteria 2386
146 Ga0070662_100219477 3300005457 Bacteria 1516
147 Ga0070681_10012780 3300005458 Bacteria 8332
148 Ga0068867_100000028 3300005459 Bacteria 87716
149 Ga0068867_100004200 3300005459 Bacteria 10133
150 Ga0068867_100004228 3300005459 Bacteria 10103
151 Ga0068867_100007450 3300005459 Bacteria 7741
152 Ga0068867_100125532 3300005459 Bacteria 1988
153 Ga0070679_100009569 3300005530 Bacteria 9165
154 Ga0070679_100020025 3300005530 Bacteria 6519
155 Ga0070679_100063132 3300005530 Bacteria 3692
156 Ga0070679_100146989 3300005530 Bacteria 2334
157 Ga0070679_100244435 3300005530 Bacteria 1751
158 Ga0070684_100003155 3300005535 Bacteria 12311
159 Ga0070684_100020722 3300005535 Bacteria 5454
160 Ga0068853_100007512 3300005539 Bacteria 8724
161 Ga0068853_100010686 3300005539 Bacteria 7433
162 Ga0068853_100041339 3300005539 Bacteria 3937
163 Ga0068853_100154195 3300005539 Bacteria 2069
164 Ga0070672_100000098 3300005543 Bacteria 43239
165 Ga0070672_100010344 3300005543 Bacteria 6470
166 Ga0070672_100015697 3300005543 Bacteria 5406
167 Ga0070686_100000128 3300005544 Bacteria 53245
168 Ga0070665_100000123 3300005548 Bacteria 147463
169 Ga0070665_100002188 3300005548 Bacteria 21801
170 Ga0070665_100092381 3300005548 Bacteria 3031
171 Ga0068855_100002440 3300005563 Bacteria 22956
172 Ga0068855_100016089 3300005563 Bacteria 8997
173 Ga0068855_100018131 3300005563 Bacteria 8459
174 Ga0068855_100019593 3300005563 Bacteria 8127
175 Ga0068855_100069849 3300005563 Bacteria 4087
176 Ga0070664_100000811 3300005564 Bacteria 24038
177 Ga0070664_100010114 3300005564 Bacteria 7647
178 Ga0068857_100001431 3300005577 Bacteria 18899
179 Ga0068857_100002408 3300005577 Bacteria 15252
180 Ga0068857_100017127 3300005577 Bacteria 6348
181 Ga0068857_100106544 3300005577 Bacteria 2517
182 Ga0068854_100004750 3300005578 Bacteria 8567
183 Ga0068854_100017047 3300005578 Bacteria 4855
184 Ga0068854_100045945 3300005578 Bacteria 3107
185 Ga0068854_100092980 3300005578 Bacteria 2247
186 Ga0068854_100101741 3300005578 Bacteria 2155
187 Ga0068856_100022031 3300005614 Bacteria 6196
188 Ga0068856_100241377 3300005614 Bacteria 1822
189 Ga0068852_100000968 3300005616 Bacteria 18862
190 Ga0068852_100025664 3300005616 Bacteria 4777
191 Ga0068852_100042719 3300005616 Bacteria 3839
192 Ga0068852_100129571 3300005616 Bacteria 2321
193 Ga0068852_100139777 3300005616 Bacteria 2240
194 Ga0068852_100146978 3300005616 Bacteria 2187
195 Ga0068852_100188373 3300005616 Bacteria 1945
196 Ga0068859_100002646 3300005617 Bacteria 18230
197 Ga0068859_100009383 3300005617 Bacteria 9881
198 Ga0068859_100033133 3300005617 Bacteria 5189
199 Ga0068859_100082236 3300005617 Bacteria 3263
200 Ga0068864_100000835 3300005618 Bacteria 25979
201 Ga0068864_100000948 3300005618 Bacteria 24272
202 Ga0068864_100005111 3300005618 Bacteria 10750
203 Ga0068864_100007745 3300005618 Bacteria 8851
204 Ga0068861_100000084 3300005719 Bacteria 45078
205 Ga0068861_100040697 3300005719 Bacteria 3477
206 Ga0068851_10039346 3300005834 Bacteria 2374
207 Ga0068863_100000331 3300005841 Bacteria 48023
208 Ga0068863_100001531 3300005841 Bacteria 22856
209 Ga0068863_100005902 3300005841 Bacteria 12004
210 Ga0068863_100107891 3300005841 Bacteria 2650
211 Ga0068858_100000378 3300005842 Bacteria 46589
212 Ga0068858_100001485 3300005842 Bacteria 24146
213 Ga0068858_100008478 3300005842 Bacteria 9879
214 Ga0068858_100018540 3300005842 Bacteria 6516
215 Ga0068858_100162476 3300005842 Bacteria 2103
216 Ga0068858_100192089 3300005842 Bacteria 1929
217 Ga0068860_100020775 3300005843 Bacteria 6360
218 Ga0068860_100039947 3300005843 Bacteria 4486
219 Ga0068860_100120419 3300005843 Bacteria 2513
220 Ga0068860_100292328 3300005843 Bacteria 1594
221 Ga0068862_100005817 3300005844 Bacteria 10279
222 Ga0068862_100071812 3300005844 Bacteria 2989
223 Ga0081539_10018358 3300005985 Bacteria 4859
224 Ga0081539_10031379 3300005985 Bacteria 3275
225 Ga0070717_10027825 3300006028 Bacteria 4520
226 Ga0075364_10040415 3300006051 Bacteria 3025
227 Ga0097621_100115330 3300006237 Bacteria 2273
228 Ga0097621_100115700 3300006237 Bacteria 2270
229 Ga0075370_10021394 3300006353 Bacteria 3543
230 Ga0068871_100005489 3300006358 Bacteria 8894
231 Ga0068871_100027867 3300006358 Bacteria 4423
232 Ga0075431_100031857 3300006847 Bacteria 5430
233 Ga0068865_100000006 3300006881 Bacteria 201186
234 Ga0068865_100008898 3300006881 Bacteria 6209
235 Ga0068865_100039088 3300006881 Bacteria 3216
236 Ga0068865_100047801 3300006881 Bacteria 2942
237 Ga0068865_100093027 3300006881 Bacteria 2191
238 Ga0097620_100002646 3300006931 Bacteria 18230
239 Ga0097620_100009383 3300006931 Bacteria 9881
240 Ga0097620_100033133 3300006931 Bacteria 5189
241 Ga0097620_100082237 3300006931 Bacteria 3263
242 Ga0105250_10042131 3300009092 Bacteria 1830
243 Ga0105240_10020240 3300009093 Bacteria 8882
244 Ga0105240_10025879 3300009093 Bacteria 7705
245 Ga0105240_10076181 3300009093 Bacteria 4136
246 Ga0105240_10203977 3300009093 Bacteria 2316
247 Ga0111539_10264290 3300009094 Bacteria 2003
248 Ga0105245_10001138 3300009098 Bacteria 24035
249 Ga0105245_10001700 3300009098 Bacteria 20029
250 Ga0105245_10003162 3300009098 Bacteria 14721
251 Ga0105245_10046500 3300009098 Bacteria 3878
252 Ga0105247_10002615 3300009101 Bacteria 12154
253 Ga0105243_10000477 3300009148 Bacteria 41078
254 Ga0105243_10083358 3300009148 Bacteria 2616
255 Ga0105243_10088678 3300009148 Bacteria 2541
256 Ga0105241_10011807 3300009174 Bacteria 6416
257 Ga0105242_10076374 3300009176 Bacteria 2792
258 Ga0105248_10000119 3300009177 Bacteria 89987
259 Ga0105248_10002873 3300009177 Bacteria 19111
260 Ga0105248_10003056 3300009177 Bacteria 18559
261 Ga0105248_10004347 3300009177 Bacteria 15674
262 Ga0105248_10025820 3300009177 Bacteria 6533
263 Ga0105248_10110320 3300009177 Bacteria 3102
264 Ga0105248_10216861 3300009177 Bacteria 2155
265 Ga0105238_10037320 3300009551 Bacteria 4940
266 Ga0105238_10192522 3300009551 Bacteria 2015
267 Ga0105249_10017455 3300009553 Bacteria 6371
268 Ga0105239_10010602 3300010375 Bacteria 10307
269 Ga0105239_10042582 3300010375 Bacteria 4975
270 Ga0105239_10087005 3300010375 Bacteria 3444
271 Ga0105239_10155730 3300010375 Bacteria 2551
272 Ga0105246_10000868 3300011119 Bacteria 17301
273 Ga0105246_10035142 3300011119 Bacteria 3347
274 Ga0105246_10089630 3300011119 Bacteria 2213
275 Ga0157373_10017332 3300013100 Bacteria 5244
276 Ga0157373_10028129 3300013100 Bacteria 4056
277 Ga0157373_10042658 3300013100 Bacteria 3242
278 Ga0157373_10107898 3300013100 Bacteria 1958
279 Ga0157371_10004369 3300013102 Bacteria 12366
280 Ga0157371_10007400 3300013102 Bacteria 8895
281 Ga0157371_10070956 3300013102 Bacteria 2466
282 Ga0157371_10080734 3300013102 Bacteria 2303
283 Ga0157370_10000462 3300013104 Bacteria 50795
284 Ga0157370_10011758 3300013104 Bacteria 9139
285 Ga0157370_10060861 3300013104 Bacteria 3584
286 Ga0157370_10218036 3300013104 Bacteria 1767
287 Ga0157369_10001381 3300013105 Bacteria 29880
288 Ga0157369_10003304 3300013105 Bacteria 19175
289 Ga0157369_10015230 3300013105 Bacteria 8678
290 Ga0157369_10025039 3300013105 Bacteria 6627
291 Ga0157369_10230356 3300013105 Bacteria 1937
292 Ga0157374_10002874 3300013296 Bacteria 14449
293 Ga0157374_10008172 3300013296 Bacteria 8940
294 Ga0157378_10001586 3300013297 Bacteria 20552
295 Ga0157378_10002395 3300013297 Bacteria 16664
296 Ga0157378_10062120 3300013297 Bacteria 3335
297 Ga0163162_10009616 3300013306 Bacteria 9407
298 Ga0163162_10032344 3300013306 Bacteria 5195
299 Ga0163162_10173719 3300013306 Bacteria 2279
300 Ga0157372_10006300 3300013307 Bacteria 12615
301 Ga0157372_10062562 3300013307 Bacteria 4170
302 Ga0157372_10209583 3300013307 Bacteria 2258
303 Ga0157375_10006898 3300013308 Bacteria 9909
304 Ga0157375_10027560 3300013308 Bacteria 5311
305 Ga0157375_10102974 3300013308 Bacteria 2941
306 Ga0157375_10190745 3300013308 Bacteria 2204
307 Ga0163163_10026418 3300014325 Bacteria 5550
308 Ga0157380_10070680 3300014326 Bacteria 2821
309 Ga0157379_10057311 3300014968 Bacteria 3482
310 Ga0157379_10126916 3300014968 Bacteria 2296
311 Ga0157376_10000113 3300014969 Bacteria 58033
312 Ga0157376_10142341 3300014969 Bacteria 2153
313 Ga0163161_10015335 3300017792 Bacteria 5342
314 Ga0213873_10000006 3300021358 Bacteria 408723
315 Ga0213876_10000004 3300021384 Bacteria 943822
316 Ga0213876_10001359 3300021384 Bacteria 15304
317 Ga0207427_100586 3300025231 Bacteria 18316
318 Ga0207425_1000072 3300025245 Bacteria 115017
319 Ga0209026_1000483 3300025250 Bacteria 29654
320 Ga0209148_1000059 3300025254 Bacteria 350224
321 Ga0209148_1001365 3300025254 Bacteria 12736
322 Ga0209129_1003291 3300025258 Bacteria 7146
323 Ga0209233_1000003 3300025261 Bacteria 1607366
324 Ga0209233_1000182 3300025261 Bacteria 137671
325 Ga0209565_1000030 3300025263 Bacteria 325058
326 Ga0209565_1000132 3300025263 Bacteria 104716
327 Ga0209565_1000140 3300025263 Bacteria 101561
328 Ga0209455_1000265 3300025272 Bacteria 59804
329 Ga0209673_1000630 3300025273 Bacteria 53635
330 Ga0209673_1002418 3300025273 Bacteria 13001
331 Ga0209675_1007212 3300025291 Bacteria 4304
332 Ga0209676_1000043 3300025292 Bacteria 418680
333 Ga0209676_1000063 3300025292 Bacteria 322025
334 Ga0209676_1000712 3300025292 Bacteria 46015
335 Ga0209676_1001967 3300025292 Bacteria 16408
336 Ga0209676_1006661 3300025292 Bacteria 5633
337 Ga0209025_1000721 3300025294 Bacteria 56094
338 Ga0209564_1000502 3300025295 Bacteria 64443
339 Ga0209758_1000001 3300025297 Bacteria 1981790
340 Ga0209758_1000009 3300025297 Bacteria 1123483
341 Ga0209758_1000924 3300025297 Bacteria 39688
342 Ga0209758_1008272 3300025297 Bacteria 6805
343 Ga0209050_1000005 3300025298 Bacteria 1557793
344 Ga0209050_1000039 3300025298 Bacteria 410069
345 Ga0209050_1000049 3300025298 Bacteria 364096
346 Ga0209050_1000559 3300025298 Bacteria 60902
347 Ga0209050_1001103 3300025298 Bacteria 32702
348 Ga0209256_1000046 3300025299 Bacteria 325040
349 Ga0209256_1004121 3300025299 Bacteria 9403
350 Ga0209256_1006103 3300025299 Bacteria 6540
351 Ga0209051_1000377 3300025303 Bacteria 63522
352 Ga0209051_1002278 3300025303 Bacteria 14056
353 Ga0209257_1000051 3300025304 Bacteria 434166
354 Ga0209257_1000134 3300025304 Bacteria 207628
355 Ga0209257_1000692 3300025304 Bacteria 52346
356 Ga0209257_1001876 3300025304 Bacteria 22762
357 Ga0209257_1017792 3300025304 Bacteria 2777
358 Ga0207697_10001089 3300025315 Bacteria 14992
359 Ga0207682_10000393 3300025893 Bacteria 20101
360 Ga0207642_10016176 3300025899 Bacteria 2803
361 Ga0207688_10000334 3300025901 Bacteria 21842
362 Ga0207680_10000146 3300025903 Bacteria 33944
363 Ga0207680_10016584 3300025903 Bacteria 3872
364 Ga0207680_10040712 3300025903 Bacteria 2706
365 Ga0207647_10000164 3300025904 Bacteria 52343
366 Ga0207647_10002600 3300025904 Bacteria 13643
367 Ga0207647_10008931 3300025904 Bacteria 7147
368 Ga0207647_10018563 3300025904 Bacteria 4699
369 Ga0207645_10003767 3300025907 Bacteria 11388
370 Ga0207645_10013362 3300025907 Bacteria 5535
371 Ga0207645_10042493 3300025907 Bacteria 2909
372 Ga0207705_10000008 3300025909 Bacteria 589717
373 Ga0207705_10000049 3300025909 Bacteria 170616
374 Ga0207705_10000096 3300025909 Bacteria 105775
375 Ga0207705_10000119 3300025909 Bacteria 88108
376 Ga0207705_10001719 3300025909 Bacteria 17362
377 Ga0207705_10002489 3300025909 Bacteria 14195
378 Ga0207705_10014833 3300025909 Bacteria 5603
379 Ga0207705_10027202 3300025909 Bacteria 4077
380 Ga0207705_10065423 3300025909 Bacteria 2628
381 Ga0207705_10105185 3300025909 Bacteria 2080
382 Ga0207705_10166194 3300025909 Bacteria 1659
383 Ga0207705_10198847 3300025909 Bacteria 1518
384 Ga0207705_10201488 3300025909 Bacteria 1508
385 Ga0207695_10020117 3300025913 Bacteria 7657
386 Ga0207695_10077465 3300025913 Bacteria 3377
387 Ga0207671_10132848 3300025914 Bacteria 1912
388 Ga0207660_10000281 3300025917 Bacteria 33675
389 Ga0207660_10016391 3300025917 Bacteria 4904
390 Ga0207660_10076546 3300025917 Bacteria 2447
391 Ga0207662_10088552 3300025918 Bacteria 1901
392 Ga0207657_10000742 3300025919 Bacteria 34615
393 Ga0207657_10003143 3300025919 Bacteria 17668
394 Ga0207657_10006615 3300025919 Bacteria 11997
395 Ga0207657_10007434 3300025919 Bacteria 11237
396 Ga0207657_10012059 3300025919 Bacteria 8548
397 Ga0207657_10026275 3300025919 Bacteria 5353
398 Ga0207657_10026961 3300025919 Bacteria 5269
399 Ga0207657_10033965 3300025919 Bacteria 4593
400 Ga0207657_10066554 3300025919 Bacteria 3066
401 Ga0207649_10000058 3300025920 Bacteria 100911
402 Ga0207649_10006083 3300025920 Bacteria 6552
403 Ga0207649_10014623 3300025920 Bacteria 4397
404 Ga0207649_10038795 3300025920 Bacteria 2886
405 Ga0207649_10062053 3300025920 Bacteria 2355
406 Ga0207652_10005962 3300025921 Bacteria 9860
407 Ga0207652_10020011 3300025921 Bacteria 5510
408 Ga0207652_10027153 3300025921 Bacteria 4770
409 Ga0207652_10059575 3300025921 Bacteria 3291
410 Ga0207681_10049823 3300025923 Bacteria 2832
411 Ga0207694_10108870 3300025924 Bacteria 2202
412 Ga0207650_10026483 3300025925 Bacteria 4137
413 Ga0207659_10004748 3300025926 Bacteria 8243
414 Ga0207659_10022052 3300025926 Bacteria 4237
415 Ga0207659_10027459 3300025926 Bacteria 3854
416 Ga0207687_10000956 3300025927 Bacteria 19651
417 Ga0207687_10002400 3300025927 Bacteria 12708
418 Ga0207664_10053737 3300025929 Bacteria 3190
419 Ga0207664_10080006 3300025929 Bacteria 2655
420 Ga0207644_10001983 3300025931 Bacteria 13239
421 Ga0207644_10005102 3300025931 Bacteria 8576
422 Ga0207644_10017258 3300025931 Bacteria 4871
423 Ga0207644_10034448 3300025931 Bacteria 3543
424 Ga0207644_10108669 3300025931 Bacteria 2094
425 Ga0207690_10006289 3300025932 Bacteria 7034
426 Ga0207690_10015611 3300025932 Bacteria 4605
427 Ga0207690_10043130 3300025932 Bacteria 2967
428 Ga0207690_10083913 3300025932 Bacteria 2232
429 Ga0207690_10172506 3300025932 Bacteria 1622
430 Ga0207706_10000764 3300025933 Bacteria 33452
431 Ga0207706_10004774 3300025933 Bacteria 12692
432 Ga0207706_10005164 3300025933 Bacteria 12186
433 Ga0207706_10006596 3300025933 Bacteria 10749
434 Ga0207706_10013864 3300025933 Bacteria 7311
435 Ga0207706_10024573 3300025933 Bacteria 5401
436 Ga0207706_10036451 3300025933 Bacteria 4368
437 Ga0207709_10000182 3300025935 Bacteria 83442
438 Ga0207670_10098722 3300025936 Bacteria 2082
439 Ga0207669_10007965 3300025937 Bacteria 4944
440 Ga0207669_10029249 3300025937 Bacteria 3044
441 Ga0207704_10000022 3300025938 Bacteria 146109
442 Ga0207704_10031621 3300025938 Bacteria 2985
443 Ga0207704_10036648 3300025938 Bacteria 2824
444 Ga0207691_10000364 3300025940 Bacteria 45561
445 Ga0207691_10004514 3300025940 Bacteria 13464
446 Ga0207691_10044587 3300025940 Bacteria 4080
447 Ga0207691_10200964 3300025940 Bacteria 1735
448 Ga0207711_10000047 3300025941 Bacteria 150849
449 Ga0207711_10000055 3300025941 Bacteria 136126
450 Ga0207711_10001846 3300025941 Bacteria 19327
451 Ga0207711_10148625 3300025941 Bacteria 2113
452 Ga0207711_10152617 3300025941 Bacteria 2085
453 Ga0207689_10002559 3300025942 Bacteria 16870
454 Ga0207689_10005187 3300025942 Bacteria 11699
455 Ga0207689_10009094 3300025942 Bacteria 8600
456 Ga0207661_10014773 3300025944 Bacteria 5728
457 Ga0207661_10026409 3300025944 Bacteria 4425
458 Ga0207679_10008353 3300025945 Bacteria 6591
459 Ga0207679_10086166 3300025945 Bacteria 2415
460 Ga0207679_10175427 3300025945 Bacteria 1769
461 Ga0207679_10212549 3300025945 Bacteria 1623
462 Ga0207667_10000029 3300025949 Bacteria 329192
463 Ga0207667_10019369 3300025949 Bacteria 7599
464 Ga0207667_10023353 3300025949 Bacteria 6809
465 Ga0207667_10026270 3300025949 Bacteria 6363
466 Ga0207667_10047624 3300025949 Bacteria 4537
467 Ga0207667_10092667 3300025949 Bacteria 3120
468 Ga0207651_10000009 3300025960 Bacteria 199913
469 Ga0207651_10002797 3300025960 Bacteria 8385
470 Ga0207651_10004624 3300025960 Bacteria 6970
471 Ga0207651_10026085 3300025960 Bacteria 3644
472 Ga0207712_10030564 3300025961 Bacteria 3622
473 Ga0207668_10000361 3300025972 Bacteria 29201
474 Ga0207640_10000359 3300025981 Bacteria 29690
475 Ga0207640_10016281 3300025981 Bacteria 4322
476 Ga0207640_10028087 3300025981 Bacteria 3435
477 Ga0207640_10095104 3300025981 Bacteria 2074
478 Ga0207640_10165011 3300025981 Bacteria 1644
479 Ga0207658_10029705 3300025986 Bacteria 3863
480 Ga0207658_10045240 3300025986 Bacteria 3208
481 Ga0207658_10068577 3300025986 Bacteria 2677
482 Ga0207658_10143835 3300025986 Bacteria 1934
483 Ga0207677_10000268 3300026023 Bacteria 39315
484 Ga0207677_10000342 3300026023 Bacteria 33136
485 Ga0207677_10004212 3300026023 Bacteria 7700
486 Ga0207677_10004573 3300026023 Bacteria 7439
487 Ga0207703_10000399 3300026035 Bacteria 46666
488 Ga0207703_10001319 3300026035 Bacteria 22802
489 Ga0207703_10001416 3300026035 Bacteria 21856
490 Ga0207703_10100419 3300026035 Bacteria 2452
491 Ga0207639_10000730 3300026041 Bacteria 22439
492 Ga0207639_10008852 3300026041 Bacteria 6923
493 Ga0207639_10023392 3300026041 Bacteria 4462
494 Ga0207639_10049818 3300026041 Bacteria 3178
495 Ga0207639_10175877 3300026041 Bacteria 1817
496 Ga0207639_10184815 3300026041 Bacteria 1776
497 Ga0207678_10000084 3300026067 Bacteria 76874
498 Ga0207678_10000723 3300026067 Bacteria 30159
499 Ga0207678_10007111 3300026067 Bacteria 9928
500 Ga0207678_10048579 3300026067 Bacteria 3667
501 Ga0207678_10050950 3300026067 Bacteria 3575
502 Ga0207708_10050546 3300026075 Bacteria 3164
503 Ga0207702_10009817 3300026078 Bacteria 8027
504 Ga0207702_10017845 3300026078 Bacteria 5874
505 Ga0207702_10084128 3300026078 Bacteria 2769
506 Ga0207702_10087415 3300026078 Bacteria 2721
507 Ga0207702_10201994 3300026078 Bacteria 1843
508 Ga0207702_10221941 3300026078 Bacteria 1761
509 Ga0207641_10000070 3300026088 Bacteria 152598
510 Ga0207641_10006890 3300026088 Bacteria 9510
511 Ga0207641_10033244 3300026088 Bacteria 4285
512 Ga0207641_10098395 3300026088 Bacteria 2572
513 Ga0207641_10182843 3300026088 Bacteria 1921
514 Ga0207641_10219441 3300026088 Bacteria 1762
515 Ga0207648_10000084 3300026089 Bacteria 88578
516 Ga0207648_10000781 3300026089 Bacteria 35889
517 Ga0207648_10002133 3300026089 Bacteria 21513
518 Ga0207648_10002612 3300026089 Bacteria 19310
519 Ga0207648_10007899 3300026089 Bacteria 10376
520 Ga0207676_10000602 3300026095 Bacteria 29493
521 Ga0207676_10001627 3300026095 Bacteria 16557
522 Ga0207676_10010480 3300026095 Bacteria 6602
523 Ga0207674_10000324 3300026116 Bacteria 60949
524 Ga0207674_10002039 3300026116 Bacteria 25644
525 Ga0207674_10002832 3300026116 Bacteria 21570
526 Ga0207674_10010710 3300026116 Bacteria 10355
527 Ga0207674_10019779 3300026116 Bacteria 7286
528 Ga0207674_10036251 3300026116 Bacteria 5141
529 Ga0207674_10108811 3300026116 Bacteria 2748
530 Ga0207675_100000166 3300026118 Bacteria 58837
531 Ga0207675_100024191 3300026118 Bacteria 5647
532 Ga0207675_100117205 3300026118 Bacteria 2517
533 Ga0207683_10009065 3300026121 Bacteria 8477
534 Ga0207683_10035180 3300026121 Bacteria 4356
535 Ga0207698_10002973 3300026142 Bacteria 10156
536 Ga0207698_10003462 3300026142 Bacteria 9502
537 Ga0207698_10042168 3300026142 Bacteria 3407
538 Ga0268266_10000262 3300028379 Bacteria 88235
539 Ga0268266_10004783 3300028379 Bacteria 12871
540 Ga0268266_10079967 3300028379 Bacteria 2847
541 Ga0268265_10007983 3300028380 Bacteria 7144
542 Ga0268264_10010864 3300028381 Bacteria 7524
543 Ga0265319_1011045 3300028563 Bacteria 3729
544 Ga0265318_10001295 3300028577 Bacteria 15034
545 Ga0307517_10026956 3300028786 Bacteria 6928
546 Ga0265338_10013094 3300028800 Bacteria 9399
547 Ga0265338_10044028 3300028800 Bacteria 4128
548 Ga0265332_10007734 3300031238 Bacteria 4855
549 Ga0265328_10054735 3300031239 Bacteria 1464
550 Ga0265320_10039594 3300031240 Bacteria 2355
551 Ga0265325_10001334 3300031241 Bacteria 17487
552 Ga0265339_10032246 3300031249 Bacteria 2956
553 Ga0265331_10003659 3300031250 Bacteria 9810
554 Ga0265316_10039927 3300031344 Bacteria 3766
555 Ga0265316_10048829 3300031344 Bacteria 3337
556 Ga0307408_100054374 3300031548 Bacteria 2894
557 Ga0307408_100111185 3300031548 Bacteria 2105
558 Ga0265313_10003424 3300031595 Bacteria 12840
559 Ga0307508_10003032 3300031616 Bacteria 17301
560 Ga0265314_10027660 3300031711 Bacteria 4244
561 Ga0265342_10005743 3300031712 Bacteria 9379
562 Ga0307405_10002622 3300031731 Bacteria 7994
563 Ga0307413_10001788 3300031824 Bacteria 8414
564 Ga0307413_10044149 3300031824 Bacteria 2632
565 Ga0307410_10000189 3300031852 Bacteria 22788
566 Ga0307410_10000344 3300031852 Bacteria 18010
567 Ga0307410_10006990 3300031852 Bacteria 6143
568 Ga0307406_10011939 3300031901 Bacteria 4939
569 Ga0307407_10000110 3300031903 Bacteria 26440
570 Ga0307412_10002246 3300031911 Bacteria 10709
571 Ga0307412_10021096 3300031911 Bacteria 3974
572 Ga0307412_10058556 3300031911 Bacteria 2578
573 Ga0307409_100000222 3300031995 Bacteria 22725
574 Ga0307409_100002352 3300031995 Bacteria 9830
575 Ga0307409_100104619 3300031995 Bacteria 2358
576 Ga0307409_100132847 3300031995 Bacteria 2130
577 Ga0307416_100027476 3300032002 Bacteria 4215
578 Ga0307414_10000801 3300032004 Bacteria 16098
579 Ga0307414_10004490 3300032004 Bacteria 7582
580 Ga0307414_10007172 3300032004 Bacteria 6254
581 Ga0307414_10041911 3300032004 Bacteria 3105
582 Ga0307414_10062749 3300032004 Bacteria 2638
583 Ga0307414_10160366 3300032004 Bacteria 1785
584 Ga0307411_10000098 3300032005 Bacteria 26810
585 Ga0307411_10000888 3300032005 Bacteria 11320
586 Ga0307411_10112684 3300032005 Bacteria 1950
587 Ga0307415_100005305 3300032126 Bacteria 6824
588 Ga0307415_100017355 3300032126 Bacteria 4314
589 Ga0316587_1006815 3300033529 Bacteria 1758
590 Ga0373923_0008534 3300035111 Bacteria 3660
591 Ga0373954_0020173 3300035118 Bacteria 3013
592 Ga0373957_0003306 3300035120 Bacteria 4751
593 Ga0373943_0007056 3300035170 Bacteria 5039
594 Ga0373955_0005811 3300035172 Bacteria 5570
595 Ga0373937_0004175 3300036401 Bacteria 12248
596 Ga0373925_0083063 3300037068 Bacteria 2439
597 Ga0395899_0001153 3300037312 Bacteria 23326
598 Ga0395899_0015175 3300037312 Bacteria 5874
599 Ga0395899_0040477 3300037312 Bacteria 3484
600 Ga0395899_0049976 3300037312 Bacteria 3106
601 Ga0395899_0051958 3300037312 Bacteria 3040
602 Ga0395899_0062427 3300037312 Bacteria 2744
603 Ga0395899_0079032 3300037312 Bacteria 2396
604 Ga0395899_0079549 3300037312 Bacteria 2387
605 Ga0395899_0087340 3300037312 Bacteria 2263
606 Ga0395899_0110216 3300037312 Bacteria 1980
607 Ga0395900_0000589 3300037418 Bacteria 49868
608 Ga0395900_0012851 3300037418 Bacteria 8555
609 Ga0395900_0031874 3300037418 Bacteria 5418
610 Ga0395900_0057745 3300037418 Bacteria 3995
611 Ga0395900_0141496 3300037418 Bacteria 2463
612 Ga0395900_0146981 3300037418 Bacteria 2410
613 Ga0395900_0148665 3300037418 Bacteria 2394
614 Ga0395900_0185153 3300037418 Bacteria 2114
615 Ga0395900_0338227 3300037418 Bacteria 1481
616 Ga0395898_0019495 3300037466 Bacteria 6901
617 Ga0395898_0024761 3300037466 Bacteria 6051
618 Ga0395898_0039431 3300037466 Bacteria 4675
619 Ga0395898_0044228 3300037466 Bacteria 4386
620 Ga0395898_0091024 3300037466 Bacteria 2935
621 Ga0395898_0091503 3300037466 Bacteria 2926
622 Ga0395898_0128522 3300037466 Bacteria 2427
623 Ga0395898_0243140 3300037466 Bacteria 1716
624 Ga0395898_0391618 3300037466 Bacteria 1325
625 Ga0395905_0010941 3300037471 Bacteria 8781
626 Ga0395905_0014753 3300037471 Bacteria 7449
627 Ga0395905_0015114 3300037471 Bacteria 7346
628 Ga0395905_0017221 3300037471 Bacteria 6864
629 Ga0395905_0017945 3300037471 Bacteria 6721
630 Ga0395905_0025568 3300037471 Bacteria 5567
631 Ga0395905_0029097 3300037471 Bacteria 5206
632 Ga0395905_0066713 3300037471 Bacteria 3370
633 Ga0395905_0080347 3300037471 Bacteria 3055
634 Ga0395905_0085798 3300037471 Bacteria 2950
635 Ga0395905_0094585 3300037471 Bacteria 2803
636 Ga0395905_0096056 3300037471 Bacteria 2782
637 Ga0395905_0115708 3300037471 Bacteria 2520
638 Ga0395905_0127673 3300037471 Bacteria 2391
639 Ga0395905_0165506 3300037471 Bacteria 2078
640 Ga0395905_0190283 3300037471 Bacteria 1925
641 Ga0395905_0261484 3300037471 Bacteria 1616
642 Ga0395905_0284314 3300037471 Bacteria 1541
643 Ga0395905_0297016 3300037471 Bacteria 1502
644 Ga0436364_0322741 3300037853 Bacteria 22847
645 Ga0395901_0002032 3300038443 Bacteria 20806
646 Ga0395901_0014089 3300038443 Bacteria 8141
647 Ga0395901_0018693 3300038443 Bacteria 7078
648 Ga0395901_0018907 3300038443 Bacteria 7044
649 Ga0395901_0023927 3300038443 Bacteria 6266
650 Ga0395901_0045429 3300038443 Bacteria 4558
651 Ga0395901_0058906 3300038443 Bacteria 3995
652 Ga0395901_0095651 3300038443 Bacteria 3112
653 Ga0395901_0102178 3300038443 Bacteria 3008
654 Ga0395901_0126271 3300038443 Bacteria 2688
655 Ga0395901_0166357 3300038443 Bacteria 2315
656 Ga0395901_0206571 3300038443 Bacteria 2057
657 Ga0395901_0217784 3300038443 Bacteria 1996
658 Ga0436365_0862833 3300039437 Bacteria 88455
659 Ga0436365_1058137 3300039437 Bacteria 63934
660 Ga0436365_1289842 3300039437 Bacteria 27584
661 Ga0436363_0441596 3300039450 Bacteria 3186
662 Ga0436362_0554113 3300039453 Bacteria 162652
663 Ga0439436_0005769 3300041404 Bacteria 3793
664 Ga0439439_0013658 3300041406 Bacteria 1970
665 Ga0439461_0000015 3300041410 Bacteria 22241
666 Ga0439465_0000240 3300041413 Bacteria 15013
667 Ga0439431_0000089 3300041997 Bacteria 14969
668 Ga0439445_0000017 3300042004 Bacteria 22138
669 Ga0439445_0001011 3300042004 Bacteria 5997
670 Ga0439448_0010647 3300042005 Bacteria 2731
671 Ga0439432_001016 3300042006 Bacteria 10605
672 Ga0439455_0000734 3300042012 Bacteria 4889
673 Ga0439455_0002013 3300042012 Bacteria 3593
674 Ga0439455_0005821 3300042012 Bacteria 2525
675 Ga0439457_005071 3300042014 Bacteria 3357
676 Ga0439462_0001597 3300042015 Bacteria 5087
677 Ga0439462_0025685 3300042015 Bacteria 1551
678 Ga0450920_001437 3300042122 Bacteria 3936
679 Ga0439446_0005043 3300042156 Bacteria 3379
680 Ga0439458_0001070 3300042157 Bacteria 6974
681 Ga0439458_0003199 3300042157 Bacteria 3880
682 Ga0439458_0004008 3300042157 Bacteria 3401
683 Ga0439434_0000049 3300042435 Bacteria 29298
684 Ga0439434_0011967 3300042435 Bacteria 2564
685 Ga0451577_0000287 3300042876 Bacteria 98086
686 Ga0466969_0018424 3300044656 Bacteria 3637
687 Ga0466972_0015501 3300044658 Bacteria 3809
688 Ga0453683_0001021 3300044673 Bacteria 26284
689 Ga0466965_0006835 3300044683 Bacteria 5211
690 Ga0466965_0148607 3300044683 Bacteria 1224
691 Ga0466966_0000001 3300044684 Bacteria 410376
692 Ga0466966_0022066 3300044684 Bacteria 4180
693 Ga0466966_0078859 3300044684 Bacteria 2053
694 Ga0466961_0014915 3300044693 Bacteria 4990
695 Ga0466961_0045507 3300044693 Bacteria 2808
696 Ga0466961_0085861 3300044693 Bacteria 1989
697 Ga0466963_0004459 3300044694 Bacteria 8142
698 Ga0466963_0009953 3300044694 Bacteria 5743
699 Ga0466963_0015391 3300044694 Bacteria 4735
700 Ga0466963_0034283 3300044694 Bacteria 3302
701 Ga0466963_0066888 3300044694 Bacteria 2411
702 Ga0453684_0000335 3300044712 Bacteria 196328
703 Ga0453684_0001362 3300044712 Bacteria 71077
704 Ga0453684_0002060 3300044712 Bacteria 51082
705 Ga0453684_0002091 3300044712 Bacteria 50553
706 Ga0466971_0002712 3300044719 Bacteria 7486
707 Ga0466971_0010174 3300044719 Bacteria 4107
708 Ga0466968_0001227 3300044735 Bacteria 9077
709 Ga0466970_0011106 3300044765 Bacteria 4586
710 Ga0466970_0012832 3300044765 Bacteria 4289
711 Ga0466970_0014513 3300044765 Bacteria 4046
712 Ga0466970_0072803 3300044765 Bacteria 1849
713 Ga0466957_0000504 3300044842 Bacteria 19597
714 Ga0466957_0044557 3300044842 Bacteria 2688
715 Ga0466957_0058337 3300044842 Bacteria 2365
716 Ga0466957_0147613 3300044842 Bacteria 1519
717 Ga0466960_0024108 3300044901 Bacteria 2741
718 Ga0466959_0003186 3300045049 Bacteria 10654
719 Ga0466959_0020078 3300045049 Bacteria 4919
720 Ga0451576_0000122 3300045051 Bacteria 197797
721 Ga0451576_0000732 3300045051 Bacteria 65825
722 Ga0466958_0003823 3300045836 Bacteria 7863
723 Ga0466967_0000149 3300045976 Bacteria 27415
724 Ga0466967_0005507 3300045976 Bacteria 8785
725 Ga0466967_0017259 3300045976 Bacteria 5723
726 Ga0466967_0039894 3300045976 Bacteria 4040
727 Ga0495638_0000440 3300046460 Bacteria 50160
728 Ga0495638_0000633 3300046460 Bacteria 38772
729 Ga0495638_0016451 3300046460 Bacteria 4954
730 Ga0495650_0000068 3300046471 Bacteria 266671
731 Ga0495650_0000083 3300046471 Bacteria 237725
732 Ga0495583_0000351 3300046506 Bacteria 72601
733 Ga0495583_0000696 3300046506 Bacteria 43409
734 Ga0495610_0000131 3300046512 Bacteria 82558
735 Ga0495620_0053703 3300046515 Bacteria 1705
736 Ga0495637_0015019 3300046520 Bacteria 3641
737 Ga0495648_0003568 3300046524 Bacteria 13615
738 Ga0495648_0055353 3300046524 Bacteria 2392
739 Ga0495663_0016170 3300046525 Bacteria 2108
740 Ga0495654_0000042 3300046530 Bacteria 164346
741 Ga0495587_0017448 3300046536 Bacteria 4459
742 Ga0495598_0003551 3300046537 Bacteria 3324
743 Ga0495598_0014638 3300046537 Bacteria 1965
744 Ga0495621_0000236 3300046539 Bacteria 13011
745 Ga0495622_0000745 3300046557 Bacteria 18213
746 Ga0495633_0078334 3300046558 Bacteria 1538
747 Ga0495668_0000587 3300046616 Bacteria 44244
748 Ga0495668_0014216 3300046616 Bacteria 4674
749 Ga0495668_0021480 3300046616 Bacteria 3701
750 Ga0495625_0004911 3300046660 Bacteria 12447
751 Ga0495625_0041223 3300046660 Bacteria 3361
752 Ga0495625_0058819 3300046660 Bacteria 2729
753 Ga0495669_0005168 3300046684 Bacteria 5428
754 Ga0495670_0000003 3300046691 Bacteria 326779
755 Ga0495670_0007460 3300046691 Bacteria 5370
756 Ga0495670_0017915 3300046691 Bacteria 3488
757 Ga0495670_0070065 3300046691 Bacteria 1774
758 Ga0495649_0000092 3300046694 Bacteria 77734
759 Ga0495600_0016538 3300046809 Bacteria 4683
760 Ga0495672_0005693 3300047320 Bacteria 9820
761 Ga0495687_000973 3300047443 Bacteria 29058
762 Ga0495673_0017813 3300047469 Bacteria 3595
763 Ga0495673_0018706 3300047469 Bacteria 3487
764 Ga0495686_0000661 3300047472 Bacteria 46810
765 Ga0495686_0004063 3300047472 Bacteria 12221
766 Ga0495686_0017773 3300047472 Bacteria 4786
767 Ga0495686_0020591 3300047472 Bacteria 4396
768 Ga0495602_0083170 3300048088 Bacteria 2683
769 Ga0496100_0071060 3300048903 Bacteria 2323
770 Ga0496101_0003459 3300048904 Bacteria 9850
771 Ga0496101_0148093 3300048904 Bacteria 1794
772 Ga0496102_0062683 3300048905 Bacteria 3405
773 Ga0496104_0002627 3300048907 Bacteria 15455
774 Ga0496104_0029517 3300048907 Bacteria 5088
775 Ga0496105_0000678 3300048908 Bacteria 22865
776 Ga0496105_0052690 3300048908 Bacteria 3361
777 Ga0496106_0049050 3300048909 Bacteria 3180
778 Ga0496107_0001705 3300048910 Bacteria 13777
779 Ga0496108_0000315 3300048911 Bacteria 41163
780 Ga0496108_0002157 3300048911 Bacteria 15762
781 Ga0496108_0059920 3300048911 Bacteria 3201
782 Ga0496109_0000617 3300048912 Bacteria 29636
783 Ga0496110_0003274 3300048913 Bacteria 12352
784 Ga0496110_0111650 3300048913 Bacteria 2457
785 Ga0496111_0009315 3300048914 Bacteria 6547
786 Ga0496111_0038978 3300048914 Bacteria 3405
787 Ga0496111_0090034 3300048914 Bacteria 2248
788 Ga0496112_0000133 3300048915 Bacteria 46286
789 Ga0496112_0019749 3300048915 Bacteria 6369
790 Ga0496112_0049824 3300048915 Bacteria 4105
791 Ga0496113_0011396 3300048916 Bacteria 5928
792 Ga0496113_0078648 3300048916 Bacteria 2523
793 Ga0496114_0006615 3300048917 Bacteria 9137
794 Ga0496114_0078383 3300048917 Bacteria 2787
795 Ga0496115_0000657 3300048918 Bacteria 25751
796 Ga0496115_0021090 3300048918 Bacteria 5028
797 Ga0496116_0000116 3300048919 Bacteria 172374
798 Ga0496117_0037622 3300048920 Bacteria 3603
799 Ga0496117_0047821 3300048920 Bacteria 3063
800 Ga0496118_0018893 3300048921 Bacteria 6183
801 Ga0496118_0029306 3300048921 Bacteria 4619
802 Ga0496120_0048321 3300048923 Bacteria 2449
803 Ga0496120_0059929 3300048923 Bacteria 2131
804 Ga0496121_0000022 3300048924 Bacteria 472849
805 Ga0496121_0000714 3300048924 Bacteria 61634
806 Ga0496121_0004591 3300048924 Bacteria 18409
807 Ga0496121_0077575 3300048924 Bacteria 2645
808 Ga0496123_0039498 3300048926 Bacteria 3300
809 Ga0496124_0000817 3300048927 Bacteria 50627
810 Ga0496124_0002298 3300048927 Bacteria 25241
811 Ga0496124_0019689 3300048927 Bacteria 6269
812 Ga0496125_0018732 3300048928 Bacteria 6564
813 Ga0496125_0021737 3300048928 Bacteria 5972
814 Ga0496125_0095714 3300048928 Bacteria 2208
815 Ga0496126_0000428 3300048929 Bacteria 84757
816 Ga0496126_0009898 3300048929 Bacteria 10074
817 Ga0496126_0021811 3300048929 Bacteria 6248
818 Ga0496126_0093798 3300048929 Bacteria 2635
819 Ga0501034_0091134 3300049571 Bacteria 3046
820 Ga0501034_0191477 3300049571 Bacteria 2007
821 Ga0501223_000106 3300049663 Bacteria 24016
822 Ga0501224_000007 3300049664 Bacteria 127654
823 Ga0501233_000050 3300049668 Bacteria 16101
824 Ga0501235_000245 3300049669 Bacteria 9923
825 Ga0501225_0000100 3300049705 Bacteria 27639
826 Ga0501226_000025 3300049853 Bacteria 91197
827 nmdc:mga06r32_4573_c1 3300050510 Bacteria 12403
828 Ga0500644_0000738 3300053088 Bacteria 11431
829 Ga0500566_0000788 3300053094 Bacteria 17996
830 Ga0500641_0013425 3300053096 Bacteria 3010
831 Ga0500555_000086 3300053103 Bacteria 44938
832 Ga0500556_0000013 3300053104 Bacteria 243797
833 Ga0500556_0001960 3300053104 Bacteria 7268
834 Ga0500562_014063 3300053108 Bacteria 2048
835 Ga0500595_001269 3300053119 Bacteria 13814
836 Ga0500607_092075 3300053121 Bacteria 1523
837 Ga0500608_000079 3300053122 Bacteria 41088
838 Ga0500642_0000002 3300053130 Bacteria 795093
839 Ga0500655_004136 3300053133 Bacteria 2611
840 Ga0500559_0000412 3300053136 Bacteria 30720
841 Ga0500564_002850 3300053138 Bacteria 6521
842 Ga0500568_0005719 3300053139 Bacteria 6373
843 Ga0500568_0018758 3300053139 Bacteria 3019
844 Ga0500604_0000021 3300053151 Bacteria 72909
845 Ga0500616_0000101 3300053153 Bacteria 172722
846 Ga0500616_0009393 3300053153 Bacteria 5953
847 Ga0500622_0006445 3300053156 Bacteria 6801
848 Ga0500622_0087674 3300053156 Bacteria 1549
849 Ga0500624_000101 3300053157 Bacteria 41193
850 Ga0500627_0015259 3300053158 Bacteria 2964
851 Ga0500636_0004742 3300053177 Bacteria 7710
852 Ga0500645_000105 3300053730 Bacteria 67078
853 Ga0500645_001424 3300053730 Bacteria 12167
854 Ga0500645_001636 3300053730 Bacteria 11047
855 Ga0500645_004093 3300053730 Bacteria 5707
856 Ga0466962_0000862 3300061719 Bacteria 13747

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001990 JGI24737J22298_10021942 JGI24737J22298_100219422 333
2 3300025940 Ga0207691_10200964 Ga0207691_102009642 339
3 3300046558 Ga0495633_0078334 Ga0495633_0078334_25_1188 347
4 3300037418 Ga0395900_0185153 Ga0395900_0185153_21_1190 355
5 3300046515 Ga0495620_0053703 Ga0495620_0053703_539_1693 356
6 3300031344 Ga0265316_10039927 Ga0265316_100399273 358
7 3300053730 Ga0500645_001636 Ga0500645_001636_2860_4020 358
8 3300044683 Ga0466965_0148607 Ga0466965_0148607_39_1214 361
9 3300037466 Ga0395898_0391618 Ga0395898_0391618_36_1274 365
10 3300025918 Ga0207662_10088552 Ga0207662_100885522 376
11 3300005719 Ga0068861_100000084 Ga0068861_10000008424 380
12 3300009177 Ga0105248_10003056 Ga0105248_1000305610 380
13 3300026118 Ga0207675_100000166 Ga0207675_10000016646 380
14 3300046660 Ga0495625_0058819 Ga0495625_0058819_1389_2717 381
15 3300037418 Ga0395900_0338227 Ga0395900_0338227_137_1441 385
16 3300005617 Ga0068859_100002646 Ga0068859_1000026466 387
17 3300006931 Ga0097620_100002646 Ga0097620_1000026466 387
18 3300025941 Ga0207711_10001846 Ga0207711_1000184610 387
19 3300042876 Ga0451577_0000287 Ga0451577_0000287_4805_6199 391
20 3300044673 Ga0453683_0001021 Ga0453683_0001021_24245_25639 391
21 3300044712 Ga0453684_0000335 Ga0453684_0000335_103014_104408 391
22 3300045051 Ga0451576_0000732 Ga0451576_0000732_42297_43691 391
23 3300048924 Ga0496121_0004591 Ga0496121_0004591_15197_16600 392
24 3300048908 Ga0496105_0052690 Ga0496105_0052690_1875_3215 397
25 3300001979 JGI24740J21852_10021675 JGI24740J21852_100216752 398
26 3300001990 JGI24737J22298_10001146 JGI24737J22298_100011464 398
27 3300002075 JGI24738J21930_10001044 JGI24738J21930_100010444 398
28 3300005328 Ga0070676_10030693 Ga0070676_100306932 398
29 3300005331 Ga0070670_100068086 Ga0070670_1000680862 398
30 3300005338 Ga0068868_100020478 Ga0068868_1000204783 398
31 3300005339 Ga0070660_100018676 Ga0070660_1000186762 398
32 3300005340 Ga0070689_100017077 Ga0070689_1000170773 398
33 3300005343 Ga0070687_100087279 Ga0070687_1000872792 398
34 3300005344 Ga0070661_100126596 Ga0070661_1001265961 398
35 3300005353 Ga0070669_100002036 Ga0070669_1000020366 398
36 3300005354 Ga0070675_100024531 Ga0070675_1000245312 398
37 3300005355 Ga0070671_100022126 Ga0070671_1000221262 398
38 3300005364 Ga0070673_100002611 Ga0070673_1000026114 398
39 3300005459 Ga0068867_100004228 Ga0068867_1000042286 398
40 3300005539 Ga0068853_100007512 Ga0068853_1000075123 398
41 3300005543 Ga0070672_100000098 Ga0070672_10000009828 398
42 3300005563 Ga0068855_100019593 Ga0068855_1000195933 398
43 3300005564 Ga0070664_100010114 Ga0070664_1000101145 398
44 3300005577 Ga0068857_100017127 Ga0068857_1000171274 398
45 3300005616 Ga0068852_100042719 Ga0068852_1000427193 398
46 3300005617 Ga0068859_100009383 Ga0068859_1000093835 398
47 3300005618 Ga0068864_100000835 Ga0068864_10000083510 398
48 3300005842 Ga0068858_100018540 Ga0068858_1000185404 398
49 3300005843 Ga0068860_100039947 Ga0068860_1000399472 398
50 3300005844 Ga0068862_100071812 Ga0068862_1000718122 398
51 3300006881 Ga0068865_100008898 Ga0068865_1000088984 398
52 3300006931 Ga0097620_100009383 Ga0097620_1000093833 398
53 3300009098 Ga0105245_10001138 Ga0105245_100011384 398
54 3300009177 Ga0105248_10004347 Ga0105248_100043476 398
55 3300013102 Ga0157371_10070956 Ga0157371_100709562 398
56 3300013297 Ga0157378_10002395 Ga0157378_100023957 398
57 3300025315 Ga0207697_10001089 Ga0207697_1000108910 398
58 3300025901 Ga0207688_10000334 Ga0207688_100003348 398
59 3300025904 Ga0207647_10000164 Ga0207647_1000016430 398
60 3300025907 Ga0207645_10013362 Ga0207645_100133622 398
61 3300025919 Ga0207657_10000742 Ga0207657_100007423 398
62 3300025923 Ga0207681_10049823 Ga0207681_100498232 398
63 3300025926 Ga0207659_10027459 Ga0207659_100274592 398
64 3300025933 Ga0207706_10000764 Ga0207706_1000076422 398
65 3300025940 Ga0207691_10000364 Ga0207691_1000036424 398
66 3300025941 Ga0207711_10152617 Ga0207711_101526172 398
67 3300025945 Ga0207679_10008353 Ga0207679_100083535 398
68 3300025949 Ga0207667_10026270 Ga0207667_100262703 398
69 3300025960 Ga0207651_10002797 Ga0207651_100027975 398
70 3300025986 Ga0207658_10045240 Ga0207658_100452402 398
71 3300026088 Ga0207641_10219441 Ga0207641_102194411 398
72 3300026089 Ga0207648_10000781 Ga0207648_1000078124 398
73 3300026095 Ga0207676_10010480 Ga0207676_100104803 398
74 3300026116 Ga0207674_10002039 Ga0207674_100020399 398
75 3300026118 Ga0207675_100117205 Ga0207675_1001172052 398
76 3300048924 Ga0496121_0000022 Ga0496121_0000022_367798_369231 398
77 3300031344 Ga0265316_10048829 Ga0265316_100488293 399
78 3300048920 Ga0496117_0047821 Ga0496117_0047821_1639_3021 399
79 3300009177 Ga0105248_10216861 Ga0105248_102168612 400
80 3300025941 Ga0207711_10148625 Ga0207711_101486252 400
81 3300009098 Ga0105245_10003162 Ga0105245_1000316210 401
82 3300009148 Ga0105243_10088678 Ga0105243_100886782 401
83 3300011119 Ga0105246_10089630 Ga0105246_100896302 401
84 3300025927 Ga0207687_10002400 Ga0207687_100024006 401
85 3300047472 Ga0495686_0000661 Ga0495686_0000661_40819_42222 401
86 3300005614 Ga0068856_100022031 Ga0068856_1000220315 402
87 3300026078 Ga0207702_10009817 Ga0207702_100098175 402
88 3300047472 Ga0495686_0004063 Ga0495686_0004063_654_2060 402
89 3300005618 Ga0068864_100000948 Ga0068864_10000094826 403
90 3300005841 Ga0068863_100000331 Ga0068863_10000033136 403
91 3300005842 Ga0068858_100000378 Ga0068858_10000037834 403
92 3300009092 Ga0105250_10042131 Ga0105250_100421312 403
93 3300014968 Ga0157379_10057311 Ga0157379_100573114 403
94 3300026035 Ga0207703_10000399 Ga0207703_1000039933 403
95 3300026088 Ga0207641_10000070 Ga0207641_1000007068 403
96 3300026095 Ga0207676_10000602 Ga0207676_1000060224 403
97 3300005548 Ga0070665_100092381 Ga0070665_1000923812 404
98 3300047469 Ga0495673_0018706 Ga0495673_0018706_1331_2749 404
99 3300001904 JGI24736J21556_1000754 JGI24736J21556_10007544 405
100 3300005334 Ga0068869_100002806 Ga0068869_1000028062 405
101 3300046460 Ga0495638_0000633 Ga0495638_0000633_19092_20498 406
102 3300013102 Ga0157371_10080734 Ga0157371_100807342 407
103 3300028563 Ga0265319_1011045 Ga0265319_10110453 407
104 3300028577 Ga0265318_10001295 Ga0265318_100012956 407
105 3300028800 Ga0265338_10013094 Ga0265338_100130943 407
106 3300031238 Ga0265332_10007734 Ga0265332_100077343 407
107 3300031239 Ga0265328_10054735 Ga0265328_100547351 407
108 3300031240 Ga0265320_10039594 Ga0265320_100395942 407
109 3300031241 Ga0265325_10001334 Ga0265325_100013345 407
110 3300031249 Ga0265339_10032246 Ga0265339_100322462 407
111 3300031250 Ga0265331_10003659 Ga0265331_100036597 407
112 3300031595 Ga0265313_10003424 Ga0265313_1000342411 407
113 3300031616 Ga0307508_10003032 Ga0307508_100030327 407
114 3300031711 Ga0265314_10027660 Ga0265314_100276602 407
115 3300031712 Ga0265342_10005743 Ga0265342_100057436 407
116 3300046616 Ga0495668_0021480 Ga0495668_0021480_282_1697 407
117 3300046660 Ga0495625_0004911 Ga0495625_0004911_1143_2558 407
118 3300053104 Ga0500556_0000013 Ga0500556_0000013_89869_91284 407
119 3300053130 Ga0500642_0000002 Ga0500642_0000002_318269_319684 407
120 3300053730 Ga0500645_000105 Ga0500645_000105_3971_5386 407
121 3300048928 Ga0496125_0095714 Ga0496125_0095714_15_1445 408
122 3300001990 JGI24737J22298_10002102 JGI24737J22298_100021026 409
123 3300005327 Ga0070658_10071614 Ga0070658_100716142 409
124 3300005366 Ga0070659_100083956 Ga0070659_1000839562 409
125 3300005455 Ga0070663_100003936 Ga0070663_1000039366 409
126 3300005563 Ga0068855_100069849 Ga0068855_1000698492 409
127 3300005834 Ga0068851_10039346 Ga0068851_100393462 409
128 3300009093 Ga0105240_10076181 Ga0105240_100761813 409
129 3300009174 Ga0105241_10011807 Ga0105241_100118076 409
130 3300010375 Ga0105239_10155730 Ga0105239_101557302 409
131 3300013100 Ga0157373_10107898 Ga0157373_101078982 409
132 3300013104 Ga0157370_10218036 Ga0157370_102180362 409
133 3300025913 Ga0207695_10077465 Ga0207695_100774653 409
134 3300025933 Ga0207706_10036451 Ga0207706_100364514 409
135 3300025949 Ga0207667_10092667 Ga0207667_100926673 409
136 3300026041 Ga0207639_10000730 Ga0207639_100007306 409
137 3300026067 Ga0207678_10000084 Ga0207678_1000008466 409
138 3300026116 Ga0207674_10019779 Ga0207674_100197795 409
139 3300031548 Ga0307408_100054374 Ga0307408_1000543741 409
140 3300037471 Ga0395905_0297016 Ga0395905_0297016_73_1473 409
141 3300047472 Ga0495686_0020591 Ga0495686_0020591_296_1675 409
142 3300048919 Ga0496116_0000116 Ga0496116_0000116_99487_100920 409
143 3300005328 Ga0070676_10066819 Ga0070676_100668192 410
144 3300005328 Ga0070676_10069457 Ga0070676_100694572 410
145 3300005330 Ga0070690_100002605 Ga0070690_1000026056 410
146 3300005330 Ga0070690_100023434 Ga0070690_1000234342 410
147 3300005338 Ga0068868_100002542 Ga0068868_1000025424 410
148 3300005339 Ga0070660_100055816 Ga0070660_1000558163 410
149 3300005340 Ga0070689_100041597 Ga0070689_1000415972 410
150 3300005355 Ga0070671_100079600 Ga0070671_1000796001 410
151 3300005356 Ga0070674_100129450 Ga0070674_1001294502 410
152 3300005367 Ga0070667_100118785 Ga0070667_1001187852 410
153 3300005456 Ga0070678_100122039 Ga0070678_1001220392 410
154 3300005457 Ga0070662_100083374 Ga0070662_1000833741 410
155 3300005457 Ga0070662_100219477 Ga0070662_1002194771 410
156 3300005459 Ga0068867_100004200 Ga0068867_1000042004 410
157 3300005459 Ga0068867_100125532 Ga0068867_1001255322 410
158 3300005539 Ga0068853_100154195 Ga0068853_1001541952 410
159 3300005617 Ga0068859_100082236 Ga0068859_1000822362 410
160 3300005843 Ga0068860_100292328 Ga0068860_1002923281 410
161 3300006237 Ga0097621_100115330 Ga0097621_1001153302 410
162 3300006881 Ga0068865_100093027 Ga0068865_1000930271 410
163 3300006931 Ga0097620_100082237 Ga0097620_1000822372 410
164 3300009093 Ga0105240_10203977 Ga0105240_102039772 410
165 3300009177 Ga0105248_10000119 Ga0105248_100001193 410
166 3300009177 Ga0105248_10002873 Ga0105248_1000287310 410
167 3300009177 Ga0105248_10110320 Ga0105248_101103201 410
168 3300009551 Ga0105238_10037320 Ga0105238_100373202 410
169 3300013100 Ga0157373_10017332 Ga0157373_100173322 410
170 3300013100 Ga0157373_10042658 Ga0157373_100426582 410
171 3300013104 Ga0157370_10060861 Ga0157370_100608613 410
172 3300013105 Ga0157369_10003304 Ga0157369_100033047 410
173 3300013105 Ga0157369_10015230 Ga0157369_100152301 410
174 3300013296 Ga0157374_10008172 Ga0157374_100081728 410
175 3300013306 Ga0163162_10173719 Ga0163162_101737192 410
176 3300025909 Ga0207705_10166194 Ga0207705_101661942 410
177 3300025936 Ga0207670_10098722 Ga0207670_100987221 410
178 3300025981 Ga0207640_10165011 Ga0207640_101650111 410
179 3300033529 Ga0316587_1006815 Ga0316587_10068151 410
180 3300037312 Ga0395899_0049976 Ga0395899_0049976_452_1855 410
181 3300037312 Ga0395899_0062427 Ga0395899_0062427_1133_2527 410
182 3300037418 Ga0395900_0012851 Ga0395900_0012851_3046_4440 410
183 3300037418 Ga0395900_0141496 Ga0395900_0141496_386_1789 410
184 3300037466 Ga0395898_0024761 Ga0395898_0024761_3061_4464 410
185 3300037466 Ga0395898_0128522 Ga0395898_0128522_228_1622 410
186 3300037471 Ga0395905_0015114 Ga0395905_0015114_2001_3395 410
187 3300037471 Ga0395905_0284314 Ga0395905_0284314_55_1515 410
188 3300038443 Ga0395901_0018907 Ga0395901_0018907_3268_4662 410
189 3300039450 Ga0436363_0441596 Ga0436363_0441596_1701_3113 410
190 3300042004 Ga0439445_0000017 Ga0439445_0000017_12863_14266 410
191 3300044694 Ga0466963_0009953 Ga0466963_0009953_1216_2619 410
192 3300044719 Ga0466971_0010174 Ga0466971_0010174_2035_3426 410
193 3300044765 Ga0466970_0011106 Ga0466970_0011106_408_1799 410
194 3300044842 Ga0466957_0000504 Ga0466957_0000504_15556_16947 410
195 3300046691 Ga0495670_0070065 Ga0495670_0070065_44_1441 410
196 3300048903 Ga0496100_0071060 Ga0496100_0071060_107_1501 410
197 3300048904 Ga0496101_0148093 Ga0496101_0148093_168_1562 410
198 3300048911 Ga0496108_0002157 Ga0496108_0002157_6608_7987 410
199 3300048914 Ga0496111_0038978 Ga0496111_0038978_221_1600 410
200 3300048915 Ga0496112_0019749 Ga0496112_0019749_917_2311 410
201 3300048915 Ga0496112_0049824 Ga0496112_0049824_367_1746 410
202 3300053153 Ga0500616_0000101 Ga0500616_0000101_140919_142337 410
203 3300003773 Ga0055537_1001708 Ga0055537_10017084 411
204 3300003790 Ga0055528_1004276 Ga0055528_10042762 411
205 3300005356 Ga0070674_100044185 Ga0070674_1000441852 411
206 3300025263 Ga0209565_1000140 Ga0209565_100014039 411
207 3300025273 Ga0209673_1000630 Ga0209673_100063045 411
208 3300025299 Ga0209256_1006103 Ga0209256_10061032 411
209 3300025303 Ga0209051_1002278 Ga0209051_10022782 411
210 3300025937 Ga0207669_10029249 Ga0207669_100292491 411
211 3300026118 Ga0207675_100024191 Ga0207675_1000241913 411
212 3300045976 Ga0466967_0039894 Ga0466967_0039894_232_1629 411
213 3300046616 Ga0495668_0000587 Ga0495668_0000587_7677_9077 411
214 3300048923 Ga0496120_0048321 Ga0496120_0048321_37_1428 411
215 3300048924 Ga0496121_0077575 Ga0496121_0077575_603_2003 411
216 3300053122 Ga0500608_000079 Ga0500608_000079_12567_13967 411
217 3300044694 Ga0466963_0004459 Ga0466963_0004459_5119_6522 412
218 3300045976 Ga0466967_0000149 Ga0466967_0000149_23534_24937 412
219 3300053156 Ga0500622_0006445 Ga0500622_0006445_2746_4146 412
220 3300001904 JGI24736J21556_1002528 JGI24736J21556_10025282 413
221 3300003215 JGI25153J46596_10000260 JGI25153J46596_100002601 413
222 3300003773 Ga0055537_1008784 Ga0055537_10087843 413
223 3300003781 Ga0055536_1001906 Ga0055536_10019062 413
224 3300003781 Ga0055536_1002035 Ga0055536_10020354 413
225 3300003781 Ga0055536_1018772 Ga0055536_10187722 413
226 3300003791 Ga0055530_10002421 Ga0055530_100024219 413
227 3300003791 Ga0055530_10008021 Ga0055530_100080212 413
228 3300003792 Ga0055540_1000943 Ga0055540_100094317 413
229 3300003794 Ga0055531_10003045 Ga0055531_100030454 413
230 3300005333 Ga0070677_10000627 Ga0070677_100006277 413
231 3300005347 Ga0070668_100078339 Ga0070668_1000783393 413
232 3300005353 Ga0070669_100063440 Ga0070669_1000634402 413
233 3300005354 Ga0070675_100002779 Ga0070675_10000277910 413
234 3300006353 Ga0075370_10021394 Ga0075370_100213941 413
235 3300025245 Ga0207425_1000072 Ga0207425_10000722 413
236 3300025258 Ga0209129_1003291 Ga0209129_10032913 413
237 3300025263 Ga0209565_1000132 Ga0209565_100013268 413
238 3300025292 Ga0209676_1000043 Ga0209676_100004327 413
239 3300025292 Ga0209676_1000712 Ga0209676_10007129 413
240 3300025292 Ga0209676_1006661 Ga0209676_10066612 413
241 3300025294 Ga0209025_1000721 Ga0209025_100072137 413
242 3300025295 Ga0209564_1000502 Ga0209564_100050225 413
243 3300025297 Ga0209758_1000009 Ga0209758_1000009638 413
244 3300025298 Ga0209050_1000005 Ga0209050_1000005531 413
245 3300025298 Ga0209050_1000559 Ga0209050_10005599 413
246 3300025298 Ga0209050_1001103 Ga0209050_100110324 413
247 3300025303 Ga0209051_1000377 Ga0209051_100037748 413
248 3300025304 Ga0209257_1000134 Ga0209257_100013489 413
249 3300025304 Ga0209257_1017792 Ga0209257_10177922 413
250 3300025893 Ga0207682_10000393 Ga0207682_1000039312 413
251 3300025926 Ga0207659_10004748 Ga0207659_100047485 413
252 3300025929 Ga0207664_10053737 Ga0207664_100537373 413
253 3300025933 Ga0207706_10013864 Ga0207706_100138645 413
254 3300025945 Ga0207679_10212549 Ga0207679_102125492 413
255 3300031548 Ga0307408_100111185 Ga0307408_1001111852 413
256 3300031852 Ga0307410_10006990 Ga0307410_100069906 413
257 3300031911 Ga0307412_10002246 Ga0307412_100022464 413
258 3300031911 Ga0307412_10058556 Ga0307412_100585561 413
259 3300031995 Ga0307409_100132847 Ga0307409_1001328473 413
260 3300032004 Ga0307414_10007172 Ga0307414_100071724 413
261 3300032005 Ga0307411_10000888 Ga0307411_1000088810 413
262 3300035111 Ga0373923_0008534 Ga0373923_0008534_984_2390 413
263 3300035118 Ga0373954_0020173 Ga0373954_0020173_1071_2477 413
264 3300035120 Ga0373957_0003306 Ga0373957_0003306_767_2173 413
265 3300035172 Ga0373955_0005811 Ga0373955_0005811_1863_3269 413
266 3300036401 Ga0373937_0004175 Ga0373937_0004175_6749_8155 413
267 3300037471 Ga0395905_0261484 Ga0395905_0261484_25_1428 413
268 3300042122 Ga0450920_001437 Ga0450920_001437_1688_3094 413
269 3300042157 Ga0439458_0004008 Ga0439458_0004008_1368_2771 413
270 3300048088 Ga0495602_0083170 Ga0495602_0083170_818_2224 413
271 3300049571 Ga0501034_0091134 Ga0501034_0091134_1422_2801 413
272 3300049663 Ga0501223_000106 Ga0501223_000106_4259_5638 413
273 3300049664 Ga0501224_000007 Ga0501224_000007_85390_86769 413
274 3300049668 Ga0501233_000050 Ga0501233_000050_4229_5608 413
275 3300049669 Ga0501235_000245 Ga0501235_000245_3157_4536 413
276 3300049705 Ga0501225_0000100 Ga0501225_0000100_26067_27446 413
277 3300049853 Ga0501226_000025 Ga0501226_000025_4423_5802 413
278 3300005289 Ga0065704_10070205 Ga0065704_100702059 414
279 3300005616 Ga0068852_100139777 Ga0068852_1001397772 414
280 3300042012 Ga0439455_0002013 Ga0439455_0002013_797_2200 414
281 3300042157 Ga0439458_0003199 Ga0439458_0003199_997_2400 414
282 iso_pu_bacteria 2848297114 2848298060 414
283 3300003791 Ga0055530_10000074 Ga0055530_1000007443 415
284 3300003791 Ga0055530_10000579 Ga0055530_1000057925 415
285 3300003794 Ga0055531_10000374 Ga0055531_100003741 415
286 3300003794 Ga0055531_10003351 Ga0055531_100033518 415
287 3300005262 Ga0065165_1000459 Ga0065165_100045923 415
288 3300025292 Ga0209676_1001967 Ga0209676_10019672 415
289 3300025297 Ga0209758_1000924 Ga0209758_10009247 415
290 3300025298 Ga0209050_1000039 Ga0209050_1000039158 415
291 3300025298 Ga0209050_1000049 Ga0209050_100004934 415
292 3300025304 Ga0209257_1000051 Ga0209257_1000051158 415
293 3300025304 Ga0209257_1000692 Ga0209257_100069238 415
294 3300025986 Ga0207658_10143835 Ga0207658_101438352 415
295 3300026116 Ga0207674_10010710 Ga0207674_100107108 415
296 3300028786 Ga0307517_10026956 Ga0307517_100269565 415
297 3300031995 Ga0307409_100104619 Ga0307409_1001046192 415
298 3300032004 Ga0307414_10160366 Ga0307414_101603662 415
299 3300037312 Ga0395899_0079549 Ga0395899_0079549_913_2334 415
300 3300037418 Ga0395900_0000589 Ga0395900_0000589_24937_26358 415
301 3300037466 Ga0395898_0044228 Ga0395898_0044228_1808_3229 415
302 3300037471 Ga0395905_0014753 Ga0395905_0014753_2255_3676 415
303 3300037471 Ga0395905_0025568 Ga0395905_0025568_3993_5414 415
304 3300037471 Ga0395905_0080347 Ga0395905_0080347_994_2415 415
305 3300044712 Ga0453684_0001362 Ga0453684_0001362_20987_22381 415
306 3300044712 Ga0453684_0002060 Ga0453684_0002060_11053_12450 415
307 3300044712 Ga0453684_0002091 Ga0453684_0002091_38918_40315 415
308 3300048907 Ga0496104_0002627 Ga0496104_0002627_7628_9034 415
309 3300048908 Ga0496105_0000678 Ga0496105_0000678_19191_20597 415
310 3300048917 Ga0496114_0006615 Ga0496114_0006615_5552_6958 415
311 3300048918 Ga0496115_0000657 Ga0496115_0000657_6470_7894 415
312 3300048918 Ga0496115_0021090 Ga0496115_0021090_444_1850 415
313 iso_pu_bacteria 2599185359 2600228696 415
314 iso_pu_bacteria 2643221588 2643951523 415
315 iso_pu_bacteria 2643221663 2644353833 415
316 iso_pu_bacteria 2818991466 2819714506 415
317 iso_pu_bacteria 2879163058 2879164946 415
318 iso_pu_bacteria 2928526807 2928529008 415
319 iso_pu_bacteria 2928968154 2928968526 415
320 iso_pu_bacteria 3000865235 3000867187 415
321 3300002075 JGI24738J21930_10010652 JGI24738J21930_100106521 416
322 3300003214 JGI25165J46597_1000106 JGI25165J46597_100010662 416
323 3300003215 JGI25153J46596_10008006 JGI25153J46596_100080062 416
324 3300003762 Ga0055542_1004480 Ga0055542_10044803 416
325 3300003773 Ga0055537_1000161 Ga0055537_100016126 416
326 3300003775 Ga0055524_1000110 Ga0055524_100011055 416
327 3300003781 Ga0055536_1005768 Ga0055536_10057682 416
328 3300003794 Ga0055531_10002640 Ga0055531_100026407 416
329 3300005262 Ga0065165_1001720 Ga0065165_10017202 416
330 3300005262 Ga0065165_1008312 Ga0065165_10083123 416
331 3300005327 Ga0070658_10000262 Ga0070658_1000026233 416
332 3300005327 Ga0070658_10002456 Ga0070658_100024569 416
333 3300005327 Ga0070658_10007785 Ga0070658_100077852 416
334 3300005327 Ga0070658_10014970 Ga0070658_100149702 416
335 3300005328 Ga0070676_10000052 Ga0070676_1000005235 416
336 3300005328 Ga0070676_10000442 Ga0070676_1000044210 416
337 3300005329 Ga0070683_100091902 Ga0070683_1000919021 416
338 3300005329 Ga0070683_100139833 Ga0070683_1001398331 416
339 3300005334 Ga0068869_100001639 Ga0068869_1000016391 416
340 3300005336 Ga0070680_100089477 Ga0070680_1000894771 416
341 3300005336 Ga0070680_100199122 Ga0070680_1001991221 416
342 3300005338 Ga0068868_100000350 Ga0068868_1000003508 416
343 3300005339 Ga0070660_100001869 Ga0070660_10000186911 416
344 3300005339 Ga0070660_100002093 Ga0070660_1000020937 416
345 3300005344 Ga0070661_100011226 Ga0070661_1000112265 416
346 3300005347 Ga0070668_100016356 Ga0070668_1000163564 416
347 3300005353 Ga0070669_100024685 Ga0070669_1000246852 416
348 3300005354 Ga0070675_100046511 Ga0070675_1000465114 416
349 3300005355 Ga0070671_100022652 Ga0070671_1000226522 416
350 3300005356 Ga0070674_100058485 Ga0070674_1000584852 416
351 3300005364 Ga0070673_100000004 Ga0070673_10000000421 416
352 3300005366 Ga0070659_100137070 Ga0070659_1001370702 416
353 3300005367 Ga0070667_100172986 Ga0070667_1001729861 416
354 3300005455 Ga0070663_100001446 Ga0070663_1000014462 416
355 3300005456 Ga0070678_100013770 Ga0070678_1000137703 416
356 3300005457 Ga0070662_100009072 Ga0070662_1000090722 416
357 3300005458 Ga0070681_10012780 Ga0070681_100127806 416
358 3300005459 Ga0068867_100000028 Ga0068867_10000002856 416
359 3300005459 Ga0068867_100007450 Ga0068867_1000074505 416
360 3300005530 Ga0070679_100020025 Ga0070679_1000200255 416
361 3300005530 Ga0070679_100063132 Ga0070679_1000631323 416
362 3300005535 Ga0070684_100020722 Ga0070684_1000207223 416
363 3300005539 Ga0068853_100010686 Ga0068853_1000106864 416
364 3300005543 Ga0070672_100015697 Ga0070672_1000156974 416
365 3300005563 Ga0068855_100002440 Ga0068855_1000024409 416
366 3300005578 Ga0068854_100004750 Ga0068854_1000047503 416
367 3300005578 Ga0068854_100017047 Ga0068854_1000170471 416
368 3300005616 Ga0068852_100025664 Ga0068852_1000256643 416
369 3300005719 Ga0068861_100040697 Ga0068861_1000406973 416
370 3300005842 Ga0068858_100162476 Ga0068858_1001624762 416
371 3300005843 Ga0068860_100020775 Ga0068860_1000207754 416
372 3300005844 Ga0068862_100005817 Ga0068862_1000058174 416
373 3300006237 Ga0097621_100115700 Ga0097621_1001157002 416
374 3300006358 Ga0068871_100005489 Ga0068871_1000054895 416
375 3300006881 Ga0068865_100000006 Ga0068865_10000000621 416
376 3300006881 Ga0068865_100039088 Ga0068865_1000390882 416
377 3300009093 Ga0105240_10020240 Ga0105240_100202403 416
378 3300009098 Ga0105245_10001700 Ga0105245_1000170011 416
379 3300009148 Ga0105243_10000477 Ga0105243_1000047711 416
380 3300009177 Ga0105248_10025820 Ga0105248_100258202 416
381 3300009551 Ga0105238_10192522 Ga0105238_101925222 416
382 3300009553 Ga0105249_10017455 Ga0105249_100174552 416
383 3300010375 Ga0105239_10010602 Ga0105239_100106023 416
384 3300010375 Ga0105239_10042582 Ga0105239_100425822 416
385 3300010375 Ga0105239_10087005 Ga0105239_100870053 416
386 3300011119 Ga0105246_10000868 Ga0105246_1000086810 416
387 3300013102 Ga0157371_10007400 Ga0157371_100074007 416
388 3300013104 Ga0157370_10000462 Ga0157370_1000046211 416
389 3300013104 Ga0157370_10011758 Ga0157370_100117585 416
390 3300013105 Ga0157369_10025039 Ga0157369_100250393 416
391 3300013105 Ga0157369_10230356 Ga0157369_102303561 416
392 3300013296 Ga0157374_10002874 Ga0157374_1000287411 416
393 3300013297 Ga0157378_10001586 Ga0157378_100015868 416
394 3300013297 Ga0157378_10062120 Ga0157378_100621201 416
395 3300013306 Ga0163162_10032344 Ga0163162_100323442 416
396 3300013307 Ga0157372_10062562 Ga0157372_100625621 416
397 3300013307 Ga0157372_10209583 Ga0157372_102095831 416
398 3300013308 Ga0157375_10006898 Ga0157375_100068986 416
399 3300013308 Ga0157375_10027560 Ga0157375_100275602 416
400 3300014326 Ga0157380_10070680 Ga0157380_100706802 416
401 3300014969 Ga0157376_10000113 Ga0157376_1000011321 416
402 3300017792 Ga0163161_10015335 Ga0163161_100153354 416
403 3300021384 Ga0213876_10001359 Ga0213876_1000135910 416
404 3300025231 Ga0207427_100586 Ga0207427_10058610 416
405 3300025250 Ga0209026_1000483 Ga0209026_100048320 416
406 3300025254 Ga0209148_1000059 Ga0209148_1000059122 416
407 3300025254 Ga0209148_1001365 Ga0209148_10013655 416
408 3300025261 Ga0209233_1000003 Ga0209233_1000003703 416
409 3300025263 Ga0209565_1000030 Ga0209565_100003078 416
410 3300025272 Ga0209455_1000265 Ga0209455_100026530 416
411 3300025273 Ga0209673_1002418 Ga0209673_10024184 416
412 3300025291 Ga0209675_1007212 Ga0209675_10072123 416
413 3300025292 Ga0209676_1000063 Ga0209676_1000063271 416
414 3300025297 Ga0209758_1008272 Ga0209758_10082723 416
415 3300025299 Ga0209256_1000046 Ga0209256_1000046207 416
416 3300025304 Ga0209257_1001876 Ga0209257_10018769 416
417 3300025899 Ga0207642_10016176 Ga0207642_100161762 416
418 3300025907 Ga0207645_10003767 Ga0207645_100037675 416
419 3300025907 Ga0207645_10042493 Ga0207645_100424932 416
420 3300025909 Ga0207705_10000049 Ga0207705_1000004927 416
421 3300025909 Ga0207705_10000119 Ga0207705_1000011915 416
422 3300025909 Ga0207705_10001719 Ga0207705_1000171910 416
423 3300025914 Ga0207671_10132848 Ga0207671_101328482 416
424 3300025919 Ga0207657_10003143 Ga0207657_100031437 416
425 3300025919 Ga0207657_10006615 Ga0207657_100066155 416
426 3300025921 Ga0207652_10059575 Ga0207652_100595752 416
427 3300025927 Ga0207687_10000956 Ga0207687_1000095614 416
428 3300025931 Ga0207644_10034448 Ga0207644_100344482 416
429 3300025932 Ga0207690_10015611 Ga0207690_100156112 416
430 3300025932 Ga0207690_10172506 Ga0207690_101725061 416
431 3300025933 Ga0207706_10004774 Ga0207706_100047746 416
432 3300025933 Ga0207706_10006596 Ga0207706_100065965 416
433 3300025935 Ga0207709_10000182 Ga0207709_1000018221 416
434 3300025938 Ga0207704_10000022 Ga0207704_1000002221 416
435 3300025942 Ga0207689_10002559 Ga0207689_1000255912 416
436 3300025942 Ga0207689_10009094 Ga0207689_100090944 416
437 3300025945 Ga0207679_10175427 Ga0207679_101754272 416
438 3300025949 Ga0207667_10000029 Ga0207667_10000029131 416
439 3300025949 Ga0207667_10023353 Ga0207667_100233535 416
440 3300025949 Ga0207667_10047624 Ga0207667_100476244 416
441 3300025960 Ga0207651_10000009 Ga0207651_1000000921 416
442 3300025961 Ga0207712_10030564 Ga0207712_100305643 416
443 3300025972 Ga0207668_10000361 Ga0207668_1000036112 416
444 3300025981 Ga0207640_10000359 Ga0207640_1000035922 416
445 3300025981 Ga0207640_10028087 Ga0207640_100280872 416
446 3300026023 Ga0207677_10000342 Ga0207677_100003428 416
447 3300026035 Ga0207703_10100419 Ga0207703_101004192 416
448 3300026041 Ga0207639_10008852 Ga0207639_100088522 416
449 3300026041 Ga0207639_10049818 Ga0207639_100498182 416
450 3300026041 Ga0207639_10175877 Ga0207639_101758772 416
451 3300026041 Ga0207639_10184815 Ga0207639_101848151 416
452 3300026067 Ga0207678_10000723 Ga0207678_1000072310 416
453 3300026078 Ga0207702_10084128 Ga0207702_100841283 416
454 3300026089 Ga0207648_10000084 Ga0207648_1000008457 416
455 3300026089 Ga0207648_10002133 Ga0207648_100021335 416
456 3300026142 Ga0207698_10003462 Ga0207698_100034624 416
457 3300028380 Ga0268265_10007983 Ga0268265_100079835 416
458 3300028381 Ga0268264_10010864 Ga0268264_100108642 416
459 3300031824 Ga0307413_10044149 Ga0307413_100441492 416
460 3300031852 Ga0307410_10000344 Ga0307410_100003447 416
461 3300031901 Ga0307406_10011939 Ga0307406_100119393 416
462 3300031911 Ga0307412_10021096 Ga0307412_100210963 416
463 3300031995 Ga0307409_100002352 Ga0307409_1000023523 416
464 3300032002 Ga0307416_100027476 Ga0307416_1000274763 416
465 3300032004 Ga0307414_10004490 Ga0307414_100044904 416
466 3300032004 Ga0307414_10041911 Ga0307414_100419112 416
467 3300032005 Ga0307411_10112684 Ga0307411_101126841 416
468 3300032126 Ga0307415_100005305 Ga0307415_1000053054 416
469 3300037312 Ga0395899_0001153 Ga0395899_0001153_5056_6459 416
470 3300037471 Ga0395905_0017945 Ga0395905_0017945_1472_2875 416
471 3300039437 Ga0436365_1058137 Ga0436365_1058137_28387_29802 416
472 3300041404 Ga0439436_0005769 Ga0439436_0005769_1701_3116 416
473 3300041406 Ga0439439_0013658 Ga0439439_0013658_356_1771 416
474 3300041410 Ga0439461_0000015 Ga0439461_0000015_9741_11159 416
475 3300041413 Ga0439465_0000240 Ga0439465_0000240_7364_8782 416
476 3300041997 Ga0439431_0000089 Ga0439431_0000089_8671_10089 416
477 3300042004 Ga0439445_0001011 Ga0439445_0001011_2821_4239 416
478 3300042006 Ga0439432_001016 Ga0439432_001016_645_2063 416
479 3300042012 Ga0439455_0000734 Ga0439455_0000734_2928_4331 416
480 3300042012 Ga0439455_0005821 Ga0439455_0005821_207_1610 416
481 3300042014 Ga0439457_005071 Ga0439457_005071_1557_2972 416
482 3300042015 Ga0439462_0001597 Ga0439462_0001597_2145_3563 416
483 3300042015 Ga0439462_0025685 Ga0439462_0025685_86_1495 416
484 3300042156 Ga0439446_0005043 Ga0439446_0005043_198_1613 416
485 3300042435 Ga0439434_0000049 Ga0439434_0000049_16160_17578 416
486 3300042435 Ga0439434_0011967 Ga0439434_0011967_1076_2491 416
487 3300044658 Ga0466972_0015501 Ga0466972_0015501_2214_3617 416
488 3300044683 Ga0466965_0006835 Ga0466965_0006835_1050_2453 416
489 3300044693 Ga0466961_0014915 Ga0466961_0014915_1947_3350 416
490 3300044693 Ga0466961_0045507 Ga0466961_0045507_462_1886 416
491 3300044694 Ga0466963_0034283 Ga0466963_0034283_1094_2497 416
492 3300045049 Ga0466959_0003186 Ga0466959_0003186_6800_8203 416
493 3300045836 Ga0466958_0003823 Ga0466958_0003823_38_1441 416
494 3300046471 Ga0495650_0000083 Ga0495650_0000083_168206_169612 416
495 3300046506 Ga0495583_0000351 Ga0495583_0000351_66453_67859 416
496 3300046536 Ga0495587_0017448 Ga0495587_0017448_1580_2995 416
497 3300046537 Ga0495598_0014638 Ga0495598_0014638_425_1834 416
498 3300046557 Ga0495622_0000745 Ga0495622_0000745_11496_12911 416
499 3300046616 Ga0495668_0014216 Ga0495668_0014216_424_1869 416
500 3300046691 Ga0495670_0000003 Ga0495670_0000003_181968_183383 416
501 3300046809 Ga0495600_0016538 Ga0495600_0016538_2862_4277 416
502 3300047472 Ga0495686_0017773 Ga0495686_0017773_2508_3923 416
503 3300048917 Ga0496114_0078383 Ga0496114_0078383_613_2067 416
504 3300048921 Ga0496118_0018893 Ga0496118_0018893_124_1527 416
505 3300048921 Ga0496118_0029306 Ga0496118_0029306_2226_3629 416
506 3300048923 Ga0496120_0059929 Ga0496120_0059929_387_1790 416
507 3300048926 Ga0496123_0039498 Ga0496123_0039498_1828_3231 416
508 3300048927 Ga0496124_0000817 Ga0496124_0000817_19237_20643 416
509 3300048927 Ga0496124_0002298 Ga0496124_0002298_13137_14543 416
510 3300048928 Ga0496125_0018732 Ga0496125_0018732_1564_2967 416
511 3300048929 Ga0496126_0000428 Ga0496126_0000428_7229_8662 416
512 3300048929 Ga0496126_0093798 Ga0496126_0093798_10_1413 416
513 3300053094 Ga0500566_0000788 Ga0500566_0000788_15585_17000 416
514 3300053096 Ga0500641_0013425 Ga0500641_0013425_1461_2876 416
515 3300053108 Ga0500562_014063 Ga0500562_014063_217_1632 416
516 3300053119 Ga0500595_001269 Ga0500595_001269_10575_11990 416
517 3300053121 Ga0500607_092075 Ga0500607_092075_30_1445 416
518 3300053133 Ga0500655_004136 Ga0500655_004136_173_1576 416
519 3300053139 Ga0500568_0018758 Ga0500568_0018758_481_1896 416
520 3300053177 Ga0500636_0004742 Ga0500636_0004742_2544_3950 416
521 3300053730 Ga0500645_001424 Ga0500645_001424_9963_11378 416
522 3300061719 Ga0466962_0000862 Ga0466962_0000862_1503_2906 416
523 iso_pu_bacteria 2643221579 2643905952 416
524 iso_pu_bacteria 2643221622 2644128482 416
525 iso_pu_bacteria 2739367664 2739651435 416
526 iso_pu_bacteria 2739367865 2740029908 416
527 iso_pu_bacteria 2843744320 2843744573 416
528 iso_pu_bacteria 2849573788 2849575656 416
529 iso_pu_bacteria 2857504554 2857507152 416
530 iso_pu_bacteria 2896429255 2896429318 416
531 iso_pu_bacteria 8002869464 8002870106 416
532 3300001989 JGI24739J22299_10000471 JGI24739J22299_100004712 417
533 3300001990 JGI24737J22298_10005103 JGI24737J22298_100051032 417
534 3300001990 JGI24737J22298_10005783 JGI24737J22298_100057833 417
535 3300001990 JGI24737J22298_10009895 JGI24737J22298_100098952 417
536 3300001991 JGI24743J22301_10000488 JGI24743J22301_100004882 417
537 3300003215 JGI25153J46596_10000006 JGI25153J46596_1000000612 417
538 3300005262 Ga0065165_1001878 Ga0065165_10018786 417
539 3300005327 Ga0070658_10000002 Ga0070658_10000002442 417
540 3300005327 Ga0070658_10012376 Ga0070658_100123762 417
541 3300005327 Ga0070658_10021972 Ga0070658_100219723 417
542 3300005327 Ga0070658_10081087 Ga0070658_100810873 417
543 3300005329 Ga0070683_100026592 Ga0070683_1000265922 417
544 3300005331 Ga0070670_100000539 Ga0070670_10000053918 417
545 3300005331 Ga0070670_100052103 Ga0070670_1000521031 417
546 3300005334 Ga0068869_100016693 Ga0068869_1000166933 417
547 3300005335 Ga0070666_10000317 Ga0070666_100003175 417
548 3300005335 Ga0070666_10001618 Ga0070666_100016182 417
549 3300005335 Ga0070666_10077527 Ga0070666_100775272 417
550 3300005336 Ga0070680_100000409 Ga0070680_1000004099 417
551 3300005337 Ga0070682_100067716 Ga0070682_1000677162 417
552 3300005339 Ga0070660_100000469 Ga0070660_10000046913 417
553 3300005339 Ga0070660_100008383 Ga0070660_1000083832 417
554 3300005339 Ga0070660_100010936 Ga0070660_1000109363 417
555 3300005339 Ga0070660_100013720 Ga0070660_1000137204 417
556 3300005344 Ga0070661_100000006 Ga0070661_10000000665 417
557 3300005344 Ga0070661_100001715 Ga0070661_1000017159 417
558 3300005344 Ga0070661_100015312 Ga0070661_1000153121 417
559 3300005345 Ga0070692_10000464 Ga0070692_1000046410 417
560 3300005354 Ga0070675_100019406 Ga0070675_1000194062 417
561 3300005355 Ga0070671_100002716 Ga0070671_10000271618 417
562 3300005355 Ga0070671_100009319 Ga0070671_1000093191 417
563 3300005355 Ga0070671_100016223 Ga0070671_1000162233 417
564 3300005356 Ga0070674_100005130 Ga0070674_1000051306 417
565 3300005364 Ga0070673_100002361 Ga0070673_1000023613 417
566 3300005364 Ga0070673_100030150 Ga0070673_1000301503 417
567 3300005364 Ga0070673_100044044 Ga0070673_1000440443 417
568 3300005366 Ga0070659_100004577 Ga0070659_1000045773 417
569 3300005366 Ga0070659_100007934 Ga0070659_1000079342 417
570 3300005366 Ga0070659_100075616 Ga0070659_1000756162 417
571 3300005366 Ga0070659_100128932 Ga0070659_1001289322 417
572 3300005367 Ga0070667_100001019 Ga0070667_10000101914 417
573 3300005367 Ga0070667_100010643 Ga0070667_1000106432 417
574 3300005435 Ga0070714_100239072 Ga0070714_1002390721 417
575 3300005436 Ga0070713_100005111 Ga0070713_1000051115 417
576 3300005455 Ga0070663_100025519 Ga0070663_1000255193 417
577 3300005456 Ga0070678_100031379 Ga0070678_1000313792 417
578 3300005457 Ga0070662_100002273 Ga0070662_1000022736 417
579 3300005457 Ga0070662_100023282 Ga0070662_1000232823 417
580 3300005457 Ga0070662_100043802 Ga0070662_1000438022 417
581 3300005530 Ga0070679_100009569 Ga0070679_1000095696 417
582 3300005530 Ga0070679_100146989 Ga0070679_1001469892 417
583 3300005530 Ga0070679_100244435 Ga0070679_1002444351 417
584 3300005535 Ga0070684_100003155 Ga0070684_1000031552 417
585 3300005539 Ga0068853_100041339 Ga0068853_1000413393 417
586 3300005543 Ga0070672_100010344 Ga0070672_1000103444 417
587 3300005544 Ga0070686_100000128 Ga0070686_10000012817 417
588 3300005548 Ga0070665_100000123 Ga0070665_10000012328 417
589 3300005548 Ga0070665_100002188 Ga0070665_1000021882 417
590 3300005563 Ga0068855_100016089 Ga0068855_1000160891 417
591 3300005563 Ga0068855_100018131 Ga0068855_1000181312 417
592 3300005564 Ga0070664_100000811 Ga0070664_10000081110 417
593 3300005577 Ga0068857_100001431 Ga0068857_1000014313 417
594 3300005577 Ga0068857_100002408 Ga0068857_1000024083 417
595 3300005577 Ga0068857_100106544 Ga0068857_1001065442 417
596 3300005578 Ga0068854_100045945 Ga0068854_1000459452 417
597 3300005578 Ga0068854_100092980 Ga0068854_1000929802 417
598 3300005578 Ga0068854_100101741 Ga0068854_1001017412 417
599 3300005614 Ga0068856_100241377 Ga0068856_1002413772 417
600 3300005616 Ga0068852_100000968 Ga0068852_1000009683 417
601 3300005616 Ga0068852_100129571 Ga0068852_1001295712 417
602 3300005616 Ga0068852_100146978 Ga0068852_1001469782 417
603 3300005616 Ga0068852_100188373 Ga0068852_1001883731 417
604 3300005618 Ga0068864_100005111 Ga0068864_10000511110 417
605 3300005618 Ga0068864_100007745 Ga0068864_1000077452 417
606 3300005841 Ga0068863_100001531 Ga0068863_10000153114 417
607 3300005841 Ga0068863_100005902 Ga0068863_1000059023 417
608 3300005841 Ga0068863_100107891 Ga0068863_1001078912 417
609 3300005842 Ga0068858_100001485 Ga0068858_10000148510 417
610 3300005842 Ga0068858_100008478 Ga0068858_1000084781 417
611 3300005842 Ga0068858_100192089 Ga0068858_1001920892 417
612 3300005843 Ga0068860_100120419 Ga0068860_1001204192 417
613 3300005985 Ga0081539_10031379 Ga0081539_100313792 417
614 3300006028 Ga0070717_10027825 Ga0070717_100278253 417
615 3300006358 Ga0068871_100027867 Ga0068871_1000278673 417
616 3300006847 Ga0075431_100031857 Ga0075431_1000318572 417
617 3300006881 Ga0068865_100047801 Ga0068865_1000478012 417
618 3300009094 Ga0111539_10264290 Ga0111539_102642902 417
619 3300009098 Ga0105245_10046500 Ga0105245_100465003 417
620 3300009148 Ga0105243_10083358 Ga0105243_100833582 417
621 3300009176 Ga0105242_10076374 Ga0105242_100763741 417
622 3300011119 Ga0105246_10035142 Ga0105246_100351421 417
623 3300013100 Ga0157373_10028129 Ga0157373_100281293 417
624 3300013102 Ga0157371_10004369 Ga0157371_100043693 417
625 3300013105 Ga0157369_10001381 Ga0157369_1000138118 417
626 3300013306 Ga0163162_10009616 Ga0163162_100096164 417
627 3300013307 Ga0157372_10006300 Ga0157372_100063007 417
628 3300013308 Ga0157375_10102974 Ga0157375_101029742 417
629 3300013308 Ga0157375_10190745 Ga0157375_101907452 417
630 3300014325 Ga0163163_10026418 Ga0163163_100264184 417
631 3300014968 Ga0157379_10126916 Ga0157379_101269162 417
632 3300014969 Ga0157376_10142341 Ga0157376_101423412 417
633 3300021358 Ga0213873_10000006 Ga0213873_10000006117 417
634 3300021384 Ga0213876_10000004 Ga0213876_10000004623 417
635 3300025297 Ga0209758_1000001 Ga0209758_10000011814 417
636 3300025903 Ga0207680_10000146 Ga0207680_100001469 417
637 3300025903 Ga0207680_10016584 Ga0207680_100165842 417
638 3300025903 Ga0207680_10040712 Ga0207680_100407121 417
639 3300025904 Ga0207647_10002600 Ga0207647_100026007 417
640 3300025904 Ga0207647_10008931 Ga0207647_100089312 417
641 3300025904 Ga0207647_10018563 Ga0207647_100185633 417
642 3300025909 Ga0207705_10000008 Ga0207705_10000008349 417
643 3300025909 Ga0207705_10000096 Ga0207705_1000009650 417
644 3300025909 Ga0207705_10002489 Ga0207705_1000248910 417
645 3300025909 Ga0207705_10014833 Ga0207705_100148333 417
646 3300025909 Ga0207705_10027202 Ga0207705_100272022 417
647 3300025909 Ga0207705_10065423 Ga0207705_100654232 417
648 3300025909 Ga0207705_10105185 Ga0207705_101051852 417
649 3300025909 Ga0207705_10198847 Ga0207705_101988471 417
650 3300025909 Ga0207705_10201488 Ga0207705_102014881 417
651 3300025913 Ga0207695_10020117 Ga0207695_100201174 417
652 3300025917 Ga0207660_10000281 Ga0207660_1000028120 417
653 3300025917 Ga0207660_10016391 Ga0207660_100163912 417
654 3300025917 Ga0207660_10076546 Ga0207660_100765462 417
655 3300025919 Ga0207657_10007434 Ga0207657_100074347 417
656 3300025919 Ga0207657_10012059 Ga0207657_100120594 417
657 3300025919 Ga0207657_10026275 Ga0207657_100262752 417
658 3300025919 Ga0207657_10026961 Ga0207657_100269612 417
659 3300025919 Ga0207657_10033965 Ga0207657_100339653 417
660 3300025919 Ga0207657_10066554 Ga0207657_100665543 417
661 3300025920 Ga0207649_10000058 Ga0207649_1000005868 417
662 3300025920 Ga0207649_10006083 Ga0207649_100060832 417
663 3300025920 Ga0207649_10014623 Ga0207649_100146233 417
664 3300025920 Ga0207649_10038795 Ga0207649_100387952 417
665 3300025920 Ga0207649_10062053 Ga0207649_100620532 417
666 3300025921 Ga0207652_10005962 Ga0207652_100059627 417
667 3300025921 Ga0207652_10020011 Ga0207652_100200112 417
668 3300025921 Ga0207652_10027153 Ga0207652_100271533 417
669 3300025924 Ga0207694_10108870 Ga0207694_101088702 417
670 3300025925 Ga0207650_10026483 Ga0207650_100264833 417
671 3300025926 Ga0207659_10022052 Ga0207659_100220522 417
672 3300025929 Ga0207664_10080006 Ga0207664_100800062 417
673 3300025931 Ga0207644_10001983 Ga0207644_100019832 417
674 3300025931 Ga0207644_10005102 Ga0207644_100051022 417
675 3300025931 Ga0207644_10017258 Ga0207644_100172582 417
676 3300025931 Ga0207644_10108669 Ga0207644_101086692 417
677 3300025932 Ga0207690_10006289 Ga0207690_100062893 417
678 3300025932 Ga0207690_10043130 Ga0207690_100431302 417
679 3300025932 Ga0207690_10083913 Ga0207690_100839132 417
680 3300025933 Ga0207706_10005164 Ga0207706_100051646 417
681 3300025933 Ga0207706_10024573 Ga0207706_100245732 417
682 3300025937 Ga0207669_10007965 Ga0207669_100079653 417
683 3300025938 Ga0207704_10031621 Ga0207704_100316212 417
684 3300025938 Ga0207704_10036648 Ga0207704_100366481 417
685 3300025940 Ga0207691_10004514 Ga0207691_100045144 417
686 3300025940 Ga0207691_10044587 Ga0207691_100445874 417
687 3300025941 Ga0207711_10000047 Ga0207711_10000047128 417
688 3300025941 Ga0207711_10000055 Ga0207711_1000005528 417
689 3300025942 Ga0207689_10005187 Ga0207689_100051877 417
690 3300025944 Ga0207661_10014773 Ga0207661_100147732 417
691 3300025944 Ga0207661_10026409 Ga0207661_100264094 417
692 3300025945 Ga0207679_10086166 Ga0207679_100861662 417
693 3300025949 Ga0207667_10019369 Ga0207667_100193693 417
694 3300025960 Ga0207651_10004624 Ga0207651_100046244 417
695 3300025960 Ga0207651_10026085 Ga0207651_100260853 417
696 3300025981 Ga0207640_10016281 Ga0207640_100162813 417
697 3300025981 Ga0207640_10095104 Ga0207640_100951042 417
698 3300025986 Ga0207658_10029705 Ga0207658_100297052 417
699 3300025986 Ga0207658_10068577 Ga0207658_100685772 417
700 3300026023 Ga0207677_10000268 Ga0207677_1000026823 417
701 3300026023 Ga0207677_10004212 Ga0207677_100042124 417
702 3300026023 Ga0207677_10004573 Ga0207677_100045734 417
703 3300026035 Ga0207703_10001319 Ga0207703_1000131910 417
704 3300026035 Ga0207703_10001416 Ga0207703_1000141611 417
705 3300026041 Ga0207639_10023392 Ga0207639_100233922 417
706 3300026067 Ga0207678_10007111 Ga0207678_100071113 417
707 3300026067 Ga0207678_10048579 Ga0207678_100485792 417
708 3300026067 Ga0207678_10050950 Ga0207678_100509502 417
709 3300026078 Ga0207702_10017845 Ga0207702_100178454 417
710 3300026078 Ga0207702_10087415 Ga0207702_100874151 417
711 3300026078 Ga0207702_10201994 Ga0207702_102019941 417
712 3300026078 Ga0207702_10221941 Ga0207702_102219412 417
713 3300026088 Ga0207641_10006890 Ga0207641_100068903 417
714 3300026088 Ga0207641_10033244 Ga0207641_100332443 417
715 3300026088 Ga0207641_10098395 Ga0207641_100983952 417
716 3300026088 Ga0207641_10182843 Ga0207641_101828432 417
717 3300026089 Ga0207648_10002612 Ga0207648_100026122 417
718 3300026089 Ga0207648_10007899 Ga0207648_100078995 417
719 3300026095 Ga0207676_10001627 Ga0207676_1000162715 417
720 3300026116 Ga0207674_10000324 Ga0207674_1000032421 417
721 3300026116 Ga0207674_10002832 Ga0207674_100028329 417
722 3300026116 Ga0207674_10036251 Ga0207674_100362512 417
723 3300026116 Ga0207674_10108811 Ga0207674_101088112 417
724 3300026121 Ga0207683_10009065 Ga0207683_100090654 417
725 3300026121 Ga0207683_10035180 Ga0207683_100351803 417
726 3300026142 Ga0207698_10002973 Ga0207698_100029736 417
727 3300026142 Ga0207698_10042168 Ga0207698_100421682 417
728 3300028379 Ga0268266_10000262 Ga0268266_1000026230 417
729 3300028379 Ga0268266_10004783 Ga0268266_100047836 417
730 3300028379 Ga0268266_10079967 Ga0268266_100799672 417
731 3300031731 Ga0307405_10002622 Ga0307405_100026222 417
732 3300031824 Ga0307413_10001788 Ga0307413_100017883 417
733 3300031852 Ga0307410_10000189 Ga0307410_100001894 417
734 3300031903 Ga0307407_10000110 Ga0307407_100001106 417
735 3300031995 Ga0307409_100000222 Ga0307409_1000002227 417
736 3300032004 Ga0307414_10000801 Ga0307414_100008017 417
737 3300032005 Ga0307411_10000098 Ga0307411_100000987 417
738 3300032126 Ga0307415_100017355 Ga0307415_1000173553 417
739 3300035170 Ga0373943_0007056 Ga0373943_0007056_1240_2661 417
740 3300037068 Ga0373925_0083063 Ga0373925_0083063_633_2054 417
741 3300037312 Ga0395899_0015175 Ga0395899_0015175_3824_5266 417
742 3300037312 Ga0395899_0040477 Ga0395899_0040477_1531_2961 417
743 3300037312 Ga0395899_0051958 Ga0395899_0051958_406_1833 417
744 3300037312 Ga0395899_0079032 Ga0395899_0079032_949_2376 417
745 3300037312 Ga0395899_0087340 Ga0395899_0087340_744_2177 417
746 3300037312 Ga0395899_0110216 Ga0395899_0110216_52_1473 417
747 3300037418 Ga0395900_0031874 Ga0395900_0031874_2583_3992 417
748 3300037418 Ga0395900_0057745 Ga0395900_0057745_2422_3864 417
749 3300037418 Ga0395900_0146981 Ga0395900_0146981_259_1686 417
750 3300037418 Ga0395900_0148665 Ga0395900_0148665_605_2044 417
751 3300037466 Ga0395898_0019495 Ga0395898_0019495_4595_6034 417
752 3300037466 Ga0395898_0039431 Ga0395898_0039431_2771_4180 417
753 3300037466 Ga0395898_0091024 Ga0395898_0091024_1360_2787 417
754 3300037466 Ga0395898_0091503 Ga0395898_0091503_21_1448 417
755 3300037466 Ga0395898_0243140 Ga0395898_0243140_191_1633 417
756 3300037471 Ga0395905_0010941 Ga0395905_0010941_5588_7009 417
757 3300037471 Ga0395905_0017221 Ga0395905_0017221_5233_6657 417
758 3300037471 Ga0395905_0029097 Ga0395905_0029097_2246_3676 417
759 3300037471 Ga0395905_0066713 Ga0395905_0066713_1251_2660 417
760 3300037471 Ga0395905_0085798 Ga0395905_0085798_24_1433 417
761 3300037471 Ga0395905_0094585 Ga0395905_0094585_640_2079 417
762 3300037471 Ga0395905_0096056 Ga0395905_0096056_948_2357 417
763 3300037471 Ga0395905_0115708 Ga0395905_0115708_1021_2448 417
764 3300037471 Ga0395905_0127673 Ga0395905_0127673_887_2296 417
765 3300037471 Ga0395905_0165506 Ga0395905_0165506_215_1654 417
766 3300037471 Ga0395905_0190283 Ga0395905_0190283_206_1615 417
767 3300037853 Ga0436364_0322741 Ga0436364_0322741_7443_8882 417
768 3300038443 Ga0395901_0002032 Ga0395901_0002032_16725_18155 417
769 3300038443 Ga0395901_0014089 Ga0395901_0014089_2753_4174 417
770 3300038443 Ga0395901_0018693 Ga0395901_0018693_1918_3345 417
771 3300038443 Ga0395901_0023927 Ga0395901_0023927_929_2356 417
772 3300038443 Ga0395901_0045429 Ga0395901_0045429_2052_3479 417
773 3300038443 Ga0395901_0058906 Ga0395901_0058906_132_1574 417
774 3300038443 Ga0395901_0095651 Ga0395901_0095651_1225_2664 417
775 3300038443 Ga0395901_0102178 Ga0395901_0102178_590_2023 417
776 3300038443 Ga0395901_0126271 Ga0395901_0126271_1077_2486 417
777 3300038443 Ga0395901_0166357 Ga0395901_0166357_173_1603 417
778 3300038443 Ga0395901_0206571 Ga0395901_0206571_145_1554 417
779 3300038443 Ga0395901_0217784 Ga0395901_0217784_495_1934 417
780 3300039437 Ga0436365_0862833 Ga0436365_0862833_3566_5020 417
781 3300039437 Ga0436365_1289842 Ga0436365_1289842_2954_4381 417
782 3300039453 Ga0436362_0554113 Ga0436362_0554113_10447_11901 417
783 3300042005 Ga0439448_0010647 Ga0439448_0010647_240_1649 417
784 3300042157 Ga0439458_0001070 Ga0439458_0001070_1866_3275 417
785 3300044656 Ga0466969_0018424 Ga0466969_0018424_896_2317 417
786 3300044684 Ga0466966_0000001 Ga0466966_0000001_81755_83173 417
787 3300044684 Ga0466966_0022066 Ga0466966_0022066_1045_2466 417
788 3300044684 Ga0466966_0078859 Ga0466966_0078859_436_1857 417
789 3300044693 Ga0466961_0085861 Ga0466961_0085861_535_1959 417
790 3300044694 Ga0466963_0015391 Ga0466963_0015391_79_1500 417
791 3300044694 Ga0466963_0066888 Ga0466963_0066888_365_1789 417
792 3300044719 Ga0466971_0002712 Ga0466971_0002712_5956_7377 417
793 3300044735 Ga0466968_0001227 Ga0466968_0001227_5712_7133 417
794 3300044765 Ga0466970_0012832 Ga0466970_0012832_2102_3523 417
795 3300044765 Ga0466970_0014513 Ga0466970_0014513_721_2142 417
796 3300044765 Ga0466970_0072803 Ga0466970_0072803_180_1601 417
797 3300044842 Ga0466957_0044557 Ga0466957_0044557_39_1463 417
798 3300044842 Ga0466957_0058337 Ga0466957_0058337_356_1777 417
799 3300044842 Ga0466957_0147613 Ga0466957_0147613_52_1476 417
800 3300044901 Ga0466960_0024108 Ga0466960_0024108_371_1795 417
801 3300045049 Ga0466959_0020078 Ga0466959_0020078_1925_3346 417
802 3300045051 Ga0451576_0000122 Ga0451576_0000122_142519_143940 417
803 3300045976 Ga0466967_0005507 Ga0466967_0005507_2402_3835 417
804 3300045976 Ga0466967_0017259 Ga0466967_0017259_3464_4885 417
805 3300046537 Ga0495598_0003551 Ga0495598_0003551_998_2422 417
806 3300046539 Ga0495621_0000236 Ga0495621_0000236_4451_5875 417
807 3300046684 Ga0495669_0005168 Ga0495669_0005168_2395_3819 417
808 3300046691 Ga0495670_0007460 Ga0495670_0007460_2940_4364 417
809 3300046691 Ga0495670_0017915 Ga0495670_0017915_1299_2702 417
810 3300047443 Ga0495687_000973 Ga0495687_000973_13546_14976 417
811 3300048904 Ga0496101_0003459 Ga0496101_0003459_4187_5614 417
812 3300048905 Ga0496102_0062683 Ga0496102_0062683_1681_3108 417
813 3300048907 Ga0496104_0029517 Ga0496104_0029517_116_1543 417
814 3300048909 Ga0496106_0049050 Ga0496106_0049050_749_2176 417
815 3300048910 Ga0496107_0001705 Ga0496107_0001705_9646_11070 417
816 3300048911 Ga0496108_0059920 Ga0496108_0059920_1561_2988 417
817 3300048912 Ga0496109_0000617 Ga0496109_0000617_25787_27211 417
818 3300048913 Ga0496110_0003274 Ga0496110_0003274_7248_8672 417
819 3300048913 Ga0496110_0111650 Ga0496110_0111650_235_1662 417
820 3300048914 Ga0496111_0009315 Ga0496111_0009315_2845_4269 417
821 3300048914 Ga0496111_0090034 Ga0496111_0090034_359_1783 417
822 3300048915 Ga0496112_0000133 Ga0496112_0000133_4184_5608 417
823 3300048916 Ga0496113_0011396 Ga0496113_0011396_3819_5243 417
824 3300048916 Ga0496113_0078648 Ga0496113_0078648_792_2219 417
825 3300049571 Ga0501034_0191477 Ga0501034_0191477_180_1607 417
826 3300050510 nmdc:mga06r32_4573_c1 nmdc:mga06r32_4573_c1_8128_9534 417
827 3300053139 Ga0500568_0005719 Ga0500568_0005719_4430_5878 417
828 3300005985 Ga0081539_10018358 Ga0081539_100183585 418
829 3300025299 Ga0209256_1004121 Ga0209256_10041217 418
830 3300046460 Ga0495638_0000440 Ga0495638_0000440_28002_29402 418
831 3300046471 Ga0495650_0000068 Ga0495650_0000068_99_1499 418
832 3300046520 Ga0495637_0015019 Ga0495637_0015019_1928_3328 418
833 3300046524 Ga0495648_0003568 Ga0495648_0003568_1867_3267 418
834 3300046525 Ga0495663_0016170 Ga0495663_0016170_22_1422 418
835 3300046530 Ga0495654_0000042 Ga0495654_0000042_39900_41300 418
836 3300046660 Ga0495625_0041223 Ga0495625_0041223_943_2343 418
837 3300046694 Ga0495649_0000092 Ga0495649_0000092_65417_66850 418
838 3300047320 Ga0495672_0005693 Ga0495672_0005693_8291_9691 418
839 3300047469 Ga0495673_0017813 Ga0495673_0017813_253_1653 418
840 3300048927 Ga0496124_0019689 Ga0496124_0019689_1234_2634 418
841 3300048929 Ga0496126_0009898 Ga0496126_0009898_8592_9992 418
842 3300053088 Ga0500644_0000738 Ga0500644_0000738_6598_7998 418
843 3300053104 Ga0500556_0001960 Ga0500556_0001960_2442_3842 418
844 3300053136 Ga0500559_0000412 Ga0500559_0000412_22067_23467 418
845 3300053138 Ga0500564_002850 Ga0500564_002850_1936_3336 418
846 3300053151 Ga0500604_0000021 Ga0500604_0000021_31191_32642 418
847 3300053153 Ga0500616_0009393 Ga0500616_0009393_3175_4575 418
848 3300053156 Ga0500622_0087674 Ga0500622_0087674_29_1462 418
849 3300053158 Ga0500627_0015259 Ga0500627_0015259_221_1621 418
850 3300053730 Ga0500645_004093 Ga0500645_004093_2776_4176 418
851 iso_pu_bacteria 2582581279 2585147647 418
852 iso_pu_bacteria 2791355048 2792460479 418
853 iso_pu_bacteria 2849560528 2849565541 418
854 iso_pu_bacteria 2851153111 2851153255 418
855 iso_pu_bacteria 2884960567 2884961854 418
856 iso_pu_bacteria 2898329390 2898331719 418
857 3300005366 Ga0070659_100034542 Ga0070659_1000345423 419
858 3300005617 Ga0068859_100033133 Ga0068859_1000331333 419
859 3300006931 Ga0097620_100033133 Ga0097620_1000331333 419
860 3300026075 Ga0207708_10050546 Ga0207708_100505462 419
861 3300046506 Ga0495583_0000696 Ga0495583_0000696_14718_16130 419
862 3300053103 Ga0500555_000086 Ga0500555_000086_13613_15025 419
863 iso_pu_bacteria 2643221699 2644552196 419
864 iso_pu_bacteria 2775507255 2778123639 419
865 iso_pu_bacteria 2808606401 2809061991 419
866 iso_pu_bacteria 2852680915 2852684510 419
867 3300009093 Ga0105240_10025879 Ga0105240_100258795 420
868 3300032004 Ga0307414_10062749 Ga0307414_100627492 420
869 3300046460 Ga0495638_0016451 Ga0495638_0016451_1557_2963 420
870 3300046524 Ga0495648_0055353 Ga0495648_0055353_78_1487 420
871 3300048920 Ga0496117_0037622 Ga0496117_0037622_249_1667 420
872 iso_pu_bacteria 2946787523 2946788976 420
873 iso_pu_bacteria 2585428106 2587917597 421
874 3300003214 JGI25165J46597_1000138 JGI25165J46597_100013894 422
875 3300025261 Ga0209233_1000182 Ga0209233_1000182103 422
876 2162886007 SwRhRL2b_contig_1372803 SwRhRL2b_0969.00010520 423
877 3300005289 Ga0065704_10005955 Ga0065704_100059555 423
878 3300006051 Ga0075364_10040415 Ga0075364_100404152 423
879 3300009101 Ga0105247_10002615 Ga0105247_100026159 423
880 3300028800 Ga0265338_10044028 Ga0265338_100440283 423
881 3300046512 Ga0495610_0000131 Ga0495610_0000131_59878_61290 423
882 3300048911 Ga0496108_0000315 Ga0496108_0000315_7355_8767 423
883 3300048924 Ga0496121_0000714 Ga0496121_0000714_31206_32618 423
884 3300048928 Ga0496125_0021737 Ga0496125_0021737_2467_3879 423
885 3300048929 Ga0496126_0021811 Ga0496126_0021811_2147_3559 423
886 3300053157 Ga0500624_000101 Ga0500624_000101_32082_33497 423
887 iso_pu_bacteria 2990265787 2990266822 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

28

479

0.95

PF07690

MFS_1

Major Facilitator Superfamily

32

400

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.824 17 415
4yb9-assembly1.cif.gz_D crystal structure of the bovine fructose transporter glut5 in an open inward-facing conformation 0.8229 18 412
4gby-assembly1.cif.gz_A the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose 0.8179 10 421
4ja3-assembly2.cif.gz_B partially occluded inward open conformation of the xylose transporter xyle from e. coli 0.8088 12 417
6rw3-assembly1.cif.gz_A the molecular basis for sugar import in malaria parasites. 0.8073 14 417
ID Description Score Start End Superfamily
af_Q54UC8_260_478_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9146 221 414 1.20.1250.20
af_Q54YF6_394_628_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8988 206 421 1.20.1250.20
af_K7K432_481_729_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8978 209 421 1.20.1250.20
af_C7J4X0_2_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8959 231 421 1.20.1250.20
af_C0PE06_523_755_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8909 230 421 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7S0J6I8-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8933 215 421 GO:0016020
GO:0022857
AF-A0A842H0Q1-F1-model_v4 deleted 0.8834 14 421
AF-X1DEU3-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8824 149 414 GO:0016020
GO:0022857
GO:1904659
AF-A0A642UL38-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.876 13 421 GO:0015791
GO:0015798
GO:0016020
GO:0022857
AF-A0A0A2L2V9-F1-model_v4 Major facilitator superfamily domain, general substrate transporter 0.8671 13 421 GO:0015791
GO:0015798
GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
77.17 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map