F484744

General Info

Members Datasets Scaffolds Average Seq Length
887 752 1774 250

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3004239961|3004243122
Length 277
Sequence LPCCSWCLPNGSCASASRRTESRIMILKDRIAVVTGAGSGIGRAGAMIMGREGAVVVIADRDQAAGEATASDIRAAGGRAEAIKTDVADDAAIEQLIAGTLDRHGRIDILHNHAGIQIGGTLTEVEVGGMDASWRVNVRAQFLAARQVMPSMIAQGGGVILNTASNSGVFYDREMIAYATSKHAVVAMTRQMSLDYARHNVRINALCPGWVDTPFNEPFIAQMGGRGAIETYVRTKIPMGRWASADEIAEAILFLVSDRSSFMTGQALVIDGGESIG

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
56 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
57 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
58 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
85 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
97 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
106 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
107 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
108 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
109 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
110 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
111 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
112 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
113 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
114 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
198 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
199 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
200 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
201 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
206 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
207 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
211 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
214 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
215 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
216 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
219 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
220 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
221 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
222 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
223 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
224 2509276019 Ensifer aridi TW10 Isolate Nodule
225 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
226 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
227 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
228 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
229 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
230 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
231 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
232 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
233 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
234 2512875024
235 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
236 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
237 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
238 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
239 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
240 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
241 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
242 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
243 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
244 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
245 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
246 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
247 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
248 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
249 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
250 2516143018 Ensifer sp. BR816 Isolate Nodule
251 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
252 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
253 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
254 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
255 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
256 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
257 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
258 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
259 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
260 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
261 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
262 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
263 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
264 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
265 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
266 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
267 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
268 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
269 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
270 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
271 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
272 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
273 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
274 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
275 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
276 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
277 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
278 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
279 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
280 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
281 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
282 2643221557 Ensifer sp. Root558 Isolate Unclassified
283 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
284 2643221599 Rhizobium sp. Root708 Isolate Unclassified
285 2643221610 Ensifer sp. Root74 Isolate Unclassified
286 2643221618 Ensifer sp. Root231 Isolate Unclassified
287 2643221626 Ensifer sp. Root31 Isolate Unclassified
288 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
289 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
290 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
291 2643221655 Ensifer sp. Root1252 Isolate Unclassified
292 2643221659 Ensifer sp. Root127 Isolate Unclassified
293 2643221668 Ensifer sp. Root423 Isolate Unclassified
294 2643221675 Ensifer sp. Root1298 Isolate Unclassified
295 2643221680 Ensifer sp. Root1312 Isolate Unclassified
296 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
297 2643221698 Ensifer sp. Root142 Isolate Unclassified
298 2643221712 Ensifer sp. Root258 Isolate Unclassified
299 2643221723 Ensifer sp. Root278 Isolate Unclassified
300 2643221726 Ensifer sp. Root954 Isolate Unclassified
301 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
302 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
303 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
304 2738541293 Rhizobium sp. GV031 Isolate Unclassified
305 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
306 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
307 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
308 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
309 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
310 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
311 2791355260 Rhizobium sp. L9 Isolate Nodule
312 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
313 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
314 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
315 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
316 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
317 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
318 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
319 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
320 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
321 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
322 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
323 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
324 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
325 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
326 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
327 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
328 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
329 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
330 2844163670 Ensifer sp. 1H6 Isolate Unclassified
331 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
332 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
333 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
334 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
335 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
336 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
337 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
338 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
339 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
340 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
341 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
342 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
343 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
344 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
345 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
346 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
347 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
348 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
349 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
350 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
351 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
352 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
353 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
354 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
355 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
356 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
357 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
358 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
359 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
360 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
361 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
362 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
363 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
364 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
365 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
366 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
367 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
368 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
369 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
370 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
371 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
372 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
373 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
374 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
375 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
376 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
377 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
378 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
379 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
380 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
381 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
382 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
383 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
384 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
385 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
386 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
387 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
388 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
389 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
390 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
391 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
392 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
393 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
394 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
395 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
396 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
397 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
398 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
399 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
400 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
401 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
402 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
403 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
404 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
405 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
406 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
407 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
408 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
409 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
410 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
411 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
412 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
413 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
414 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
415 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
416 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
417 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
418 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
419 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
420 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
421 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
422 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
423 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
424 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
425 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
426 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
427 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
428 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
429 2909042592 Labrys sp. LIt4 Isolate Nodule
430 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
431 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
432 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
433 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
434 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
435 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
436 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
437 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
438 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
439 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
440 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
441 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
442 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
443 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
444 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
445 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
446 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
447 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
448 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
449 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
450 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
451 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
452 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
453 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
454 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
455 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
456 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
457 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
458 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
459 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
460 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
461 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
462 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
463 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
464 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
465 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
466 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
467 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
468 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
469 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
470 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
471 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
472 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
473 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
474 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
475 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
476 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
477 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
478 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
479 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
480 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
481 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
482 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
483 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
484 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
485 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
486 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
487 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
488 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
489 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
490 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
491 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
492 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
493 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
494 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
495 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
496 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
497 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
498 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
499 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
500 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
501 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
502 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
503 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
504 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
505 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
506 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
507 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
508 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
509 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
510 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
511 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
512 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
513 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
514 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
515 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
516 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
517 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
518 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
519 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
520 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
521 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
522 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
523 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
524 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
525 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
526 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
527 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
528 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
529 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
530 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
531 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
532 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
533 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
534 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
535 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
536 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
537 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
538 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
539 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
540 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
541 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
542 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
543 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
544 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
545 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
546 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
547 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
548 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
549 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
550 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
551 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
552 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
553 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
554 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
555 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
556 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
557 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
558 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
559 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
560 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
561 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
562 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
563 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
564 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
565 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
566 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
567 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
568 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
569 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
570 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
571 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
572 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
573 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
574 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
575 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
576 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
577 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
578 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
579 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
580 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
581 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
582 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
583 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
584 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
585 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
586 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
587 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
588 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
589 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
590 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
591 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
592 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
593 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
594 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
595 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
596 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
597 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
598 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
599 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
600 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
601 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
602 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
603 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
604 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
605 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
606 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
607 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
608 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
609 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
610 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
611 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
612 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
613 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
614 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
615 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
616 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
617 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
618 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
619 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
620 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
621 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
622 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
623 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
624 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
625 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
626 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
627 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
628 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
629 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
630 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
631 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
632 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
633 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
634 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
635 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
636 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
637 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
638 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
639 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
640 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
641 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
642 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
643 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
644 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
645 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
646 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
647 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
648 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
649 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
650 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
651 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
652 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
653 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
654 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
655 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
656 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
657 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
658 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
659 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
660 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
661 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
662 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
663 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
664 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
665 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
666 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
667 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
668 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
669 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
670 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
671 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
672 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
673 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
674 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
675 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
676 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
677 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
678 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
679 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
680 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
681 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
682 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
683 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
684 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
685 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
686 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
687 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
688 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
689 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
690 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
691 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
692 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
693 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
694 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
695 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
696 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
697 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
698 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
699 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
700 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
701 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
702 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
703 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
704 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
705 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
706 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
707 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
708 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
709 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
710 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
711 3004167301 Mesorhizobium loti 582 Isolate Unclassified
712 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
713 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
714 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
715 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
716 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
717 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
718 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
719 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
720 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
721 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
722 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
723 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
724 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
725 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
726 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
727 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
728 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
729 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
730 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
731 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
732 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
733 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
734 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
735 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
736 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
737 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
738 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
739 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
740 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
741 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
742 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
743 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
744 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
745 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
746 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
747 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
748 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
749 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
750 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
751 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
752 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.57
Metatranscriptomes 0
Isolates 60.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.66
Nodule 51.86
Rhizoplane 2.93
Rhizosphere 15.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000008 3300002705 Bacteria 229035
2 JGI25162J39368_1000763 3300002737 Bacteria 21779
3 JGI25154J39366_1000050 3300002738 Bacteria 124480
4 JGI25158J39367_1000212 3300002739 Bacteria 13735
5 JGI25157J39369_1000028 3300002741 Bacteria 147384
6 JGI25152J39213_1000104 3300002773 Bacteria 59331
7 JGI25152J39213_1005787 3300002773 Bacteria 3514
8 JGI25152J39213_1020440 3300002773 Bacteria 1182
9 JGI25150J39212_1000078 3300002774 Bacteria 58894
10 JGI25159J45721_1000014 3300002987 Bacteria 147809
11 JGI25159J45721_1001409 3300002987 Bacteria 9986
12 JGI25151J46595_10000098 3300003187 Bacteria 117930
13 JGI25151J46595_10013855 3300003187 Bacteria 3615
14 JGI25151J46595_10027472 3300003187 Bacteria 2280
15 JGI25165J46597_1000034 3300003214 Bacteria 292458
16 JGI25165J46597_1000225 3300003214 Bacteria 78516
17 JGI25153J46596_10001165 3300003215 Bacteria 15900
18 JGI25153J46596_10051313 3300003215 Bacteria 1182
19 JGI25153J46596_10051323 3300003215 Bacteria 1182
20 rootH1_10032856 3300003316 Bacteria 2219
21 rootH2_10228021 3300003320 Bacteria 1290
22 rootL2_10007139 3300003322 Bacteria 8246
23 rootH1_10153169 3300003323 Bacteria 5176
24 JGI25160J50197_1000020 3300003354 Bacteria 232739
25 JGI25160J50197_1004499 3300003354 Bacteria 6016
26 JGI25160J50197_1019638 3300003354 Bacteria 2065
27 JGI25160J50197_1022418 3300003354 Bacteria 1851
28 JGI25161J50226_1000233 3300003374 Bacteria 33741
29 JGI25161J50226_1000377 3300003374 Bacteria 22446
30 Ga0055526_1008686 3300003771 Bacteria 5014
31 Ga0055526_1018083 3300003771 Bacteria 2652
32 Ga0055526_1020242 3300003771 Bacteria 2379
33 Ga0055524_1001223 3300003775 Bacteria 15182
34 Ga0055524_1006753 3300003775 Bacteria 4954
35 Ga0055524_1007851 3300003775 Bacteria 4490
36 Ga0055524_1016422 3300003775 Bacteria 2656
37 Ga0055524_1023316 3300003775 Bacteria 1996
38 Ga0055536_1016334 3300003781 Bacteria 2487
39 Ga0055528_1000275 3300003790 Bacteria 43696
40 Ga0055528_1013124 3300003790 Bacteria 3165
41 Ga0055528_1016049 3300003790 Bacteria 2670
42 Ga0055528_1022002 3300003790 Bacteria 1999
43 Ga0055540_1003295 3300003792 Bacteria 7886
44 Ga0055543_1000292 3300004625 Bacteria 35925
45 Ga0055543_1000717 3300004625 Bacteria 16806
46 Ga0065165_1000013 3300005262 Bacteria 301887
47 Ga0065165_1019104 3300005262 Bacteria 2459
48 Ga0065165_1057389 3300005262 Bacteria 1079
49 Ga0065715_10169551 3300005293 Bacteria 1554
50 Ga0070669_100696465 3300005353 Bacteria 857
51 Ga0070674_100366050 3300005356 Bacteria 1169
52 Ga0070663_100204968 3300005455 Bacteria 1541
53 Ga0070698_100082270 3300005471 Bacteria 3212
54 Ga0070697_100143396 3300005536 Bacteria 2010
55 Ga0070697_100462672 3300005536 Bacteria 1106
56 Ga0070665_100395465 3300005548 Bacteria 1390
57 Ga0070665_100395532 3300005548 Bacteria 1390
58 Ga0068862_100395243 3300005844 Bacteria 1292
59 Ga0075365_10000468 3300006038 Bacteria 15201
60 Ga0075365_10045118 3300006038 Bacteria 2890
61 Ga0075367_10014666 3300006178 Bacteria 4243
62 Ga0075369_10039935 3300006186 Bacteria 2005
63 Ga0075369_10060477 3300006186 Bacteria 1652
64 Ga0075433_10384468 3300006852 Bacteria 1239
65 Ga0079104_1001492 3300006946 Bacteria 15578
66 Ga0099826_10233372 3300006948 Bacteria 981
67 Ga0075435_100067742 3300007076 Bacteria 2907
68 Ga0105251_10012777 3300009011 Bacteria 4732
69 Ga0105250_10030425 3300009092 Bacteria 2170
70 Ga0105241_10080445 3300009174 Bacteria 2550
71 Ga0105237_10481732 3300009545 Bacteria 1247
72 Ga0105238_10202847 3300009551 Bacteria 1959
73 Ga0123341_1000012 3300009765 Bacteria 105056
74 Ga0105239_10038994 3300010375 Bacteria 5204
75 Ga0105239_10102623 3300010375 Bacteria 3165
76 Ga0105239_10111604 3300010375 Bacteria 3031
77 Ga0171463_1003 3300013249 Bacteria 695693
78 Ga0163162_10232708 3300013306 Bacteria 1973
79 Ga0163163_10063588 3300014325 Bacteria 3659
80 Ga0182008_10047383 3300014497 Bacteria 2136
81 Ga0182006_1013843 3300015261 Bacteria 3489
82 Ga0182007_10010250 3300015262 Bacteria 3716
83 Ga0183363_1042 3300015690 Bacteria 40813
84 Ga0163161_10314474 3300017792 Bacteria 1236
85 Ga0214543_1001113 3300021327 Bacteria 50390
86 Ga0228711_1000042 3300022739 Bacteria 85993
87 Ga0228710_1000046 3300022740 Bacteria 86044
88 Ga0209435_100020 3300025206 Bacteria 229105
89 Ga0209436_100007 3300025208 Bacteria 149841
90 Ga0209436_102676 3300025208 Bacteria 5172
91 Ga0209437_100183 3300025233 Bacteria 129519
92 Ga0207425_1000061 3300025245 Bacteria 138680
93 Ga0207425_1007114 3300025245 Bacteria 2989
94 Ga0209646_1000070 3300025246 Bacteria 229105
95 Ga0209026_1000057 3300025250 Bacteria 229105
96 Ga0209148_1007908 3300025254 Bacteria 2172
97 Ga0209759_1000047 3300025256 Bacteria 229105
98 Ga0209129_1000019 3300025258 Bacteria 460802
99 Ga0209129_1000134 3300025258 Bacteria 125870
100 Ga0209129_1001685 3300025258 Bacteria 11961
101 Ga0209129_1002994 3300025258 Bacteria 7699
102 Ga0209129_1008444 3300025258 Bacteria 2863
103 Ga0209233_1000028 3300025261 Bacteria 642062
104 Ga0209233_1000054 3300025261 Bacteria 439669
105 Ga0209673_1000132 3300025273 Bacteria 162349
106 Ga0209673_1002028 3300025273 Bacteria 15416
107 Ga0209673_1003790 3300025273 Bacteria 8588
108 Ga0209673_1020812 3300025273 Bacteria 2311
109 Ga0209130_1000001 3300025284 Bacteria 831557
110 Ga0209130_1000034 3300025284 Bacteria 302439
111 Ga0209130_1024232 3300025284 Bacteria 1327
112 Ga0209676_1011450 3300025292 Bacteria 3573
113 Ga0209676_1017125 3300025292 Bacteria 2579
114 Ga0209025_1000254 3300025294 Bacteria 125870
115 Ga0209025_1000311 3300025294 Bacteria 108141
116 Ga0209025_1002894 3300025294 Bacteria 17153
117 Ga0209025_1008442 3300025294 Bacteria 7412
118 Ga0209025_1010699 3300025294 Bacteria 6172
119 Ga0209025_1020474 3300025294 Bacteria 3618
120 Ga0209564_1000013 3300025295 Bacteria 775755
121 Ga0209564_1002059 3300025295 Bacteria 17332
122 Ga0209564_1003015 3300025295 Bacteria 12035
123 Ga0209564_1004731 3300025295 Bacteria 8150
124 Ga0209564_1008082 3300025295 Bacteria 5268
125 Ga0209564_1026511 3300025295 Bacteria 1912
126 Ga0209758_1000360 3300025297 Bacteria 81364
127 Ga0209758_1015387 3300025297 Bacteria 3965
128 Ga0209758_1021975 3300025297 Bacteria 2948
129 Ga0209256_1000805 3300025299 Bacteria 40172
130 Ga0209256_1001152 3300025299 Bacteria 29986
131 Ga0209256_1002303 3300025299 Bacteria 15994
132 Ga0209256_1003354 3300025299 Bacteria 11347
133 Ga0209256_1004736 3300025299 Bacteria 8318
134 Ga0207426_1000006 3300025302 Bacteria 1025969
135 Ga0207426_1000045 3300025302 Bacteria 422847
136 Ga0207426_1000457 3300025302 Bacteria 64140
137 Ga0209051_1001034 3300025303 Bacteria 26321
138 Ga0209051_1027785 3300025303 Bacteria 2247
139 Ga0209051_1034551 3300025303 Bacteria 1893
140 Ga0207713_1054922 3300025735 Bacteria 1558
141 Ga0207684_10218872 3300025910 Bacteria 1643
142 Ga0207671_10482882 3300025914 Bacteria 987
143 Ga0207681_10187305 3300025923 Bacteria 1581
144 Ga0207694_10072161 3300025924 Bacteria 2699
145 Ga0207668_10574610 3300025972 Bacteria 979
146 Ga0207678_10100669 3300026067 Bacteria 2468
147 Ga0209281_1000246 3300027111 Bacteria 107513
148 Ga0209371_1013818 3300027312 Bacteria 2243
149 Ga0209282_1000062 3300027666 Bacteria 95390
150 Ga0268266_10658971 3300028379 Bacteria 1008
151 Ga0307515_10000068 3300028794 Bacteria 242305
152 Ga0307515_10001124 3300028794 Bacteria 61171
153 Ga0307515_10009754 3300028794 Bacteria 18506
154 Ga0307515_10018702 3300028794 Bacteria 12510
155 Ga0268256_1015440 3300030500 Bacteria 2228
156 Ga0265327_10069257 3300031251 Bacteria 1772
157 Ga0307513_10002899 3300031456 Bacteria 23470
158 Ga0307513_10185922 3300031456 Bacteria 1935
159 Ga0307513_10287973 3300031456 Bacteria 1416
160 Ga0307412_10002256 3300031911 Bacteria 10680
161 Ga0315914_1000015 3300031967 Bacteria 128727
162 Ga0307415_100663833 3300032126 Bacteria 936
163 Ga0307510_10003965 3300033180 Bacteria 17345
164 Ga0315913_1000021 3300033430 Bacteria 95385
165 Ga0315915_1000020 3300033464 Bacteria 128727
166 Ga0373926_0025745 3300035083 Bacteria 2055
167 Ga0373943_0162571 3300035170 Bacteria 1216
168 Ga0373946_0024259 3300035171 Bacteria 2375
169 Ga0373935_0017097 3300035692 Bacteria 4394
170 Ga0373927_0014809 3300035695 Bacteria 5157
171 Ga0395898_0383253 3300037466 Bacteria 1341
172 Ga0395898_0416986 3300037466 Bacteria 1280
173 Ga0395905_0001595 3300037471 Bacteria 26980
174 Ga0395905_0063641 3300037471 Bacteria 3451
175 Ga0395905_0078627 3300037471 Bacteria 3091
176 Ga0395905_0151531 3300037471 Bacteria 2181
177 Ga0395905_0251651 3300037471 Bacteria 1650
178 Ga0439466_0036554 3300041411 Bacteria 1658
179 Ga0439465_0006451 3300041413 Bacteria 3728
180 Ga0439465_0085306 3300041413 Bacteria 1075
181 Ga0451833_0585458 3300041491 Bacteria 2942
182 Ga0451839_0560920 3300041496 Bacteria 3571
183 Ga0451845_0513563 3300041501 Bacteria 2816
184 Ga0451847_0575807 3300041503 Bacteria 3457
185 Ga0451849_0728410 3300041505 Bacteria 2531
186 Ga0451851_0131809 3300041507 Bacteria 6124
187 Ga0451843_0383034 3300041509 Bacteria 2413
188 Ga0451855_1153263 3300041511 Bacteria 1250
189 Ga0451853_0488010 3300041512 Bacteria 2810
190 Ga0451853_2864751 3300041512 Bacteria 1053
191 Ga0439433_0059691 3300041999 Bacteria 908
192 Ga0451577_0012889 3300042876 Bacteria 7847
193 Ga0466972_0038211 3300044658 Bacteria 2345
194 Ga0466972_0061510 3300044658 Bacteria 1800
195 Ga0466963_0010725 3300044694 Bacteria 5560
196 Ga0466970_0000013 3300044765 Bacteria 83194
197 Ga0466957_0006587 3300044842 Bacteria 6566
198 Ga0451576_0382590 3300045051 Bacteria 1475
199 Ga0466958_0011236 3300045836 Bacteria 5040
200 Ga0466967_0491511 3300045976 Bacteria 1203
201 Ga0495617_065019 3300046452 Bacteria 1203
202 Ga0495603_0096490 3300046455 Bacteria 1727
203 Ga0495629_0025450 3300046459 Bacteria 4205
204 Ga0495638_0000218 3300046460 Bacteria 79814
205 Ga0495582_0028103 3300046473 Bacteria 3086
206 Ga0495662_0043793 3300046476 Bacteria 2161
207 Ga0495585_0023304 3300046492 Bacteria 3553
208 Ga0495606_0100314 3300046507 Bacteria 1764
209 Ga0495610_0005107 3300046512 Bacteria 9440
210 Ga0495610_0045893 3300046512 Bacteria 2159
211 Ga0495610_0073763 3300046512 Bacteria 1585
212 Ga0495620_0000188 3300046515 Bacteria 47539
213 Ga0495620_0008803 3300046515 Bacteria 5400
214 Ga0495620_0105096 3300046515 Bacteria 1123
215 Ga0495630_0261960 3300046517 Bacteria 1321
216 Ga0495643_0000918 3300046522 Bacteria 30966
217 Ga0495643_0082129 3300046522 Bacteria 1675
218 Ga0495648_0002240 3300046524 Bacteria 18073
219 Ga0495663_0000206 3300046525 Bacteria 23509
220 Ga0495622_0020077 3300046557 Bacteria 3111
221 Ga0495633_0097652 3300046558 Bacteria 1364
222 Ga0495668_0081758 3300046616 Bacteria 1772
223 Ga0495668_0329934 3300046616 Bacteria 837
224 Ga0495611_0000489 3300046648 Bacteria 23665
225 Ga0495625_0000364 3300046660 Bacteria 69279
226 Ga0495625_0169571 3300046660 Bacteria 1458
227 Ga0495625_0305036 3300046660 Bacteria 1018
228 Ga0495661_0039660 3300046665 Bacteria 2925
229 Ga0495588_0000677 3300046674 Bacteria 15710
230 Ga0495588_0094926 3300046674 Bacteria 1564
231 Ga0495613_0000406 3300046689 Bacteria 36952
232 Ga0495670_0000087 3300046691 Bacteria 41042
233 Ga0495671_0000081 3300046692 Bacteria 92311
234 Ga0495649_0000975 3300046694 Bacteria 22575
235 Ga0495600_0233851 3300046809 Bacteria 1172
236 Ga0495660_0099326 3300046810 Bacteria 1500
237 Ga0495604_0003678 3300047317 Bacteria 12221
238 Ga0495687_000090 3300047443 Bacteria 141153
239 Ga0495687_025090 3300047443 Bacteria 2824
240 Ga0495687_073615 3300047443 Bacteria 1361
241 Ga0495681_0002849 3300047470 Bacteria 12216
242 Ga0495686_0000157 3300047472 Bacteria 130757
243 Ga0495686_0194698 3300047472 Bacteria 1166
244 Ga0496100_0202734 3300048903 Bacteria 1447
245 Ga0496101_0161285 3300048904 Bacteria 1719
246 Ga0496101_0203251 3300048904 Bacteria 1532
247 Ga0496102_0185181 3300048905 Bacteria 1962
248 Ga0496103_0184186 3300048906 Bacteria 1342
249 Ga0496104_0242683 3300048907 Bacteria 1714
250 Ga0496105_0176759 3300048908 Bacteria 1748
251 Ga0496106_0000355 3300048909 Bacteria 32404
252 Ga0496107_0189571 3300048910 Bacteria 1527
253 Ga0496108_0409024 3300048911 Bacteria 1185
254 Ga0496109_0325494 3300048912 Bacteria 1451
255 Ga0496109_0379149 3300048912 Bacteria 1336
256 Ga0496111_0048262 3300048914 Bacteria 3067
257 Ga0496112_0161296 3300048915 Bacteria 2209
258 Ga0496112_0219825 3300048915 Bacteria 1856
259 Ga0496112_0254348 3300048915 Bacteria 1707
260 Ga0496112_0324391 3300048915 Bacteria 1484
261 Ga0496112_0403218 3300048915 Bacteria 1307
262 Ga0496113_0042049 3300048916 Bacteria 3375
263 Ga0496113_0161241 3300048916 Bacteria 1773
264 Ga0496114_0124169 3300048917 Bacteria 2223
265 Ga0496114_0222246 3300048917 Bacteria 1658
266 Ga0496115_0545419 3300048918 Bacteria 927
267 Ga0496115_0547715 3300048918 Bacteria 925
268 Ga0496116_0033228 3300048919 Bacteria 3663
269 Ga0496116_0052068 3300048919 Bacteria 2714
270 Ga0496116_0074565 3300048919 Bacteria 2133
271 Ga0496117_0005024 3300048920 Bacteria 14182
272 Ga0496117_0009510 3300048920 Bacteria 9031
273 Ga0496117_0062261 3300048920 Bacteria 2558
274 Ga0496117_0063617 3300048920 Bacteria 2521
275 Ga0496117_0098266 3300048920 Bacteria 1862
276 Ga0496118_0005333 3300048921 Bacteria 14644
277 Ga0496118_0008211 3300048921 Bacteria 10845
278 Ga0496118_0038673 3300048921 Bacteria 3820
279 Ga0496118_0155885 3300048921 Bacteria 1421
280 Ga0496118_0160039 3300048921 Bacteria 1394
281 Ga0496119_0005583 3300048922 Bacteria 11961
282 Ga0496119_0050636 3300048922 Bacteria 2559
283 Ga0496119_0081576 3300048922 Bacteria 1862
284 Ga0496120_0001220 3300048923 Bacteria 32486
285 Ga0496120_0014119 3300048923 Bacteria 5335
286 Ga0496120_0020196 3300048923 Bacteria 4241
287 Ga0496121_0004476 3300048924 Bacteria 18755
288 Ga0496121_0004834 3300048924 Bacteria 17734
289 Ga0496121_0010821 3300048924 Bacteria 10209
290 Ga0496122_0007612 3300048925 Bacteria 11970
291 Ga0496123_0000236 3300048926 Bacteria 111543
292 Ga0496123_0038071 3300048926 Bacteria 3386
293 Ga0496123_0045113 3300048926 Bacteria 3006
294 Ga0496123_0063411 3300048926 Bacteria 2361
295 Ga0496124_0044751 3300048927 Bacteria 3796
296 Ga0496124_0094137 3300048927 Bacteria 2437
297 Ga0496124_0141721 3300048927 Bacteria 1896
298 Ga0496124_0165916 3300048927 Bacteria 1716
299 Ga0496124_0459051 3300048927 Bacteria 866
300 Ga0496124_0476836 3300048927 Bacteria 843
301 Ga0496125_0012755 3300048928 Bacteria 8310
302 Ga0496125_0046989 3300048928 Bacteria 3615
303 Ga0496125_0056177 3300048928 Bacteria 3199
304 Ga0496125_0250808 3300048928 Bacteria 1117
305 Ga0496126_0027922 3300048929 Bacteria 5382
306 Ga0496126_0046979 3300048929 Bacteria 3954
307 Ga0496126_0092324 3300048929 Bacteria 2660
308 Ga0495678_000059 3300049459 Bacteria 143694
309 Ga0495682_0013528 3300049460 Bacteria 3104
310 Ga0501034_0762187 3300049571 Bacteria 863
311 Ga0501047_0482169 3300049581 Bacteria 1068
312 Ga0501071_0293353 3300049587 Bacteria 1232
313 Ga0501079_0579695 3300049741 Bacteria 883
314 Ga0501044_0304454 3300049823 Bacteria 1522
315 nmdc:mga03683_122739_c1 3300050489 Bacteria 1156
316 nmdc:mga00v17_385229_c1 3300050491 Bacteria 911
317 nmdc:mga0yw44_226678_c1 3300050492 Bacteria 1240
318 nmdc:mga0yw44_66259_c1 3300050492 Bacteria 2228
319 nmdc:mga0a205_215240_c1 3300050515 Bacteria 1808
320 nmdc:mga0sz30_12394_c1 3300050516 Bacteria 3317
321 nmdc:mga0sz30_8692_c2 3300050516 Bacteria 1062
322 Ga0500610_0141412 3300053079 Bacteria 1215
323 Ga0500578_0026662 3300053086 Bacteria 3706
324 Ga0500644_0023193 3300053088 Bacteria 1882
325 Ga0500583_0046179 3300053092 Bacteria 2003
326 Ga0500555_021014 3300053103 Bacteria 1880
327 Ga0500597_090154 3300053120 Bacteria 1332
328 Ga0500608_000469 3300053122 Bacteria 15099
329 Ga0500618_001097 3300053125 Bacteria 13303
330 Ga0500618_021399 3300053125 Bacteria 1578
331 Ga0500618_057013 3300053125 Bacteria 880
332 Ga0500658_0072198 3300053134 Bacteria 1459
333 Ga0500564_042621 3300053138 Bacteria 2086
334 Ga0500568_0000415 3300053139 Bacteria 32506
335 Ga0500568_0003149 3300053139 Bacteria 9399
336 Ga0500573_0050932 3300053140 Bacteria 2382
337 Ga0500574_001357 3300053141 Bacteria 3614
338 Ga0500590_000882 3300053148 Bacteria 11344
339 Ga0500604_0029240 3300053151 Bacteria 1605
340 Ga0500604_0042344 3300053151 Bacteria 1380
341 Ga0500616_0029451 3300053153 Bacteria 3020
342 Ga0500619_003732 3300053154 Bacteria 3168
343 Ga0500620_000405 3300053155 Bacteria 7949
344 Ga0500622_0000134 3300053156 Bacteria 78418
345 Ga0500624_000360 3300053157 Bacteria 14769
346 Ga0500633_0011394 3300053160 Bacteria 2416
347 Ga0500634_0123316 3300053161 Bacteria 1257
348 Ga0500638_050575 3300053162 Bacteria 2010
349 Ga0500636_0003486 3300053177 Bacteria 8860
350 Ga0500636_0173540 3300053177 Bacteria 1164
351 Ga0500567_090415 3300053723 Bacteria 1298
352 3004243122 3004239961 Bacteria 6892290
353 2503201017 2503198000 Bacteria 6884444
354 2509108330 2508501122 Bacteria 6292184
355 2509144521 2508501127 Bacteria 7037543
356 2509372570 2509276018 Bacteria 6910194
357 2509376537 2509276019 Bacteria 6802256
358 2509391209 2509276021 Bacteria 7634384
359 2509394067 2509276022 Bacteria 6200534
360 2509448282 2509276033 Bacteria 7180565
361 2510318258 2510065059 Bacteria 6847884
362 2511186794 2510917028 Bacteria 6185411
363 2511200347 2510917030 Bacteria 7460662
364 2511502309 2511231052 Bacteria 6974333
365 2512533690 2512047086 Bacteria 6850303
366 2512928923 2512875016 Bacteria 6529530
367 2512960107 2512875024 Bacteria 7195110
368 2512970609 2512875026 Bacteria 6861065
369 2513587439 2513237086 Bacteria 7265287
370 2513600566 2513237088 Bacteria 6927906
371 2513601671 2513237089 Bacteria 6553624
372 2513608994 2513237090 Bacteria 7096802
373 2513619223 2513237091 Bacteria 6900273
374 2513871439 2513237138 Bacteria 7368160
375 2513885585 2513237140 Bacteria 7076289
376 2513906001 2513237143 Bacteria 6664116
377 2513984176 2513237156 Bacteria 6402557
378 2514002886 2513237160 Bacteria 6650282
379 2514021523 2513237162 Bacteria 7468464
380 2514038972 2513237164 Bacteria 7563725
381 2515609088 2515154107 Bacteria 6795637
382 2515635865 2515154113 Bacteria 7807172
383 2516204191 2516143018 Bacteria 6951533
384 2516893689 2516653046 Bacteria 6989037
385 2517570420 2517487022 Bacteria 7227575
386 2523107034 2522572158 Bacteria 6514390
387 2524448484 2524023207 Bacteria 6813453
388 2535518130 2534681796 Bacteria 7146037
389 2551675747 2551306084 Bacteria 8942552
390 2551687336 2551306085 Bacteria 7347181
391 2551695558 2551306086 Bacteria 6843938
392 2551702421 2551306087 Bacteria 7351905
393 2551713852 2551306089 Bacteria 7162724
394 2551718873 2551306090 Bacteria 7953713
395 2551730082 2551306091 Bacteria 7086830
396 2551742476 2551306093 Bacteria 7064773
397 2558864394 2558860100 Bacteria 8458965
398 2585169785 2582581283 Bacteria 6030556
399 2585222489 2582581298 Bacteria 7315509
400 2585257600 2582581304 Bacteria 5831370
401 2585267375 2582581306 Bacteria 6450535
402 2585275941 2582581307 Bacteria 6597605
403 2585283743 2582581308 Bacteria 7413247
404 2585331870 2582581316 Bacteria 7774528
405 2585386443 2582581865 Bacteria 6644329
406 2585404466 2582581867 Bacteria 7184437
407 2585544559 2585427529 Bacteria 7395659
408 2585824291 2585427590 Bacteria 6824633
409 2585900995 2585427608 Bacteria 6544331
410 2588517965 2588253730 Bacteria 6881675
411 2597811864 2597489875 Bacteria 7010078
412 2599939872 2599185301 Bacteria 6161860
413 2600195450 2599185352 Bacteria 7228948
414 2617382826 2617270742 Bacteria 6808054
415 2643803018 2643221557 Bacteria 7184309
416 2643988434 2643221595 Bacteria 6565519
417 2644004180 2643221599 Bacteria 6292121
418 2644063380 2643221610 Bacteria 7480339
419 2644107211 2643221618 Bacteria 7717186
420 2644150776 2643221626 Bacteria 8069654
421 2644154649 2643221627 Bacteria 6761570
422 2644193786 2643221634 Bacteria 6705461
423 2644202796 2643221636 Bacteria 6583769
424 2644308607 2643221655 Bacteria 7722067
425 2644335423 2643221659 Bacteria 7890716
426 2644374663 2643221668 Bacteria 7306521
427 2644414143 2643221675 Bacteria 7473456
428 2644447671 2643221680 Bacteria 7473610
429 2644501660 2643221689 Bacteria 6042950
430 2644539828 2643221698 Bacteria 7756764
431 2644614547 2643221712 Bacteria 7729434
432 2644676009 2643221723 Bacteria 7095460
433 2644690144 2643221726 Bacteria 7455827
434 2688596395 2687453392 Bacteria 6880454
435 2694630213 2693429783 Bacteria 7019804
436 2694634292 2693429784 Bacteria 7241525
437 2738802789 2738541293 Bacteria 7065685
438 2756673783 2756170246 Bacteria 7451806
439 2776269900 2775506902 Bacteria 6208009
440 2776281017 2775506904 Bacteria 5954060
441 2776913989 2775507049 Bacteria 6284736
442 2792747641 2791355123 Bacteria 8049106
443 2793317264 2791355259 Bacteria 7254731
444 2793324791 2791355260 Bacteria 6598818
445 2802716963 2802428858 Bacteria 6636079
446 2802725712 2802428859 Bacteria 6667919
447 2802730199 2802428860 Bacteria 6525526
448 2802737830 2802428861 Bacteria 6534206
449 2802742716 2802428862 Bacteria 6633353
450 2802750204 2802428863 Bacteria 6410669
451 2819613601 2818991448 Bacteria 6772224
452 2838026710 2838022645 Bacteria 6494267
453 2838076808 2838074704 Bacteria 6785777
454 2840770520 2840764183 Bacteria 6358399
455 2841736783 2841734538 Bacteria 6784580
456 2841868666 2841864319 Bacteria 6742987
457 2842202313 2842198810 Bacteria 6608673
458 2842342614 2842341865 Bacteria 7003929
459 2842365611 2842363717 Bacteria 6844742
460 2842485502 2842482326 Bacteria 7212537
461 2844003038 2844002411 Bacteria 7168230
462 2844011220 2844009547 Bacteria 6728125
463 2844164646 2844163670 Bacteria 7266046
464 2847672370 2847670302 Bacteria 6165597
465 2847690802 2847686936 Bacteria 6278406
466 2850081535 2850079185 Bacteria 6848280
467 2855826412 2855825444 Bacteria 6785811
468 2855841802 2855839649 Bacteria 7135830
469 2856315777 2856314179 Bacteria 6477897
470 2856327260 2856320880 Bacteria 7263508
471 2856328460 2856328259 Bacteria 6528202
472 2856341259 2856334872 Bacteria 7037011
473 2856344667 2856342000 Bacteria 7176905
474 2856351140 2856349417 Bacteria 6230045
475 2856366845 2856364286 Bacteria 6939991
476 2857357603 2857349434 Bacteria 7926032
477 2857519362 2857516855 Bacteria 7787325
478 2858802586 2858800743 Bacteria 6603254
479 2869176382 2869169390 Bacteria 6659796
480 2869238769 2869234852 Bacteria 6654993
481 2869245713 2869242130 Bacteria 6609239
482 2869249856 2869249662 Bacteria 6868783
483 2869257980 2869256925 Bacteria 6981691
484 2869269697 2869264136 Bacteria 6880765
485 2869277639 2869271264 Bacteria 6908218
486 2869279511 2869278585 Bacteria 7077053
487 2869287743 2869285874 Bacteria 6901219
488 2871435691 2871429161 Bacteria 6547891
489 2871439692 2871435913 Bacteria 6880295
490 2871444781 2871444079 Bacteria 6423508
491 2871456311 2871451962 Bacteria 7336357
492 2871459601 2871459585 Bacteria 6866887
493 2871468609 2871466892 Bacteria 6923287
494 2871478260 2871474448 Bacteria 6806570
495 2871493542 2871488783 Bacteria 6929816
496 2871496556 2871495908 Bacteria 6935695
497 2874105763 2874102143 Bacteria 6342645
498 2874111559 2874109183 Bacteria 6517025
499 2874118553 2874116593 Bacteria 6674494
500 2874134459 2874131515 Bacteria 6820270
501 2874139499 2874139085 Bacteria 7021506
502 2874151374 2874146452 Bacteria 7533118
503 2874159008 2874155637 Bacteria 6724144
504 2874166493 2874162495 Bacteria 6174670
505 2874169215 2874168670 Bacteria 8062617
506 2876369035 2876363079 Bacteria 6544991
507 2876369698 2876369609 Bacteria 6807521
508 2876379470 2876377896 Bacteria 6565995
509 2876392179 2876386047 Bacteria 6698674
510 2876397685 2876392853 Bacteria 6660880
511 2876402326 2876399893 Bacteria 6927900
512 2876407513 2876406927 Bacteria 6191900
513 2876417427 2876413966 Bacteria 6831344
514 2876427711 2876420981 Bacteria 6687741
515 2878041193 2878035449 Bacteria 6555736
516 2878742037 2878738818 Bacteria 7136951
517 2878749254 2878745973 Bacteria 6867388
518 2878757584 2878753008 Bacteria 6922523
519 2878760784 2878760144 Bacteria 6823465
520 2878767591 2878767105 Bacteria 6898628
521 2878775753 2878774303 Bacteria 6108671
522 2878782289 2878781027 Bacteria 6834456
523 2878789673 2878788777 Bacteria 6567085
524 2881149559 2881147464 Bacteria 7779814
525 2881166448 2881161766 Bacteria 7127907
526 2881850486 2881845957 Bacteria 6611900
527 2881860960 2881853255 Bacteria 6698367
528 2881862399 2881861095 Bacteria 7128710
529 2882639361 2882632389 Bacteria 8154593
530 2882913595 2882912400 Bacteria 6801539
531 2885307928 2885305155 Bacteria 7348390
532 2885313741 2885312484 Bacteria 6415165
533 2885333100 2885326080 Bacteria 7134805
534 2885338773 2885334103 Bacteria 7216818
535 2885344827 2885342637 Bacteria 7011821
536 2885354650 2885350715 Bacteria 6787678
537 2888337079 2888337043 Bacteria 6629336
538 2888344762 2888343758 Bacteria 6611049
539 2888352312 2888350351 Bacteria 7372807
540 2889014305 2889010040 Bacteria 6749192
541 2889020990 2889016732 Bacteria 6700763
542 2896390398 2896384573 Bacteria 7700774
543 2903449110 2903448605 Bacteria 7357801
544 2903498718 2903492973 Bacteria 13473544
545 2903501314 2903492973 Bacteria 13473544
546 2903514111 2903513507 Bacteria 6344008
547 2903526497 2903521522 Bacteria 6525694
548 2903532274 2903528002 Bacteria 6586099
549 2903541350 2903540706 Bacteria 7062119
550 2904664336 2904659560 Bacteria 6685615
551 2906310292 2906308376 Bacteria 6841989
552 2906324357 2906321335 Bacteria 6579571
553 2906333172 2906328253 Bacteria 6585166
554 2906358232 2906354277 Bacteria 6991324
555 2906367263 2906363423 Bacteria 6856682
556 2906372696 2906370794 Bacteria 6881062
557 2906385771 2906378014 Bacteria 6911440
558 2906396968 2906393657 Bacteria 6790866
559 2906405430 2906401398 Bacteria 6693206
560 2906410027 2906408224 Bacteria 6162342
561 2906415914 2906414383 Bacteria 6580790
562 2906435016 2906427513 Bacteria 6375796
563 2909045069 2909042592 Bacteria 6499737
564 2915983020 2915980308 Bacteria 6624279
565 2915991111 2915986958 Bacteria 6739310
566 2915997835 2915993759 Bacteria 7016183
567 2916001273 2916000859 Bacteria 6865702
568 2916013393 2916007675 Bacteria 6898660
569 2916015106 2916014648 Bacteria 6946486
570 2916032532 2916028427 Bacteria 6748433
571 2916039176 2916035215 Bacteria 6755766
572 2916047287 2916041962 Bacteria 6820487
573 2916049112 2916048683 Bacteria 6543552
574 2916055786 2916055098 Bacteria 6758838
575 2916064341 2916061851 Bacteria 6737736
576 2916075351 2916068649 Bacteria 6943657
577 2916079250 2916076590 Bacteria 6596108
578 2919103074 2919100787 Bacteria 7710546
579 2920761467 2920760137 Bacteria 7427611
580 2920825287 2920822456 Bacteria 6897201
581 2921205550 2921201388 Bacteria 6926299
582 2921212783 2921208531 Bacteria 6745326
583 2921241643 2921237296 Bacteria 6876710
584 2921246144 2921244191 Bacteria 6568419
585 2921253867 2921250672 Bacteria 6677771
586 2921261970 2921257292 Bacteria 6808382
587 2921268328 2921263974 Bacteria 6864552
588 2921287453 2921282425 Bacteria 6826397
589 2921296157 2921289301 Bacteria 7316391
590 2922130913 2922130491 Bacteria 7173936
591 2922154939 2922151315 Bacteria 6902399
592 2922159161 2922158528 Bacteria 6573167
593 2922172693 2922172374 Bacteria 6167644
594 2922178739 2922178524 Bacteria 6025201
595 2922190473 2922185730 Bacteria 7113964
596 2923559387 2923556063 Bacteria 6793593
597 2924147207 2924144063 Bacteria 6883928
598 2924155809 2924150972 Bacteria 7169444
599 2924161130 2924158325 Bacteria 7188855
600 2924171604 2924165586 Bacteria 7260590
601 2924178785 2924172951 Bacteria 6749356
602 2924181839 2924179722 Bacteria 6843264
603 2924192799 2924186466 Bacteria 6876637
604 2924196159 2924193448 Bacteria 6955718
605 2924207035 2924200457 Bacteria 6757188
606 2924207932 2924207177 Bacteria 6917007
607 2924219082 2924214083 Bacteria 7080103
608 2924228597 2924221636 Bacteria 7113495
609 2924231650 2924228884 Bacteria 6633132
610 2924711864 2924710171 Bacteria 6752351
611 2924723728 2924718760 Bacteria 6331356
612 2924728464 2924726620 Bacteria 6271473
613 2924737609 2924733363 Bacteria 7574837
614 2924743726 2924741084 Bacteria 6661321
615 2924749693 2924748358 Bacteria 6154725
616 2924756183 2924754689 Bacteria 6774424
617 2924766713 2924762789 Bacteria 6561353
618 2924779721 2924776078 Bacteria 7492003
619 2924786879 2924784321 Bacteria 7416538
620 2936998286 2936996657 Bacteria 6298727
621 2937005590 2937002841 Bacteria 6934057
622 2937011793 2937009748 Bacteria 6746052
623 2937021451 2937016420 Bacteria 6782579
624 2937024654 2937023124 Bacteria 6815156
625 2937031064 2937029754 Bacteria 6424026
626 2937037066 2937036028 Bacteria 6846469
627 2937048843 2937042894 Bacteria 6741576
628 2937050865 2937049772 Bacteria 6757901
629 2937058490 2937056579 Bacteria 7107896
630 2937069677 2937063883 Bacteria 7199456
631 2937072022 2937071275 Bacteria 6984483
632 2937081616 2937078374 Bacteria 6610289
633 2937085610 2937084907 Bacteria 6618516
634 2937101985 2937098957 Bacteria 7249374
635 2937112791 2937106411 Bacteria 6947143
636 2937117427 2937113482 Bacteria 6505872
637 2937122663 2937119839 Bacteria 6597547
638 2937129681 2937126314 Bacteria 6771275
639 2937817116 2937813078 Bacteria 7783518
640 2937826286 2937822353 Bacteria 7290551
641 2937841366 2937836603 Bacteria 6811263
642 2937848722 2937848649 Bacteria 6983481
643 2937863579 2937861824 Bacteria 6660327
644 2937880135 2937877337 Bacteria 7246526
645 2937893387 2937891427 Bacteria 6357007
646 2937972878 2937972304 Bacteria 7532020
647 2937981229 2937980651 Bacteria 6517427
648 2937995206 2937994558 Bacteria 7036190
649 2938014896 2938014810 Bacteria 6700592
650 2941502068 2941499720 Bacteria 7599444
651 2957378417 2957375807 Bacteria 6425588
652 2957387032 2957382221 Bacteria 6737050
653 2957393170 2957388812 Bacteria 6778072
654 2957401851 2957395598 Bacteria 6822399
655 2957407820 2957402308 Bacteria 6741770
656 2957414550 2957408893 Bacteria 6558585
657 2957419547 2957415311 Bacteria 6991633
658 2957432470 2957430029 Bacteria 7022557
659 2957437885 2957437181 Bacteria 6568994
660 2957448531 2957443900 Bacteria 6869977
661 2957457091 2957450854 Bacteria 6765715
662 2957462540 2957457609 Bacteria 6967680
663 2957468912 2957464669 Bacteria 6568877
664 2957477815 2957471148 Bacteria 6797643
665 2957482290 2957478035 Bacteria 6756658
666 2957491174 2957484790 Bacteria 6703082
667 2957492688 2957491536 Bacteria 6695180
668 2957504501 2957498199 Bacteria 7126688
669 2957510365 2957505466 Bacteria 7253085
670 2958035089 2958034702 Bacteria 6989922
671 2958044120 2958041894 Bacteria 13082850
672 2958054741 2958041894 Bacteria 13082850
673 2958065787 2958064165 Bacteria 7158582
674 2958073052 2958071322 Bacteria 6815895
675 2958087188 2958084443 Bacteria 7312792
676 2958101489 2958100919 Bacteria 6800575
677 2958112061 2958108152 Bacteria 6681128
678 2958120897 2958115193 Bacteria 6923548
679 2958123003 2958122699 Bacteria 7280457
680 2958132145 2958130278 Bacteria 6897202
681 2958141009 2958137437 Bacteria 6050276
682 2958145532 2958144490 Bacteria 6677056
683 2958164954 2958158011 Bacteria 6058449
684 2958165529 2958165035 Bacteria 6906348
685 2958179091 2958172287 Bacteria 6716688
686 2958181959 2958179912 Bacteria 6874908
687 2960585270 2960584000 Bacteria 6864594
688 2960594203 2960591022 Bacteria 6622873
689 2960603681 2960597568 Bacteria 6550735
690 2960607393 2960603979 Bacteria 6898737
691 2960614595 2960610863 Bacteria 6691244
692 2960620348 2960617483 Bacteria 6727748
693 2960633673 2960631154 Bacteria 6732508
694 2960642860 2960637947 Bacteria 7296468
695 2960650223 2960645483 Bacteria 7211087
696 2960659883 2960652885 Bacteria 7083688
697 2960663260 2960660292 Bacteria 7041660
698 2960671101 2960667422 Bacteria 6763020
699 2960680260 2960674078 Bacteria 6609048
700 2960680993 2960680706 Bacteria 6624464
701 2960692089 2960687367 Bacteria 6535474
702 2960698077 2960693952 Bacteria 6749742
703 2961079803 2961077736 Bacteria 7079850
704 2961119335 2961114664 Bacteria 6680456
705 2961130248 2961127735 Bacteria 7196641
706 2961142992 2961136820 Bacteria 6775228
707 2961163988 2961163497 Bacteria 6901077
708 2961175089 2961170736 Bacteria 7072258
709 2961186755 2961183825 Bacteria 6688536
710 2963650311 2963644680 Bacteria 6530403
711 2964615158 2964607997 Bacteria 7101408
712 2964617964 2964615318 Bacteria 6809089
713 2964626994 2964621998 Bacteria 6834995
714 2964631230 2964628898 Bacteria 7083044
715 2964638083 2964636051 Bacteria 7091832
716 2964649075 2964643177 Bacteria 6820887
717 2964652585 2964649959 Bacteria 6675118
718 2964661032 2964656573 Bacteria 7100150
719 2964665304 2964663802 Bacteria 7019362
720 2964676219 2964670856 Bacteria 6851364
721 2964680793 2964678106 Bacteria 6792020
722 2964687218 2964685014 Bacteria 6839111
723 2964694331 2964691889 Bacteria 6802758
724 2964699468 2964698721 Bacteria 6765331
725 2964707752 2964705432 Bacteria 7114648
726 2964713835 2964712639 Bacteria 6695970
727 2964725905 2964719344 Bacteria 7286602
728 2965018946 2965018300 Bacteria 6883036
729 2965030994 2965025482 Bacteria 6532201
730 2965032207 2965032056 Bacteria 6887443
731 2965046330 2965040258 Bacteria 6855979
732 2965054026 2965047637 Bacteria 6623551
733 2965064902 2965062239 Bacteria 7412989
734 2965092493 2965089291 Bacteria 6866420
735 2965110709 2965102966 Bacteria 6800987
736 2965118675 2965110997 Bacteria 6693150
737 2965124894 2965119406 Bacteria 6956431
738 2967664809 2967664464 Bacteria 6948836
739 2967678366 2967671571 Bacteria 7021409
740 2967682057 2967678726 Bacteria 7264382
741 2967690008 2967686174 Bacteria 6678622
742 2967695673 2967693043 Bacteria 6804451
743 2967702754 2967699805 Bacteria 6854538
744 2967712611 2967706974 Bacteria 7186053
745 2967716935 2967714385 Bacteria 7000047
746 2967725578 2967721400 Bacteria 7073753
747 2967730077 2967728569 Bacteria 6641507
748 2967735911 2967735183 Bacteria 6827012
749 2967748388 2967742019 Bacteria 6794534
750 2967752319 2967748971 Bacteria 6733771
751 2967757843 2967755722 Bacteria 6814706
752 2967767377 2967762386 Bacteria 6923502
753 2967775083 2967769361 Bacteria 6587838
754 2967777304 2967775926 Bacteria 6738189
755 2967999910 2967996073 Bacteria 6787468
756 2968008269 2968003550 Bacteria 6929263
757 2968023509 2968016561 Bacteria 7022047
758 2968086071 2968083720 Bacteria 7351627
759 2968091325 2968091066 Bacteria 6052692
760 2968102218 2968097103 Bacteria 6107094
761 2968115590 2968110612 Bacteria 6814636
762 2968118973 2968117919 Bacteria 6536078
763 2968128943 2968128360 Bacteria 6270294
764 2968172391 2968171901 Bacteria 6894245
765 2970024185 2970019648 Bacteria 7072033
766 2970031780 2970026789 Bacteria 6785236
767 2970038747 2970033650 Bacteria 7118744
768 2970047099 2970040964 Bacteria 6731123
769 2970054956 2970047711 Bacteria 7088379
770 2970059224 2970054988 Bacteria 6611507
771 2970063250 2970061556 Bacteria 7099761
772 2970070720 2970068827 Bacteria 7123112
773 2970078742 2970076120 Bacteria 6697332
774 2970088328 2970082768 Bacteria 6183754
775 2970091066 2970088815 Bacteria 6933825
776 2970098863 2970095765 Bacteria 6936963
777 2970107929 2970102677 Bacteria 6812532
778 2970113767 2970109326 Bacteria 6863976
779 2970116719 2970116247 Bacteria 6501857
780 2970124867 2970122695 Bacteria 6625855
781 2970132200 2970129317 Bacteria 6806560
782 2970140515 2970136068 Bacteria 7207982
783 2970145173 2970143518 Bacteria 6446480
784 2970152313 2970149975 Bacteria 6779706
785 2970157816 2970156795 Bacteria 7168044
786 2970164564 2970164137 Bacteria 6861252
787 2970172765 2970170962 Bacteria 6876229
788 2970183932 2970177841 Bacteria 6768001
789 2970188940 2970184632 Bacteria 7054431
790 2970193729 2970191845 Bacteria 7032787
791 2970476091 2970469710 Bacteria 6969209
792 2970490733 2970489779 Bacteria 6517260
793 2970507677 2970503327 Bacteria 7099517
794 2970511608 2970510686 Bacteria 7006402
795 2970526493 2970524798 Bacteria 6840927
796 2970536341 2970532167 Bacteria 6553173
797 2970542757 2970540015 Bacteria 6977556
798 2970552161 2970547951 Bacteria 6931819
799 2970555637 2970554993 Bacteria 6814252
800 2970594111 2970593180 Bacteria 7073582
801 2970626116 2970619444 Bacteria 6986144
802 2970631172 2970627176 Bacteria 6680862
803 2977522627 2977516862 Bacteria 6940108
804 2977528158 2977523885 Bacteria 6960446
805 2977531495 2977530762 Bacteria 6951399
806 2977540773 2977537788 Bacteria 6929320
807 2977548386 2977544691 Bacteria 6875412
808 2977555794 2977551784 Bacteria 7125765
809 2977560297 2977558990 Bacteria 6863948
810 2977571647 2977565890 Bacteria 6901543
811 2977575677 2977572785 Bacteria 6763888
812 2977582269 2977579622 Bacteria 6772100
813 2977826741 2977821940 Bacteria 6906439
814 2977833823 2977828996 Bacteria 7007971
815 2977847407 2977843712 Bacteria 6753583
816 2977856078 2977851361 Bacteria 6694324
817 2977860644 2977858184 Bacteria 6215359
818 2977871299 2977864932 Bacteria 7534097
819 2977878432 2977872689 Bacteria 7270173
820 2977914090 2977907340 Bacteria 6577984
821 2977916469 2977915119 Bacteria 6829656
822 2977928304 2977922695 Bacteria 6956781
823 2977941568 2977935797 Bacteria 6252826
824 2977946285 2977942078 Bacteria 7570577
825 2977954558 2977950692 Bacteria 6893264
826 2977960022 2977957713 Bacteria 6877875
827 2977978713 2977971508 Bacteria 7472917
828 2977990269 2977986579 Bacteria 6581278
829 2979715191 2979710463 Bacteria 6785254
830 2979748050 2979742915 Bacteria 7301278
831 2979766385 2979764755 Bacteria 6610066
832 2979774712 2979772303 Bacteria 6618277
833 2979780146 2979779861 Bacteria 6219781
834 2979793344 2979793036 Bacteria 6808957
835 2979812861 2979808191 Bacteria 7179355
836 2987645105 2987636660 Bacteria 8088555
837 2987648553 2987645492 Bacteria 6117018
838 2987656664 2987652177 Bacteria 6969023
839 2987659996 2987659509 Bacteria 6966464
840 2987667642 2987666974 Bacteria 6509233
841 2989349724 2989349275 Bacteria 6349068
842 2996344470 2996341866 Bacteria 6643098
843 2996354671 2996348954 Bacteria 7239054
844 2996389503 2996386984 Bacteria 6978667
845 3000137791 3000135777 Bacteria 6891109
846 3004173730 3004167301 Bacteria 8330599
847 3004189044 3004188549 Bacteria 6952365
848 3004203339 3004195979 Bacteria 6776956
849 3004206657 3004203850 Bacteria 7307914
850 3004215692 3004211236 Bacteria 7417683
851 3004224469 3004218560 Bacteria 7421728
852 3004234973 3004232784 Bacteria 6662140
853 3004248539 3004248173 Bacteria 6563236
854 3004269151 3004268573 Bacteria 7043476
855 3004281319 3004275668 Bacteria 7114440
856 3004293780 3004289098 Bacteria 6135450
857 3004336810 3004334049 Bacteria 8449246
858 3005420965 3005416602 Bacteria 7064308
859 3005451064 3005445848 Bacteria 6906074
860 3005457240 3005452660 Bacteria 5889319
861 637078637 637000159 Bacteria 7596297
862 643822229 643692032 Bacteria 6891900
863 648741963 648276728 Bacteria 6968865
864 649870946 649633066 Bacteria 6690028
865 8002290096 8002285264 Bacteria 6717907
866 8003994236 8003992118 Bacteria 7266902
867 8004001885 8003999396 Bacteria 7063185
868 8004304661 8004300914 Bacteria 6132239
869 8004314131 8004312739 Bacteria 7444653
870 8004369529 8004361976 Bacteria 6858373
871 8004379157 8004374579 Bacteria 6898112
872 8004389528 8004387939 Bacteria 7049250
873 8004403956 8004395343 Bacteria 6620908
874 8004445956 8004445564 Bacteria 6322258
875 8004638438 8004633249 Bacteria 6723080
876 8004644041 8004640170 Bacteria 6723001
877 8004712351 8004703790 Bacteria 8006957
878 8004717926 8004714634 Bacteria 6776161
879 8004727684 8004727605 Bacteria 6643904
880 8005305295 8005301065 Bacteria 6614431
881 8005319300 8005314921 Bacteria 7072929
882 8005489367 8005484373 Bacteria 6297373
883 8005549013 8005542996 Bacteria 7077758
884 8005683867 8005682033 Bacteria 6726518
885 8005689318 8005688590 Bacteria 6610080
886 8054563469 8054558443 Bacteria 5204801
887 8055618312 8055617313 Bacteria 7548464
888 JGI25156J39149_1000008
889 JGI25162J39368_1000763
890 JGI25154J39366_1000050
891 JGI25158J39367_1000212
892 JGI25157J39369_1000028
893 JGI25152J39213_1000104
894 JGI25152J39213_1005787
895 JGI25152J39213_1020440
896 JGI25150J39212_1000078
897 JGI25159J45721_1000014
898 JGI25159J45721_1001409
899 JGI25151J46595_10000098
900 JGI25151J46595_10013855
901 JGI25151J46595_10027472
902 JGI25165J46597_1000034
903 JGI25165J46597_1000225
904 JGI25153J46596_10001165
905 JGI25153J46596_10051313
906 JGI25153J46596_10051323
907 rootH1_10032856
908 rootH2_10228021
909 rootL2_10007139
910 rootH1_10153169
911 JGI25160J50197_1000020
912 JGI25160J50197_1004499
913 JGI25160J50197_1019638
914 JGI25160J50197_1022418
915 JGI25161J50226_1000233
916 JGI25161J50226_1000377
917 Ga0055526_1008686
918 Ga0055526_1018083
919 Ga0055526_1020242
920 Ga0055524_1001223
921 Ga0055524_1006753
922 Ga0055524_1007851
923 Ga0055524_1016422
924 Ga0055524_1023316
925 Ga0055536_1016334
926 Ga0055528_1000275
927 Ga0055528_1013124
928 Ga0055528_1016049
929 Ga0055528_1022002
930 Ga0055540_1003295
931 Ga0055543_1000292
932 Ga0055543_1000717
933 Ga0065165_1000013
934 Ga0065165_1019104
935 Ga0065165_1057389
936 Ga0065715_10169551
937 Ga0070669_100696465
938 Ga0070674_100366050
939 Ga0070663_100204968
940 Ga0070698_100082270
941 Ga0070697_100143396
942 Ga0070697_100462672
943 Ga0070665_100395465
944 Ga0070665_100395532
945 Ga0068862_100395243
946 Ga0075365_10000468
947 Ga0075365_10045118
948 Ga0075367_10014666
949 Ga0075369_10039935
950 Ga0075369_10060477
951 Ga0075433_10384468
952 Ga0079104_1001492
953 Ga0099826_10233372
954 Ga0075435_100067742
955 Ga0105251_10012777
956 Ga0105250_10030425
957 Ga0105241_10080445
958 Ga0105237_10481732
959 Ga0105238_10202847
960 Ga0123341_1000012
961 Ga0105239_10038994
962 Ga0105239_10102623
963 Ga0105239_10111604
964 Ga0171463_1003
965 Ga0163162_10232708
966 Ga0163163_10063588
967 Ga0182008_10047383
968 Ga0182006_1013843
969 Ga0182007_10010250
970 Ga0183363_1042
971 Ga0163161_10314474
972 Ga0214543_1001113
973 Ga0228711_1000042
974 Ga0228710_1000046
975 Ga0209435_100020
976 Ga0209436_100007
977 Ga0209436_102676
978 Ga0209437_100183
979 Ga0207425_1000061
980 Ga0207425_1007114
981 Ga0209646_1000070
982 Ga0209026_1000057
983 Ga0209148_1007908
984 Ga0209759_1000047
985 Ga0209129_1000019
986 Ga0209129_1000134
987 Ga0209129_1001685
988 Ga0209129_1002994
989 Ga0209129_1008444
990 Ga0209233_1000028
991 Ga0209233_1000054
992 Ga0209673_1000132
993 Ga0209673_1002028
994 Ga0209673_1003790
995 Ga0209673_1020812
996 Ga0209130_1000001
997 Ga0209130_1000034
998 Ga0209130_1024232
999 Ga0209676_1011450
1000 Ga0209676_1017125
1001 Ga0209025_1000254
1002 Ga0209025_1000311
1003 Ga0209025_1002894
1004 Ga0209025_1008442
1005 Ga0209025_1010699
1006 Ga0209025_1020474
1007 Ga0209564_1000013
1008 Ga0209564_1002059
1009 Ga0209564_1003015
1010 Ga0209564_1004731
1011 Ga0209564_1008082
1012 Ga0209564_1026511
1013 Ga0209758_1000360
1014 Ga0209758_1015387
1015 Ga0209758_1021975
1016 Ga0209256_1000805
1017 Ga0209256_1001152
1018 Ga0209256_1002303
1019 Ga0209256_1003354
1020 Ga0209256_1004736
1021 Ga0207426_1000006
1022 Ga0207426_1000045
1023 Ga0207426_1000457
1024 Ga0209051_1001034
1025 Ga0209051_1027785
1026 Ga0209051_1034551
1027 Ga0207713_1054922
1028 Ga0207684_10218872
1029 Ga0207671_10482882
1030 Ga0207681_10187305
1031 Ga0207694_10072161
1032 Ga0207668_10574610
1033 Ga0207678_10100669
1034 Ga0209281_1000246
1035 Ga0209371_1013818
1036 Ga0209282_1000062
1037 Ga0268266_10658971
1038 Ga0307515_10000068
1039 Ga0307515_10001124
1040 Ga0307515_10009754
1041 Ga0307515_10018702
1042 Ga0268256_1015440
1043 Ga0265327_10069257
1044 Ga0307513_10002899
1045 Ga0307513_10185922
1046 Ga0307513_10287973
1047 Ga0307412_10002256
1048 Ga0315914_1000015
1049 Ga0307415_100663833
1050 Ga0307510_10003965
1051 Ga0315913_1000021
1052 Ga0315915_1000020
1053 Ga0373926_0025745
1054 Ga0373943_0162571
1055 Ga0373946_0024259
1056 Ga0373935_0017097
1057 Ga0373927_0014809
1058 Ga0395898_0383253
1059 Ga0395898_0416986
1060 Ga0395905_0001595
1061 Ga0395905_0063641
1062 Ga0395905_0078627
1063 Ga0395905_0151531
1064 Ga0395905_0251651
1065 Ga0439466_0036554
1066 Ga0439465_0006451
1067 Ga0439465_0085306
1068 Ga0451833_0585458
1069 Ga0451839_0560920
1070 Ga0451845_0513563
1071 Ga0451847_0575807
1072 Ga0451849_0728410
1073 Ga0451851_0131809
1074 Ga0451843_0383034
1075 Ga0451855_1153263
1076 Ga0451853_0488010
1077 Ga0451853_2864751
1078 Ga0439433_0059691
1079 Ga0451577_0012889
1080 Ga0466972_0038211
1081 Ga0466972_0061510
1082 Ga0466963_0010725
1083 Ga0466970_0000013
1084 Ga0466957_0006587
1085 Ga0451576_0382590
1086 Ga0466958_0011236
1087 Ga0466967_0491511
1088 Ga0495617_065019
1089 Ga0495603_0096490
1090 Ga0495629_0025450
1091 Ga0495638_0000218
1092 Ga0495582_0028103
1093 Ga0495662_0043793
1094 Ga0495585_0023304
1095 Ga0495606_0100314
1096 Ga0495610_0005107
1097 Ga0495610_0045893
1098 Ga0495610_0073763
1099 Ga0495620_0000188
1100 Ga0495620_0008803
1101 Ga0495620_0105096
1102 Ga0495630_0261960
1103 Ga0495643_0000918
1104 Ga0495643_0082129
1105 Ga0495648_0002240
1106 Ga0495663_0000206
1107 Ga0495622_0020077
1108 Ga0495633_0097652
1109 Ga0495668_0081758
1110 Ga0495668_0329934
1111 Ga0495611_0000489
1112 Ga0495625_0000364
1113 Ga0495625_0169571
1114 Ga0495625_0305036
1115 Ga0495661_0039660
1116 Ga0495588_0000677
1117 Ga0495588_0094926
1118 Ga0495613_0000406
1119 Ga0495670_0000087
1120 Ga0495671_0000081
1121 Ga0495649_0000975
1122 Ga0495600_0233851
1123 Ga0495660_0099326
1124 Ga0495604_0003678
1125 Ga0495687_000090
1126 Ga0495687_025090
1127 Ga0495687_073615
1128 Ga0495681_0002849
1129 Ga0495686_0000157
1130 Ga0495686_0194698
1131 Ga0496100_0202734
1132 Ga0496101_0161285
1133 Ga0496101_0203251
1134 Ga0496102_0185181
1135 Ga0496103_0184186
1136 Ga0496104_0242683
1137 Ga0496105_0176759
1138 Ga0496106_0000355
1139 Ga0496107_0189571
1140 Ga0496108_0409024
1141 Ga0496109_0325494
1142 Ga0496109_0379149
1143 Ga0496111_0048262
1144 Ga0496112_0161296
1145 Ga0496112_0219825
1146 Ga0496112_0254348
1147 Ga0496112_0324391
1148 Ga0496112_0403218
1149 Ga0496113_0042049
1150 Ga0496113_0161241
1151 Ga0496114_0124169
1152 Ga0496114_0222246
1153 Ga0496115_0545419
1154 Ga0496115_0547715
1155 Ga0496116_0033228
1156 Ga0496116_0052068
1157 Ga0496116_0074565
1158 Ga0496117_0005024
1159 Ga0496117_0009510
1160 Ga0496117_0062261
1161 Ga0496117_0063617
1162 Ga0496117_0098266
1163 Ga0496118_0005333
1164 Ga0496118_0008211
1165 Ga0496118_0038673
1166 Ga0496118_0155885
1167 Ga0496118_0160039
1168 Ga0496119_0005583
1169 Ga0496119_0050636
1170 Ga0496119_0081576
1171 Ga0496120_0001220
1172 Ga0496120_0014119
1173 Ga0496120_0020196
1174 Ga0496121_0004476
1175 Ga0496121_0004834
1176 Ga0496121_0010821
1177 Ga0496122_0007612
1178 Ga0496123_0000236
1179 Ga0496123_0038071
1180 Ga0496123_0045113
1181 Ga0496123_0063411
1182 Ga0496124_0044751
1183 Ga0496124_0094137
1184 Ga0496124_0141721
1185 Ga0496124_0165916
1186 Ga0496124_0459051
1187 Ga0496124_0476836
1188 Ga0496125_0012755
1189 Ga0496125_0046989
1190 Ga0496125_0056177
1191 Ga0496125_0250808
1192 Ga0496126_0027922
1193 Ga0496126_0046979
1194 Ga0496126_0092324
1195 Ga0495678_000059
1196 Ga0495682_0013528
1197 Ga0501034_0762187
1198 Ga0501047_0482169
1199 Ga0501071_0293353
1200 Ga0501079_0579695
1201 Ga0501044_0304454
1202 nmdc:mga03683_122739_c1
1203 nmdc:mga00v17_385229_c1
1204 nmdc:mga0yw44_226678_c1
1205 nmdc:mga0yw44_66259_c1
1206 nmdc:mga0a205_215240_c1
1207 nmdc:mga0sz30_12394_c1
1208 nmdc:mga0sz30_8692_c2
1209 Ga0500610_0141412
1210 Ga0500578_0026662
1211 Ga0500644_0023193
1212 Ga0500583_0046179
1213 Ga0500555_021014
1214 Ga0500597_090154
1215 Ga0500608_000469
1216 Ga0500618_001097
1217 Ga0500618_021399
1218 Ga0500618_057013
1219 Ga0500658_0072198
1220 Ga0500564_042621
1221 Ga0500568_0000415
1222 Ga0500568_0003149
1223 Ga0500573_0050932
1224 Ga0500574_001357
1225 Ga0500590_000882
1226 Ga0500604_0029240
1227 Ga0500604_0042344
1228 Ga0500616_0029451
1229 Ga0500619_003732
1230 Ga0500620_000405
1231 Ga0500622_0000134
1232 Ga0500624_000360
1233 Ga0500633_0011394
1234 Ga0500634_0123316
1235 Ga0500638_050575
1236 Ga0500636_0003486
1237 Ga0500636_0173540
1238 Ga0500567_090415
1239 3004243122
1240 2503201017
1241 2509108330
1242 2509144521
1243 2509372570
1244 2509376537
1245 2509391209
1246 2509394067
1247 2509448282
1248 2510318258
1249 2511186794
1250 2511200347
1251 2511502309
1252 2512533690
1253 2512928923
1254 2512960107
1255 2512970609
1256 2513587439
1257 2513600566
1258 2513601671
1259 2513608994
1260 2513619223
1261 2513871439
1262 2513885585
1263 2513906001
1264 2513984176
1265 2514002886
1266 2514021523
1267 2514038972
1268 2515609088
1269 2515635865
1270 2516204191
1271 2516893689
1272 2517570420
1273 2523107034
1274 2524448484
1275 2535518130
1276 2551675747
1277 2551687336
1278 2551695558
1279 2551702421
1280 2551713852
1281 2551718873
1282 2551730082
1283 2551742476
1284 2558864394
1285 2585169785
1286 2585222489
1287 2585257600
1288 2585267375
1289 2585275941
1290 2585283743
1291 2585331870
1292 2585386443
1293 2585404466
1294 2585544559
1295 2585824291
1296 2585900995
1297 2588517965
1298 2597811864
1299 2599939872
1300 2600195450
1301 2617382826
1302 2643803018
1303 2643988434
1304 2644004180
1305 2644063380
1306 2644107211
1307 2644150776
1308 2644154649
1309 2644193786
1310 2644202796
1311 2644308607
1312 2644335423
1313 2644374663
1314 2644414143
1315 2644447671
1316 2644501660
1317 2644539828
1318 2644614547
1319 2644676009
1320 2644690144
1321 2688596395
1322 2694630213
1323 2694634292
1324 2738802789
1325 2756673783
1326 2776269900
1327 2776281017
1328 2776913989
1329 2792747641
1330 2793317264
1331 2793324791
1332 2802716963
1333 2802725712
1334 2802730199
1335 2802737830
1336 2802742716
1337 2802750204
1338 2819613601
1339 2838026710
1340 2838076808
1341 2840770520
1342 2841736783
1343 2841868666
1344 2842202313
1345 2842342614
1346 2842365611
1347 2842485502
1348 2844003038
1349 2844011220
1350 2844164646
1351 2847672370
1352 2847690802
1353 2850081535
1354 2855826412
1355 2855841802
1356 2856315777
1357 2856327260
1358 2856328460
1359 2856341259
1360 2856344667
1361 2856351140
1362 2856366845
1363 2857357603
1364 2857519362
1365 2858802586
1366 2869176382
1367 2869238769
1368 2869245713
1369 2869249856
1370 2869257980
1371 2869269697
1372 2869277639
1373 2869279511
1374 2869287743
1375 2871435691
1376 2871439692
1377 2871444781
1378 2871456311
1379 2871459601
1380 2871468609
1381 2871478260
1382 2871493542
1383 2871496556
1384 2874105763
1385 2874111559
1386 2874118553
1387 2874134459
1388 2874139499
1389 2874151374
1390 2874159008
1391 2874166493
1392 2874169215
1393 2876369035
1394 2876369698
1395 2876379470
1396 2876392179
1397 2876397685
1398 2876402326
1399 2876407513
1400 2876417427
1401 2876427711
1402 2878041193
1403 2878742037
1404 2878749254
1405 2878757584
1406 2878760784
1407 2878767591
1408 2878775753
1409 2878782289
1410 2878789673
1411 2881149559
1412 2881166448
1413 2881850486
1414 2881860960
1415 2881862399
1416 2882639361
1417 2882913595
1418 2885307928
1419 2885313741
1420 2885333100
1421 2885338773
1422 2885344827
1423 2885354650
1424 2888337079
1425 2888344762
1426 2888352312
1427 2889014305
1428 2889020990
1429 2896390398
1430 2903449110
1431 2903498718
1432 2903501314
1433 2903514111
1434 2903526497
1435 2903532274
1436 2903541350
1437 2904664336
1438 2906310292
1439 2906324357
1440 2906333172
1441 2906358232
1442 2906367263
1443 2906372696
1444 2906385771
1445 2906396968
1446 2906405430
1447 2906410027
1448 2906415914
1449 2906435016
1450 2909045069
1451 2915983020
1452 2915991111
1453 2915997835
1454 2916001273
1455 2916013393
1456 2916015106
1457 2916032532
1458 2916039176
1459 2916047287
1460 2916049112
1461 2916055786
1462 2916064341
1463 2916075351
1464 2916079250
1465 2919103074
1466 2920761467
1467 2920825287
1468 2921205550
1469 2921212783
1470 2921241643
1471 2921246144
1472 2921253867
1473 2921261970
1474 2921268328
1475 2921287453
1476 2921296157
1477 2922130913
1478 2922154939
1479 2922159161
1480 2922172693
1481 2922178739
1482 2922190473
1483 2923559387
1484 2924147207
1485 2924155809
1486 2924161130
1487 2924171604
1488 2924178785
1489 2924181839
1490 2924192799
1491 2924196159
1492 2924207035
1493 2924207932
1494 2924219082
1495 2924228597
1496 2924231650
1497 2924711864
1498 2924723728
1499 2924728464
1500 2924737609
1501 2924743726
1502 2924749693
1503 2924756183
1504 2924766713
1505 2924779721
1506 2924786879
1507 2936998286
1508 2937005590
1509 2937011793
1510 2937021451
1511 2937024654
1512 2937031064
1513 2937037066
1514 2937048843
1515 2937050865
1516 2937058490
1517 2937069677
1518 2937072022
1519 2937081616
1520 2937085610
1521 2937101985
1522 2937112791
1523 2937117427
1524 2937122663
1525 2937129681
1526 2937817116
1527 2937826286
1528 2937841366
1529 2937848722
1530 2937863579
1531 2937880135
1532 2937893387
1533 2937972878
1534 2937981229
1535 2937995206
1536 2938014896
1537 2941502068
1538 2957378417
1539 2957387032
1540 2957393170
1541 2957401851
1542 2957407820
1543 2957414550
1544 2957419547
1545 2957432470
1546 2957437885
1547 2957448531
1548 2957457091
1549 2957462540
1550 2957468912
1551 2957477815
1552 2957482290
1553 2957491174
1554 2957492688
1555 2957504501
1556 2957510365
1557 2958035089
1558 2958044120
1559 2958054741
1560 2958065787
1561 2958073052
1562 2958087188
1563 2958101489
1564 2958112061
1565 2958120897
1566 2958123003
1567 2958132145
1568 2958141009
1569 2958145532
1570 2958164954
1571 2958165529
1572 2958179091
1573 2958181959
1574 2960585270
1575 2960594203
1576 2960603681
1577 2960607393
1578 2960614595
1579 2960620348
1580 2960633673
1581 2960642860
1582 2960650223
1583 2960659883
1584 2960663260
1585 2960671101
1586 2960680260
1587 2960680993
1588 2960692089
1589 2960698077
1590 2961079803
1591 2961119335
1592 2961130248
1593 2961142992
1594 2961163988
1595 2961175089
1596 2961186755
1597 2963650311
1598 2964615158
1599 2964617964
1600 2964626994
1601 2964631230
1602 2964638083
1603 2964649075
1604 2964652585
1605 2964661032
1606 2964665304
1607 2964676219
1608 2964680793
1609 2964687218
1610 2964694331
1611 2964699468
1612 2964707752
1613 2964713835
1614 2964725905
1615 2965018946
1616 2965030994
1617 2965032207
1618 2965046330
1619 2965054026
1620 2965064902
1621 2965092493
1622 2965110709
1623 2965118675
1624 2965124894
1625 2967664809
1626 2967678366
1627 2967682057
1628 2967690008
1629 2967695673
1630 2967702754
1631 2967712611
1632 2967716935
1633 2967725578
1634 2967730077
1635 2967735911
1636 2967748388
1637 2967752319
1638 2967757843
1639 2967767377
1640 2967775083
1641 2967777304
1642 2967999910
1643 2968008269
1644 2968023509
1645 2968086071
1646 2968091325
1647 2968102218
1648 2968115590
1649 2968118973
1650 2968128943
1651 2968172391
1652 2970024185
1653 2970031780
1654 2970038747
1655 2970047099
1656 2970054956
1657 2970059224
1658 2970063250
1659 2970070720
1660 2970078742
1661 2970088328
1662 2970091066
1663 2970098863
1664 2970107929
1665 2970113767
1666 2970116719
1667 2970124867
1668 2970132200
1669 2970140515
1670 2970145173
1671 2970152313
1672 2970157816
1673 2970164564
1674 2970172765
1675 2970183932
1676 2970188940
1677 2970193729
1678 2970476091
1679 2970490733
1680 2970507677
1681 2970511608
1682 2970526493
1683 2970536341
1684 2970542757
1685 2970552161
1686 2970555637
1687 2970594111
1688 2970626116
1689 2970631172
1690 2977522627
1691 2977528158
1692 2977531495
1693 2977540773
1694 2977548386
1695 2977555794
1696 2977560297
1697 2977571647
1698 2977575677
1699 2977582269
1700 2977826741
1701 2977833823
1702 2977847407
1703 2977856078
1704 2977860644
1705 2977871299
1706 2977878432
1707 2977914090
1708 2977916469
1709 2977928304
1710 2977941568
1711 2977946285
1712 2977954558
1713 2977960022
1714 2977978713
1715 2977990269
1716 2979715191
1717 2979748050
1718 2979766385
1719 2979774712
1720 2979780146
1721 2979793344
1722 2979812861
1723 2987645105
1724 2987648553
1725 2987656664
1726 2987659996
1727 2987667642
1728 2989349724
1729 2996344470
1730 2996354671
1731 2996389503
1732 3000137791
1733 3004173730
1734 3004189044
1735 3004203339
1736 3004206657
1737 3004215692
1738 3004224469
1739 3004234973
1740 3004248539
1741 3004269151
1742 3004281319
1743 3004293780
1744 3004336810
1745 3005420965
1746 3005451064
1747 3005457240
1748 637078637
1749 643822229
1750 648741963
1751 649870946
1752 8002290096
1753 8003994236
1754 8004001885
1755 8004304661
1756 8004314131
1757 8004369529
1758 8004379157
1759 8004389528
1760 8004403956
1761 8004445956
1762 8004638438
1763 8004644041
1764 8004712351
1765 8004717926
1766 8004727684
1767 8005305295
1768 8005319300
1769 8005489367
1770 8005549013
1771 8005683867
1772 8005689318
1773 8054563469
1774 8055618312

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

30

224

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

36

275

0.93

PF08659

KR

KR domain

31

204

0.82

PF23441

25

276

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ftp-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9737 2 250
8jfi-assembly1.cif.gz_B-2 crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-hexanoyl-acp from helicobacter pylori 0.9729 6 250
8jfi-assembly2.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-hexanoyl-acp from helicobacter pylori 0.9721 6 250
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9711 1 253
4dmm-assembly1.cif.gz_B 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with nadp 0.9711 1 250
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9711 1 253 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9697 2 250 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9671 1 253 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9665 3 183 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9659 6 253 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3YIB0-F1-model_v4 SDR family oxidoreductase 0.9823 3 250 GO:0016491
AF-A0A1F8NVU4-F1-model_v4 Short-chain dehydrogenase 0.9822 2 253 GO:0016491
AF-A0A2S0MRL0-F1-model_v4 SDR family oxidoreductase 0.9821 1 251 GO:0016491
AF-A0A2S8SBY0-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9818 1 251 GO:0016491
AF-A0A1P8M8Y9-F1-model_v4 Short-chain dehydrogenase 0.9816 1 253 GO:0016616

Map