F484765

General Info

Members Datasets Scaffolds Average Seq Length
888 425 1776 120

Family's Representative Sequence

Representative Sequence 3300041406|Ga0439439_0043177|Ga0439439_0043177_110_553
Length 147
Sequence MSTAGPPQGAKAPSGASEDTSAPSVGAHASSDPNCVFCKIIEGKIPSRKMYEDDDLFGFHDIAPWAPVHFMLVPKRHIPSMAQVTPDDAALLGKIMTLAPRLAIEQGCRPYPQGGFRIVVNTGAEGGQEVHHLHVHVMGGPRPWLKG

Samples

Sample ID Description Type Environment
1 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
98 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
99 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
174 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
178 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
186 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
187 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
188 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
189 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
190 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
191 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
222 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
223 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
224 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
228 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
231 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
232 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
235 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
236 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
237 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
238 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
239 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
240 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
241 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
242 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
243 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
244 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
245 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
246 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
247 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
248 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
249 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
250 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
251 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
252 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
253 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
254 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
255 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
256 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
257 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
258 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
259 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
260 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
261 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
262 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
263 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
264 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
265 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
266 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
267 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
268 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
269 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
270 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
271 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
272 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
273 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
274 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
278 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
279 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
287 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
300 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
301 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
302 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
303 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
306 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
313 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
316 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
317 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
320 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
321 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
322 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
323 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
324 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
325 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
340 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
341 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
344 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
345 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
346 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
347 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
348 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
349 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
362 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
363 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
364 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
365 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
366 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
367 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
368 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
369 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
373 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
374 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
375 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
376 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
377 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
381 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
382 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
383 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
384 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
385 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
386 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
391 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
392 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
393 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
394 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
395 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
396 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
397 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
398 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
399 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
400 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
401 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
402 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
403 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
404 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
405 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
406 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
407 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
408 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
409 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
410 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
411 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
412 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
413 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
414 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
415 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
416 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
417 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
418 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
419 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
420 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
421 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
422 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 2643221611 Acidovorax sp. Root219 Isolate Unclassified
424 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
425 2932422444 Comamonas sp. 4034 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.45
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.72
Nodule 0.56
Rhizoplane 2.93
Rhizosphere 62.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439439_0043177 3300041406 Bacteria 1172
2 SwRhRL2b_contig_1139595 2162886007 Bacteria 844
3 JGI24741J21665_1026264 3300001915 Bacteria 887
4 JGI24740J21852_10013300 3300001979 Bacteria 3076
5 JGI24739J22299_10005889 3300001989 Bacteria 4641
6 JGI24739J22299_10032128 3300001989 Bacteria 1808
7 JGI25152J39213_1005621 3300002773 Bacteria 3602
8 JGI25152J39213_1010919 3300002773 Bacteria 2040
9 JGI25152J39213_1021101 3300002773 Bacteria 1149
10 JGI25150J39212_1015355 3300002774 Bacteria 1279
11 JGI25150J39212_1023691 3300002774 Bacteria 910
12 JGI25159J45721_1006067 3300002987 Bacteria 3674
13 JGI25159J45721_1024264 3300002987 Bacteria 1084
14 JGI25151J46595_10001069 3300003187 Bacteria 20425
15 JGI25151J46595_10001564 3300003187 Bacteria 15277
16 JGI25151J46595_10041641 3300003187 Bacteria 1665
17 JGI25151J46595_10046740 3300003187 Bacteria 1513
18 JGI25153J46596_10012731 3300003215 Bacteria 3604
19 JGI25153J46596_10038296 3300003215 Bacteria 1513
20 rootH1_10026301 3300003316 Bacteria 1996
21 rootH2_10161433 3300003320 Bacteria 1325
22 rootL2_10066366 3300003322 Bacteria 1163
23 rootH1_10052402 3300003323 Bacteria 2726
24 JGI25160J50197_1009111 3300003354 Bacteria 3711
25 JGI25160J50197_1028168 3300003354 Bacteria 1513
26 JGI25161J50226_1001273 3300003374 Bacteria 8027
27 JGI25161J50226_1011521 3300003374 Bacteria 1107
28 Ga0006562J51391_1005968 3300003578 Bacteria 2496
29 Ga0006562J51391_1022798 3300003578 Bacteria 2508
30 Ga0006562J51391_1022801 3300003578 Bacteria 950
31 Ga0055527_1013703 3300003760 Bacteria 903
32 Ga0055535_1001110 3300003761 Bacteria 16350
33 Ga0055542_1000080 3300003762 Bacteria 129634
34 Ga0055526_1030637 3300003771 Bacteria 1564
35 Ga0055526_1037136 3300003771 Bacteria 1279
36 Ga0055537_1000150 3300003773 Bacteria 52097
37 Ga0055537_1003893 3300003773 Bacteria 4445
38 Ga0055537_1013649 3300003773 Bacteria 1513
39 Ga0055524_1028031 3300003775 Bacteria 1696
40 Ga0055524_1037663 3300003775 Bacteria 1279
41 Ga0055536_1010350 3300003781 Bacteria 3716
42 Ga0055536_1014050 3300003781 Bacteria 2838
43 Ga0055536_1017459 3300003781 Bacteria 2348
44 Ga0055536_1018282 3300003781 Bacteria 2252
45 Ga0055536_1048769 3300003781 Bacteria 945
46 Ga0055534_1000016 3300003784 Bacteria 144444
47 Ga0055534_1007358 3300003784 Bacteria 2632
48 Ga0055534_1022159 3300003784 Bacteria 1054
49 Ga0055534_1032462 3300003784 Bacteria 799
50 Ga0055528_1000894 3300003790 Bacteria 20125
51 Ga0055528_1009649 3300003790 Bacteria 4014
52 Ga0055528_1028958 3300003790 Bacteria 1513
53 Ga0055530_10002826 3300003791 Bacteria 10654
54 Ga0055530_10005609 3300003791 Bacteria 5893
55 Ga0055540_1001247 3300003792 Bacteria 15622
56 Ga0055540_1006304 3300003792 Bacteria 4742
57 Ga0055540_1008300 3300003792 Bacteria 3758
58 Ga0055540_1010102 3300003792 Bacteria 3173
59 Ga0055540_1024557 3300003792 Bacteria 1492
60 Ga0055540_1028493 3300003792 Bacteria 1320
61 Ga0055540_1043556 3300003792 Bacteria 957
62 Ga0055531_10000257 3300003794 Bacteria 56547
63 Ga0055531_10013583 3300003794 Bacteria 3742
64 Ga0055531_10043153 3300003794 Bacteria 1279
65 Ga0055531_10043197 3300003794 Bacteria 1278
66 Ga0055543_1004453 3300004625 Bacteria 3823
67 Ga0055543_1012039 3300004625 Bacteria 1751
68 Ga0065165_1022212 3300005262 Bacteria 2182
69 Ga0065165_1084303 3300005262 Bacteria 819
70 Ga0065714_10003179 3300005288 Bacteria 12607
71 Ga0065714_10020540 3300005288 Bacteria 2653
72 Ga0065704_10098136 3300005289 Bacteria 2364
73 Ga0065704_10150792 3300005289 Bacteria 1431
74 Ga0065704_10194160 3300005289 Bacteria 1170
75 Ga0070658_10150835 3300005327 Bacteria 1946
76 Ga0070658_10195232 3300005327 Bacteria 1707
77 Ga0070658_10238409 3300005327 Bacteria 1541
78 Ga0070658_10553014 3300005327 Bacteria 996
79 Ga0070658_10612725 3300005327 Bacteria 944
80 Ga0070676_10403174 3300005328 Bacteria 952
81 Ga0070676_10952606 3300005328 Bacteria 642
82 Ga0070676_11060213 3300005328 Bacteria 611
83 Ga0070677_10371826 3300005333 Bacteria 746
84 Ga0068869_100358093 3300005334 Bacteria 1191
85 Ga0068869_100909658 3300005334 Bacteria 762
86 Ga0070680_100182847 3300005336 Bacteria 1766
87 Ga0068868_101196025 3300005338 Bacteria 703
88 Ga0070660_100112312 3300005339 Bacteria 2169
89 Ga0070660_101101614 3300005339 Bacteria 672
90 Ga0070668_100133718 3300005347 Bacteria 1992
91 Ga0070669_100142848 3300005353 Bacteria 1847
92 Ga0070675_100110942 3300005354 Bacteria 2320
93 Ga0070675_100286798 3300005354 Bacteria 1448
94 Ga0070671_100698192 3300005355 Bacteria 880
95 Ga0070674_100108262 3300005356 Bacteria 2036
96 Ga0070674_102031511 3300005356 Bacteria 524
97 Ga0070673_100176030 3300005364 Bacteria 1829
98 Ga0070673_100227738 3300005364 Bacteria 1616
99 Ga0070673_100567129 3300005364 Bacteria 1033
100 Ga0070688_101805254 3300005365 Bacteria 502
101 Ga0070659_100144962 3300005366 Bacteria 1934
102 Ga0070659_100272375 3300005366 Bacteria 1407
103 Ga0070667_100055014 3300005367 Bacteria 3361
104 Ga0070667_101352748 3300005367 Bacteria 668
105 Ga0070714_100065548 3300005435 Bacteria 3129
106 Ga0070678_100078732 3300005456 Bacteria 2491
107 Ga0070678_100117703 3300005456 Bacteria 2090
108 Ga0070678_100136554 3300005456 Bacteria 1956
109 Ga0070678_100188117 3300005456 Bacteria 1696
110 Ga0070678_100241016 3300005456 Bacteria 1512
111 Ga0070678_101381302 3300005456 Bacteria 657
112 Ga0070662_100018575 3300005457 Bacteria 4705
113 Ga0070662_100127535 3300005457 Bacteria 1957
114 Ga0068867_100655319 3300005459 Bacteria 921
115 Ga0068867_100740580 3300005459 Bacteria 871
116 Ga0068867_101894647 3300005459 Bacteria 562
117 Ga0070679_100041543 3300005530 Bacteria 4576
118 Ga0070679_100144338 3300005530 Bacteria 2358
119 Ga0070684_101847280 3300005535 Bacteria 570
120 Ga0068853_100163721 3300005539 Bacteria 2008
121 Ga0068853_100527782 3300005539 Bacteria 1116
122 Ga0068853_100645953 3300005539 Bacteria 1007
123 Ga0068853_100757762 3300005539 Bacteria 928
124 Ga0070672_100253317 3300005543 Bacteria 1483
125 Ga0070665_100024013 3300005548 Bacteria 6139
126 Ga0070665_100162313 3300005548 Bacteria 2236
127 Ga0070665_100510248 3300005548 Bacteria 1214
128 Ga0070665_100580640 3300005548 Bacteria 1134
129 Ga0070665_102025120 3300005548 Bacteria 581
130 Ga0068855_100006806 3300005563 Bacteria 13869
131 Ga0068855_100163186 3300005563 Bacteria 2527
132 Ga0068855_100329547 3300005563 Bacteria 1685
133 Ga0070664_100008507 3300005564 Bacteria 8295
134 Ga0070664_102046068 3300005564 Bacteria 543
135 Ga0068857_100231554 3300005577 Bacteria 1690
136 Ga0068857_100848605 3300005577 Bacteria 874
137 Ga0068857_101168081 3300005577 Bacteria 745
138 Ga0068854_100068140 3300005578 Bacteria 2594
139 Ga0068854_100907765 3300005578 Bacteria 774
140 Ga0068852_100169742 3300005616 Bacteria 2044
141 Ga0068851_10029330 3300005834 Bacteria 2723
142 Ga0068870_10920240 3300005840 Bacteria 619
143 Ga0068858_101197000 3300005842 Bacteria 747
144 Ga0068862_100105979 3300005844 Bacteria 2464
145 Ga0075365_10004543 3300006038 Bacteria 7371
146 Ga0075365_10011938 3300006038 Bacteria 5131
147 Ga0075365_10023104 3300006038 Bacteria 3906
148 Ga0075365_10024567 3300006038 Bacteria 3803
149 Ga0075365_10166075 3300006038 Bacteria 1540
150 Ga0075365_10343725 3300006038 Bacteria 1051
151 Ga0075365_10386338 3300006038 Bacteria 988
152 Ga0075368_10282316 3300006042 Bacteria 714
153 Ga0075363_100007676 3300006048 Bacteria 4976
154 Ga0075363_100070252 3300006048 Bacteria 1901
155 Ga0075363_100217430 3300006048 Bacteria 1095
156 Ga0075363_100408512 3300006048 Bacteria 798
157 Ga0075364_10001078 3300006051 Bacteria 14541
158 Ga0075364_10298992 3300006051 Bacteria 1095
159 Ga0075432_10001601 3300006058 Bacteria 7442
160 Ga0075432_10005352 3300006058 Bacteria 4373
161 Ga0075362_10043861 3300006177 Bacteria 1981
162 Ga0075362_10047496 3300006177 Bacteria 1912
163 Ga0075362_10139559 3300006177 Bacteria 1157
164 Ga0075362_10152965 3300006177 Bacteria 1108
165 Ga0075362_10327870 3300006177 Bacteria 763
166 Ga0075362_10579740 3300006177 Bacteria 578
167 Ga0075362_10586143 3300006177 Bacteria 575
168 Ga0075367_10027246 3300006178 Bacteria 3249
169 Ga0075367_10086295 3300006178 Bacteria 1905
170 Ga0075367_10100772 3300006178 Bacteria 1765
171 Ga0075367_10231618 3300006178 Bacteria 1157
172 Ga0075367_10343297 3300006178 Bacteria 942
173 Ga0075369_10335295 3300006186 Bacteria 708
174 Ga0075366_10002010 3300006195 Bacteria 10317
175 Ga0075366_10003520 3300006195 Bacteria 8275
176 Ga0075366_10009938 3300006195 Bacteria 5327
177 Ga0075366_10034637 3300006195 Bacteria 2974
178 Ga0075366_10057553 3300006195 Bacteria 2310
179 Ga0075366_10100825 3300006195 Bacteria 1732
180 Ga0097621_100175436 3300006237 Bacteria 1850
181 Ga0097621_102158638 3300006237 Bacteria 533
182 Ga0075370_10000304 3300006353 Bacteria 17728
183 Ga0075370_10005111 3300006353 Bacteria 6468
184 Ga0075370_10014472 3300006353 Bacteria 4209
185 Ga0075370_10015729 3300006353 Bacteria 4058
186 Ga0075370_10020002 3300006353 Bacteria 3651
187 Ga0075370_10110612 3300006353 Bacteria 1596
188 Ga0075370_10124227 3300006353 Bacteria 1504
189 Ga0075370_10144188 3300006353 Bacteria 1393
190 Ga0075370_10250007 3300006353 Bacteria 1051
191 Ga0075370_10422826 3300006353 Bacteria 801
192 Ga0075370_10515906 3300006353 Bacteria 722
193 Ga0075370_10751826 3300006353 Bacteria 593
194 Ga0068871_101579579 3300006358 Bacteria 621
195 Ga0075430_100069245 3300006846 Bacteria 2960
196 Ga0075431_100579867 3300006847 Bacteria 1107
197 Ga0075429_100177102 3300006880 Bacteria 1869
198 Ga0068865_100951286 3300006881 Bacteria 750
199 Ga0079104_1025289 3300006946 Bacteria 1551
200 Ga0099826_10000101 3300006948 Bacteria 40408
201 Ga0099826_10109187 3300006948 Bacteria 1651
202 Ga0105244_10049588 3300009036 Bacteria 2145
203 Ga0105244_10271625 3300009036 Bacteria 787
204 Ga0105244_10473373 3300009036 Bacteria 576
205 Ga0105240_10008945 3300009093 Bacteria 14239
206 Ga0105240_10104606 3300009093 Bacteria 3438
207 Ga0105240_10217744 3300009093 Bacteria 2226
208 Ga0105245_10180345 3300009098 Bacteria 2017
209 Ga0105245_10655149 3300009098 Bacteria 1080
210 Ga0105245_11059773 3300009098 Bacteria 856
211 Ga0105245_12239086 3300009098 Bacteria 600
212 Ga0105243_10036791 3300009148 Bacteria 3802
213 Ga0105243_10037344 3300009148 Bacteria 3775
214 Ga0105243_10726453 3300009148 Bacteria 971
215 Ga0105243_11030141 3300009148 Bacteria 827
216 Ga0105241_10554815 3300009174 Bacteria 1032
217 Ga0105242_10001936 3300009176 Bacteria 16289
218 Ga0105242_10410881 3300009176 Bacteria 1266
219 Ga0105242_10422116 3300009176 Bacteria 1250
220 Ga0105242_10455396 3300009176 Bacteria 1207
221 Ga0105237_10393687 3300009545 Bacteria 1390
222 Ga0105237_11603970 3300009545 Bacteria 658
223 Ga0105238_10005849 3300009551 Bacteria 12180
224 Ga0105238_10385391 3300009551 Bacteria 1394
225 Ga0105238_10506597 3300009551 Bacteria 1208
226 Ga0105249_11017161 3300009553 Bacteria 898
227 Ga0105239_10105208 3300010375 Bacteria 3125
228 Ga0105239_10775322 3300010375 Bacteria 1098
229 Ga0105239_11669661 3300010375 Bacteria 737
230 Ga0105246_10111217 3300011119 Bacteria 2012
231 Ga0105246_10154807 3300011119 Bacteria 1740
232 Ga0105246_11161716 3300011119 Bacteria 708
233 Ga0157322_1033385 3300012490 Bacteria 560
234 Ga0157347_1033560 3300012502 Bacteria 653
235 Ga0157339_1017976 3300012505 Bacteria 723
236 Ga0157373_10031485 3300013100 Bacteria 3818
237 Ga0157373_10145760 3300013100 Bacteria 1665
238 Ga0157373_10187275 3300013100 Bacteria 1458
239 Ga0157373_10292037 3300013100 Bacteria 1156
240 Ga0157373_10462388 3300013100 Bacteria 914
241 Ga0157371_10347860 3300013102 Bacteria 1079
242 Ga0157370_10006343 3300013104 Bacteria 13063
243 Ga0157370_10577168 3300013104 Bacteria 1030
244 Ga0157370_10828426 3300013104 Bacteria 841
245 Ga0157370_10918275 3300013104 Bacteria 794
246 Ga0157370_11218174 3300013104 Bacteria 679
247 Ga0157369_10008807 3300013105 Bacteria 11563
248 Ga0157374_10277529 3300013296 Bacteria 1654
249 Ga0157374_11426807 3300013296 Bacteria 715
250 Ga0163162_10296582 3300013306 Bacteria 1748
251 Ga0157372_10568359 3300013307 Bacteria 1322
252 Ga0157372_12350477 3300013307 Bacteria 612
253 Ga0157375_10156318 3300013308 Bacteria 2419
254 Ga0157375_10213056 3300013308 Bacteria 2090
255 Ga0157375_11688974 3300013308 Bacteria 750
256 Ga0182008_10001806 3300014497 Bacteria 13972
257 Ga0182008_10005163 3300014497 Bacteria 7487
258 Ga0182008_10020210 3300014497 Bacteria 3431
259 Ga0182008_10183987 3300014497 Bacteria 1058
260 Ga0182008_10221844 3300014497 Bacteria 967
261 Ga0157377_11321952 3300014745 Bacteria 564
262 Ga0157376_10186194 3300014969 Bacteria 1901
263 Ga0157376_10998306 3300014969 Bacteria 859
264 Ga0157376_12562524 3300014969 Bacteria 550
265 Ga0182006_1005907 3300015261 Bacteria 5761
266 Ga0182006_1041115 3300015261 Bacteria 1817
267 Ga0182006_1157628 3300015261 Bacteria 766
268 Ga0182006_1323034 3300015261 Bacteria 507
269 Ga0182007_10004286 3300015262 Bacteria 6501
270 Ga0182007_10015525 3300015262 Bacteria 2837
271 Ga0182007_10051471 3300015262 Bacteria 1358
272 Ga0182005_1042401 3300015265 Bacteria 1237
273 Ga0182005_1139173 3300015265 Bacteria 700
274 Ga0182005_1155222 3300015265 Bacteria 668
275 Ga0183362_10003 3300015683 Bacteria 977584
276 Ga0163161_10001428 3300017792 Bacteria 17611
277 Ga0163161_10001866 3300017792 Bacteria 15379
278 Ga0163161_10011965 3300017792 Bacteria 6020
279 Ga0163161_10033986 3300017792 Bacteria 3646
280 Ga0163161_10135200 3300017792 Bacteria 1863
281 Ga0163161_10468120 3300017792 Bacteria 1021
282 Ga0163161_10681605 3300017792 Bacteria 854
283 Ga0163161_11387551 3300017792 Bacteria 613
284 Ga0163161_11496708 3300017792 Bacteria 592
285 Ga0213872_10067622 3300021361 Bacteria 1612
286 Ga0209672_100378 3300025228 Bacteria 27209
287 Ga0209147_100696 3300025229 Bacteria 17227
288 Ga0209258_100093 3300025242 Bacteria 223559
289 Ga0207425_1003154 3300025245 Bacteria 5398
290 Ga0207425_1037790 3300025245 Bacteria 930
291 Ga0209148_1000007 3300025254 Bacteria 1592273
292 Ga0209129_1000024 3300025258 Bacteria 417268
293 Ga0209129_1005316 3300025258 Bacteria 4615
294 Ga0209129_1006968 3300025258 Bacteria 3489
295 Ga0209129_1009656 3300025258 Bacteria 2508
296 Ga0209129_1012142 3300025258 Bacteria 2001
297 Ga0209565_1000098 3300025263 Bacteria 132021
298 Ga0209565_1000633 3300025263 Bacteria 22947
299 Ga0209565_1003729 3300025263 Bacteria 4831
300 Ga0209673_1000058 3300025273 Bacteria 269028
301 Ga0209673_1001185 3300025273 Bacteria 28137
302 Ga0209673_1002178 3300025273 Bacteria 14443
303 Ga0209673_1021052 3300025273 Bacteria 2291
304 Ga0209673_1082175 3300025273 Bacteria 735
305 Ga0209673_1124279 3300025273 Bacteria 521
306 Ga0209130_1001692 3300025284 Bacteria 13338
307 Ga0209130_1018535 3300025284 Bacteria 1631
308 Ga0209130_1041871 3300025284 Bacteria 879
309 Ga0209675_1000010 3300025291 Bacteria 541927
310 Ga0209675_1000151 3300025291 Bacteria 91172
311 Ga0209675_1000431 3300025291 Bacteria 33567
312 Ga0209675_1001858 3300025291 Bacteria 11452
313 Ga0209676_1000028 3300025292 Bacteria 559745
314 Ga0209676_1000333 3300025292 Bacteria 90785
315 Ga0209676_1002526 3300025292 Bacteria 12760
316 Ga0209676_1005042 3300025292 Bacteria 7062
317 Ga0209676_1008655 3300025292 Bacteria 4504
318 Ga0209676_1045505 3300025292 Bacteria 1194
319 Ga0209676_1054226 3300025292 Bacteria 1034
320 Ga0209025_1000289 3300025294 Bacteria 113555
321 Ga0209025_1000685 3300025294 Bacteria 58093
322 Ga0209025_1004578 3300025294 Bacteria 11876
323 Ga0209025_1008279 3300025294 Bacteria 7509
324 Ga0209025_1008530 3300025294 Bacteria 7360
325 Ga0209025_1016710 3300025294 Bacteria 4300
326 Ga0209564_1000209 3300025295 Bacteria 133651
327 Ga0209564_1002281 3300025295 Bacteria 15652
328 Ga0209564_1027576 3300025295 Bacteria 1841
329 Ga0209564_1028299 3300025295 Bacteria 1796
330 Ga0209758_1000049 3300025297 Bacteria 345104
331 Ga0209758_1027337 3300025297 Bacteria 2440
332 Ga0209050_1000072 3300025298 Bacteria 293619
333 Ga0209050_1000721 3300025298 Bacteria 48376
334 Ga0209050_1000927 3300025298 Bacteria 38487
335 Ga0209050_1024101 3300025298 Bacteria 2118
336 Ga0209050_1032889 3300025298 Bacteria 1584
337 Ga0209256_1000088 3300025299 Bacteria 217236
338 Ga0209256_1017360 3300025299 Bacteria 2395
339 Ga0209256_1023416 3300025299 Bacteria 1842
340 Ga0207426_1000038 3300025302 Bacteria 441522
341 Ga0207426_1000053 3300025302 Bacteria 384818
342 Ga0209051_1000015 3300025303 Bacteria 546798
343 Ga0209051_1000025 3300025303 Bacteria 415397
344 Ga0209051_1000056 3300025303 Bacteria 271616
345 Ga0209051_1000424 3300025303 Bacteria 57966
346 Ga0209051_1000545 3300025303 Bacteria 46076
347 Ga0209051_1000757 3300025303 Bacteria 34605
348 Ga0209051_1004866 3300025303 Bacteria 8064
349 Ga0209051_1045133 3300025303 Bacteria 1528
350 Ga0209257_1000039 3300025304 Bacteria 591694
351 Ga0209257_1003278 3300025304 Bacteria 14122
352 Ga0209257_1003691 3300025304 Bacteria 12748
353 Ga0209257_1004686 3300025304 Bacteria 10280
354 Ga0209257_1024960 3300025304 Bacteria 2054
355 Ga0207656_10025888 3300025321 Bacteria 2386
356 Ga0207655_1009225 3300025728 Bacteria 6155
357 Ga0207688_10951891 3300025901 Bacteria 543
358 Ga0207647_10259423 3300025904 Bacteria 995
359 Ga0207645_10466030 3300025907 Bacteria 853
360 Ga0207705_10119461 3300025909 Bacteria 1955
361 Ga0207705_10190402 3300025909 Bacteria 1551
362 Ga0207705_10191968 3300025909 Bacteria 1545
363 Ga0207705_10344520 3300025909 Bacteria 1147
364 Ga0207705_10374570 3300025909 Bacteria 1099
365 Ga0207705_10670440 3300025909 Bacteria 806
366 Ga0207707_10122443 3300025912 Bacteria 2275
367 Ga0207695_10216190 3300025913 Bacteria 1826
368 Ga0207695_10330904 3300025913 Bacteria 1412
369 Ga0207671_10025637 3300025914 Bacteria 4427
370 Ga0207657_10038921 3300025919 Bacteria 4229
371 Ga0207657_10552566 3300025919 Bacteria 900
372 Ga0207657_10887746 3300025919 Bacteria 687
373 Ga0207657_10922875 3300025919 Bacteria 672
374 Ga0207649_11599179 3300025920 Bacteria 516
375 Ga0207652_10048380 3300025921 Bacteria 3635
376 Ga0207652_11169647 3300025921 Bacteria 670
377 Ga0207681_10100764 3300025923 Bacteria 2082
378 Ga0207694_10009970 3300025924 Bacteria 7161
379 Ga0207694_10367641 3300025924 Bacteria 1192
380 Ga0207659_10248065 3300025926 Bacteria 1443
381 Ga0207687_10097625 3300025927 Bacteria 2155
382 Ga0207687_10450402 3300025927 Bacteria 1067
383 Ga0207687_10909488 3300025927 Bacteria 753
384 Ga0207690_10153252 3300025932 Bacteria 1710
385 Ga0207690_10305274 3300025932 Bacteria 1246
386 Ga0207706_10019114 3300025933 Bacteria 6163
387 Ga0207686_10021874 3300025934 Bacteria 3676
388 Ga0207686_10344627 3300025934 Bacteria 1120
389 Ga0207709_10000958 3300025935 Bacteria 21596
390 Ga0207709_10001025 3300025935 Bacteria 20674
391 Ga0207709_10058565 3300025935 Bacteria 2394
392 Ga0207709_11446482 3300025935 Bacteria 570
393 Ga0207669_10153012 3300025937 Bacteria 1618
394 Ga0207669_11194577 3300025937 Bacteria 644
395 Ga0207669_11287390 3300025937 Bacteria 621
396 Ga0207691_10183575 3300025940 Bacteria 1827
397 Ga0207691_10465680 3300025940 Bacteria 1075
398 Ga0207691_10518676 3300025940 Bacteria 1011
399 Ga0207689_10401036 3300025942 Bacteria 1143
400 Ga0207679_10249310 3300025945 Bacteria 1508
401 Ga0207667_10044142 3300025949 Bacteria 4726
402 Ga0207667_10271972 3300025949 Bacteria 1732
403 Ga0207667_10442505 3300025949 Bacteria 1321
404 Ga0207651_10191923 3300025960 Bacteria 1630
405 Ga0207651_10874111 3300025960 Bacteria 800
406 Ga0207651_11562231 3300025960 Bacteria 594
407 Ga0207712_11194328 3300025961 Bacteria 678
408 Ga0207640_10277130 3300025981 Bacteria 1315
409 Ga0207640_10818682 3300025981 Bacteria 808
410 Ga0207658_10480905 3300025986 Bacteria 1103
411 Ga0207658_11051644 3300025986 Bacteria 743
412 Ga0207703_11399255 3300026035 Bacteria 673
413 Ga0207639_10062155 3300026041 Bacteria 2886
414 Ga0207639_10442979 3300026041 Bacteria 1178
415 Ga0207639_10559538 3300026041 Bacteria 1051
416 Ga0207639_10622354 3300026041 Bacteria 997
417 Ga0207639_11035979 3300026041 Bacteria 769
418 Ga0207678_10131083 3300026067 Bacteria 2138
419 Ga0207702_11370509 3300026078 Bacteria 701
420 Ga0207648_10906197 3300026089 Bacteria 824
421 Ga0207648_11713992 3300026089 Bacteria 590
422 Ga0207674_10087595 3300026116 Bacteria 3107
423 Ga0207674_10362219 3300026116 Bacteria 1401
424 Ga0207683_10043646 3300026121 Bacteria 3918
425 Ga0207683_10156580 3300026121 Bacteria 2058
426 Ga0207683_10201423 3300026121 Bacteria 1810
427 Ga0207683_10390270 3300026121 Bacteria 1280
428 Ga0207683_10511563 3300026121 Bacteria 1109
429 Ga0207683_11242106 3300026121 Bacteria 690
430 Ga0207698_10675695 3300026142 Bacteria 1025
431 Ga0209281_1039412 3300027111 Bacteria 802
432 Ga0209968_1026886 3300027526 Bacteria 952
433 Ga0209982_1033270 3300027552 Bacteria 813
434 Ga0209970_1000036 3300027614 Bacteria 17242
435 Ga0209282_1000785 3300027666 Bacteria 16113
436 Ga0209971_1023805 3300027682 Bacteria 1461
437 Ga0209813_10047942 3300027866 Bacteria 1325
438 Ga0209974_10004079 3300027876 Bacteria 5216
439 Ga0209974_10013668 3300027876 Bacteria 2703
440 Ga0209974_10094486 3300027876 Bacteria 1039
441 Ga0207428_10081162 3300027907 Bacteria 2533
442 Ga0207428_10200482 3300027907 Bacteria 1502
443 Ga0268266_10013081 3300028379 Bacteria 7156
444 Ga0268266_10483141 3300028379 Bacteria 1181
445 Ga0268266_11535685 3300028379 Bacteria 641
446 Ga0268265_10102366 3300028380 Bacteria 2316
447 Ga0307515_10004716 3300028794 Bacteria 27939
448 Ga0307515_10296335 3300028794 Bacteria 1307
449 Ga0307512_10215614 3300030522 Bacteria 1012
450 Ga0316177_1085660 3300030731 Bacteria 2710
451 Ga0316177_1120923 3300030731 Bacteria 1727
452 Ga0316176_1044943 3300030732 Bacteria 5479
453 Ga0314311_1181387 3300030733 Bacteria 8006
454 Ga0316183_1046501 3300030742 Bacteria 6498
455 Ga0316181_1019721 3300030744 Bacteria 5168
456 Ga0316182_1247982 3300030745 Bacteria 1962
457 Ga0316182_1441726 3300030745 Bacteria 1772
458 Ga0265332_10292800 3300031238 Bacteria 672
459 Ga0265331_10119585 3300031250 Bacteria 1205
460 Ga0265327_10000789 3300031251 Bacteria 48791
461 Ga0265327_10005861 3300031251 Bacteria 10046
462 Ga0265316_10103655 3300031344 Bacteria 2160
463 Ga0307513_10076892 3300031456 Bacteria 3460
464 Ga0307513_10886532 3300031456 Bacteria 599
465 Ga0307408_100013422 3300031548 Bacteria 5436
466 Ga0307408_100253542 3300031548 Bacteria 1452
467 Ga0307408_100567688 3300031548 Bacteria 1003
468 Ga0307408_100567720 3300031548 Bacteria 1003
469 Ga0307408_101210607 3300031548 Bacteria 705
470 Ga0307514_10004647 3300031649 Bacteria 12588
471 Ga0265314_10006203 3300031711 Bacteria 10617
472 Ga0265342_10060778 3300031712 Bacteria 2227
473 Ga0265342_10185236 3300031712 Bacteria 1138
474 Ga0307516_10156441 3300031730 Bacteria 2034
475 Ga0307405_10045105 3300031731 Bacteria 2699
476 Ga0307405_10223349 3300031731 Bacteria 1383
477 Ga0307405_10825468 3300031731 Bacteria 778
478 Ga0307410_10064368 3300031852 Bacteria 2519
479 Ga0307406_10005016 3300031901 Bacteria 7215
480 Ga0307406_11115606 3300031901 Bacteria 682
481 Ga0307412_10086036 3300031911 Bacteria 2186
482 Ga0307412_10152808 3300031911 Bacteria 1705
483 Ga0307412_10516845 3300031911 Bacteria 997
484 Ga0307412_11693916 3300031911 Bacteria 579
485 Ga0307416_100026977 3300032002 Bacteria 4244
486 Ga0307416_100034338 3300032002 Bacteria 3859
487 Ga0307416_101143473 3300032002 Bacteria 884
488 Ga0307416_101601510 3300032002 Bacteria 756
489 Ga0307414_10070360 3300032004 Bacteria 2519
490 Ga0307414_10072933 3300032004 Bacteria 2481
491 Ga0307414_10493195 3300032004 Bacteria 1082
492 Ga0307411_10647557 3300032005 Bacteria 914
493 Ga0307415_100713115 3300032126 Bacteria 907
494 Ga0373939_0337975 3300035114 Bacteria 610
495 Ga0373931_0159054 3300035691 Bacteria 1323
496 Ga0373935_0389638 3300035692 Bacteria 999
497 Ga0373927_0827967 3300035695 Bacteria 611
498 Ga0373925_0511951 3300037068 Bacteria 986
499 Ga0395899_0019414 3300037312 Bacteria 5165
500 Ga0395899_0035679 3300037312 Bacteria 3732
501 Ga0395899_0173816 3300037312 Bacteria 1515
502 Ga0395899_0244138 3300037312 Bacteria 1235
503 Ga0395900_0011923 3300037418 Bacteria 8886
504 Ga0395900_0019815 3300037418 Bacteria 6854
505 Ga0395900_0047396 3300037418 Bacteria 4424
506 Ga0395900_0052858 3300037418 Bacteria 4182
507 Ga0395900_0421238 3300037418 Bacteria 1296
508 Ga0395900_0853076 3300037418 Bacteria 836
509 Ga0395898_0016238 3300037466 Bacteria 7621
510 Ga0395898_0017821 3300037466 Bacteria 7245
511 Ga0395898_0110816 3300037466 Bacteria 2630
512 Ga0395898_0475940 3300037466 Bacteria 1188
513 Ga0395898_0693006 3300037466 Bacteria 961
514 Ga0395905_0000027 3300037471 Bacteria 297239
515 Ga0395905_0011168 3300037471 Bacteria 8682
516 Ga0395905_0018668 3300037471 Bacteria 6577
517 Ga0395905_0023994 3300037471 Bacteria 5758
518 Ga0395905_0025965 3300037471 Bacteria 5522
519 Ga0395905_0059022 3300037471 Bacteria 3587
520 Ga0395905_0093619 3300037471 Bacteria 2818
521 Ga0395905_0097950 3300037471 Bacteria 2753
522 Ga0395905_0167972 3300037471 Bacteria 2061
523 Ga0395905_0573117 3300037471 Bacteria 1030
524 Ga0395905_0576879 3300037471 Bacteria 1026
525 Ga0395905_1149015 3300037471 Bacteria 680
526 Ga0395901_0026973 3300038443 Bacteria 5898
527 Ga0395901_0043020 3300038443 Bacteria 4685
528 Ga0395901_0061046 3300038443 Bacteria 3923
529 Ga0395901_0064334 3300038443 Bacteria 3818
530 Ga0395901_0068948 3300038443 Bacteria 3683
531 Ga0395901_0121481 3300038443 Bacteria 2745
532 Ga0395901_0211801 3300038443 Bacteria 2028
533 Ga0395901_0257769 3300038443 Bacteria 1816
534 Ga0395901_1123484 3300038443 Bacteria 755
535 Ga0395901_1896524 3300038443 Bacteria 543
536 Ga0436361_0070738 3300039447 Bacteria 27213
537 Ga0439436_0006510 3300041404 Bacteria 3585
538 Ga0439436_0010396 3300041404 Bacteria 2839
539 Ga0439436_0018487 3300041404 Bacteria 2084
540 Ga0439438_039792 3300041405 Bacteria 1224
541 Ga0439439_0002012 3300041406 Bacteria 4227
542 Ga0439447_022624 3300041407 Bacteria 1644
543 Ga0439447_028164 3300041407 Bacteria 1429
544 Ga0439447_152725 3300041407 Bacteria 531
545 Ga0439461_0006354 3300041410 Bacteria 2055
546 Ga0439466_0002323 3300041411 Bacteria 7463
547 Ga0439466_0012501 3300041411 Bacteria 3125
548 Ga0439466_0015344 3300041411 Bacteria 2782
549 Ga0439465_0001853 3300041413 Bacteria 6919
550 Ga0439465_0004649 3300041413 Bacteria 4430
551 Ga0451791_0284746 3300041451 Bacteria 1155
552 Ga0451791_0563739 3300041451 Bacteria 607
553 Ga0451791_1887967 3300041451 Bacteria 693
554 Ga0451798_0925139 3300041458 Bacteria 708
555 Ga0451807_0419949 3300041486 Bacteria 675
556 Ga0451807_1686510 3300041486 Bacteria 731
557 Ga0451807_2302176 3300041486 Bacteria 547
558 Ga0451833_0574531 3300041491 Bacteria 807
559 Ga0451835_1043689 3300041492 Bacteria 550
560 Ga0451841_1228420 3300041498 Bacteria 551
561 Ga0451853_1261129 3300041512 Bacteria 745
562 Ga0439433_0001942 3300041999 Bacteria 4328
563 Ga0439437_003204 3300042000 Bacteria 1763
564 Ga0439441_035560 3300042001 Bacteria 982
565 Ga0439442_004106 3300042002 Bacteria 2888
566 Ga0439443_034373 3300042003 Bacteria 846
567 Ga0439445_0000200 3300042004 Bacteria 10930
568 Ga0439445_0240596 3300042004 Bacteria 539
569 Ga0439448_0107664 3300042005 Bacteria 951
570 Ga0439432_001787 3300042006 Bacteria 8050
571 Ga0439432_002229 3300042006 Bacteria 7308
572 Ga0439432_070836 3300042006 Bacteria 1063
573 Ga0439449_0001772 3300042007 Bacteria 8484
574 Ga0439449_0003811 3300042007 Bacteria 5838
575 Ga0439449_0010236 3300042007 Bacteria 3542
576 Ga0439449_0166167 3300042007 Bacteria 824
577 Ga0439452_002059 3300042010 Bacteria 7639
578 Ga0439452_002146 3300042010 Bacteria 7456
579 Ga0439457_008995 3300042014 Bacteria 2337
580 Ga0439457_045221 3300042014 Bacteria 984
581 Ga0439462_0002253 3300042015 Bacteria 4455
582 Ga0439462_0007235 3300042015 Bacteria 2776
583 Ga0439462_0048246 3300042015 Bacteria 1142
584 Ga0450914_024523 3300042118 Bacteria 693
585 Ga0450915_000567 3300042119 Bacteria 1412
586 Ga0450923_014302 3300042125 Bacteria 1471
587 Ga0450890_003980 3300042127 Bacteria 1945
588 Ga0450890_004272 3300042127 Bacteria 1871
589 Ga0450897_004575 3300042128 Bacteria 1162
590 Ga0450891_012508 3300042129 Bacteria 791
591 Ga0450891_013050 3300042129 Bacteria 778
592 Ga0450891_014893 3300042129 Bacteria 735
593 Ga0450894_003496 3300042131 Bacteria 2053
594 Ga0450896_017735 3300042133 Bacteria 1029
595 Ga0450898_083624 3300042134 Bacteria 652
596 Ga0450898_106959 3300042134 Bacteria 589
597 Ga0450899_027903 3300042135 Bacteria 679
598 Ga0450899_053117 3300042135 Bacteria 519
599 Ga0450889_022346 3300042144 Bacteria 709
600 Ga0450906_004422 3300042145 Bacteria 2947
601 Ga0450906_014423 3300042145 Bacteria 1446
602 Ga0450907_039478 3300042146 Bacteria 808
603 Ga0450910_010458 3300042147 Bacteria 1321
604 Ga0450910_019073 3300042147 Bacteria 1028
605 Ga0439446_0002191 3300042156 Bacteria 4654
606 Ga0439446_0025007 3300042156 Bacteria 1706
607 Ga0439446_0027195 3300042156 Bacteria 1641
608 Ga0439446_0027520 3300042156 Bacteria 1632
609 Ga0439446_0036356 3300042156 Bacteria 1439
610 Ga0439458_0043951 3300042157 Bacteria 1090
611 Ga0450908_001658 3300042184 Bacteria 4326
612 Ga0450909_001276 3300042185 Bacteria 3501
613 Ga0450909_012894 3300042185 Bacteria 1227
614 Ga0450909_075119 3300042185 Bacteria 544
615 Ga0439434_0003517 3300042435 Bacteria 4573
616 Ga0439434_0015359 3300042435 Bacteria 2283
617 Ga0439434_0033137 3300042435 Bacteria 1573
618 Ga0439434_0226519 3300042435 Bacteria 635
619 Ga0439459_0006177 3300042438 Bacteria 1989
620 Ga0439459_0046862 3300042438 Bacteria 937
621 Ga0439464_0173676 3300042439 Bacteria 680
622 Ga0439460_0085406 3300042461 Bacteria 996
623 Ga0450918_002358 3300042531 Bacteria 3568
624 Ga0450893_0001444 3300042532 Bacteria 3642
625 Ga0450893_0049621 3300042532 Bacteria 784
626 Ga0451577_0358732 3300042876 Bacteria 1322
627 Ga0451577_0828007 3300042876 Bacteria 835
628 Ga0466969_0049691 3300044656 Bacteria 2068
629 Ga0466969_0279328 3300044656 Bacteria 756
630 Ga0466969_0366439 3300044656 Bacteria 653
631 Ga0466972_0099995 3300044658 Bacteria 1372
632 Ga0453683_0001910 3300044673 Bacteria 17016
633 Ga0466965_0071587 3300044683 Bacteria 1744
634 Ga0466966_0005606 3300044684 Bacteria 8252
635 Ga0466966_0200452 3300044684 Bacteria 1208
636 Ga0466966_0384950 3300044684 Bacteria 843
637 Ga0466966_0412938 3300044684 Bacteria 811
638 Ga0466961_0009772 3300044693 Bacteria 6106
639 Ga0466961_0456847 3300044693 Bacteria 773
640 Ga0466961_0797692 3300044693 Bacteria 564
641 Ga0453684_0029736 3300044712 Bacteria 7744
642 Ga0466968_0416519 3300044735 Bacteria 660
643 Ga0466970_0037547 3300044765 Bacteria 2568
644 Ga0466970_0514055 3300044765 Bacteria 690
645 Ga0466957_0061317 3300044842 Bacteria 2308
646 Ga0466957_0746637 3300044842 Bacteria 693
647 Ga0466960_0001088 3300044901 Bacteria 9760
648 Ga0466960_0029132 3300044901 Bacteria 2531
649 Ga0466959_0004682 3300045049 Bacteria 9207
650 Ga0466959_0537711 3300045049 Bacteria 789
651 Ga0466959_0593486 3300045049 Bacteria 745
652 Ga0451576_0000559 3300045051 Bacteria 79734
653 Ga0451576_0010377 3300045051 Bacteria 10695
654 Ga0451576_0058565 3300045051 Bacteria 4025
655 Ga0466958_0058801 3300045836 Bacteria 2338
656 Ga0466958_0164172 3300045836 Bacteria 1405
657 Ga0466967_0280760 3300045976 Bacteria 1598
658 Ga0466967_1861571 3300045976 Bacteria 599
659 Ga0466967_2452211 3300045976 Bacteria 517
660 Ga0495627_031677 3300046453 Bacteria 1668
661 Ga0495592_0473012 3300046454 Bacteria 782
662 Ga0495592_0653312 3300046454 Bacteria 637
663 Ga0495629_0102665 3300046459 Bacteria 1995
664 Ga0495638_0015785 3300046460 Bacteria 5060
665 Ga0495639_0010350 3300046475 Bacteria 4016
666 Ga0495606_0476936 3300046507 Bacteria 634
667 Ga0495610_0020676 3300046512 Bacteria 3648
668 Ga0495616_0009239 3300046513 Bacteria 5780
669 Ga0495620_0009770 3300046515 Bacteria 5089
670 Ga0495628_0354517 3300046516 Bacteria 1078
671 Ga0495630_0387909 3300046517 Bacteria 1070
672 Ga0495631_0001403 3300046518 Bacteria 14640
673 Ga0495637_0014620 3300046520 Bacteria 3700
674 Ga0495642_0006401 3300046528 Bacteria 4516
675 Ga0495654_0028131 3300046530 Bacteria 2876
676 Ga0495609_0051625 3300046538 Bacteria 1831
677 Ga0495621_0002023 3300046539 Bacteria 5353
678 Ga0495621_0022746 3300046539 Bacteria 2081
679 Ga0495621_0271021 3300046539 Bacteria 698
680 Ga0495597_0336747 3300046542 Bacteria 581
681 Ga0495645_0904462 3300046543 Bacteria 524
682 Ga0495622_0099676 3300046557 Bacteria 1332
683 Ga0495633_0002867 3300046558 Bacteria 11817
684 Ga0495633_0390144 3300046558 Bacteria 630
685 Ga0495656_0069410 3300046615 Bacteria 1561
686 Ga0495668_0366149 3300046616 Bacteria 791
687 Ga0495625_0000950 3300046660 Bacteria 38751
688 Ga0495625_0032930 3300046660 Bacteria 3837
689 Ga0495625_0074298 3300046660 Bacteria 2381
690 Ga0495659_0380250 3300046664 Bacteria 607
691 Ga0495588_0048360 3300046674 Bacteria 2184
692 Ga0495588_0053050 3300046674 Bacteria 2090
693 Ga0495658_0104350 3300046683 Bacteria 1696
694 Ga0495624_0250966 3300046690 Bacteria 1070
695 Ga0495670_0119378 3300046691 Bacteria 1369
696 Ga0495670_0377313 3300046691 Bacteria 765
697 Ga0495671_0018988 3300046692 Bacteria 3640
698 Ga0495660_0287649 3300046810 Bacteria 749
699 Ga0495660_0488988 3300046810 Bacteria 527
700 Ga0495636_0148352 3300047318 Bacteria 1051
701 Ga0495676_0031210 3300047321 Bacteria 4509
702 Ga0495677_0242834 3300047445 Bacteria 704
703 Ga0495681_0043623 3300047470 Bacteria 2161
704 Ga0495686_0435546 3300047472 Bacteria 699
705 Ga0495593_0326380 3300047673 Bacteria 767
706 Ga0495602_0774103 3300048088 Bacteria 646
707 Ga0495602_0849131 3300048088 Bacteria 610
708 Ga0495614_0030677 3300048089 Bacteria 2314
709 Ga0495615_0002681 3300048090 Bacteria 2885
710 Ga0496100_0016152 3300048903 Bacteria 4377
711 Ga0496101_0007428 3300048904 Bacteria 7104
712 Ga0496101_0117793 3300048904 Bacteria 2005
713 Ga0496102_0093723 3300048905 Bacteria 2782
714 Ga0496102_0165399 3300048905 Bacteria 2081
715 Ga0496102_0380421 3300048905 Bacteria 1328
716 Ga0496103_0065385 3300048906 Bacteria 2268
717 Ga0496104_0013037 3300048907 Bacteria 7486
718 Ga0496105_0008264 3300048908 Bacteria 8093
719 Ga0496106_0077299 3300048909 Bacteria 2552
720 Ga0496107_0132983 3300048910 Bacteria 1837
721 Ga0496108_0172028 3300048911 Bacteria 1874
722 Ga0496108_0969957 3300048911 Bacteria 727
723 Ga0496109_0273958 3300048912 Bacteria 1590
724 Ga0496109_1238728 3300048912 Bacteria 682
725 Ga0496110_0156828 3300048913 Bacteria 2062
726 Ga0496111_0256807 3300048914 Bacteria 1297
727 Ga0496114_0084455 3300048917 Bacteria 2688
728 Ga0496114_0706236 3300048917 Bacteria 884
729 Ga0496116_0033637 3300048919 Bacteria 3634
730 Ga0496117_0015780 3300048920 Bacteria 6412
731 Ga0496117_0037087 3300048920 Bacteria 3636
732 Ga0496117_0264277 3300048920 Bacteria 931
733 Ga0496118_0021075 3300048921 Bacteria 5752
734 Ga0496118_0039565 3300048921 Bacteria 3760
735 Ga0496118_0585427 3300048921 Bacteria 537
736 Ga0496121_0111561 3300048924 Bacteria 2085
737 Ga0496121_0286394 3300048924 Bacteria 1124
738 Ga0496121_0687878 3300048924 Bacteria 617
739 Ga0496122_0000612 3300048925 Bacteria 73307
740 Ga0496122_0063771 3300048925 Bacteria 2686
741 Ga0496122_0138791 3300048925 Bacteria 1525
742 Ga0496122_0246728 3300048925 Bacteria 1002
743 Ga0496122_0530445 3300048925 Bacteria 565
744 Ga0496123_0000274 3300048926 Bacteria 101783
745 Ga0496123_0089931 3300048926 Bacteria 1827
746 Ga0496123_0423655 3300048926 Bacteria 599
747 Ga0496124_0032035 3300048927 Bacteria 4649
748 Ga0496124_0077684 3300048927 Bacteria 2737
749 Ga0496124_0168032 3300048927 Bacteria 1702
750 Ga0496124_0337340 3300048927 Bacteria 1072
751 Ga0496124_0466726 3300048927 Bacteria 856
752 Ga0496125_0001638 3300048928 Bacteria 31567
753 Ga0496125_0033897 3300048928 Bacteria 4510
754 Ga0496125_0036908 3300048928 Bacteria 4257
755 Ga0496125_0132219 3300048928 Bacteria 1754
756 Ga0496125_0158301 3300048928 Bacteria 1543
757 Ga0496125_0320160 3300048928 Bacteria 941
758 Ga0496126_0133652 3300048929 Bacteria 2142
759 Ga0496126_0178471 3300048929 Bacteria 1805
760 Ga0496126_0479461 3300048929 Bacteria 997
761 Ga0495678_106703 3300049459 Bacteria 962
762 Ga0501031_0353708 3300049568 Bacteria 951
763 Ga0501032_0156858 3300049569 Bacteria 1495
764 Ga0501033_0056838 3300049570 Bacteria 2892
765 Ga0501034_0053289 3300049571 Bacteria 4074
766 Ga0501036_0372060 3300049572 Bacteria 1193
767 Ga0501037_0060577 3300049573 Bacteria 2761
768 Ga0501038_0516179 3300049574 Bacteria 912
769 Ga0501039_0757851 3300049575 Bacteria 758
770 Ga0501043_0115453 3300049579 Bacteria 2107
771 Ga0501046_0307583 3300049580 Bacteria 1156
772 Ga0501047_0083028 3300049581 Bacteria 3079
773 Ga0501047_0299824 3300049581 Bacteria 1450
774 Ga0501073_0467381 3300049589 Bacteria 872
775 Ga0501073_0651054 3300049589 Bacteria 727
776 Ga0501202_093042 3300049652 Bacteria 724
777 Ga0501217_237112 3300049661 Bacteria 583
778 Ga0501222_007776 3300049662 Bacteria 1430
779 Ga0501223_043000 3300049663 Bacteria 877
780 Ga0501227_086972 3300049665 Bacteria 823
781 Ga0501249_004009 3300049679 Bacteria 2978
782 Ga0501250_087720 3300049680 Bacteria 538
783 Ga0501257_100559 3300049686 Bacteria 759
784 Ga0501225_0007716 3300049705 Bacteria 3114
785 Ga0501080_0014745 3300049742 Bacteria 7197
786 Ga0501083_0335777 3300049744 Bacteria 983
787 Ga0501241_010478 3300049758 Bacteria 1686
788 Ga0501262_000513 3300049759 Bacteria 4596
789 Ga0501263_019471 3300049760 Bacteria 904
790 Ga0501268_122528 3300049765 Bacteria 578
791 Ga0501276_034326 3300049773 Bacteria 543
792 Ga0501279_084610 3300049775 Bacteria 552
793 Ga0501035_0031308 3300049822 Bacteria 4845
794 Ga0501035_0373786 3300049822 Bacteria 1189
795 Ga0501044_0060322 3300049823 Bacteria 3884
796 Ga0501044_0935345 3300049823 Bacteria 740
797 nmdc:mga03683_11246_c1 3300050489 Bacteria 2199
798 nmdc:mga03683_123766_c1 3300050489 Bacteria 1152
799 nmdc:mga03683_166557_c1 3300050489 Bacteria 1000
800 nmdc:mga03683_22662_c1 3300050489 Bacteria 2437
801 nmdc:mga03683_406521_c1 3300050489 Bacteria 651
802 nmdc:mga03683_413827_c1 3300050489 Bacteria 645
803 nmdc:mga03683_97770_c1 3300050489 Bacteria 1287
804 nmdc:mga03n38_144487_c1 3300050490 Bacteria 1191
805 nmdc:mga03n38_176977_c1 3300050490 Bacteria 1091
806 nmdc:mga03n38_20471_c1 3300050490 Bacteria 2647
807 nmdc:mga03n38_232587_c1 3300050490 Bacteria 967
808 nmdc:mga00v17_12651_c1 3300050491 Bacteria 4660
809 nmdc:mga00v17_36016_c1 3300050491 Bacteria 2948
810 nmdc:mga00v17_365046_c1 3300050491 Bacteria 939
811 nmdc:mga0yw44_171054_c1 3300050492 Bacteria 1426
812 nmdc:mga0yw44_240572_c1 3300050492 Bacteria 1203
813 nmdc:mga0yw44_307585_c1 3300050492 Bacteria 1063
814 nmdc:mga0yw44_375349_c1 3300050492 Bacteria 960
815 nmdc:mga0yw44_537366_c1 3300050492 Bacteria 794
816 nmdc:mga0k408_103583_c1 3300050493 Bacteria 1679
817 nmdc:mga0k408_158161_c1 3300050493 Bacteria 1350
818 nmdc:mga0k408_166660_c1 3300050493 Bacteria 1313
819 nmdc:mga0k408_22290_c1 3300050493 Bacteria 3566
820 nmdc:mga0k408_28590_c1 3300050493 Bacteria 3170
821 nmdc:mga0k408_738_c1 3300050493 Bacteria 8286
822 nmdc:mga0k408_761577_c1 3300050493 Bacteria 565
823 nmdc:mga0k408_7755_c1 3300050493 Bacteria 5739
824 nmdc:mga0k408_9853_c2 3300050493 Bacteria 2373
825 nmdc:mga06z11_160996_c1 3300050494 Bacteria 1283
826 nmdc:mga06z11_396102_c1 3300050494 Bacteria 831
827 nmdc:mga06z11_80956_c1 3300050494 Bacteria 1742
828 nmdc:mga07m45_108489_c1 3300050496 Bacteria 1597
829 nmdc:mga07m45_155597_c1 3300050496 Bacteria 1326
830 nmdc:mga07m45_22375_c1 3300050496 Bacteria 3450
831 nmdc:mga07m45_23384_c1 3300050496 Bacteria 3378
832 nmdc:mga07m45_264321_c1 3300050496 Bacteria 1001
833 nmdc:mga07m45_28633_c1 3300050496 Bacteria 3075
834 nmdc:mga07m45_326734_c1 3300050496 Bacteria 892
835 nmdc:mga07m45_397530_c1 3300050496 Bacteria 800
836 nmdc:mga07m45_3986_c1 3300050496 Bacteria 7179
837 nmdc:mga07m45_548386_c1 3300050496 Bacteria 669
838 nmdc:mga07m45_8729_c1 3300050496 Bacteria 5222
839 nmdc:mga09592_196814_c1 3300050508 Bacteria 1745
840 nmdc:mga0qj67_245762_c1 3300050509 Bacteria 1452
841 nmdc:mga06r32_1124761_c1 3300050510 Bacteria 734
842 nmdc:mga0sz30_145677_c1 3300050516 Bacteria 1046
843 nmdc:mga0sz30_24531_c1 3300050516 Bacteria 1932
844 nmdc:mga0sz30_394199_c1 3300050516 Bacteria 620
845 Ga0495612_0489445 3300053078 Bacteria 564
846 Ga0500610_0060324 3300053079 Bacteria 1979
847 Ga0500610_0104821 3300053079 Bacteria 1459
848 Ga0500643_011950 3300053087 Bacteria 3134
849 Ga0500643_014775 3300053087 Bacteria 2698
850 Ga0500651_0008924 3300053093 Bacteria 5930
851 Ga0500651_0035169 3300053093 Bacteria 3158
852 Ga0500566_0129632 3300053094 Bacteria 1351
853 Ga0500641_0177406 3300053096 Bacteria 915
854 Ga0500555_073697 3300053103 Bacteria 897
855 Ga0500571_007027 3300053110 Bacteria 6106
856 Ga0500572_043135 3300053111 Bacteria 1317
857 Ga0500593_008356 3300053117 Bacteria 4248
858 Ga0500594_0002788 3300053118 Bacteria 3805
859 Ga0500594_0003939 3300053118 Bacteria 3270
860 Ga0500607_008438 3300053121 Bacteria 6268
861 Ga0500608_182094 3300053122 Bacteria 888
862 Ga0500626_021831 3300053128 Bacteria 2858
863 Ga0500628_051806 3300053129 Bacteria 976
864 Ga0500655_000855 3300053133 Bacteria 5917
865 Ga0500658_0074236 3300053134 Bacteria 1441
866 Ga0500559_0006052 3300053136 Bacteria 5485
867 Ga0500559_0031588 3300053136 Bacteria 2272
868 Ga0500564_018419 3300053138 Bacteria 3184
869 Ga0500573_0268522 3300053140 Bacteria 869
870 Ga0500574_056804 3300053141 Bacteria 1129
871 Ga0500577_0382880 3300053142 Bacteria 615
872 Ga0500604_0107760 3300053151 Bacteria 923
873 Ga0500604_0164307 3300053151 Bacteria 757
874 Ga0500616_0004050 3300053153 Bacteria 10655
875 Ga0500620_171538 3300053155 Bacteria 750
876 Ga0500627_0006594 3300053158 Bacteria 3968
877 Ga0500627_0282291 3300053158 Bacteria 728
878 Ga0500633_0366922 3300053160 Bacteria 523
879 Ga0500634_0023270 3300053161 Bacteria 3367
880 Ga0500634_0039635 3300053161 Bacteria 2561
881 Ga0500634_0213995 3300053161 Bacteria 834
882 Ga0500638_003554 3300053162 Bacteria 5793
883 Ga0500625_085942 3300053729 Bacteria 1360
884 Ga0500596_010039 3300053735 Bacteria 1469
885 Ga0587108_013452 3300059653 Bacteria 719
886 2644071422 2643221611 Bacteria 6820941
887 2885196975 2885192300 Bacteria 5882526
888 2932424005 2932422444 Bacteria 4678430
889 Ga0439439_0043177
890 SwRhRL2b_contig_1139595
891 JGI24741J21665_1026264
892 JGI24740J21852_10013300
893 JGI24739J22299_10005889
894 JGI24739J22299_10032128
895 JGI25152J39213_1005621
896 JGI25152J39213_1010919
897 JGI25152J39213_1021101
898 JGI25150J39212_1015355
899 JGI25150J39212_1023691
900 JGI25159J45721_1006067
901 JGI25159J45721_1024264
902 JGI25151J46595_10001069
903 JGI25151J46595_10001564
904 JGI25151J46595_10041641
905 JGI25151J46595_10046740
906 JGI25153J46596_10012731
907 JGI25153J46596_10038296
908 rootH1_10026301
909 rootH2_10161433
910 rootL2_10066366
911 rootH1_10052402
912 JGI25160J50197_1009111
913 JGI25160J50197_1028168
914 JGI25161J50226_1001273
915 JGI25161J50226_1011521
916 Ga0006562J51391_1005968
917 Ga0006562J51391_1022798
918 Ga0006562J51391_1022801
919 Ga0055527_1013703
920 Ga0055535_1001110
921 Ga0055542_1000080
922 Ga0055526_1030637
923 Ga0055526_1037136
924 Ga0055537_1000150
925 Ga0055537_1003893
926 Ga0055537_1013649
927 Ga0055524_1028031
928 Ga0055524_1037663
929 Ga0055536_1010350
930 Ga0055536_1014050
931 Ga0055536_1017459
932 Ga0055536_1018282
933 Ga0055536_1048769
934 Ga0055534_1000016
935 Ga0055534_1007358
936 Ga0055534_1022159
937 Ga0055534_1032462
938 Ga0055528_1000894
939 Ga0055528_1009649
940 Ga0055528_1028958
941 Ga0055530_10002826
942 Ga0055530_10005609
943 Ga0055540_1001247
944 Ga0055540_1006304
945 Ga0055540_1008300
946 Ga0055540_1010102
947 Ga0055540_1024557
948 Ga0055540_1028493
949 Ga0055540_1043556
950 Ga0055531_10000257
951 Ga0055531_10013583
952 Ga0055531_10043153
953 Ga0055531_10043197
954 Ga0055543_1004453
955 Ga0055543_1012039
956 Ga0065165_1022212
957 Ga0065165_1084303
958 Ga0065714_10003179
959 Ga0065714_10020540
960 Ga0065704_10098136
961 Ga0065704_10150792
962 Ga0065704_10194160
963 Ga0070658_10150835
964 Ga0070658_10195232
965 Ga0070658_10238409
966 Ga0070658_10553014
967 Ga0070658_10612725
968 Ga0070676_10403174
969 Ga0070676_10952606
970 Ga0070676_11060213
971 Ga0070677_10371826
972 Ga0068869_100358093
973 Ga0068869_100909658
974 Ga0070680_100182847
975 Ga0068868_101196025
976 Ga0070660_100112312
977 Ga0070660_101101614
978 Ga0070668_100133718
979 Ga0070669_100142848
980 Ga0070675_100110942
981 Ga0070675_100286798
982 Ga0070671_100698192
983 Ga0070674_100108262
984 Ga0070674_102031511
985 Ga0070673_100176030
986 Ga0070673_100227738
987 Ga0070673_100567129
988 Ga0070688_101805254
989 Ga0070659_100144962
990 Ga0070659_100272375
991 Ga0070667_100055014
992 Ga0070667_101352748
993 Ga0070714_100065548
994 Ga0070678_100078732
995 Ga0070678_100117703
996 Ga0070678_100136554
997 Ga0070678_100188117
998 Ga0070678_100241016
999 Ga0070678_101381302
1000 Ga0070662_100018575
1001 Ga0070662_100127535
1002 Ga0068867_100655319
1003 Ga0068867_100740580
1004 Ga0068867_101894647
1005 Ga0070679_100041543
1006 Ga0070679_100144338
1007 Ga0070684_101847280
1008 Ga0068853_100163721
1009 Ga0068853_100527782
1010 Ga0068853_100645953
1011 Ga0068853_100757762
1012 Ga0070672_100253317
1013 Ga0070665_100024013
1014 Ga0070665_100162313
1015 Ga0070665_100510248
1016 Ga0070665_100580640
1017 Ga0070665_102025120
1018 Ga0068855_100006806
1019 Ga0068855_100163186
1020 Ga0068855_100329547
1021 Ga0070664_100008507
1022 Ga0070664_102046068
1023 Ga0068857_100231554
1024 Ga0068857_100848605
1025 Ga0068857_101168081
1026 Ga0068854_100068140
1027 Ga0068854_100907765
1028 Ga0068852_100169742
1029 Ga0068851_10029330
1030 Ga0068870_10920240
1031 Ga0068858_101197000
1032 Ga0068862_100105979
1033 Ga0075365_10004543
1034 Ga0075365_10011938
1035 Ga0075365_10023104
1036 Ga0075365_10024567
1037 Ga0075365_10166075
1038 Ga0075365_10343725
1039 Ga0075365_10386338
1040 Ga0075368_10282316
1041 Ga0075363_100007676
1042 Ga0075363_100070252
1043 Ga0075363_100217430
1044 Ga0075363_100408512
1045 Ga0075364_10001078
1046 Ga0075364_10298992
1047 Ga0075432_10001601
1048 Ga0075432_10005352
1049 Ga0075362_10043861
1050 Ga0075362_10047496
1051 Ga0075362_10139559
1052 Ga0075362_10152965
1053 Ga0075362_10327870
1054 Ga0075362_10579740
1055 Ga0075362_10586143
1056 Ga0075367_10027246
1057 Ga0075367_10086295
1058 Ga0075367_10100772
1059 Ga0075367_10231618
1060 Ga0075367_10343297
1061 Ga0075369_10335295
1062 Ga0075366_10002010
1063 Ga0075366_10003520
1064 Ga0075366_10009938
1065 Ga0075366_10034637
1066 Ga0075366_10057553
1067 Ga0075366_10100825
1068 Ga0097621_100175436
1069 Ga0097621_102158638
1070 Ga0075370_10000304
1071 Ga0075370_10005111
1072 Ga0075370_10014472
1073 Ga0075370_10015729
1074 Ga0075370_10020002
1075 Ga0075370_10110612
1076 Ga0075370_10124227
1077 Ga0075370_10144188
1078 Ga0075370_10250007
1079 Ga0075370_10422826
1080 Ga0075370_10515906
1081 Ga0075370_10751826
1082 Ga0068871_101579579
1083 Ga0075430_100069245
1084 Ga0075431_100579867
1085 Ga0075429_100177102
1086 Ga0068865_100951286
1087 Ga0079104_1025289
1088 Ga0099826_10000101
1089 Ga0099826_10109187
1090 Ga0105244_10049588
1091 Ga0105244_10271625
1092 Ga0105244_10473373
1093 Ga0105240_10008945
1094 Ga0105240_10104606
1095 Ga0105240_10217744
1096 Ga0105245_10180345
1097 Ga0105245_10655149
1098 Ga0105245_11059773
1099 Ga0105245_12239086
1100 Ga0105243_10036791
1101 Ga0105243_10037344
1102 Ga0105243_10726453
1103 Ga0105243_11030141
1104 Ga0105241_10554815
1105 Ga0105242_10001936
1106 Ga0105242_10410881
1107 Ga0105242_10422116
1108 Ga0105242_10455396
1109 Ga0105237_10393687
1110 Ga0105237_11603970
1111 Ga0105238_10005849
1112 Ga0105238_10385391
1113 Ga0105238_10506597
1114 Ga0105249_11017161
1115 Ga0105239_10105208
1116 Ga0105239_10775322
1117 Ga0105239_11669661
1118 Ga0105246_10111217
1119 Ga0105246_10154807
1120 Ga0105246_11161716
1121 Ga0157322_1033385
1122 Ga0157347_1033560
1123 Ga0157339_1017976
1124 Ga0157373_10031485
1125 Ga0157373_10145760
1126 Ga0157373_10187275
1127 Ga0157373_10292037
1128 Ga0157373_10462388
1129 Ga0157371_10347860
1130 Ga0157370_10006343
1131 Ga0157370_10577168
1132 Ga0157370_10828426
1133 Ga0157370_10918275
1134 Ga0157370_11218174
1135 Ga0157369_10008807
1136 Ga0157374_10277529
1137 Ga0157374_11426807
1138 Ga0163162_10296582
1139 Ga0157372_10568359
1140 Ga0157372_12350477
1141 Ga0157375_10156318
1142 Ga0157375_10213056
1143 Ga0157375_11688974
1144 Ga0182008_10001806
1145 Ga0182008_10005163
1146 Ga0182008_10020210
1147 Ga0182008_10183987
1148 Ga0182008_10221844
1149 Ga0157377_11321952
1150 Ga0157376_10186194
1151 Ga0157376_10998306
1152 Ga0157376_12562524
1153 Ga0182006_1005907
1154 Ga0182006_1041115
1155 Ga0182006_1157628
1156 Ga0182006_1323034
1157 Ga0182007_10004286
1158 Ga0182007_10015525
1159 Ga0182007_10051471
1160 Ga0182005_1042401
1161 Ga0182005_1139173
1162 Ga0182005_1155222
1163 Ga0183362_10003
1164 Ga0163161_10001428
1165 Ga0163161_10001866
1166 Ga0163161_10011965
1167 Ga0163161_10033986
1168 Ga0163161_10135200
1169 Ga0163161_10468120
1170 Ga0163161_10681605
1171 Ga0163161_11387551
1172 Ga0163161_11496708
1173 Ga0213872_10067622
1174 Ga0209672_100378
1175 Ga0209147_100696
1176 Ga0209258_100093
1177 Ga0207425_1003154
1178 Ga0207425_1037790
1179 Ga0209148_1000007
1180 Ga0209129_1000024
1181 Ga0209129_1005316
1182 Ga0209129_1006968
1183 Ga0209129_1009656
1184 Ga0209129_1012142
1185 Ga0209565_1000098
1186 Ga0209565_1000633
1187 Ga0209565_1003729
1188 Ga0209673_1000058
1189 Ga0209673_1001185
1190 Ga0209673_1002178
1191 Ga0209673_1021052
1192 Ga0209673_1082175
1193 Ga0209673_1124279
1194 Ga0209130_1001692
1195 Ga0209130_1018535
1196 Ga0209130_1041871
1197 Ga0209675_1000010
1198 Ga0209675_1000151
1199 Ga0209675_1000431
1200 Ga0209675_1001858
1201 Ga0209676_1000028
1202 Ga0209676_1000333
1203 Ga0209676_1002526
1204 Ga0209676_1005042
1205 Ga0209676_1008655
1206 Ga0209676_1045505
1207 Ga0209676_1054226
1208 Ga0209025_1000289
1209 Ga0209025_1000685
1210 Ga0209025_1004578
1211 Ga0209025_1008279
1212 Ga0209025_1008530
1213 Ga0209025_1016710
1214 Ga0209564_1000209
1215 Ga0209564_1002281
1216 Ga0209564_1027576
1217 Ga0209564_1028299
1218 Ga0209758_1000049
1219 Ga0209758_1027337
1220 Ga0209050_1000072
1221 Ga0209050_1000721
1222 Ga0209050_1000927
1223 Ga0209050_1024101
1224 Ga0209050_1032889
1225 Ga0209256_1000088
1226 Ga0209256_1017360
1227 Ga0209256_1023416
1228 Ga0207426_1000038
1229 Ga0207426_1000053
1230 Ga0209051_1000015
1231 Ga0209051_1000025
1232 Ga0209051_1000056
1233 Ga0209051_1000424
1234 Ga0209051_1000545
1235 Ga0209051_1000757
1236 Ga0209051_1004866
1237 Ga0209051_1045133
1238 Ga0209257_1000039
1239 Ga0209257_1003278
1240 Ga0209257_1003691
1241 Ga0209257_1004686
1242 Ga0209257_1024960
1243 Ga0207656_10025888
1244 Ga0207655_1009225
1245 Ga0207688_10951891
1246 Ga0207647_10259423
1247 Ga0207645_10466030
1248 Ga0207705_10119461
1249 Ga0207705_10190402
1250 Ga0207705_10191968
1251 Ga0207705_10344520
1252 Ga0207705_10374570
1253 Ga0207705_10670440
1254 Ga0207707_10122443
1255 Ga0207695_10216190
1256 Ga0207695_10330904
1257 Ga0207671_10025637
1258 Ga0207657_10038921
1259 Ga0207657_10552566
1260 Ga0207657_10887746
1261 Ga0207657_10922875
1262 Ga0207649_11599179
1263 Ga0207652_10048380
1264 Ga0207652_11169647
1265 Ga0207681_10100764
1266 Ga0207694_10009970
1267 Ga0207694_10367641
1268 Ga0207659_10248065
1269 Ga0207687_10097625
1270 Ga0207687_10450402
1271 Ga0207687_10909488
1272 Ga0207690_10153252
1273 Ga0207690_10305274
1274 Ga0207706_10019114
1275 Ga0207686_10021874
1276 Ga0207686_10344627
1277 Ga0207709_10000958
1278 Ga0207709_10001025
1279 Ga0207709_10058565
1280 Ga0207709_11446482
1281 Ga0207669_10153012
1282 Ga0207669_11194577
1283 Ga0207669_11287390
1284 Ga0207691_10183575
1285 Ga0207691_10465680
1286 Ga0207691_10518676
1287 Ga0207689_10401036
1288 Ga0207679_10249310
1289 Ga0207667_10044142
1290 Ga0207667_10271972
1291 Ga0207667_10442505
1292 Ga0207651_10191923
1293 Ga0207651_10874111
1294 Ga0207651_11562231
1295 Ga0207712_11194328
1296 Ga0207640_10277130
1297 Ga0207640_10818682
1298 Ga0207658_10480905
1299 Ga0207658_11051644
1300 Ga0207703_11399255
1301 Ga0207639_10062155
1302 Ga0207639_10442979
1303 Ga0207639_10559538
1304 Ga0207639_10622354
1305 Ga0207639_11035979
1306 Ga0207678_10131083
1307 Ga0207702_11370509
1308 Ga0207648_10906197
1309 Ga0207648_11713992
1310 Ga0207674_10087595
1311 Ga0207674_10362219
1312 Ga0207683_10043646
1313 Ga0207683_10156580
1314 Ga0207683_10201423
1315 Ga0207683_10390270
1316 Ga0207683_10511563
1317 Ga0207683_11242106
1318 Ga0207698_10675695
1319 Ga0209281_1039412
1320 Ga0209968_1026886
1321 Ga0209982_1033270
1322 Ga0209970_1000036
1323 Ga0209282_1000785
1324 Ga0209971_1023805
1325 Ga0209813_10047942
1326 Ga0209974_10004079
1327 Ga0209974_10013668
1328 Ga0209974_10094486
1329 Ga0207428_10081162
1330 Ga0207428_10200482
1331 Ga0268266_10013081
1332 Ga0268266_10483141
1333 Ga0268266_11535685
1334 Ga0268265_10102366
1335 Ga0307515_10004716
1336 Ga0307515_10296335
1337 Ga0307512_10215614
1338 Ga0316177_1085660
1339 Ga0316177_1120923
1340 Ga0316176_1044943
1341 Ga0314311_1181387
1342 Ga0316183_1046501
1343 Ga0316181_1019721
1344 Ga0316182_1247982
1345 Ga0316182_1441726
1346 Ga0265332_10292800
1347 Ga0265331_10119585
1348 Ga0265327_10000789
1349 Ga0265327_10005861
1350 Ga0265316_10103655
1351 Ga0307513_10076892
1352 Ga0307513_10886532
1353 Ga0307408_100013422
1354 Ga0307408_100253542
1355 Ga0307408_100567688
1356 Ga0307408_100567720
1357 Ga0307408_101210607
1358 Ga0307514_10004647
1359 Ga0265314_10006203
1360 Ga0265342_10060778
1361 Ga0265342_10185236
1362 Ga0307516_10156441
1363 Ga0307405_10045105
1364 Ga0307405_10223349
1365 Ga0307405_10825468
1366 Ga0307410_10064368
1367 Ga0307406_10005016
1368 Ga0307406_11115606
1369 Ga0307412_10086036
1370 Ga0307412_10152808
1371 Ga0307412_10516845
1372 Ga0307412_11693916
1373 Ga0307416_100026977
1374 Ga0307416_100034338
1375 Ga0307416_101143473
1376 Ga0307416_101601510
1377 Ga0307414_10070360
1378 Ga0307414_10072933
1379 Ga0307414_10493195
1380 Ga0307411_10647557
1381 Ga0307415_100713115
1382 Ga0373939_0337975
1383 Ga0373931_0159054
1384 Ga0373935_0389638
1385 Ga0373927_0827967
1386 Ga0373925_0511951
1387 Ga0395899_0019414
1388 Ga0395899_0035679
1389 Ga0395899_0173816
1390 Ga0395899_0244138
1391 Ga0395900_0011923
1392 Ga0395900_0019815
1393 Ga0395900_0047396
1394 Ga0395900_0052858
1395 Ga0395900_0421238
1396 Ga0395900_0853076
1397 Ga0395898_0016238
1398 Ga0395898_0017821
1399 Ga0395898_0110816
1400 Ga0395898_0475940
1401 Ga0395898_0693006
1402 Ga0395905_0000027
1403 Ga0395905_0011168
1404 Ga0395905_0018668
1405 Ga0395905_0023994
1406 Ga0395905_0025965
1407 Ga0395905_0059022
1408 Ga0395905_0093619
1409 Ga0395905_0097950
1410 Ga0395905_0167972
1411 Ga0395905_0573117
1412 Ga0395905_0576879
1413 Ga0395905_1149015
1414 Ga0395901_0026973
1415 Ga0395901_0043020
1416 Ga0395901_0061046
1417 Ga0395901_0064334
1418 Ga0395901_0068948
1419 Ga0395901_0121481
1420 Ga0395901_0211801
1421 Ga0395901_0257769
1422 Ga0395901_1123484
1423 Ga0395901_1896524
1424 Ga0436361_0070738
1425 Ga0439436_0006510
1426 Ga0439436_0010396
1427 Ga0439436_0018487
1428 Ga0439438_039792
1429 Ga0439439_0002012
1430 Ga0439447_022624
1431 Ga0439447_028164
1432 Ga0439447_152725
1433 Ga0439461_0006354
1434 Ga0439466_0002323
1435 Ga0439466_0012501
1436 Ga0439466_0015344
1437 Ga0439465_0001853
1438 Ga0439465_0004649
1439 Ga0451791_0284746
1440 Ga0451791_0563739
1441 Ga0451791_1887967
1442 Ga0451798_0925139
1443 Ga0451807_0419949
1444 Ga0451807_1686510
1445 Ga0451807_2302176
1446 Ga0451833_0574531
1447 Ga0451835_1043689
1448 Ga0451841_1228420
1449 Ga0451853_1261129
1450 Ga0439433_0001942
1451 Ga0439437_003204
1452 Ga0439441_035560
1453 Ga0439442_004106
1454 Ga0439443_034373
1455 Ga0439445_0000200
1456 Ga0439445_0240596
1457 Ga0439448_0107664
1458 Ga0439432_001787
1459 Ga0439432_002229
1460 Ga0439432_070836
1461 Ga0439449_0001772
1462 Ga0439449_0003811
1463 Ga0439449_0010236
1464 Ga0439449_0166167
1465 Ga0439452_002059
1466 Ga0439452_002146
1467 Ga0439457_008995
1468 Ga0439457_045221
1469 Ga0439462_0002253
1470 Ga0439462_0007235
1471 Ga0439462_0048246
1472 Ga0450914_024523
1473 Ga0450915_000567
1474 Ga0450923_014302
1475 Ga0450890_003980
1476 Ga0450890_004272
1477 Ga0450897_004575
1478 Ga0450891_012508
1479 Ga0450891_013050
1480 Ga0450891_014893
1481 Ga0450894_003496
1482 Ga0450896_017735
1483 Ga0450898_083624
1484 Ga0450898_106959
1485 Ga0450899_027903
1486 Ga0450899_053117
1487 Ga0450889_022346
1488 Ga0450906_004422
1489 Ga0450906_014423
1490 Ga0450907_039478
1491 Ga0450910_010458
1492 Ga0450910_019073
1493 Ga0439446_0002191
1494 Ga0439446_0025007
1495 Ga0439446_0027195
1496 Ga0439446_0027520
1497 Ga0439446_0036356
1498 Ga0439458_0043951
1499 Ga0450908_001658
1500 Ga0450909_001276
1501 Ga0450909_012894
1502 Ga0450909_075119
1503 Ga0439434_0003517
1504 Ga0439434_0015359
1505 Ga0439434_0033137
1506 Ga0439434_0226519
1507 Ga0439459_0006177
1508 Ga0439459_0046862
1509 Ga0439464_0173676
1510 Ga0439460_0085406
1511 Ga0450918_002358
1512 Ga0450893_0001444
1513 Ga0450893_0049621
1514 Ga0451577_0358732
1515 Ga0451577_0828007
1516 Ga0466969_0049691
1517 Ga0466969_0279328
1518 Ga0466969_0366439
1519 Ga0466972_0099995
1520 Ga0453683_0001910
1521 Ga0466965_0071587
1522 Ga0466966_0005606
1523 Ga0466966_0200452
1524 Ga0466966_0384950
1525 Ga0466966_0412938
1526 Ga0466961_0009772
1527 Ga0466961_0456847
1528 Ga0466961_0797692
1529 Ga0453684_0029736
1530 Ga0466968_0416519
1531 Ga0466970_0037547
1532 Ga0466970_0514055
1533 Ga0466957_0061317
1534 Ga0466957_0746637
1535 Ga0466960_0001088
1536 Ga0466960_0029132
1537 Ga0466959_0004682
1538 Ga0466959_0537711
1539 Ga0466959_0593486
1540 Ga0451576_0000559
1541 Ga0451576_0010377
1542 Ga0451576_0058565
1543 Ga0466958_0058801
1544 Ga0466958_0164172
1545 Ga0466967_0280760
1546 Ga0466967_1861571
1547 Ga0466967_2452211
1548 Ga0495627_031677
1549 Ga0495592_0473012
1550 Ga0495592_0653312
1551 Ga0495629_0102665
1552 Ga0495638_0015785
1553 Ga0495639_0010350
1554 Ga0495606_0476936
1555 Ga0495610_0020676
1556 Ga0495616_0009239
1557 Ga0495620_0009770
1558 Ga0495628_0354517
1559 Ga0495630_0387909
1560 Ga0495631_0001403
1561 Ga0495637_0014620
1562 Ga0495642_0006401
1563 Ga0495654_0028131
1564 Ga0495609_0051625
1565 Ga0495621_0002023
1566 Ga0495621_0022746
1567 Ga0495621_0271021
1568 Ga0495597_0336747
1569 Ga0495645_0904462
1570 Ga0495622_0099676
1571 Ga0495633_0002867
1572 Ga0495633_0390144
1573 Ga0495656_0069410
1574 Ga0495668_0366149
1575 Ga0495625_0000950
1576 Ga0495625_0032930
1577 Ga0495625_0074298
1578 Ga0495659_0380250
1579 Ga0495588_0048360
1580 Ga0495588_0053050
1581 Ga0495658_0104350
1582 Ga0495624_0250966
1583 Ga0495670_0119378
1584 Ga0495670_0377313
1585 Ga0495671_0018988
1586 Ga0495660_0287649
1587 Ga0495660_0488988
1588 Ga0495636_0148352
1589 Ga0495676_0031210
1590 Ga0495677_0242834
1591 Ga0495681_0043623
1592 Ga0495686_0435546
1593 Ga0495593_0326380
1594 Ga0495602_0774103
1595 Ga0495602_0849131
1596 Ga0495614_0030677
1597 Ga0495615_0002681
1598 Ga0496100_0016152
1599 Ga0496101_0007428
1600 Ga0496101_0117793
1601 Ga0496102_0093723
1602 Ga0496102_0165399
1603 Ga0496102_0380421
1604 Ga0496103_0065385
1605 Ga0496104_0013037
1606 Ga0496105_0008264
1607 Ga0496106_0077299
1608 Ga0496107_0132983
1609 Ga0496108_0172028
1610 Ga0496108_0969957
1611 Ga0496109_0273958
1612 Ga0496109_1238728
1613 Ga0496110_0156828
1614 Ga0496111_0256807
1615 Ga0496114_0084455
1616 Ga0496114_0706236
1617 Ga0496116_0033637
1618 Ga0496117_0015780
1619 Ga0496117_0037087
1620 Ga0496117_0264277
1621 Ga0496118_0021075
1622 Ga0496118_0039565
1623 Ga0496118_0585427
1624 Ga0496121_0111561
1625 Ga0496121_0286394
1626 Ga0496121_0687878
1627 Ga0496122_0000612
1628 Ga0496122_0063771
1629 Ga0496122_0138791
1630 Ga0496122_0246728
1631 Ga0496122_0530445
1632 Ga0496123_0000274
1633 Ga0496123_0089931
1634 Ga0496123_0423655
1635 Ga0496124_0032035
1636 Ga0496124_0077684
1637 Ga0496124_0168032
1638 Ga0496124_0337340
1639 Ga0496124_0466726
1640 Ga0496125_0001638
1641 Ga0496125_0033897
1642 Ga0496125_0036908
1643 Ga0496125_0132219
1644 Ga0496125_0158301
1645 Ga0496125_0320160
1646 Ga0496126_0133652
1647 Ga0496126_0178471
1648 Ga0496126_0479461
1649 Ga0495678_106703
1650 Ga0501031_0353708
1651 Ga0501032_0156858
1652 Ga0501033_0056838
1653 Ga0501034_0053289
1654 Ga0501036_0372060
1655 Ga0501037_0060577
1656 Ga0501038_0516179
1657 Ga0501039_0757851
1658 Ga0501043_0115453
1659 Ga0501046_0307583
1660 Ga0501047_0083028
1661 Ga0501047_0299824
1662 Ga0501073_0467381
1663 Ga0501073_0651054
1664 Ga0501202_093042
1665 Ga0501217_237112
1666 Ga0501222_007776
1667 Ga0501223_043000
1668 Ga0501227_086972
1669 Ga0501249_004009
1670 Ga0501250_087720
1671 Ga0501257_100559
1672 Ga0501225_0007716
1673 Ga0501080_0014745
1674 Ga0501083_0335777
1675 Ga0501241_010478
1676 Ga0501262_000513
1677 Ga0501263_019471
1678 Ga0501268_122528
1679 Ga0501276_034326
1680 Ga0501279_084610
1681 Ga0501035_0031308
1682 Ga0501035_0373786
1683 Ga0501044_0060322
1684 Ga0501044_0935345
1685 nmdc:mga03683_11246_c1
1686 nmdc:mga03683_123766_c1
1687 nmdc:mga03683_166557_c1
1688 nmdc:mga03683_22662_c1
1689 nmdc:mga03683_406521_c1
1690 nmdc:mga03683_413827_c1
1691 nmdc:mga03683_97770_c1
1692 nmdc:mga03n38_144487_c1
1693 nmdc:mga03n38_176977_c1
1694 nmdc:mga03n38_20471_c1
1695 nmdc:mga03n38_232587_c1
1696 nmdc:mga00v17_12651_c1
1697 nmdc:mga00v17_36016_c1
1698 nmdc:mga00v17_365046_c1
1699 nmdc:mga0yw44_171054_c1
1700 nmdc:mga0yw44_240572_c1
1701 nmdc:mga0yw44_307585_c1
1702 nmdc:mga0yw44_375349_c1
1703 nmdc:mga0yw44_537366_c1
1704 nmdc:mga0k408_103583_c1
1705 nmdc:mga0k408_158161_c1
1706 nmdc:mga0k408_166660_c1
1707 nmdc:mga0k408_22290_c1
1708 nmdc:mga0k408_28590_c1
1709 nmdc:mga0k408_738_c1
1710 nmdc:mga0k408_761577_c1
1711 nmdc:mga0k408_7755_c1
1712 nmdc:mga0k408_9853_c2
1713 nmdc:mga06z11_160996_c1
1714 nmdc:mga06z11_396102_c1
1715 nmdc:mga06z11_80956_c1
1716 nmdc:mga07m45_108489_c1
1717 nmdc:mga07m45_155597_c1
1718 nmdc:mga07m45_22375_c1
1719 nmdc:mga07m45_23384_c1
1720 nmdc:mga07m45_264321_c1
1721 nmdc:mga07m45_28633_c1
1722 nmdc:mga07m45_326734_c1
1723 nmdc:mga07m45_397530_c1
1724 nmdc:mga07m45_3986_c1
1725 nmdc:mga07m45_548386_c1
1726 nmdc:mga07m45_8729_c1
1727 nmdc:mga09592_196814_c1
1728 nmdc:mga0qj67_245762_c1
1729 nmdc:mga06r32_1124761_c1
1730 nmdc:mga0sz30_145677_c1
1731 nmdc:mga0sz30_24531_c1
1732 nmdc:mga0sz30_394199_c1
1733 Ga0495612_0489445
1734 Ga0500610_0060324
1735 Ga0500610_0104821
1736 Ga0500643_011950
1737 Ga0500643_014775
1738 Ga0500651_0008924
1739 Ga0500651_0035169
1740 Ga0500566_0129632
1741 Ga0500641_0177406
1742 Ga0500555_073697
1743 Ga0500571_007027
1744 Ga0500572_043135
1745 Ga0500593_008356
1746 Ga0500594_0002788
1747 Ga0500594_0003939
1748 Ga0500607_008438
1749 Ga0500608_182094
1750 Ga0500626_021831
1751 Ga0500628_051806
1752 Ga0500655_000855
1753 Ga0500658_0074236
1754 Ga0500559_0006052
1755 Ga0500559_0031588
1756 Ga0500564_018419
1757 Ga0500573_0268522
1758 Ga0500574_056804
1759 Ga0500577_0382880
1760 Ga0500604_0107760
1761 Ga0500604_0164307
1762 Ga0500616_0004050
1763 Ga0500620_171538
1764 Ga0500627_0006594
1765 Ga0500627_0282291
1766 Ga0500633_0366922
1767 Ga0500634_0023270
1768 Ga0500634_0039635
1769 Ga0500634_0213995
1770 Ga0500638_003554
1771 Ga0500625_085942
1772 Ga0500596_010039
1773 Ga0587108_013452
1774 2644071422
1775 2885196975
1776 2932424005

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

34

145

0.96

PF01230

HIT

HIT domain

42

142

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uvm-assembly1.cif.gz_A hit family hydrolase from clostridium thermocellum cth-393 0.9204 3 115
4egu-assembly1.cif.gz_B 0.95a resolution structure of a histidine triad protein from clostridium difficile 0.9084 3 114
3omf-assembly1.cif.gz_A crystal structure of a histidine triad family protein from entamoeba histolytica, bound to amp 0.9006 6 114
3n1s-assembly2.cif.gz_F crystal structure of wild type echint gmp complex 0.8982 4 115
3n1t-assembly2.cif.gz_E crystal structure of the h101a mutant echint gmp complex 0.8962 8 115
ID Description Score Start End Superfamily
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9285 3 114 3.30.428.10
4eguB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9084 3 114 3.30.428.10
3oxkA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8995 6 114 3.30.428.10
4q61B00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.886 7 113 3.30.428.10
4zglE00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8847 8 113 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A4Q3PTY9-F1-model_v4 deleted 0.9723 1 110
AF-A0A1I7EZ11-F1-model_v4 Histidine triad (HIT) family protein 0.9666 4 114 GO:0003824
AF-A0A536SZ33-F1-model_v4 Histidine triad nucleotide-binding protein 0.9649 4 114 GO:0003824
AF-A0A0P8DWU0-F1-model_v4 Hit-like protein 0.9582 3 114 GO:0003824
AF-A0A4Q1TAI9-F1-model_v4 Histidine triad nucleotide-binding protein 0.9567 3 111 GO:0003824

Map