F484765
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 888 | 425 | 1776 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300041406|Ga0439439_0043177|Ga0439439_0043177_110_553 |
| Length | 147 |
| Sequence | MSTAGPPQGAKAPSGASEDTSAPSVGAHASSDPNCVFCKIIEGKIPSRKMYEDDDLFGFHDIAPWAPVHFMLVPKRHIPSMAQVTPDDAALLGKIMTLAPRLAIEQGCRPYPQGGFRIVVNTGAEGGQEVHHLHVHVMGGPRPWLKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 17 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 18 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 85 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 98 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 99 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 174 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 186 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 187 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 188 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 189 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 190 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 191 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 192 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 199 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 221 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 222 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 223 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 224 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 225 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 226 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 227 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 231 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 232 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 233 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 234 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 235 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 236 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 237 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 238 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 239 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 240 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 241 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 242 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 243 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 244 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 245 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 246 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 247 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 248 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 249 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 250 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 251 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 252 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 253 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 254 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 255 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 256 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 257 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 258 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 259 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 260 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 261 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 262 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 263 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 264 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 265 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 266 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 267 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 268 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 269 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 270 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 271 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 272 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 273 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 274 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 275 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 276 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 277 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 278 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 279 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 280 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 281 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 285 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 286 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 339 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 340 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 341 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 342 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 343 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 344 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 345 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 346 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 347 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 348 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 362 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 363 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 364 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 367 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 368 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 369 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 373 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 374 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 375 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 376 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 377 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 381 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 382 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 385 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 391 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 393 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 394 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 395 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 397 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 398 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 401 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 403 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 404 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 405 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 406 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 407 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 409 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 411 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 412 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 413 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 415 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 416 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 418 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 419 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 421 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 422 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 424 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 425 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.45 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 28.72 |
| Nodule | 0.56 |
| Rhizoplane | 2.93 |
| Rhizosphere | 62.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439439_0043177 | 3300041406 | Bacteria | 1172 |
| 2 | SwRhRL2b_contig_1139595 | 2162886007 | Bacteria | 844 |
| 3 | JGI24741J21665_1026264 | 3300001915 | Bacteria | 887 |
| 4 | JGI24740J21852_10013300 | 3300001979 | Bacteria | 3076 |
| 5 | JGI24739J22299_10005889 | 3300001989 | Bacteria | 4641 |
| 6 | JGI24739J22299_10032128 | 3300001989 | Bacteria | 1808 |
| 7 | JGI25152J39213_1005621 | 3300002773 | Bacteria | 3602 |
| 8 | JGI25152J39213_1010919 | 3300002773 | Bacteria | 2040 |
| 9 | JGI25152J39213_1021101 | 3300002773 | Bacteria | 1149 |
| 10 | JGI25150J39212_1015355 | 3300002774 | Bacteria | 1279 |
| 11 | JGI25150J39212_1023691 | 3300002774 | Bacteria | 910 |
| 12 | JGI25159J45721_1006067 | 3300002987 | Bacteria | 3674 |
| 13 | JGI25159J45721_1024264 | 3300002987 | Bacteria | 1084 |
| 14 | JGI25151J46595_10001069 | 3300003187 | Bacteria | 20425 |
| 15 | JGI25151J46595_10001564 | 3300003187 | Bacteria | 15277 |
| 16 | JGI25151J46595_10041641 | 3300003187 | Bacteria | 1665 |
| 17 | JGI25151J46595_10046740 | 3300003187 | Bacteria | 1513 |
| 18 | JGI25153J46596_10012731 | 3300003215 | Bacteria | 3604 |
| 19 | JGI25153J46596_10038296 | 3300003215 | Bacteria | 1513 |
| 20 | rootH1_10026301 | 3300003316 | Bacteria | 1996 |
| 21 | rootH2_10161433 | 3300003320 | Bacteria | 1325 |
| 22 | rootL2_10066366 | 3300003322 | Bacteria | 1163 |
| 23 | rootH1_10052402 | 3300003323 | Bacteria | 2726 |
| 24 | JGI25160J50197_1009111 | 3300003354 | Bacteria | 3711 |
| 25 | JGI25160J50197_1028168 | 3300003354 | Bacteria | 1513 |
| 26 | JGI25161J50226_1001273 | 3300003374 | Bacteria | 8027 |
| 27 | JGI25161J50226_1011521 | 3300003374 | Bacteria | 1107 |
| 28 | Ga0006562J51391_1005968 | 3300003578 | Bacteria | 2496 |
| 29 | Ga0006562J51391_1022798 | 3300003578 | Bacteria | 2508 |
| 30 | Ga0006562J51391_1022801 | 3300003578 | Bacteria | 950 |
| 31 | Ga0055527_1013703 | 3300003760 | Bacteria | 903 |
| 32 | Ga0055535_1001110 | 3300003761 | Bacteria | 16350 |
| 33 | Ga0055542_1000080 | 3300003762 | Bacteria | 129634 |
| 34 | Ga0055526_1030637 | 3300003771 | Bacteria | 1564 |
| 35 | Ga0055526_1037136 | 3300003771 | Bacteria | 1279 |
| 36 | Ga0055537_1000150 | 3300003773 | Bacteria | 52097 |
| 37 | Ga0055537_1003893 | 3300003773 | Bacteria | 4445 |
| 38 | Ga0055537_1013649 | 3300003773 | Bacteria | 1513 |
| 39 | Ga0055524_1028031 | 3300003775 | Bacteria | 1696 |
| 40 | Ga0055524_1037663 | 3300003775 | Bacteria | 1279 |
| 41 | Ga0055536_1010350 | 3300003781 | Bacteria | 3716 |
| 42 | Ga0055536_1014050 | 3300003781 | Bacteria | 2838 |
| 43 | Ga0055536_1017459 | 3300003781 | Bacteria | 2348 |
| 44 | Ga0055536_1018282 | 3300003781 | Bacteria | 2252 |
| 45 | Ga0055536_1048769 | 3300003781 | Bacteria | 945 |
| 46 | Ga0055534_1000016 | 3300003784 | Bacteria | 144444 |
| 47 | Ga0055534_1007358 | 3300003784 | Bacteria | 2632 |
| 48 | Ga0055534_1022159 | 3300003784 | Bacteria | 1054 |
| 49 | Ga0055534_1032462 | 3300003784 | Bacteria | 799 |
| 50 | Ga0055528_1000894 | 3300003790 | Bacteria | 20125 |
| 51 | Ga0055528_1009649 | 3300003790 | Bacteria | 4014 |
| 52 | Ga0055528_1028958 | 3300003790 | Bacteria | 1513 |
| 53 | Ga0055530_10002826 | 3300003791 | Bacteria | 10654 |
| 54 | Ga0055530_10005609 | 3300003791 | Bacteria | 5893 |
| 55 | Ga0055540_1001247 | 3300003792 | Bacteria | 15622 |
| 56 | Ga0055540_1006304 | 3300003792 | Bacteria | 4742 |
| 57 | Ga0055540_1008300 | 3300003792 | Bacteria | 3758 |
| 58 | Ga0055540_1010102 | 3300003792 | Bacteria | 3173 |
| 59 | Ga0055540_1024557 | 3300003792 | Bacteria | 1492 |
| 60 | Ga0055540_1028493 | 3300003792 | Bacteria | 1320 |
| 61 | Ga0055540_1043556 | 3300003792 | Bacteria | 957 |
| 62 | Ga0055531_10000257 | 3300003794 | Bacteria | 56547 |
| 63 | Ga0055531_10013583 | 3300003794 | Bacteria | 3742 |
| 64 | Ga0055531_10043153 | 3300003794 | Bacteria | 1279 |
| 65 | Ga0055531_10043197 | 3300003794 | Bacteria | 1278 |
| 66 | Ga0055543_1004453 | 3300004625 | Bacteria | 3823 |
| 67 | Ga0055543_1012039 | 3300004625 | Bacteria | 1751 |
| 68 | Ga0065165_1022212 | 3300005262 | Bacteria | 2182 |
| 69 | Ga0065165_1084303 | 3300005262 | Bacteria | 819 |
| 70 | Ga0065714_10003179 | 3300005288 | Bacteria | 12607 |
| 71 | Ga0065714_10020540 | 3300005288 | Bacteria | 2653 |
| 72 | Ga0065704_10098136 | 3300005289 | Bacteria | 2364 |
| 73 | Ga0065704_10150792 | 3300005289 | Bacteria | 1431 |
| 74 | Ga0065704_10194160 | 3300005289 | Bacteria | 1170 |
| 75 | Ga0070658_10150835 | 3300005327 | Bacteria | 1946 |
| 76 | Ga0070658_10195232 | 3300005327 | Bacteria | 1707 |
| 77 | Ga0070658_10238409 | 3300005327 | Bacteria | 1541 |
| 78 | Ga0070658_10553014 | 3300005327 | Bacteria | 996 |
| 79 | Ga0070658_10612725 | 3300005327 | Bacteria | 944 |
| 80 | Ga0070676_10403174 | 3300005328 | Bacteria | 952 |
| 81 | Ga0070676_10952606 | 3300005328 | Bacteria | 642 |
| 82 | Ga0070676_11060213 | 3300005328 | Bacteria | 611 |
| 83 | Ga0070677_10371826 | 3300005333 | Bacteria | 746 |
| 84 | Ga0068869_100358093 | 3300005334 | Bacteria | 1191 |
| 85 | Ga0068869_100909658 | 3300005334 | Bacteria | 762 |
| 86 | Ga0070680_100182847 | 3300005336 | Bacteria | 1766 |
| 87 | Ga0068868_101196025 | 3300005338 | Bacteria | 703 |
| 88 | Ga0070660_100112312 | 3300005339 | Bacteria | 2169 |
| 89 | Ga0070660_101101614 | 3300005339 | Bacteria | 672 |
| 90 | Ga0070668_100133718 | 3300005347 | Bacteria | 1992 |
| 91 | Ga0070669_100142848 | 3300005353 | Bacteria | 1847 |
| 92 | Ga0070675_100110942 | 3300005354 | Bacteria | 2320 |
| 93 | Ga0070675_100286798 | 3300005354 | Bacteria | 1448 |
| 94 | Ga0070671_100698192 | 3300005355 | Bacteria | 880 |
| 95 | Ga0070674_100108262 | 3300005356 | Bacteria | 2036 |
| 96 | Ga0070674_102031511 | 3300005356 | Bacteria | 524 |
| 97 | Ga0070673_100176030 | 3300005364 | Bacteria | 1829 |
| 98 | Ga0070673_100227738 | 3300005364 | Bacteria | 1616 |
| 99 | Ga0070673_100567129 | 3300005364 | Bacteria | 1033 |
| 100 | Ga0070688_101805254 | 3300005365 | Bacteria | 502 |
| 101 | Ga0070659_100144962 | 3300005366 | Bacteria | 1934 |
| 102 | Ga0070659_100272375 | 3300005366 | Bacteria | 1407 |
| 103 | Ga0070667_100055014 | 3300005367 | Bacteria | 3361 |
| 104 | Ga0070667_101352748 | 3300005367 | Bacteria | 668 |
| 105 | Ga0070714_100065548 | 3300005435 | Bacteria | 3129 |
| 106 | Ga0070678_100078732 | 3300005456 | Bacteria | 2491 |
| 107 | Ga0070678_100117703 | 3300005456 | Bacteria | 2090 |
| 108 | Ga0070678_100136554 | 3300005456 | Bacteria | 1956 |
| 109 | Ga0070678_100188117 | 3300005456 | Bacteria | 1696 |
| 110 | Ga0070678_100241016 | 3300005456 | Bacteria | 1512 |
| 111 | Ga0070678_101381302 | 3300005456 | Bacteria | 657 |
| 112 | Ga0070662_100018575 | 3300005457 | Bacteria | 4705 |
| 113 | Ga0070662_100127535 | 3300005457 | Bacteria | 1957 |
| 114 | Ga0068867_100655319 | 3300005459 | Bacteria | 921 |
| 115 | Ga0068867_100740580 | 3300005459 | Bacteria | 871 |
| 116 | Ga0068867_101894647 | 3300005459 | Bacteria | 562 |
| 117 | Ga0070679_100041543 | 3300005530 | Bacteria | 4576 |
| 118 | Ga0070679_100144338 | 3300005530 | Bacteria | 2358 |
| 119 | Ga0070684_101847280 | 3300005535 | Bacteria | 570 |
| 120 | Ga0068853_100163721 | 3300005539 | Bacteria | 2008 |
| 121 | Ga0068853_100527782 | 3300005539 | Bacteria | 1116 |
| 122 | Ga0068853_100645953 | 3300005539 | Bacteria | 1007 |
| 123 | Ga0068853_100757762 | 3300005539 | Bacteria | 928 |
| 124 | Ga0070672_100253317 | 3300005543 | Bacteria | 1483 |
| 125 | Ga0070665_100024013 | 3300005548 | Bacteria | 6139 |
| 126 | Ga0070665_100162313 | 3300005548 | Bacteria | 2236 |
| 127 | Ga0070665_100510248 | 3300005548 | Bacteria | 1214 |
| 128 | Ga0070665_100580640 | 3300005548 | Bacteria | 1134 |
| 129 | Ga0070665_102025120 | 3300005548 | Bacteria | 581 |
| 130 | Ga0068855_100006806 | 3300005563 | Bacteria | 13869 |
| 131 | Ga0068855_100163186 | 3300005563 | Bacteria | 2527 |
| 132 | Ga0068855_100329547 | 3300005563 | Bacteria | 1685 |
| 133 | Ga0070664_100008507 | 3300005564 | Bacteria | 8295 |
| 134 | Ga0070664_102046068 | 3300005564 | Bacteria | 543 |
| 135 | Ga0068857_100231554 | 3300005577 | Bacteria | 1690 |
| 136 | Ga0068857_100848605 | 3300005577 | Bacteria | 874 |
| 137 | Ga0068857_101168081 | 3300005577 | Bacteria | 745 |
| 138 | Ga0068854_100068140 | 3300005578 | Bacteria | 2594 |
| 139 | Ga0068854_100907765 | 3300005578 | Bacteria | 774 |
| 140 | Ga0068852_100169742 | 3300005616 | Bacteria | 2044 |
| 141 | Ga0068851_10029330 | 3300005834 | Bacteria | 2723 |
| 142 | Ga0068870_10920240 | 3300005840 | Bacteria | 619 |
| 143 | Ga0068858_101197000 | 3300005842 | Bacteria | 747 |
| 144 | Ga0068862_100105979 | 3300005844 | Bacteria | 2464 |
| 145 | Ga0075365_10004543 | 3300006038 | Bacteria | 7371 |
| 146 | Ga0075365_10011938 | 3300006038 | Bacteria | 5131 |
| 147 | Ga0075365_10023104 | 3300006038 | Bacteria | 3906 |
| 148 | Ga0075365_10024567 | 3300006038 | Bacteria | 3803 |
| 149 | Ga0075365_10166075 | 3300006038 | Bacteria | 1540 |
| 150 | Ga0075365_10343725 | 3300006038 | Bacteria | 1051 |
| 151 | Ga0075365_10386338 | 3300006038 | Bacteria | 988 |
| 152 | Ga0075368_10282316 | 3300006042 | Bacteria | 714 |
| 153 | Ga0075363_100007676 | 3300006048 | Bacteria | 4976 |
| 154 | Ga0075363_100070252 | 3300006048 | Bacteria | 1901 |
| 155 | Ga0075363_100217430 | 3300006048 | Bacteria | 1095 |
| 156 | Ga0075363_100408512 | 3300006048 | Bacteria | 798 |
| 157 | Ga0075364_10001078 | 3300006051 | Bacteria | 14541 |
| 158 | Ga0075364_10298992 | 3300006051 | Bacteria | 1095 |
| 159 | Ga0075432_10001601 | 3300006058 | Bacteria | 7442 |
| 160 | Ga0075432_10005352 | 3300006058 | Bacteria | 4373 |
| 161 | Ga0075362_10043861 | 3300006177 | Bacteria | 1981 |
| 162 | Ga0075362_10047496 | 3300006177 | Bacteria | 1912 |
| 163 | Ga0075362_10139559 | 3300006177 | Bacteria | 1157 |
| 164 | Ga0075362_10152965 | 3300006177 | Bacteria | 1108 |
| 165 | Ga0075362_10327870 | 3300006177 | Bacteria | 763 |
| 166 | Ga0075362_10579740 | 3300006177 | Bacteria | 578 |
| 167 | Ga0075362_10586143 | 3300006177 | Bacteria | 575 |
| 168 | Ga0075367_10027246 | 3300006178 | Bacteria | 3249 |
| 169 | Ga0075367_10086295 | 3300006178 | Bacteria | 1905 |
| 170 | Ga0075367_10100772 | 3300006178 | Bacteria | 1765 |
| 171 | Ga0075367_10231618 | 3300006178 | Bacteria | 1157 |
| 172 | Ga0075367_10343297 | 3300006178 | Bacteria | 942 |
| 173 | Ga0075369_10335295 | 3300006186 | Bacteria | 708 |
| 174 | Ga0075366_10002010 | 3300006195 | Bacteria | 10317 |
| 175 | Ga0075366_10003520 | 3300006195 | Bacteria | 8275 |
| 176 | Ga0075366_10009938 | 3300006195 | Bacteria | 5327 |
| 177 | Ga0075366_10034637 | 3300006195 | Bacteria | 2974 |
| 178 | Ga0075366_10057553 | 3300006195 | Bacteria | 2310 |
| 179 | Ga0075366_10100825 | 3300006195 | Bacteria | 1732 |
| 180 | Ga0097621_100175436 | 3300006237 | Bacteria | 1850 |
| 181 | Ga0097621_102158638 | 3300006237 | Bacteria | 533 |
| 182 | Ga0075370_10000304 | 3300006353 | Bacteria | 17728 |
| 183 | Ga0075370_10005111 | 3300006353 | Bacteria | 6468 |
| 184 | Ga0075370_10014472 | 3300006353 | Bacteria | 4209 |
| 185 | Ga0075370_10015729 | 3300006353 | Bacteria | 4058 |
| 186 | Ga0075370_10020002 | 3300006353 | Bacteria | 3651 |
| 187 | Ga0075370_10110612 | 3300006353 | Bacteria | 1596 |
| 188 | Ga0075370_10124227 | 3300006353 | Bacteria | 1504 |
| 189 | Ga0075370_10144188 | 3300006353 | Bacteria | 1393 |
| 190 | Ga0075370_10250007 | 3300006353 | Bacteria | 1051 |
| 191 | Ga0075370_10422826 | 3300006353 | Bacteria | 801 |
| 192 | Ga0075370_10515906 | 3300006353 | Bacteria | 722 |
| 193 | Ga0075370_10751826 | 3300006353 | Bacteria | 593 |
| 194 | Ga0068871_101579579 | 3300006358 | Bacteria | 621 |
| 195 | Ga0075430_100069245 | 3300006846 | Bacteria | 2960 |
| 196 | Ga0075431_100579867 | 3300006847 | Bacteria | 1107 |
| 197 | Ga0075429_100177102 | 3300006880 | Bacteria | 1869 |
| 198 | Ga0068865_100951286 | 3300006881 | Bacteria | 750 |
| 199 | Ga0079104_1025289 | 3300006946 | Bacteria | 1551 |
| 200 | Ga0099826_10000101 | 3300006948 | Bacteria | 40408 |
| 201 | Ga0099826_10109187 | 3300006948 | Bacteria | 1651 |
| 202 | Ga0105244_10049588 | 3300009036 | Bacteria | 2145 |
| 203 | Ga0105244_10271625 | 3300009036 | Bacteria | 787 |
| 204 | Ga0105244_10473373 | 3300009036 | Bacteria | 576 |
| 205 | Ga0105240_10008945 | 3300009093 | Bacteria | 14239 |
| 206 | Ga0105240_10104606 | 3300009093 | Bacteria | 3438 |
| 207 | Ga0105240_10217744 | 3300009093 | Bacteria | 2226 |
| 208 | Ga0105245_10180345 | 3300009098 | Bacteria | 2017 |
| 209 | Ga0105245_10655149 | 3300009098 | Bacteria | 1080 |
| 210 | Ga0105245_11059773 | 3300009098 | Bacteria | 856 |
| 211 | Ga0105245_12239086 | 3300009098 | Bacteria | 600 |
| 212 | Ga0105243_10036791 | 3300009148 | Bacteria | 3802 |
| 213 | Ga0105243_10037344 | 3300009148 | Bacteria | 3775 |
| 214 | Ga0105243_10726453 | 3300009148 | Bacteria | 971 |
| 215 | Ga0105243_11030141 | 3300009148 | Bacteria | 827 |
| 216 | Ga0105241_10554815 | 3300009174 | Bacteria | 1032 |
| 217 | Ga0105242_10001936 | 3300009176 | Bacteria | 16289 |
| 218 | Ga0105242_10410881 | 3300009176 | Bacteria | 1266 |
| 219 | Ga0105242_10422116 | 3300009176 | Bacteria | 1250 |
| 220 | Ga0105242_10455396 | 3300009176 | Bacteria | 1207 |
| 221 | Ga0105237_10393687 | 3300009545 | Bacteria | 1390 |
| 222 | Ga0105237_11603970 | 3300009545 | Bacteria | 658 |
| 223 | Ga0105238_10005849 | 3300009551 | Bacteria | 12180 |
| 224 | Ga0105238_10385391 | 3300009551 | Bacteria | 1394 |
| 225 | Ga0105238_10506597 | 3300009551 | Bacteria | 1208 |
| 226 | Ga0105249_11017161 | 3300009553 | Bacteria | 898 |
| 227 | Ga0105239_10105208 | 3300010375 | Bacteria | 3125 |
| 228 | Ga0105239_10775322 | 3300010375 | Bacteria | 1098 |
| 229 | Ga0105239_11669661 | 3300010375 | Bacteria | 737 |
| 230 | Ga0105246_10111217 | 3300011119 | Bacteria | 2012 |
| 231 | Ga0105246_10154807 | 3300011119 | Bacteria | 1740 |
| 232 | Ga0105246_11161716 | 3300011119 | Bacteria | 708 |
| 233 | Ga0157322_1033385 | 3300012490 | Bacteria | 560 |
| 234 | Ga0157347_1033560 | 3300012502 | Bacteria | 653 |
| 235 | Ga0157339_1017976 | 3300012505 | Bacteria | 723 |
| 236 | Ga0157373_10031485 | 3300013100 | Bacteria | 3818 |
| 237 | Ga0157373_10145760 | 3300013100 | Bacteria | 1665 |
| 238 | Ga0157373_10187275 | 3300013100 | Bacteria | 1458 |
| 239 | Ga0157373_10292037 | 3300013100 | Bacteria | 1156 |
| 240 | Ga0157373_10462388 | 3300013100 | Bacteria | 914 |
| 241 | Ga0157371_10347860 | 3300013102 | Bacteria | 1079 |
| 242 | Ga0157370_10006343 | 3300013104 | Bacteria | 13063 |
| 243 | Ga0157370_10577168 | 3300013104 | Bacteria | 1030 |
| 244 | Ga0157370_10828426 | 3300013104 | Bacteria | 841 |
| 245 | Ga0157370_10918275 | 3300013104 | Bacteria | 794 |
| 246 | Ga0157370_11218174 | 3300013104 | Bacteria | 679 |
| 247 | Ga0157369_10008807 | 3300013105 | Bacteria | 11563 |
| 248 | Ga0157374_10277529 | 3300013296 | Bacteria | 1654 |
| 249 | Ga0157374_11426807 | 3300013296 | Bacteria | 715 |
| 250 | Ga0163162_10296582 | 3300013306 | Bacteria | 1748 |
| 251 | Ga0157372_10568359 | 3300013307 | Bacteria | 1322 |
| 252 | Ga0157372_12350477 | 3300013307 | Bacteria | 612 |
| 253 | Ga0157375_10156318 | 3300013308 | Bacteria | 2419 |
| 254 | Ga0157375_10213056 | 3300013308 | Bacteria | 2090 |
| 255 | Ga0157375_11688974 | 3300013308 | Bacteria | 750 |
| 256 | Ga0182008_10001806 | 3300014497 | Bacteria | 13972 |
| 257 | Ga0182008_10005163 | 3300014497 | Bacteria | 7487 |
| 258 | Ga0182008_10020210 | 3300014497 | Bacteria | 3431 |
| 259 | Ga0182008_10183987 | 3300014497 | Bacteria | 1058 |
| 260 | Ga0182008_10221844 | 3300014497 | Bacteria | 967 |
| 261 | Ga0157377_11321952 | 3300014745 | Bacteria | 564 |
| 262 | Ga0157376_10186194 | 3300014969 | Bacteria | 1901 |
| 263 | Ga0157376_10998306 | 3300014969 | Bacteria | 859 |
| 264 | Ga0157376_12562524 | 3300014969 | Bacteria | 550 |
| 265 | Ga0182006_1005907 | 3300015261 | Bacteria | 5761 |
| 266 | Ga0182006_1041115 | 3300015261 | Bacteria | 1817 |
| 267 | Ga0182006_1157628 | 3300015261 | Bacteria | 766 |
| 268 | Ga0182006_1323034 | 3300015261 | Bacteria | 507 |
| 269 | Ga0182007_10004286 | 3300015262 | Bacteria | 6501 |
| 270 | Ga0182007_10015525 | 3300015262 | Bacteria | 2837 |
| 271 | Ga0182007_10051471 | 3300015262 | Bacteria | 1358 |
| 272 | Ga0182005_1042401 | 3300015265 | Bacteria | 1237 |
| 273 | Ga0182005_1139173 | 3300015265 | Bacteria | 700 |
| 274 | Ga0182005_1155222 | 3300015265 | Bacteria | 668 |
| 275 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 276 | Ga0163161_10001428 | 3300017792 | Bacteria | 17611 |
| 277 | Ga0163161_10001866 | 3300017792 | Bacteria | 15379 |
| 278 | Ga0163161_10011965 | 3300017792 | Bacteria | 6020 |
| 279 | Ga0163161_10033986 | 3300017792 | Bacteria | 3646 |
| 280 | Ga0163161_10135200 | 3300017792 | Bacteria | 1863 |
| 281 | Ga0163161_10468120 | 3300017792 | Bacteria | 1021 |
| 282 | Ga0163161_10681605 | 3300017792 | Bacteria | 854 |
| 283 | Ga0163161_11387551 | 3300017792 | Bacteria | 613 |
| 284 | Ga0163161_11496708 | 3300017792 | Bacteria | 592 |
| 285 | Ga0213872_10067622 | 3300021361 | Bacteria | 1612 |
| 286 | Ga0209672_100378 | 3300025228 | Bacteria | 27209 |
| 287 | Ga0209147_100696 | 3300025229 | Bacteria | 17227 |
| 288 | Ga0209258_100093 | 3300025242 | Bacteria | 223559 |
| 289 | Ga0207425_1003154 | 3300025245 | Bacteria | 5398 |
| 290 | Ga0207425_1037790 | 3300025245 | Bacteria | 930 |
| 291 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 292 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 293 | Ga0209129_1005316 | 3300025258 | Bacteria | 4615 |
| 294 | Ga0209129_1006968 | 3300025258 | Bacteria | 3489 |
| 295 | Ga0209129_1009656 | 3300025258 | Bacteria | 2508 |
| 296 | Ga0209129_1012142 | 3300025258 | Bacteria | 2001 |
| 297 | Ga0209565_1000098 | 3300025263 | Bacteria | 132021 |
| 298 | Ga0209565_1000633 | 3300025263 | Bacteria | 22947 |
| 299 | Ga0209565_1003729 | 3300025263 | Bacteria | 4831 |
| 300 | Ga0209673_1000058 | 3300025273 | Bacteria | 269028 |
| 301 | Ga0209673_1001185 | 3300025273 | Bacteria | 28137 |
| 302 | Ga0209673_1002178 | 3300025273 | Bacteria | 14443 |
| 303 | Ga0209673_1021052 | 3300025273 | Bacteria | 2291 |
| 304 | Ga0209673_1082175 | 3300025273 | Bacteria | 735 |
| 305 | Ga0209673_1124279 | 3300025273 | Bacteria | 521 |
| 306 | Ga0209130_1001692 | 3300025284 | Bacteria | 13338 |
| 307 | Ga0209130_1018535 | 3300025284 | Bacteria | 1631 |
| 308 | Ga0209130_1041871 | 3300025284 | Bacteria | 879 |
| 309 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 310 | Ga0209675_1000151 | 3300025291 | Bacteria | 91172 |
| 311 | Ga0209675_1000431 | 3300025291 | Bacteria | 33567 |
| 312 | Ga0209675_1001858 | 3300025291 | Bacteria | 11452 |
| 313 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 314 | Ga0209676_1000333 | 3300025292 | Bacteria | 90785 |
| 315 | Ga0209676_1002526 | 3300025292 | Bacteria | 12760 |
| 316 | Ga0209676_1005042 | 3300025292 | Bacteria | 7062 |
| 317 | Ga0209676_1008655 | 3300025292 | Bacteria | 4504 |
| 318 | Ga0209676_1045505 | 3300025292 | Bacteria | 1194 |
| 319 | Ga0209676_1054226 | 3300025292 | Bacteria | 1034 |
| 320 | Ga0209025_1000289 | 3300025294 | Bacteria | 113555 |
| 321 | Ga0209025_1000685 | 3300025294 | Bacteria | 58093 |
| 322 | Ga0209025_1004578 | 3300025294 | Bacteria | 11876 |
| 323 | Ga0209025_1008279 | 3300025294 | Bacteria | 7509 |
| 324 | Ga0209025_1008530 | 3300025294 | Bacteria | 7360 |
| 325 | Ga0209025_1016710 | 3300025294 | Bacteria | 4300 |
| 326 | Ga0209564_1000209 | 3300025295 | Bacteria | 133651 |
| 327 | Ga0209564_1002281 | 3300025295 | Bacteria | 15652 |
| 328 | Ga0209564_1027576 | 3300025295 | Bacteria | 1841 |
| 329 | Ga0209564_1028299 | 3300025295 | Bacteria | 1796 |
| 330 | Ga0209758_1000049 | 3300025297 | Bacteria | 345104 |
| 331 | Ga0209758_1027337 | 3300025297 | Bacteria | 2440 |
| 332 | Ga0209050_1000072 | 3300025298 | Bacteria | 293619 |
| 333 | Ga0209050_1000721 | 3300025298 | Bacteria | 48376 |
| 334 | Ga0209050_1000927 | 3300025298 | Bacteria | 38487 |
| 335 | Ga0209050_1024101 | 3300025298 | Bacteria | 2118 |
| 336 | Ga0209050_1032889 | 3300025298 | Bacteria | 1584 |
| 337 | Ga0209256_1000088 | 3300025299 | Bacteria | 217236 |
| 338 | Ga0209256_1017360 | 3300025299 | Bacteria | 2395 |
| 339 | Ga0209256_1023416 | 3300025299 | Bacteria | 1842 |
| 340 | Ga0207426_1000038 | 3300025302 | Bacteria | 441522 |
| 341 | Ga0207426_1000053 | 3300025302 | Bacteria | 384818 |
| 342 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 343 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 344 | Ga0209051_1000056 | 3300025303 | Bacteria | 271616 |
| 345 | Ga0209051_1000424 | 3300025303 | Bacteria | 57966 |
| 346 | Ga0209051_1000545 | 3300025303 | Bacteria | 46076 |
| 347 | Ga0209051_1000757 | 3300025303 | Bacteria | 34605 |
| 348 | Ga0209051_1004866 | 3300025303 | Bacteria | 8064 |
| 349 | Ga0209051_1045133 | 3300025303 | Bacteria | 1528 |
| 350 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 351 | Ga0209257_1003278 | 3300025304 | Bacteria | 14122 |
| 352 | Ga0209257_1003691 | 3300025304 | Bacteria | 12748 |
| 353 | Ga0209257_1004686 | 3300025304 | Bacteria | 10280 |
| 354 | Ga0209257_1024960 | 3300025304 | Bacteria | 2054 |
| 355 | Ga0207656_10025888 | 3300025321 | Bacteria | 2386 |
| 356 | Ga0207655_1009225 | 3300025728 | Bacteria | 6155 |
| 357 | Ga0207688_10951891 | 3300025901 | Bacteria | 543 |
| 358 | Ga0207647_10259423 | 3300025904 | Bacteria | 995 |
| 359 | Ga0207645_10466030 | 3300025907 | Bacteria | 853 |
| 360 | Ga0207705_10119461 | 3300025909 | Bacteria | 1955 |
| 361 | Ga0207705_10190402 | 3300025909 | Bacteria | 1551 |
| 362 | Ga0207705_10191968 | 3300025909 | Bacteria | 1545 |
| 363 | Ga0207705_10344520 | 3300025909 | Bacteria | 1147 |
| 364 | Ga0207705_10374570 | 3300025909 | Bacteria | 1099 |
| 365 | Ga0207705_10670440 | 3300025909 | Bacteria | 806 |
| 366 | Ga0207707_10122443 | 3300025912 | Bacteria | 2275 |
| 367 | Ga0207695_10216190 | 3300025913 | Bacteria | 1826 |
| 368 | Ga0207695_10330904 | 3300025913 | Bacteria | 1412 |
| 369 | Ga0207671_10025637 | 3300025914 | Bacteria | 4427 |
| 370 | Ga0207657_10038921 | 3300025919 | Bacteria | 4229 |
| 371 | Ga0207657_10552566 | 3300025919 | Bacteria | 900 |
| 372 | Ga0207657_10887746 | 3300025919 | Bacteria | 687 |
| 373 | Ga0207657_10922875 | 3300025919 | Bacteria | 672 |
| 374 | Ga0207649_11599179 | 3300025920 | Bacteria | 516 |
| 375 | Ga0207652_10048380 | 3300025921 | Bacteria | 3635 |
| 376 | Ga0207652_11169647 | 3300025921 | Bacteria | 670 |
| 377 | Ga0207681_10100764 | 3300025923 | Bacteria | 2082 |
| 378 | Ga0207694_10009970 | 3300025924 | Bacteria | 7161 |
| 379 | Ga0207694_10367641 | 3300025924 | Bacteria | 1192 |
| 380 | Ga0207659_10248065 | 3300025926 | Bacteria | 1443 |
| 381 | Ga0207687_10097625 | 3300025927 | Bacteria | 2155 |
| 382 | Ga0207687_10450402 | 3300025927 | Bacteria | 1067 |
| 383 | Ga0207687_10909488 | 3300025927 | Bacteria | 753 |
| 384 | Ga0207690_10153252 | 3300025932 | Bacteria | 1710 |
| 385 | Ga0207690_10305274 | 3300025932 | Bacteria | 1246 |
| 386 | Ga0207706_10019114 | 3300025933 | Bacteria | 6163 |
| 387 | Ga0207686_10021874 | 3300025934 | Bacteria | 3676 |
| 388 | Ga0207686_10344627 | 3300025934 | Bacteria | 1120 |
| 389 | Ga0207709_10000958 | 3300025935 | Bacteria | 21596 |
| 390 | Ga0207709_10001025 | 3300025935 | Bacteria | 20674 |
| 391 | Ga0207709_10058565 | 3300025935 | Bacteria | 2394 |
| 392 | Ga0207709_11446482 | 3300025935 | Bacteria | 570 |
| 393 | Ga0207669_10153012 | 3300025937 | Bacteria | 1618 |
| 394 | Ga0207669_11194577 | 3300025937 | Bacteria | 644 |
| 395 | Ga0207669_11287390 | 3300025937 | Bacteria | 621 |
| 396 | Ga0207691_10183575 | 3300025940 | Bacteria | 1827 |
| 397 | Ga0207691_10465680 | 3300025940 | Bacteria | 1075 |
| 398 | Ga0207691_10518676 | 3300025940 | Bacteria | 1011 |
| 399 | Ga0207689_10401036 | 3300025942 | Bacteria | 1143 |
| 400 | Ga0207679_10249310 | 3300025945 | Bacteria | 1508 |
| 401 | Ga0207667_10044142 | 3300025949 | Bacteria | 4726 |
| 402 | Ga0207667_10271972 | 3300025949 | Bacteria | 1732 |
| 403 | Ga0207667_10442505 | 3300025949 | Bacteria | 1321 |
| 404 | Ga0207651_10191923 | 3300025960 | Bacteria | 1630 |
| 405 | Ga0207651_10874111 | 3300025960 | Bacteria | 800 |
| 406 | Ga0207651_11562231 | 3300025960 | Bacteria | 594 |
| 407 | Ga0207712_11194328 | 3300025961 | Bacteria | 678 |
| 408 | Ga0207640_10277130 | 3300025981 | Bacteria | 1315 |
| 409 | Ga0207640_10818682 | 3300025981 | Bacteria | 808 |
| 410 | Ga0207658_10480905 | 3300025986 | Bacteria | 1103 |
| 411 | Ga0207658_11051644 | 3300025986 | Bacteria | 743 |
| 412 | Ga0207703_11399255 | 3300026035 | Bacteria | 673 |
| 413 | Ga0207639_10062155 | 3300026041 | Bacteria | 2886 |
| 414 | Ga0207639_10442979 | 3300026041 | Bacteria | 1178 |
| 415 | Ga0207639_10559538 | 3300026041 | Bacteria | 1051 |
| 416 | Ga0207639_10622354 | 3300026041 | Bacteria | 997 |
| 417 | Ga0207639_11035979 | 3300026041 | Bacteria | 769 |
| 418 | Ga0207678_10131083 | 3300026067 | Bacteria | 2138 |
| 419 | Ga0207702_11370509 | 3300026078 | Bacteria | 701 |
| 420 | Ga0207648_10906197 | 3300026089 | Bacteria | 824 |
| 421 | Ga0207648_11713992 | 3300026089 | Bacteria | 590 |
| 422 | Ga0207674_10087595 | 3300026116 | Bacteria | 3107 |
| 423 | Ga0207674_10362219 | 3300026116 | Bacteria | 1401 |
| 424 | Ga0207683_10043646 | 3300026121 | Bacteria | 3918 |
| 425 | Ga0207683_10156580 | 3300026121 | Bacteria | 2058 |
| 426 | Ga0207683_10201423 | 3300026121 | Bacteria | 1810 |
| 427 | Ga0207683_10390270 | 3300026121 | Bacteria | 1280 |
| 428 | Ga0207683_10511563 | 3300026121 | Bacteria | 1109 |
| 429 | Ga0207683_11242106 | 3300026121 | Bacteria | 690 |
| 430 | Ga0207698_10675695 | 3300026142 | Bacteria | 1025 |
| 431 | Ga0209281_1039412 | 3300027111 | Bacteria | 802 |
| 432 | Ga0209968_1026886 | 3300027526 | Bacteria | 952 |
| 433 | Ga0209982_1033270 | 3300027552 | Bacteria | 813 |
| 434 | Ga0209970_1000036 | 3300027614 | Bacteria | 17242 |
| 435 | Ga0209282_1000785 | 3300027666 | Bacteria | 16113 |
| 436 | Ga0209971_1023805 | 3300027682 | Bacteria | 1461 |
| 437 | Ga0209813_10047942 | 3300027866 | Bacteria | 1325 |
| 438 | Ga0209974_10004079 | 3300027876 | Bacteria | 5216 |
| 439 | Ga0209974_10013668 | 3300027876 | Bacteria | 2703 |
| 440 | Ga0209974_10094486 | 3300027876 | Bacteria | 1039 |
| 441 | Ga0207428_10081162 | 3300027907 | Bacteria | 2533 |
| 442 | Ga0207428_10200482 | 3300027907 | Bacteria | 1502 |
| 443 | Ga0268266_10013081 | 3300028379 | Bacteria | 7156 |
| 444 | Ga0268266_10483141 | 3300028379 | Bacteria | 1181 |
| 445 | Ga0268266_11535685 | 3300028379 | Bacteria | 641 |
| 446 | Ga0268265_10102366 | 3300028380 | Bacteria | 2316 |
| 447 | Ga0307515_10004716 | 3300028794 | Bacteria | 27939 |
| 448 | Ga0307515_10296335 | 3300028794 | Bacteria | 1307 |
| 449 | Ga0307512_10215614 | 3300030522 | Bacteria | 1012 |
| 450 | Ga0316177_1085660 | 3300030731 | Bacteria | 2710 |
| 451 | Ga0316177_1120923 | 3300030731 | Bacteria | 1727 |
| 452 | Ga0316176_1044943 | 3300030732 | Bacteria | 5479 |
| 453 | Ga0314311_1181387 | 3300030733 | Bacteria | 8006 |
| 454 | Ga0316183_1046501 | 3300030742 | Bacteria | 6498 |
| 455 | Ga0316181_1019721 | 3300030744 | Bacteria | 5168 |
| 456 | Ga0316182_1247982 | 3300030745 | Bacteria | 1962 |
| 457 | Ga0316182_1441726 | 3300030745 | Bacteria | 1772 |
| 458 | Ga0265332_10292800 | 3300031238 | Bacteria | 672 |
| 459 | Ga0265331_10119585 | 3300031250 | Bacteria | 1205 |
| 460 | Ga0265327_10000789 | 3300031251 | Bacteria | 48791 |
| 461 | Ga0265327_10005861 | 3300031251 | Bacteria | 10046 |
| 462 | Ga0265316_10103655 | 3300031344 | Bacteria | 2160 |
| 463 | Ga0307513_10076892 | 3300031456 | Bacteria | 3460 |
| 464 | Ga0307513_10886532 | 3300031456 | Bacteria | 599 |
| 465 | Ga0307408_100013422 | 3300031548 | Bacteria | 5436 |
| 466 | Ga0307408_100253542 | 3300031548 | Bacteria | 1452 |
| 467 | Ga0307408_100567688 | 3300031548 | Bacteria | 1003 |
| 468 | Ga0307408_100567720 | 3300031548 | Bacteria | 1003 |
| 469 | Ga0307408_101210607 | 3300031548 | Bacteria | 705 |
| 470 | Ga0307514_10004647 | 3300031649 | Bacteria | 12588 |
| 471 | Ga0265314_10006203 | 3300031711 | Bacteria | 10617 |
| 472 | Ga0265342_10060778 | 3300031712 | Bacteria | 2227 |
| 473 | Ga0265342_10185236 | 3300031712 | Bacteria | 1138 |
| 474 | Ga0307516_10156441 | 3300031730 | Bacteria | 2034 |
| 475 | Ga0307405_10045105 | 3300031731 | Bacteria | 2699 |
| 476 | Ga0307405_10223349 | 3300031731 | Bacteria | 1383 |
| 477 | Ga0307405_10825468 | 3300031731 | Bacteria | 778 |
| 478 | Ga0307410_10064368 | 3300031852 | Bacteria | 2519 |
| 479 | Ga0307406_10005016 | 3300031901 | Bacteria | 7215 |
| 480 | Ga0307406_11115606 | 3300031901 | Bacteria | 682 |
| 481 | Ga0307412_10086036 | 3300031911 | Bacteria | 2186 |
| 482 | Ga0307412_10152808 | 3300031911 | Bacteria | 1705 |
| 483 | Ga0307412_10516845 | 3300031911 | Bacteria | 997 |
| 484 | Ga0307412_11693916 | 3300031911 | Bacteria | 579 |
| 485 | Ga0307416_100026977 | 3300032002 | Bacteria | 4244 |
| 486 | Ga0307416_100034338 | 3300032002 | Bacteria | 3859 |
| 487 | Ga0307416_101143473 | 3300032002 | Bacteria | 884 |
| 488 | Ga0307416_101601510 | 3300032002 | Bacteria | 756 |
| 489 | Ga0307414_10070360 | 3300032004 | Bacteria | 2519 |
| 490 | Ga0307414_10072933 | 3300032004 | Bacteria | 2481 |
| 491 | Ga0307414_10493195 | 3300032004 | Bacteria | 1082 |
| 492 | Ga0307411_10647557 | 3300032005 | Bacteria | 914 |
| 493 | Ga0307415_100713115 | 3300032126 | Bacteria | 907 |
| 494 | Ga0373939_0337975 | 3300035114 | Bacteria | 610 |
| 495 | Ga0373931_0159054 | 3300035691 | Bacteria | 1323 |
| 496 | Ga0373935_0389638 | 3300035692 | Bacteria | 999 |
| 497 | Ga0373927_0827967 | 3300035695 | Bacteria | 611 |
| 498 | Ga0373925_0511951 | 3300037068 | Bacteria | 986 |
| 499 | Ga0395899_0019414 | 3300037312 | Bacteria | 5165 |
| 500 | Ga0395899_0035679 | 3300037312 | Bacteria | 3732 |
| 501 | Ga0395899_0173816 | 3300037312 | Bacteria | 1515 |
| 502 | Ga0395899_0244138 | 3300037312 | Bacteria | 1235 |
| 503 | Ga0395900_0011923 | 3300037418 | Bacteria | 8886 |
| 504 | Ga0395900_0019815 | 3300037418 | Bacteria | 6854 |
| 505 | Ga0395900_0047396 | 3300037418 | Bacteria | 4424 |
| 506 | Ga0395900_0052858 | 3300037418 | Bacteria | 4182 |
| 507 | Ga0395900_0421238 | 3300037418 | Bacteria | 1296 |
| 508 | Ga0395900_0853076 | 3300037418 | Bacteria | 836 |
| 509 | Ga0395898_0016238 | 3300037466 | Bacteria | 7621 |
| 510 | Ga0395898_0017821 | 3300037466 | Bacteria | 7245 |
| 511 | Ga0395898_0110816 | 3300037466 | Bacteria | 2630 |
| 512 | Ga0395898_0475940 | 3300037466 | Bacteria | 1188 |
| 513 | Ga0395898_0693006 | 3300037466 | Bacteria | 961 |
| 514 | Ga0395905_0000027 | 3300037471 | Bacteria | 297239 |
| 515 | Ga0395905_0011168 | 3300037471 | Bacteria | 8682 |
| 516 | Ga0395905_0018668 | 3300037471 | Bacteria | 6577 |
| 517 | Ga0395905_0023994 | 3300037471 | Bacteria | 5758 |
| 518 | Ga0395905_0025965 | 3300037471 | Bacteria | 5522 |
| 519 | Ga0395905_0059022 | 3300037471 | Bacteria | 3587 |
| 520 | Ga0395905_0093619 | 3300037471 | Bacteria | 2818 |
| 521 | Ga0395905_0097950 | 3300037471 | Bacteria | 2753 |
| 522 | Ga0395905_0167972 | 3300037471 | Bacteria | 2061 |
| 523 | Ga0395905_0573117 | 3300037471 | Bacteria | 1030 |
| 524 | Ga0395905_0576879 | 3300037471 | Bacteria | 1026 |
| 525 | Ga0395905_1149015 | 3300037471 | Bacteria | 680 |
| 526 | Ga0395901_0026973 | 3300038443 | Bacteria | 5898 |
| 527 | Ga0395901_0043020 | 3300038443 | Bacteria | 4685 |
| 528 | Ga0395901_0061046 | 3300038443 | Bacteria | 3923 |
| 529 | Ga0395901_0064334 | 3300038443 | Bacteria | 3818 |
| 530 | Ga0395901_0068948 | 3300038443 | Bacteria | 3683 |
| 531 | Ga0395901_0121481 | 3300038443 | Bacteria | 2745 |
| 532 | Ga0395901_0211801 | 3300038443 | Bacteria | 2028 |
| 533 | Ga0395901_0257769 | 3300038443 | Bacteria | 1816 |
| 534 | Ga0395901_1123484 | 3300038443 | Bacteria | 755 |
| 535 | Ga0395901_1896524 | 3300038443 | Bacteria | 543 |
| 536 | Ga0436361_0070738 | 3300039447 | Bacteria | 27213 |
| 537 | Ga0439436_0006510 | 3300041404 | Bacteria | 3585 |
| 538 | Ga0439436_0010396 | 3300041404 | Bacteria | 2839 |
| 539 | Ga0439436_0018487 | 3300041404 | Bacteria | 2084 |
| 540 | Ga0439438_039792 | 3300041405 | Bacteria | 1224 |
| 541 | Ga0439439_0002012 | 3300041406 | Bacteria | 4227 |
| 542 | Ga0439447_022624 | 3300041407 | Bacteria | 1644 |
| 543 | Ga0439447_028164 | 3300041407 | Bacteria | 1429 |
| 544 | Ga0439447_152725 | 3300041407 | Bacteria | 531 |
| 545 | Ga0439461_0006354 | 3300041410 | Bacteria | 2055 |
| 546 | Ga0439466_0002323 | 3300041411 | Bacteria | 7463 |
| 547 | Ga0439466_0012501 | 3300041411 | Bacteria | 3125 |
| 548 | Ga0439466_0015344 | 3300041411 | Bacteria | 2782 |
| 549 | Ga0439465_0001853 | 3300041413 | Bacteria | 6919 |
| 550 | Ga0439465_0004649 | 3300041413 | Bacteria | 4430 |
| 551 | Ga0451791_0284746 | 3300041451 | Bacteria | 1155 |
| 552 | Ga0451791_0563739 | 3300041451 | Bacteria | 607 |
| 553 | Ga0451791_1887967 | 3300041451 | Bacteria | 693 |
| 554 | Ga0451798_0925139 | 3300041458 | Bacteria | 708 |
| 555 | Ga0451807_0419949 | 3300041486 | Bacteria | 675 |
| 556 | Ga0451807_1686510 | 3300041486 | Bacteria | 731 |
| 557 | Ga0451807_2302176 | 3300041486 | Bacteria | 547 |
| 558 | Ga0451833_0574531 | 3300041491 | Bacteria | 807 |
| 559 | Ga0451835_1043689 | 3300041492 | Bacteria | 550 |
| 560 | Ga0451841_1228420 | 3300041498 | Bacteria | 551 |
| 561 | Ga0451853_1261129 | 3300041512 | Bacteria | 745 |
| 562 | Ga0439433_0001942 | 3300041999 | Bacteria | 4328 |
| 563 | Ga0439437_003204 | 3300042000 | Bacteria | 1763 |
| 564 | Ga0439441_035560 | 3300042001 | Bacteria | 982 |
| 565 | Ga0439442_004106 | 3300042002 | Bacteria | 2888 |
| 566 | Ga0439443_034373 | 3300042003 | Bacteria | 846 |
| 567 | Ga0439445_0000200 | 3300042004 | Bacteria | 10930 |
| 568 | Ga0439445_0240596 | 3300042004 | Bacteria | 539 |
| 569 | Ga0439448_0107664 | 3300042005 | Bacteria | 951 |
| 570 | Ga0439432_001787 | 3300042006 | Bacteria | 8050 |
| 571 | Ga0439432_002229 | 3300042006 | Bacteria | 7308 |
| 572 | Ga0439432_070836 | 3300042006 | Bacteria | 1063 |
| 573 | Ga0439449_0001772 | 3300042007 | Bacteria | 8484 |
| 574 | Ga0439449_0003811 | 3300042007 | Bacteria | 5838 |
| 575 | Ga0439449_0010236 | 3300042007 | Bacteria | 3542 |
| 576 | Ga0439449_0166167 | 3300042007 | Bacteria | 824 |
| 577 | Ga0439452_002059 | 3300042010 | Bacteria | 7639 |
| 578 | Ga0439452_002146 | 3300042010 | Bacteria | 7456 |
| 579 | Ga0439457_008995 | 3300042014 | Bacteria | 2337 |
| 580 | Ga0439457_045221 | 3300042014 | Bacteria | 984 |
| 581 | Ga0439462_0002253 | 3300042015 | Bacteria | 4455 |
| 582 | Ga0439462_0007235 | 3300042015 | Bacteria | 2776 |
| 583 | Ga0439462_0048246 | 3300042015 | Bacteria | 1142 |
| 584 | Ga0450914_024523 | 3300042118 | Bacteria | 693 |
| 585 | Ga0450915_000567 | 3300042119 | Bacteria | 1412 |
| 586 | Ga0450923_014302 | 3300042125 | Bacteria | 1471 |
| 587 | Ga0450890_003980 | 3300042127 | Bacteria | 1945 |
| 588 | Ga0450890_004272 | 3300042127 | Bacteria | 1871 |
| 589 | Ga0450897_004575 | 3300042128 | Bacteria | 1162 |
| 590 | Ga0450891_012508 | 3300042129 | Bacteria | 791 |
| 591 | Ga0450891_013050 | 3300042129 | Bacteria | 778 |
| 592 | Ga0450891_014893 | 3300042129 | Bacteria | 735 |
| 593 | Ga0450894_003496 | 3300042131 | Bacteria | 2053 |
| 594 | Ga0450896_017735 | 3300042133 | Bacteria | 1029 |
| 595 | Ga0450898_083624 | 3300042134 | Bacteria | 652 |
| 596 | Ga0450898_106959 | 3300042134 | Bacteria | 589 |
| 597 | Ga0450899_027903 | 3300042135 | Bacteria | 679 |
| 598 | Ga0450899_053117 | 3300042135 | Bacteria | 519 |
| 599 | Ga0450889_022346 | 3300042144 | Bacteria | 709 |
| 600 | Ga0450906_004422 | 3300042145 | Bacteria | 2947 |
| 601 | Ga0450906_014423 | 3300042145 | Bacteria | 1446 |
| 602 | Ga0450907_039478 | 3300042146 | Bacteria | 808 |
| 603 | Ga0450910_010458 | 3300042147 | Bacteria | 1321 |
| 604 | Ga0450910_019073 | 3300042147 | Bacteria | 1028 |
| 605 | Ga0439446_0002191 | 3300042156 | Bacteria | 4654 |
| 606 | Ga0439446_0025007 | 3300042156 | Bacteria | 1706 |
| 607 | Ga0439446_0027195 | 3300042156 | Bacteria | 1641 |
| 608 | Ga0439446_0027520 | 3300042156 | Bacteria | 1632 |
| 609 | Ga0439446_0036356 | 3300042156 | Bacteria | 1439 |
| 610 | Ga0439458_0043951 | 3300042157 | Bacteria | 1090 |
| 611 | Ga0450908_001658 | 3300042184 | Bacteria | 4326 |
| 612 | Ga0450909_001276 | 3300042185 | Bacteria | 3501 |
| 613 | Ga0450909_012894 | 3300042185 | Bacteria | 1227 |
| 614 | Ga0450909_075119 | 3300042185 | Bacteria | 544 |
| 615 | Ga0439434_0003517 | 3300042435 | Bacteria | 4573 |
| 616 | Ga0439434_0015359 | 3300042435 | Bacteria | 2283 |
| 617 | Ga0439434_0033137 | 3300042435 | Bacteria | 1573 |
| 618 | Ga0439434_0226519 | 3300042435 | Bacteria | 635 |
| 619 | Ga0439459_0006177 | 3300042438 | Bacteria | 1989 |
| 620 | Ga0439459_0046862 | 3300042438 | Bacteria | 937 |
| 621 | Ga0439464_0173676 | 3300042439 | Bacteria | 680 |
| 622 | Ga0439460_0085406 | 3300042461 | Bacteria | 996 |
| 623 | Ga0450918_002358 | 3300042531 | Bacteria | 3568 |
| 624 | Ga0450893_0001444 | 3300042532 | Bacteria | 3642 |
| 625 | Ga0450893_0049621 | 3300042532 | Bacteria | 784 |
| 626 | Ga0451577_0358732 | 3300042876 | Bacteria | 1322 |
| 627 | Ga0451577_0828007 | 3300042876 | Bacteria | 835 |
| 628 | Ga0466969_0049691 | 3300044656 | Bacteria | 2068 |
| 629 | Ga0466969_0279328 | 3300044656 | Bacteria | 756 |
| 630 | Ga0466969_0366439 | 3300044656 | Bacteria | 653 |
| 631 | Ga0466972_0099995 | 3300044658 | Bacteria | 1372 |
| 632 | Ga0453683_0001910 | 3300044673 | Bacteria | 17016 |
| 633 | Ga0466965_0071587 | 3300044683 | Bacteria | 1744 |
| 634 | Ga0466966_0005606 | 3300044684 | Bacteria | 8252 |
| 635 | Ga0466966_0200452 | 3300044684 | Bacteria | 1208 |
| 636 | Ga0466966_0384950 | 3300044684 | Bacteria | 843 |
| 637 | Ga0466966_0412938 | 3300044684 | Bacteria | 811 |
| 638 | Ga0466961_0009772 | 3300044693 | Bacteria | 6106 |
| 639 | Ga0466961_0456847 | 3300044693 | Bacteria | 773 |
| 640 | Ga0466961_0797692 | 3300044693 | Bacteria | 564 |
| 641 | Ga0453684_0029736 | 3300044712 | Bacteria | 7744 |
| 642 | Ga0466968_0416519 | 3300044735 | Bacteria | 660 |
| 643 | Ga0466970_0037547 | 3300044765 | Bacteria | 2568 |
| 644 | Ga0466970_0514055 | 3300044765 | Bacteria | 690 |
| 645 | Ga0466957_0061317 | 3300044842 | Bacteria | 2308 |
| 646 | Ga0466957_0746637 | 3300044842 | Bacteria | 693 |
| 647 | Ga0466960_0001088 | 3300044901 | Bacteria | 9760 |
| 648 | Ga0466960_0029132 | 3300044901 | Bacteria | 2531 |
| 649 | Ga0466959_0004682 | 3300045049 | Bacteria | 9207 |
| 650 | Ga0466959_0537711 | 3300045049 | Bacteria | 789 |
| 651 | Ga0466959_0593486 | 3300045049 | Bacteria | 745 |
| 652 | Ga0451576_0000559 | 3300045051 | Bacteria | 79734 |
| 653 | Ga0451576_0010377 | 3300045051 | Bacteria | 10695 |
| 654 | Ga0451576_0058565 | 3300045051 | Bacteria | 4025 |
| 655 | Ga0466958_0058801 | 3300045836 | Bacteria | 2338 |
| 656 | Ga0466958_0164172 | 3300045836 | Bacteria | 1405 |
| 657 | Ga0466967_0280760 | 3300045976 | Bacteria | 1598 |
| 658 | Ga0466967_1861571 | 3300045976 | Bacteria | 599 |
| 659 | Ga0466967_2452211 | 3300045976 | Bacteria | 517 |
| 660 | Ga0495627_031677 | 3300046453 | Bacteria | 1668 |
| 661 | Ga0495592_0473012 | 3300046454 | Bacteria | 782 |
| 662 | Ga0495592_0653312 | 3300046454 | Bacteria | 637 |
| 663 | Ga0495629_0102665 | 3300046459 | Bacteria | 1995 |
| 664 | Ga0495638_0015785 | 3300046460 | Bacteria | 5060 |
| 665 | Ga0495639_0010350 | 3300046475 | Bacteria | 4016 |
| 666 | Ga0495606_0476936 | 3300046507 | Bacteria | 634 |
| 667 | Ga0495610_0020676 | 3300046512 | Bacteria | 3648 |
| 668 | Ga0495616_0009239 | 3300046513 | Bacteria | 5780 |
| 669 | Ga0495620_0009770 | 3300046515 | Bacteria | 5089 |
| 670 | Ga0495628_0354517 | 3300046516 | Bacteria | 1078 |
| 671 | Ga0495630_0387909 | 3300046517 | Bacteria | 1070 |
| 672 | Ga0495631_0001403 | 3300046518 | Bacteria | 14640 |
| 673 | Ga0495637_0014620 | 3300046520 | Bacteria | 3700 |
| 674 | Ga0495642_0006401 | 3300046528 | Bacteria | 4516 |
| 675 | Ga0495654_0028131 | 3300046530 | Bacteria | 2876 |
| 676 | Ga0495609_0051625 | 3300046538 | Bacteria | 1831 |
| 677 | Ga0495621_0002023 | 3300046539 | Bacteria | 5353 |
| 678 | Ga0495621_0022746 | 3300046539 | Bacteria | 2081 |
| 679 | Ga0495621_0271021 | 3300046539 | Bacteria | 698 |
| 680 | Ga0495597_0336747 | 3300046542 | Bacteria | 581 |
| 681 | Ga0495645_0904462 | 3300046543 | Bacteria | 524 |
| 682 | Ga0495622_0099676 | 3300046557 | Bacteria | 1332 |
| 683 | Ga0495633_0002867 | 3300046558 | Bacteria | 11817 |
| 684 | Ga0495633_0390144 | 3300046558 | Bacteria | 630 |
| 685 | Ga0495656_0069410 | 3300046615 | Bacteria | 1561 |
| 686 | Ga0495668_0366149 | 3300046616 | Bacteria | 791 |
| 687 | Ga0495625_0000950 | 3300046660 | Bacteria | 38751 |
| 688 | Ga0495625_0032930 | 3300046660 | Bacteria | 3837 |
| 689 | Ga0495625_0074298 | 3300046660 | Bacteria | 2381 |
| 690 | Ga0495659_0380250 | 3300046664 | Bacteria | 607 |
| 691 | Ga0495588_0048360 | 3300046674 | Bacteria | 2184 |
| 692 | Ga0495588_0053050 | 3300046674 | Bacteria | 2090 |
| 693 | Ga0495658_0104350 | 3300046683 | Bacteria | 1696 |
| 694 | Ga0495624_0250966 | 3300046690 | Bacteria | 1070 |
| 695 | Ga0495670_0119378 | 3300046691 | Bacteria | 1369 |
| 696 | Ga0495670_0377313 | 3300046691 | Bacteria | 765 |
| 697 | Ga0495671_0018988 | 3300046692 | Bacteria | 3640 |
| 698 | Ga0495660_0287649 | 3300046810 | Bacteria | 749 |
| 699 | Ga0495660_0488988 | 3300046810 | Bacteria | 527 |
| 700 | Ga0495636_0148352 | 3300047318 | Bacteria | 1051 |
| 701 | Ga0495676_0031210 | 3300047321 | Bacteria | 4509 |
| 702 | Ga0495677_0242834 | 3300047445 | Bacteria | 704 |
| 703 | Ga0495681_0043623 | 3300047470 | Bacteria | 2161 |
| 704 | Ga0495686_0435546 | 3300047472 | Bacteria | 699 |
| 705 | Ga0495593_0326380 | 3300047673 | Bacteria | 767 |
| 706 | Ga0495602_0774103 | 3300048088 | Bacteria | 646 |
| 707 | Ga0495602_0849131 | 3300048088 | Bacteria | 610 |
| 708 | Ga0495614_0030677 | 3300048089 | Bacteria | 2314 |
| 709 | Ga0495615_0002681 | 3300048090 | Bacteria | 2885 |
| 710 | Ga0496100_0016152 | 3300048903 | Bacteria | 4377 |
| 711 | Ga0496101_0007428 | 3300048904 | Bacteria | 7104 |
| 712 | Ga0496101_0117793 | 3300048904 | Bacteria | 2005 |
| 713 | Ga0496102_0093723 | 3300048905 | Bacteria | 2782 |
| 714 | Ga0496102_0165399 | 3300048905 | Bacteria | 2081 |
| 715 | Ga0496102_0380421 | 3300048905 | Bacteria | 1328 |
| 716 | Ga0496103_0065385 | 3300048906 | Bacteria | 2268 |
| 717 | Ga0496104_0013037 | 3300048907 | Bacteria | 7486 |
| 718 | Ga0496105_0008264 | 3300048908 | Bacteria | 8093 |
| 719 | Ga0496106_0077299 | 3300048909 | Bacteria | 2552 |
| 720 | Ga0496107_0132983 | 3300048910 | Bacteria | 1837 |
| 721 | Ga0496108_0172028 | 3300048911 | Bacteria | 1874 |
| 722 | Ga0496108_0969957 | 3300048911 | Bacteria | 727 |
| 723 | Ga0496109_0273958 | 3300048912 | Bacteria | 1590 |
| 724 | Ga0496109_1238728 | 3300048912 | Bacteria | 682 |
| 725 | Ga0496110_0156828 | 3300048913 | Bacteria | 2062 |
| 726 | Ga0496111_0256807 | 3300048914 | Bacteria | 1297 |
| 727 | Ga0496114_0084455 | 3300048917 | Bacteria | 2688 |
| 728 | Ga0496114_0706236 | 3300048917 | Bacteria | 884 |
| 729 | Ga0496116_0033637 | 3300048919 | Bacteria | 3634 |
| 730 | Ga0496117_0015780 | 3300048920 | Bacteria | 6412 |
| 731 | Ga0496117_0037087 | 3300048920 | Bacteria | 3636 |
| 732 | Ga0496117_0264277 | 3300048920 | Bacteria | 931 |
| 733 | Ga0496118_0021075 | 3300048921 | Bacteria | 5752 |
| 734 | Ga0496118_0039565 | 3300048921 | Bacteria | 3760 |
| 735 | Ga0496118_0585427 | 3300048921 | Bacteria | 537 |
| 736 | Ga0496121_0111561 | 3300048924 | Bacteria | 2085 |
| 737 | Ga0496121_0286394 | 3300048924 | Bacteria | 1124 |
| 738 | Ga0496121_0687878 | 3300048924 | Bacteria | 617 |
| 739 | Ga0496122_0000612 | 3300048925 | Bacteria | 73307 |
| 740 | Ga0496122_0063771 | 3300048925 | Bacteria | 2686 |
| 741 | Ga0496122_0138791 | 3300048925 | Bacteria | 1525 |
| 742 | Ga0496122_0246728 | 3300048925 | Bacteria | 1002 |
| 743 | Ga0496122_0530445 | 3300048925 | Bacteria | 565 |
| 744 | Ga0496123_0000274 | 3300048926 | Bacteria | 101783 |
| 745 | Ga0496123_0089931 | 3300048926 | Bacteria | 1827 |
| 746 | Ga0496123_0423655 | 3300048926 | Bacteria | 599 |
| 747 | Ga0496124_0032035 | 3300048927 | Bacteria | 4649 |
| 748 | Ga0496124_0077684 | 3300048927 | Bacteria | 2737 |
| 749 | Ga0496124_0168032 | 3300048927 | Bacteria | 1702 |
| 750 | Ga0496124_0337340 | 3300048927 | Bacteria | 1072 |
| 751 | Ga0496124_0466726 | 3300048927 | Bacteria | 856 |
| 752 | Ga0496125_0001638 | 3300048928 | Bacteria | 31567 |
| 753 | Ga0496125_0033897 | 3300048928 | Bacteria | 4510 |
| 754 | Ga0496125_0036908 | 3300048928 | Bacteria | 4257 |
| 755 | Ga0496125_0132219 | 3300048928 | Bacteria | 1754 |
| 756 | Ga0496125_0158301 | 3300048928 | Bacteria | 1543 |
| 757 | Ga0496125_0320160 | 3300048928 | Bacteria | 941 |
| 758 | Ga0496126_0133652 | 3300048929 | Bacteria | 2142 |
| 759 | Ga0496126_0178471 | 3300048929 | Bacteria | 1805 |
| 760 | Ga0496126_0479461 | 3300048929 | Bacteria | 997 |
| 761 | Ga0495678_106703 | 3300049459 | Bacteria | 962 |
| 762 | Ga0501031_0353708 | 3300049568 | Bacteria | 951 |
| 763 | Ga0501032_0156858 | 3300049569 | Bacteria | 1495 |
| 764 | Ga0501033_0056838 | 3300049570 | Bacteria | 2892 |
| 765 | Ga0501034_0053289 | 3300049571 | Bacteria | 4074 |
| 766 | Ga0501036_0372060 | 3300049572 | Bacteria | 1193 |
| 767 | Ga0501037_0060577 | 3300049573 | Bacteria | 2761 |
| 768 | Ga0501038_0516179 | 3300049574 | Bacteria | 912 |
| 769 | Ga0501039_0757851 | 3300049575 | Bacteria | 758 |
| 770 | Ga0501043_0115453 | 3300049579 | Bacteria | 2107 |
| 771 | Ga0501046_0307583 | 3300049580 | Bacteria | 1156 |
| 772 | Ga0501047_0083028 | 3300049581 | Bacteria | 3079 |
| 773 | Ga0501047_0299824 | 3300049581 | Bacteria | 1450 |
| 774 | Ga0501073_0467381 | 3300049589 | Bacteria | 872 |
| 775 | Ga0501073_0651054 | 3300049589 | Bacteria | 727 |
| 776 | Ga0501202_093042 | 3300049652 | Bacteria | 724 |
| 777 | Ga0501217_237112 | 3300049661 | Bacteria | 583 |
| 778 | Ga0501222_007776 | 3300049662 | Bacteria | 1430 |
| 779 | Ga0501223_043000 | 3300049663 | Bacteria | 877 |
| 780 | Ga0501227_086972 | 3300049665 | Bacteria | 823 |
| 781 | Ga0501249_004009 | 3300049679 | Bacteria | 2978 |
| 782 | Ga0501250_087720 | 3300049680 | Bacteria | 538 |
| 783 | Ga0501257_100559 | 3300049686 | Bacteria | 759 |
| 784 | Ga0501225_0007716 | 3300049705 | Bacteria | 3114 |
| 785 | Ga0501080_0014745 | 3300049742 | Bacteria | 7197 |
| 786 | Ga0501083_0335777 | 3300049744 | Bacteria | 983 |
| 787 | Ga0501241_010478 | 3300049758 | Bacteria | 1686 |
| 788 | Ga0501262_000513 | 3300049759 | Bacteria | 4596 |
| 789 | Ga0501263_019471 | 3300049760 | Bacteria | 904 |
| 790 | Ga0501268_122528 | 3300049765 | Bacteria | 578 |
| 791 | Ga0501276_034326 | 3300049773 | Bacteria | 543 |
| 792 | Ga0501279_084610 | 3300049775 | Bacteria | 552 |
| 793 | Ga0501035_0031308 | 3300049822 | Bacteria | 4845 |
| 794 | Ga0501035_0373786 | 3300049822 | Bacteria | 1189 |
| 795 | Ga0501044_0060322 | 3300049823 | Bacteria | 3884 |
| 796 | Ga0501044_0935345 | 3300049823 | Bacteria | 740 |
| 797 | nmdc:mga03683_11246_c1 | 3300050489 | Bacteria | 2199 |
| 798 | nmdc:mga03683_123766_c1 | 3300050489 | Bacteria | 1152 |
| 799 | nmdc:mga03683_166557_c1 | 3300050489 | Bacteria | 1000 |
| 800 | nmdc:mga03683_22662_c1 | 3300050489 | Bacteria | 2437 |
| 801 | nmdc:mga03683_406521_c1 | 3300050489 | Bacteria | 651 |
| 802 | nmdc:mga03683_413827_c1 | 3300050489 | Bacteria | 645 |
| 803 | nmdc:mga03683_97770_c1 | 3300050489 | Bacteria | 1287 |
| 804 | nmdc:mga03n38_144487_c1 | 3300050490 | Bacteria | 1191 |
| 805 | nmdc:mga03n38_176977_c1 | 3300050490 | Bacteria | 1091 |
| 806 | nmdc:mga03n38_20471_c1 | 3300050490 | Bacteria | 2647 |
| 807 | nmdc:mga03n38_232587_c1 | 3300050490 | Bacteria | 967 |
| 808 | nmdc:mga00v17_12651_c1 | 3300050491 | Bacteria | 4660 |
| 809 | nmdc:mga00v17_36016_c1 | 3300050491 | Bacteria | 2948 |
| 810 | nmdc:mga00v17_365046_c1 | 3300050491 | Bacteria | 939 |
| 811 | nmdc:mga0yw44_171054_c1 | 3300050492 | Bacteria | 1426 |
| 812 | nmdc:mga0yw44_240572_c1 | 3300050492 | Bacteria | 1203 |
| 813 | nmdc:mga0yw44_307585_c1 | 3300050492 | Bacteria | 1063 |
| 814 | nmdc:mga0yw44_375349_c1 | 3300050492 | Bacteria | 960 |
| 815 | nmdc:mga0yw44_537366_c1 | 3300050492 | Bacteria | 794 |
| 816 | nmdc:mga0k408_103583_c1 | 3300050493 | Bacteria | 1679 |
| 817 | nmdc:mga0k408_158161_c1 | 3300050493 | Bacteria | 1350 |
| 818 | nmdc:mga0k408_166660_c1 | 3300050493 | Bacteria | 1313 |
| 819 | nmdc:mga0k408_22290_c1 | 3300050493 | Bacteria | 3566 |
| 820 | nmdc:mga0k408_28590_c1 | 3300050493 | Bacteria | 3170 |
| 821 | nmdc:mga0k408_738_c1 | 3300050493 | Bacteria | 8286 |
| 822 | nmdc:mga0k408_761577_c1 | 3300050493 | Bacteria | 565 |
| 823 | nmdc:mga0k408_7755_c1 | 3300050493 | Bacteria | 5739 |
| 824 | nmdc:mga0k408_9853_c2 | 3300050493 | Bacteria | 2373 |
| 825 | nmdc:mga06z11_160996_c1 | 3300050494 | Bacteria | 1283 |
| 826 | nmdc:mga06z11_396102_c1 | 3300050494 | Bacteria | 831 |
| 827 | nmdc:mga06z11_80956_c1 | 3300050494 | Bacteria | 1742 |
| 828 | nmdc:mga07m45_108489_c1 | 3300050496 | Bacteria | 1597 |
| 829 | nmdc:mga07m45_155597_c1 | 3300050496 | Bacteria | 1326 |
| 830 | nmdc:mga07m45_22375_c1 | 3300050496 | Bacteria | 3450 |
| 831 | nmdc:mga07m45_23384_c1 | 3300050496 | Bacteria | 3378 |
| 832 | nmdc:mga07m45_264321_c1 | 3300050496 | Bacteria | 1001 |
| 833 | nmdc:mga07m45_28633_c1 | 3300050496 | Bacteria | 3075 |
| 834 | nmdc:mga07m45_326734_c1 | 3300050496 | Bacteria | 892 |
| 835 | nmdc:mga07m45_397530_c1 | 3300050496 | Bacteria | 800 |
| 836 | nmdc:mga07m45_3986_c1 | 3300050496 | Bacteria | 7179 |
| 837 | nmdc:mga07m45_548386_c1 | 3300050496 | Bacteria | 669 |
| 838 | nmdc:mga07m45_8729_c1 | 3300050496 | Bacteria | 5222 |
| 839 | nmdc:mga09592_196814_c1 | 3300050508 | Bacteria | 1745 |
| 840 | nmdc:mga0qj67_245762_c1 | 3300050509 | Bacteria | 1452 |
| 841 | nmdc:mga06r32_1124761_c1 | 3300050510 | Bacteria | 734 |
| 842 | nmdc:mga0sz30_145677_c1 | 3300050516 | Bacteria | 1046 |
| 843 | nmdc:mga0sz30_24531_c1 | 3300050516 | Bacteria | 1932 |
| 844 | nmdc:mga0sz30_394199_c1 | 3300050516 | Bacteria | 620 |
| 845 | Ga0495612_0489445 | 3300053078 | Bacteria | 564 |
| 846 | Ga0500610_0060324 | 3300053079 | Bacteria | 1979 |
| 847 | Ga0500610_0104821 | 3300053079 | Bacteria | 1459 |
| 848 | Ga0500643_011950 | 3300053087 | Bacteria | 3134 |
| 849 | Ga0500643_014775 | 3300053087 | Bacteria | 2698 |
| 850 | Ga0500651_0008924 | 3300053093 | Bacteria | 5930 |
| 851 | Ga0500651_0035169 | 3300053093 | Bacteria | 3158 |
| 852 | Ga0500566_0129632 | 3300053094 | Bacteria | 1351 |
| 853 | Ga0500641_0177406 | 3300053096 | Bacteria | 915 |
| 854 | Ga0500555_073697 | 3300053103 | Bacteria | 897 |
| 855 | Ga0500571_007027 | 3300053110 | Bacteria | 6106 |
| 856 | Ga0500572_043135 | 3300053111 | Bacteria | 1317 |
| 857 | Ga0500593_008356 | 3300053117 | Bacteria | 4248 |
| 858 | Ga0500594_0002788 | 3300053118 | Bacteria | 3805 |
| 859 | Ga0500594_0003939 | 3300053118 | Bacteria | 3270 |
| 860 | Ga0500607_008438 | 3300053121 | Bacteria | 6268 |
| 861 | Ga0500608_182094 | 3300053122 | Bacteria | 888 |
| 862 | Ga0500626_021831 | 3300053128 | Bacteria | 2858 |
| 863 | Ga0500628_051806 | 3300053129 | Bacteria | 976 |
| 864 | Ga0500655_000855 | 3300053133 | Bacteria | 5917 |
| 865 | Ga0500658_0074236 | 3300053134 | Bacteria | 1441 |
| 866 | Ga0500559_0006052 | 3300053136 | Bacteria | 5485 |
| 867 | Ga0500559_0031588 | 3300053136 | Bacteria | 2272 |
| 868 | Ga0500564_018419 | 3300053138 | Bacteria | 3184 |
| 869 | Ga0500573_0268522 | 3300053140 | Bacteria | 869 |
| 870 | Ga0500574_056804 | 3300053141 | Bacteria | 1129 |
| 871 | Ga0500577_0382880 | 3300053142 | Bacteria | 615 |
| 872 | Ga0500604_0107760 | 3300053151 | Bacteria | 923 |
| 873 | Ga0500604_0164307 | 3300053151 | Bacteria | 757 |
| 874 | Ga0500616_0004050 | 3300053153 | Bacteria | 10655 |
| 875 | Ga0500620_171538 | 3300053155 | Bacteria | 750 |
| 876 | Ga0500627_0006594 | 3300053158 | Bacteria | 3968 |
| 877 | Ga0500627_0282291 | 3300053158 | Bacteria | 728 |
| 878 | Ga0500633_0366922 | 3300053160 | Bacteria | 523 |
| 879 | Ga0500634_0023270 | 3300053161 | Bacteria | 3367 |
| 880 | Ga0500634_0039635 | 3300053161 | Bacteria | 2561 |
| 881 | Ga0500634_0213995 | 3300053161 | Bacteria | 834 |
| 882 | Ga0500638_003554 | 3300053162 | Bacteria | 5793 |
| 883 | Ga0500625_085942 | 3300053729 | Bacteria | 1360 |
| 884 | Ga0500596_010039 | 3300053735 | Bacteria | 1469 |
| 885 | Ga0587108_013452 | 3300059653 | Bacteria | 719 |
| 886 | 2644071422 | 2643221611 | Bacteria | 6820941 |
| 887 | 2885196975 | 2885192300 | Bacteria | 5882526 |
| 888 | 2932424005 | 2932422444 | Bacteria | 4678430 |
| 889 | Ga0439439_0043177 | |||
| 890 | SwRhRL2b_contig_1139595 | |||
| 891 | JGI24741J21665_1026264 | |||
| 892 | JGI24740J21852_10013300 | |||
| 893 | JGI24739J22299_10005889 | |||
| 894 | JGI24739J22299_10032128 | |||
| 895 | JGI25152J39213_1005621 | |||
| 896 | JGI25152J39213_1010919 | |||
| 897 | JGI25152J39213_1021101 | |||
| 898 | JGI25150J39212_1015355 | |||
| 899 | JGI25150J39212_1023691 | |||
| 900 | JGI25159J45721_1006067 | |||
| 901 | JGI25159J45721_1024264 | |||
| 902 | JGI25151J46595_10001069 | |||
| 903 | JGI25151J46595_10001564 | |||
| 904 | JGI25151J46595_10041641 | |||
| 905 | JGI25151J46595_10046740 | |||
| 906 | JGI25153J46596_10012731 | |||
| 907 | JGI25153J46596_10038296 | |||
| 908 | rootH1_10026301 | |||
| 909 | rootH2_10161433 | |||
| 910 | rootL2_10066366 | |||
| 911 | rootH1_10052402 | |||
| 912 | JGI25160J50197_1009111 | |||
| 913 | JGI25160J50197_1028168 | |||
| 914 | JGI25161J50226_1001273 | |||
| 915 | JGI25161J50226_1011521 | |||
| 916 | Ga0006562J51391_1005968 | |||
| 917 | Ga0006562J51391_1022798 | |||
| 918 | Ga0006562J51391_1022801 | |||
| 919 | Ga0055527_1013703 | |||
| 920 | Ga0055535_1001110 | |||
| 921 | Ga0055542_1000080 | |||
| 922 | Ga0055526_1030637 | |||
| 923 | Ga0055526_1037136 | |||
| 924 | Ga0055537_1000150 | |||
| 925 | Ga0055537_1003893 | |||
| 926 | Ga0055537_1013649 | |||
| 927 | Ga0055524_1028031 | |||
| 928 | Ga0055524_1037663 | |||
| 929 | Ga0055536_1010350 | |||
| 930 | Ga0055536_1014050 | |||
| 931 | Ga0055536_1017459 | |||
| 932 | Ga0055536_1018282 | |||
| 933 | Ga0055536_1048769 | |||
| 934 | Ga0055534_1000016 | |||
| 935 | Ga0055534_1007358 | |||
| 936 | Ga0055534_1022159 | |||
| 937 | Ga0055534_1032462 | |||
| 938 | Ga0055528_1000894 | |||
| 939 | Ga0055528_1009649 | |||
| 940 | Ga0055528_1028958 | |||
| 941 | Ga0055530_10002826 | |||
| 942 | Ga0055530_10005609 | |||
| 943 | Ga0055540_1001247 | |||
| 944 | Ga0055540_1006304 | |||
| 945 | Ga0055540_1008300 | |||
| 946 | Ga0055540_1010102 | |||
| 947 | Ga0055540_1024557 | |||
| 948 | Ga0055540_1028493 | |||
| 949 | Ga0055540_1043556 | |||
| 950 | Ga0055531_10000257 | |||
| 951 | Ga0055531_10013583 | |||
| 952 | Ga0055531_10043153 | |||
| 953 | Ga0055531_10043197 | |||
| 954 | Ga0055543_1004453 | |||
| 955 | Ga0055543_1012039 | |||
| 956 | Ga0065165_1022212 | |||
| 957 | Ga0065165_1084303 | |||
| 958 | Ga0065714_10003179 | |||
| 959 | Ga0065714_10020540 | |||
| 960 | Ga0065704_10098136 | |||
| 961 | Ga0065704_10150792 | |||
| 962 | Ga0065704_10194160 | |||
| 963 | Ga0070658_10150835 | |||
| 964 | Ga0070658_10195232 | |||
| 965 | Ga0070658_10238409 | |||
| 966 | Ga0070658_10553014 | |||
| 967 | Ga0070658_10612725 | |||
| 968 | Ga0070676_10403174 | |||
| 969 | Ga0070676_10952606 | |||
| 970 | Ga0070676_11060213 | |||
| 971 | Ga0070677_10371826 | |||
| 972 | Ga0068869_100358093 | |||
| 973 | Ga0068869_100909658 | |||
| 974 | Ga0070680_100182847 | |||
| 975 | Ga0068868_101196025 | |||
| 976 | Ga0070660_100112312 | |||
| 977 | Ga0070660_101101614 | |||
| 978 | Ga0070668_100133718 | |||
| 979 | Ga0070669_100142848 | |||
| 980 | Ga0070675_100110942 | |||
| 981 | Ga0070675_100286798 | |||
| 982 | Ga0070671_100698192 | |||
| 983 | Ga0070674_100108262 | |||
| 984 | Ga0070674_102031511 | |||
| 985 | Ga0070673_100176030 | |||
| 986 | Ga0070673_100227738 | |||
| 987 | Ga0070673_100567129 | |||
| 988 | Ga0070688_101805254 | |||
| 989 | Ga0070659_100144962 | |||
| 990 | Ga0070659_100272375 | |||
| 991 | Ga0070667_100055014 | |||
| 992 | Ga0070667_101352748 | |||
| 993 | Ga0070714_100065548 | |||
| 994 | Ga0070678_100078732 | |||
| 995 | Ga0070678_100117703 | |||
| 996 | Ga0070678_100136554 | |||
| 997 | Ga0070678_100188117 | |||
| 998 | Ga0070678_100241016 | |||
| 999 | Ga0070678_101381302 | |||
| 1000 | Ga0070662_100018575 | |||
| 1001 | Ga0070662_100127535 | |||
| 1002 | Ga0068867_100655319 | |||
| 1003 | Ga0068867_100740580 | |||
| 1004 | Ga0068867_101894647 | |||
| 1005 | Ga0070679_100041543 | |||
| 1006 | Ga0070679_100144338 | |||
| 1007 | Ga0070684_101847280 | |||
| 1008 | Ga0068853_100163721 | |||
| 1009 | Ga0068853_100527782 | |||
| 1010 | Ga0068853_100645953 | |||
| 1011 | Ga0068853_100757762 | |||
| 1012 | Ga0070672_100253317 | |||
| 1013 | Ga0070665_100024013 | |||
| 1014 | Ga0070665_100162313 | |||
| 1015 | Ga0070665_100510248 | |||
| 1016 | Ga0070665_100580640 | |||
| 1017 | Ga0070665_102025120 | |||
| 1018 | Ga0068855_100006806 | |||
| 1019 | Ga0068855_100163186 | |||
| 1020 | Ga0068855_100329547 | |||
| 1021 | Ga0070664_100008507 | |||
| 1022 | Ga0070664_102046068 | |||
| 1023 | Ga0068857_100231554 | |||
| 1024 | Ga0068857_100848605 | |||
| 1025 | Ga0068857_101168081 | |||
| 1026 | Ga0068854_100068140 | |||
| 1027 | Ga0068854_100907765 | |||
| 1028 | Ga0068852_100169742 | |||
| 1029 | Ga0068851_10029330 | |||
| 1030 | Ga0068870_10920240 | |||
| 1031 | Ga0068858_101197000 | |||
| 1032 | Ga0068862_100105979 | |||
| 1033 | Ga0075365_10004543 | |||
| 1034 | Ga0075365_10011938 | |||
| 1035 | Ga0075365_10023104 | |||
| 1036 | Ga0075365_10024567 | |||
| 1037 | Ga0075365_10166075 | |||
| 1038 | Ga0075365_10343725 | |||
| 1039 | Ga0075365_10386338 | |||
| 1040 | Ga0075368_10282316 | |||
| 1041 | Ga0075363_100007676 | |||
| 1042 | Ga0075363_100070252 | |||
| 1043 | Ga0075363_100217430 | |||
| 1044 | Ga0075363_100408512 | |||
| 1045 | Ga0075364_10001078 | |||
| 1046 | Ga0075364_10298992 | |||
| 1047 | Ga0075432_10001601 | |||
| 1048 | Ga0075432_10005352 | |||
| 1049 | Ga0075362_10043861 | |||
| 1050 | Ga0075362_10047496 | |||
| 1051 | Ga0075362_10139559 | |||
| 1052 | Ga0075362_10152965 | |||
| 1053 | Ga0075362_10327870 | |||
| 1054 | Ga0075362_10579740 | |||
| 1055 | Ga0075362_10586143 | |||
| 1056 | Ga0075367_10027246 | |||
| 1057 | Ga0075367_10086295 | |||
| 1058 | Ga0075367_10100772 | |||
| 1059 | Ga0075367_10231618 | |||
| 1060 | Ga0075367_10343297 | |||
| 1061 | Ga0075369_10335295 | |||
| 1062 | Ga0075366_10002010 | |||
| 1063 | Ga0075366_10003520 | |||
| 1064 | Ga0075366_10009938 | |||
| 1065 | Ga0075366_10034637 | |||
| 1066 | Ga0075366_10057553 | |||
| 1067 | Ga0075366_10100825 | |||
| 1068 | Ga0097621_100175436 | |||
| 1069 | Ga0097621_102158638 | |||
| 1070 | Ga0075370_10000304 | |||
| 1071 | Ga0075370_10005111 | |||
| 1072 | Ga0075370_10014472 | |||
| 1073 | Ga0075370_10015729 | |||
| 1074 | Ga0075370_10020002 | |||
| 1075 | Ga0075370_10110612 | |||
| 1076 | Ga0075370_10124227 | |||
| 1077 | Ga0075370_10144188 | |||
| 1078 | Ga0075370_10250007 | |||
| 1079 | Ga0075370_10422826 | |||
| 1080 | Ga0075370_10515906 | |||
| 1081 | Ga0075370_10751826 | |||
| 1082 | Ga0068871_101579579 | |||
| 1083 | Ga0075430_100069245 | |||
| 1084 | Ga0075431_100579867 | |||
| 1085 | Ga0075429_100177102 | |||
| 1086 | Ga0068865_100951286 | |||
| 1087 | Ga0079104_1025289 | |||
| 1088 | Ga0099826_10000101 | |||
| 1089 | Ga0099826_10109187 | |||
| 1090 | Ga0105244_10049588 | |||
| 1091 | Ga0105244_10271625 | |||
| 1092 | Ga0105244_10473373 | |||
| 1093 | Ga0105240_10008945 | |||
| 1094 | Ga0105240_10104606 | |||
| 1095 | Ga0105240_10217744 | |||
| 1096 | Ga0105245_10180345 | |||
| 1097 | Ga0105245_10655149 | |||
| 1098 | Ga0105245_11059773 | |||
| 1099 | Ga0105245_12239086 | |||
| 1100 | Ga0105243_10036791 | |||
| 1101 | Ga0105243_10037344 | |||
| 1102 | Ga0105243_10726453 | |||
| 1103 | Ga0105243_11030141 | |||
| 1104 | Ga0105241_10554815 | |||
| 1105 | Ga0105242_10001936 | |||
| 1106 | Ga0105242_10410881 | |||
| 1107 | Ga0105242_10422116 | |||
| 1108 | Ga0105242_10455396 | |||
| 1109 | Ga0105237_10393687 | |||
| 1110 | Ga0105237_11603970 | |||
| 1111 | Ga0105238_10005849 | |||
| 1112 | Ga0105238_10385391 | |||
| 1113 | Ga0105238_10506597 | |||
| 1114 | Ga0105249_11017161 | |||
| 1115 | Ga0105239_10105208 | |||
| 1116 | Ga0105239_10775322 | |||
| 1117 | Ga0105239_11669661 | |||
| 1118 | Ga0105246_10111217 | |||
| 1119 | Ga0105246_10154807 | |||
| 1120 | Ga0105246_11161716 | |||
| 1121 | Ga0157322_1033385 | |||
| 1122 | Ga0157347_1033560 | |||
| 1123 | Ga0157339_1017976 | |||
| 1124 | Ga0157373_10031485 | |||
| 1125 | Ga0157373_10145760 | |||
| 1126 | Ga0157373_10187275 | |||
| 1127 | Ga0157373_10292037 | |||
| 1128 | Ga0157373_10462388 | |||
| 1129 | Ga0157371_10347860 | |||
| 1130 | Ga0157370_10006343 | |||
| 1131 | Ga0157370_10577168 | |||
| 1132 | Ga0157370_10828426 | |||
| 1133 | Ga0157370_10918275 | |||
| 1134 | Ga0157370_11218174 | |||
| 1135 | Ga0157369_10008807 | |||
| 1136 | Ga0157374_10277529 | |||
| 1137 | Ga0157374_11426807 | |||
| 1138 | Ga0163162_10296582 | |||
| 1139 | Ga0157372_10568359 | |||
| 1140 | Ga0157372_12350477 | |||
| 1141 | Ga0157375_10156318 | |||
| 1142 | Ga0157375_10213056 | |||
| 1143 | Ga0157375_11688974 | |||
| 1144 | Ga0182008_10001806 | |||
| 1145 | Ga0182008_10005163 | |||
| 1146 | Ga0182008_10020210 | |||
| 1147 | Ga0182008_10183987 | |||
| 1148 | Ga0182008_10221844 | |||
| 1149 | Ga0157377_11321952 | |||
| 1150 | Ga0157376_10186194 | |||
| 1151 | Ga0157376_10998306 | |||
| 1152 | Ga0157376_12562524 | |||
| 1153 | Ga0182006_1005907 | |||
| 1154 | Ga0182006_1041115 | |||
| 1155 | Ga0182006_1157628 | |||
| 1156 | Ga0182006_1323034 | |||
| 1157 | Ga0182007_10004286 | |||
| 1158 | Ga0182007_10015525 | |||
| 1159 | Ga0182007_10051471 | |||
| 1160 | Ga0182005_1042401 | |||
| 1161 | Ga0182005_1139173 | |||
| 1162 | Ga0182005_1155222 | |||
| 1163 | Ga0183362_10003 | |||
| 1164 | Ga0163161_10001428 | |||
| 1165 | Ga0163161_10001866 | |||
| 1166 | Ga0163161_10011965 | |||
| 1167 | Ga0163161_10033986 | |||
| 1168 | Ga0163161_10135200 | |||
| 1169 | Ga0163161_10468120 | |||
| 1170 | Ga0163161_10681605 | |||
| 1171 | Ga0163161_11387551 | |||
| 1172 | Ga0163161_11496708 | |||
| 1173 | Ga0213872_10067622 | |||
| 1174 | Ga0209672_100378 | |||
| 1175 | Ga0209147_100696 | |||
| 1176 | Ga0209258_100093 | |||
| 1177 | Ga0207425_1003154 | |||
| 1178 | Ga0207425_1037790 | |||
| 1179 | Ga0209148_1000007 | |||
| 1180 | Ga0209129_1000024 | |||
| 1181 | Ga0209129_1005316 | |||
| 1182 | Ga0209129_1006968 | |||
| 1183 | Ga0209129_1009656 | |||
| 1184 | Ga0209129_1012142 | |||
| 1185 | Ga0209565_1000098 | |||
| 1186 | Ga0209565_1000633 | |||
| 1187 | Ga0209565_1003729 | |||
| 1188 | Ga0209673_1000058 | |||
| 1189 | Ga0209673_1001185 | |||
| 1190 | Ga0209673_1002178 | |||
| 1191 | Ga0209673_1021052 | |||
| 1192 | Ga0209673_1082175 | |||
| 1193 | Ga0209673_1124279 | |||
| 1194 | Ga0209130_1001692 | |||
| 1195 | Ga0209130_1018535 | |||
| 1196 | Ga0209130_1041871 | |||
| 1197 | Ga0209675_1000010 | |||
| 1198 | Ga0209675_1000151 | |||
| 1199 | Ga0209675_1000431 | |||
| 1200 | Ga0209675_1001858 | |||
| 1201 | Ga0209676_1000028 | |||
| 1202 | Ga0209676_1000333 | |||
| 1203 | Ga0209676_1002526 | |||
| 1204 | Ga0209676_1005042 | |||
| 1205 | Ga0209676_1008655 | |||
| 1206 | Ga0209676_1045505 | |||
| 1207 | Ga0209676_1054226 | |||
| 1208 | Ga0209025_1000289 | |||
| 1209 | Ga0209025_1000685 | |||
| 1210 | Ga0209025_1004578 | |||
| 1211 | Ga0209025_1008279 | |||
| 1212 | Ga0209025_1008530 | |||
| 1213 | Ga0209025_1016710 | |||
| 1214 | Ga0209564_1000209 | |||
| 1215 | Ga0209564_1002281 | |||
| 1216 | Ga0209564_1027576 | |||
| 1217 | Ga0209564_1028299 | |||
| 1218 | Ga0209758_1000049 | |||
| 1219 | Ga0209758_1027337 | |||
| 1220 | Ga0209050_1000072 | |||
| 1221 | Ga0209050_1000721 | |||
| 1222 | Ga0209050_1000927 | |||
| 1223 | Ga0209050_1024101 | |||
| 1224 | Ga0209050_1032889 | |||
| 1225 | Ga0209256_1000088 | |||
| 1226 | Ga0209256_1017360 | |||
| 1227 | Ga0209256_1023416 | |||
| 1228 | Ga0207426_1000038 | |||
| 1229 | Ga0207426_1000053 | |||
| 1230 | Ga0209051_1000015 | |||
| 1231 | Ga0209051_1000025 | |||
| 1232 | Ga0209051_1000056 | |||
| 1233 | Ga0209051_1000424 | |||
| 1234 | Ga0209051_1000545 | |||
| 1235 | Ga0209051_1000757 | |||
| 1236 | Ga0209051_1004866 | |||
| 1237 | Ga0209051_1045133 | |||
| 1238 | Ga0209257_1000039 | |||
| 1239 | Ga0209257_1003278 | |||
| 1240 | Ga0209257_1003691 | |||
| 1241 | Ga0209257_1004686 | |||
| 1242 | Ga0209257_1024960 | |||
| 1243 | Ga0207656_10025888 | |||
| 1244 | Ga0207655_1009225 | |||
| 1245 | Ga0207688_10951891 | |||
| 1246 | Ga0207647_10259423 | |||
| 1247 | Ga0207645_10466030 | |||
| 1248 | Ga0207705_10119461 | |||
| 1249 | Ga0207705_10190402 | |||
| 1250 | Ga0207705_10191968 | |||
| 1251 | Ga0207705_10344520 | |||
| 1252 | Ga0207705_10374570 | |||
| 1253 | Ga0207705_10670440 | |||
| 1254 | Ga0207707_10122443 | |||
| 1255 | Ga0207695_10216190 | |||
| 1256 | Ga0207695_10330904 | |||
| 1257 | Ga0207671_10025637 | |||
| 1258 | Ga0207657_10038921 | |||
| 1259 | Ga0207657_10552566 | |||
| 1260 | Ga0207657_10887746 | |||
| 1261 | Ga0207657_10922875 | |||
| 1262 | Ga0207649_11599179 | |||
| 1263 | Ga0207652_10048380 | |||
| 1264 | Ga0207652_11169647 | |||
| 1265 | Ga0207681_10100764 | |||
| 1266 | Ga0207694_10009970 | |||
| 1267 | Ga0207694_10367641 | |||
| 1268 | Ga0207659_10248065 | |||
| 1269 | Ga0207687_10097625 | |||
| 1270 | Ga0207687_10450402 | |||
| 1271 | Ga0207687_10909488 | |||
| 1272 | Ga0207690_10153252 | |||
| 1273 | Ga0207690_10305274 | |||
| 1274 | Ga0207706_10019114 | |||
| 1275 | Ga0207686_10021874 | |||
| 1276 | Ga0207686_10344627 | |||
| 1277 | Ga0207709_10000958 | |||
| 1278 | Ga0207709_10001025 | |||
| 1279 | Ga0207709_10058565 | |||
| 1280 | Ga0207709_11446482 | |||
| 1281 | Ga0207669_10153012 | |||
| 1282 | Ga0207669_11194577 | |||
| 1283 | Ga0207669_11287390 | |||
| 1284 | Ga0207691_10183575 | |||
| 1285 | Ga0207691_10465680 | |||
| 1286 | Ga0207691_10518676 | |||
| 1287 | Ga0207689_10401036 | |||
| 1288 | Ga0207679_10249310 | |||
| 1289 | Ga0207667_10044142 | |||
| 1290 | Ga0207667_10271972 | |||
| 1291 | Ga0207667_10442505 | |||
| 1292 | Ga0207651_10191923 | |||
| 1293 | Ga0207651_10874111 | |||
| 1294 | Ga0207651_11562231 | |||
| 1295 | Ga0207712_11194328 | |||
| 1296 | Ga0207640_10277130 | |||
| 1297 | Ga0207640_10818682 | |||
| 1298 | Ga0207658_10480905 | |||
| 1299 | Ga0207658_11051644 | |||
| 1300 | Ga0207703_11399255 | |||
| 1301 | Ga0207639_10062155 | |||
| 1302 | Ga0207639_10442979 | |||
| 1303 | Ga0207639_10559538 | |||
| 1304 | Ga0207639_10622354 | |||
| 1305 | Ga0207639_11035979 | |||
| 1306 | Ga0207678_10131083 | |||
| 1307 | Ga0207702_11370509 | |||
| 1308 | Ga0207648_10906197 | |||
| 1309 | Ga0207648_11713992 | |||
| 1310 | Ga0207674_10087595 | |||
| 1311 | Ga0207674_10362219 | |||
| 1312 | Ga0207683_10043646 | |||
| 1313 | Ga0207683_10156580 | |||
| 1314 | Ga0207683_10201423 | |||
| 1315 | Ga0207683_10390270 | |||
| 1316 | Ga0207683_10511563 | |||
| 1317 | Ga0207683_11242106 | |||
| 1318 | Ga0207698_10675695 | |||
| 1319 | Ga0209281_1039412 | |||
| 1320 | Ga0209968_1026886 | |||
| 1321 | Ga0209982_1033270 | |||
| 1322 | Ga0209970_1000036 | |||
| 1323 | Ga0209282_1000785 | |||
| 1324 | Ga0209971_1023805 | |||
| 1325 | Ga0209813_10047942 | |||
| 1326 | Ga0209974_10004079 | |||
| 1327 | Ga0209974_10013668 | |||
| 1328 | Ga0209974_10094486 | |||
| 1329 | Ga0207428_10081162 | |||
| 1330 | Ga0207428_10200482 | |||
| 1331 | Ga0268266_10013081 | |||
| 1332 | Ga0268266_10483141 | |||
| 1333 | Ga0268266_11535685 | |||
| 1334 | Ga0268265_10102366 | |||
| 1335 | Ga0307515_10004716 | |||
| 1336 | Ga0307515_10296335 | |||
| 1337 | Ga0307512_10215614 | |||
| 1338 | Ga0316177_1085660 | |||
| 1339 | Ga0316177_1120923 | |||
| 1340 | Ga0316176_1044943 | |||
| 1341 | Ga0314311_1181387 | |||
| 1342 | Ga0316183_1046501 | |||
| 1343 | Ga0316181_1019721 | |||
| 1344 | Ga0316182_1247982 | |||
| 1345 | Ga0316182_1441726 | |||
| 1346 | Ga0265332_10292800 | |||
| 1347 | Ga0265331_10119585 | |||
| 1348 | Ga0265327_10000789 | |||
| 1349 | Ga0265327_10005861 | |||
| 1350 | Ga0265316_10103655 | |||
| 1351 | Ga0307513_10076892 | |||
| 1352 | Ga0307513_10886532 | |||
| 1353 | Ga0307408_100013422 | |||
| 1354 | Ga0307408_100253542 | |||
| 1355 | Ga0307408_100567688 | |||
| 1356 | Ga0307408_100567720 | |||
| 1357 | Ga0307408_101210607 | |||
| 1358 | Ga0307514_10004647 | |||
| 1359 | Ga0265314_10006203 | |||
| 1360 | Ga0265342_10060778 | |||
| 1361 | Ga0265342_10185236 | |||
| 1362 | Ga0307516_10156441 | |||
| 1363 | Ga0307405_10045105 | |||
| 1364 | Ga0307405_10223349 | |||
| 1365 | Ga0307405_10825468 | |||
| 1366 | Ga0307410_10064368 | |||
| 1367 | Ga0307406_10005016 | |||
| 1368 | Ga0307406_11115606 | |||
| 1369 | Ga0307412_10086036 | |||
| 1370 | Ga0307412_10152808 | |||
| 1371 | Ga0307412_10516845 | |||
| 1372 | Ga0307412_11693916 | |||
| 1373 | Ga0307416_100026977 | |||
| 1374 | Ga0307416_100034338 | |||
| 1375 | Ga0307416_101143473 | |||
| 1376 | Ga0307416_101601510 | |||
| 1377 | Ga0307414_10070360 | |||
| 1378 | Ga0307414_10072933 | |||
| 1379 | Ga0307414_10493195 | |||
| 1380 | Ga0307411_10647557 | |||
| 1381 | Ga0307415_100713115 | |||
| 1382 | Ga0373939_0337975 | |||
| 1383 | Ga0373931_0159054 | |||
| 1384 | Ga0373935_0389638 | |||
| 1385 | Ga0373927_0827967 | |||
| 1386 | Ga0373925_0511951 | |||
| 1387 | Ga0395899_0019414 | |||
| 1388 | Ga0395899_0035679 | |||
| 1389 | Ga0395899_0173816 | |||
| 1390 | Ga0395899_0244138 | |||
| 1391 | Ga0395900_0011923 | |||
| 1392 | Ga0395900_0019815 | |||
| 1393 | Ga0395900_0047396 | |||
| 1394 | Ga0395900_0052858 | |||
| 1395 | Ga0395900_0421238 | |||
| 1396 | Ga0395900_0853076 | |||
| 1397 | Ga0395898_0016238 | |||
| 1398 | Ga0395898_0017821 | |||
| 1399 | Ga0395898_0110816 | |||
| 1400 | Ga0395898_0475940 | |||
| 1401 | Ga0395898_0693006 | |||
| 1402 | Ga0395905_0000027 | |||
| 1403 | Ga0395905_0011168 | |||
| 1404 | Ga0395905_0018668 | |||
| 1405 | Ga0395905_0023994 | |||
| 1406 | Ga0395905_0025965 | |||
| 1407 | Ga0395905_0059022 | |||
| 1408 | Ga0395905_0093619 | |||
| 1409 | Ga0395905_0097950 | |||
| 1410 | Ga0395905_0167972 | |||
| 1411 | Ga0395905_0573117 | |||
| 1412 | Ga0395905_0576879 | |||
| 1413 | Ga0395905_1149015 | |||
| 1414 | Ga0395901_0026973 | |||
| 1415 | Ga0395901_0043020 | |||
| 1416 | Ga0395901_0061046 | |||
| 1417 | Ga0395901_0064334 | |||
| 1418 | Ga0395901_0068948 | |||
| 1419 | Ga0395901_0121481 | |||
| 1420 | Ga0395901_0211801 | |||
| 1421 | Ga0395901_0257769 | |||
| 1422 | Ga0395901_1123484 | |||
| 1423 | Ga0395901_1896524 | |||
| 1424 | Ga0436361_0070738 | |||
| 1425 | Ga0439436_0006510 | |||
| 1426 | Ga0439436_0010396 | |||
| 1427 | Ga0439436_0018487 | |||
| 1428 | Ga0439438_039792 | |||
| 1429 | Ga0439439_0002012 | |||
| 1430 | Ga0439447_022624 | |||
| 1431 | Ga0439447_028164 | |||
| 1432 | Ga0439447_152725 | |||
| 1433 | Ga0439461_0006354 | |||
| 1434 | Ga0439466_0002323 | |||
| 1435 | Ga0439466_0012501 | |||
| 1436 | Ga0439466_0015344 | |||
| 1437 | Ga0439465_0001853 | |||
| 1438 | Ga0439465_0004649 | |||
| 1439 | Ga0451791_0284746 | |||
| 1440 | Ga0451791_0563739 | |||
| 1441 | Ga0451791_1887967 | |||
| 1442 | Ga0451798_0925139 | |||
| 1443 | Ga0451807_0419949 | |||
| 1444 | Ga0451807_1686510 | |||
| 1445 | Ga0451807_2302176 | |||
| 1446 | Ga0451833_0574531 | |||
| 1447 | Ga0451835_1043689 | |||
| 1448 | Ga0451841_1228420 | |||
| 1449 | Ga0451853_1261129 | |||
| 1450 | Ga0439433_0001942 | |||
| 1451 | Ga0439437_003204 | |||
| 1452 | Ga0439441_035560 | |||
| 1453 | Ga0439442_004106 | |||
| 1454 | Ga0439443_034373 | |||
| 1455 | Ga0439445_0000200 | |||
| 1456 | Ga0439445_0240596 | |||
| 1457 | Ga0439448_0107664 | |||
| 1458 | Ga0439432_001787 | |||
| 1459 | Ga0439432_002229 | |||
| 1460 | Ga0439432_070836 | |||
| 1461 | Ga0439449_0001772 | |||
| 1462 | Ga0439449_0003811 | |||
| 1463 | Ga0439449_0010236 | |||
| 1464 | Ga0439449_0166167 | |||
| 1465 | Ga0439452_002059 | |||
| 1466 | Ga0439452_002146 | |||
| 1467 | Ga0439457_008995 | |||
| 1468 | Ga0439457_045221 | |||
| 1469 | Ga0439462_0002253 | |||
| 1470 | Ga0439462_0007235 | |||
| 1471 | Ga0439462_0048246 | |||
| 1472 | Ga0450914_024523 | |||
| 1473 | Ga0450915_000567 | |||
| 1474 | Ga0450923_014302 | |||
| 1475 | Ga0450890_003980 | |||
| 1476 | Ga0450890_004272 | |||
| 1477 | Ga0450897_004575 | |||
| 1478 | Ga0450891_012508 | |||
| 1479 | Ga0450891_013050 | |||
| 1480 | Ga0450891_014893 | |||
| 1481 | Ga0450894_003496 | |||
| 1482 | Ga0450896_017735 | |||
| 1483 | Ga0450898_083624 | |||
| 1484 | Ga0450898_106959 | |||
| 1485 | Ga0450899_027903 | |||
| 1486 | Ga0450899_053117 | |||
| 1487 | Ga0450889_022346 | |||
| 1488 | Ga0450906_004422 | |||
| 1489 | Ga0450906_014423 | |||
| 1490 | Ga0450907_039478 | |||
| 1491 | Ga0450910_010458 | |||
| 1492 | Ga0450910_019073 | |||
| 1493 | Ga0439446_0002191 | |||
| 1494 | Ga0439446_0025007 | |||
| 1495 | Ga0439446_0027195 | |||
| 1496 | Ga0439446_0027520 | |||
| 1497 | Ga0439446_0036356 | |||
| 1498 | Ga0439458_0043951 | |||
| 1499 | Ga0450908_001658 | |||
| 1500 | Ga0450909_001276 | |||
| 1501 | Ga0450909_012894 | |||
| 1502 | Ga0450909_075119 | |||
| 1503 | Ga0439434_0003517 | |||
| 1504 | Ga0439434_0015359 | |||
| 1505 | Ga0439434_0033137 | |||
| 1506 | Ga0439434_0226519 | |||
| 1507 | Ga0439459_0006177 | |||
| 1508 | Ga0439459_0046862 | |||
| 1509 | Ga0439464_0173676 | |||
| 1510 | Ga0439460_0085406 | |||
| 1511 | Ga0450918_002358 | |||
| 1512 | Ga0450893_0001444 | |||
| 1513 | Ga0450893_0049621 | |||
| 1514 | Ga0451577_0358732 | |||
| 1515 | Ga0451577_0828007 | |||
| 1516 | Ga0466969_0049691 | |||
| 1517 | Ga0466969_0279328 | |||
| 1518 | Ga0466969_0366439 | |||
| 1519 | Ga0466972_0099995 | |||
| 1520 | Ga0453683_0001910 | |||
| 1521 | Ga0466965_0071587 | |||
| 1522 | Ga0466966_0005606 | |||
| 1523 | Ga0466966_0200452 | |||
| 1524 | Ga0466966_0384950 | |||
| 1525 | Ga0466966_0412938 | |||
| 1526 | Ga0466961_0009772 | |||
| 1527 | Ga0466961_0456847 | |||
| 1528 | Ga0466961_0797692 | |||
| 1529 | Ga0453684_0029736 | |||
| 1530 | Ga0466968_0416519 | |||
| 1531 | Ga0466970_0037547 | |||
| 1532 | Ga0466970_0514055 | |||
| 1533 | Ga0466957_0061317 | |||
| 1534 | Ga0466957_0746637 | |||
| 1535 | Ga0466960_0001088 | |||
| 1536 | Ga0466960_0029132 | |||
| 1537 | Ga0466959_0004682 | |||
| 1538 | Ga0466959_0537711 | |||
| 1539 | Ga0466959_0593486 | |||
| 1540 | Ga0451576_0000559 | |||
| 1541 | Ga0451576_0010377 | |||
| 1542 | Ga0451576_0058565 | |||
| 1543 | Ga0466958_0058801 | |||
| 1544 | Ga0466958_0164172 | |||
| 1545 | Ga0466967_0280760 | |||
| 1546 | Ga0466967_1861571 | |||
| 1547 | Ga0466967_2452211 | |||
| 1548 | Ga0495627_031677 | |||
| 1549 | Ga0495592_0473012 | |||
| 1550 | Ga0495592_0653312 | |||
| 1551 | Ga0495629_0102665 | |||
| 1552 | Ga0495638_0015785 | |||
| 1553 | Ga0495639_0010350 | |||
| 1554 | Ga0495606_0476936 | |||
| 1555 | Ga0495610_0020676 | |||
| 1556 | Ga0495616_0009239 | |||
| 1557 | Ga0495620_0009770 | |||
| 1558 | Ga0495628_0354517 | |||
| 1559 | Ga0495630_0387909 | |||
| 1560 | Ga0495631_0001403 | |||
| 1561 | Ga0495637_0014620 | |||
| 1562 | Ga0495642_0006401 | |||
| 1563 | Ga0495654_0028131 | |||
| 1564 | Ga0495609_0051625 | |||
| 1565 | Ga0495621_0002023 | |||
| 1566 | Ga0495621_0022746 | |||
| 1567 | Ga0495621_0271021 | |||
| 1568 | Ga0495597_0336747 | |||
| 1569 | Ga0495645_0904462 | |||
| 1570 | Ga0495622_0099676 | |||
| 1571 | Ga0495633_0002867 | |||
| 1572 | Ga0495633_0390144 | |||
| 1573 | Ga0495656_0069410 | |||
| 1574 | Ga0495668_0366149 | |||
| 1575 | Ga0495625_0000950 | |||
| 1576 | Ga0495625_0032930 | |||
| 1577 | Ga0495625_0074298 | |||
| 1578 | Ga0495659_0380250 | |||
| 1579 | Ga0495588_0048360 | |||
| 1580 | Ga0495588_0053050 | |||
| 1581 | Ga0495658_0104350 | |||
| 1582 | Ga0495624_0250966 | |||
| 1583 | Ga0495670_0119378 | |||
| 1584 | Ga0495670_0377313 | |||
| 1585 | Ga0495671_0018988 | |||
| 1586 | Ga0495660_0287649 | |||
| 1587 | Ga0495660_0488988 | |||
| 1588 | Ga0495636_0148352 | |||
| 1589 | Ga0495676_0031210 | |||
| 1590 | Ga0495677_0242834 | |||
| 1591 | Ga0495681_0043623 | |||
| 1592 | Ga0495686_0435546 | |||
| 1593 | Ga0495593_0326380 | |||
| 1594 | Ga0495602_0774103 | |||
| 1595 | Ga0495602_0849131 | |||
| 1596 | Ga0495614_0030677 | |||
| 1597 | Ga0495615_0002681 | |||
| 1598 | Ga0496100_0016152 | |||
| 1599 | Ga0496101_0007428 | |||
| 1600 | Ga0496101_0117793 | |||
| 1601 | Ga0496102_0093723 | |||
| 1602 | Ga0496102_0165399 | |||
| 1603 | Ga0496102_0380421 | |||
| 1604 | Ga0496103_0065385 | |||
| 1605 | Ga0496104_0013037 | |||
| 1606 | Ga0496105_0008264 | |||
| 1607 | Ga0496106_0077299 | |||
| 1608 | Ga0496107_0132983 | |||
| 1609 | Ga0496108_0172028 | |||
| 1610 | Ga0496108_0969957 | |||
| 1611 | Ga0496109_0273958 | |||
| 1612 | Ga0496109_1238728 | |||
| 1613 | Ga0496110_0156828 | |||
| 1614 | Ga0496111_0256807 | |||
| 1615 | Ga0496114_0084455 | |||
| 1616 | Ga0496114_0706236 | |||
| 1617 | Ga0496116_0033637 | |||
| 1618 | Ga0496117_0015780 | |||
| 1619 | Ga0496117_0037087 | |||
| 1620 | Ga0496117_0264277 | |||
| 1621 | Ga0496118_0021075 | |||
| 1622 | Ga0496118_0039565 | |||
| 1623 | Ga0496118_0585427 | |||
| 1624 | Ga0496121_0111561 | |||
| 1625 | Ga0496121_0286394 | |||
| 1626 | Ga0496121_0687878 | |||
| 1627 | Ga0496122_0000612 | |||
| 1628 | Ga0496122_0063771 | |||
| 1629 | Ga0496122_0138791 | |||
| 1630 | Ga0496122_0246728 | |||
| 1631 | Ga0496122_0530445 | |||
| 1632 | Ga0496123_0000274 | |||
| 1633 | Ga0496123_0089931 | |||
| 1634 | Ga0496123_0423655 | |||
| 1635 | Ga0496124_0032035 | |||
| 1636 | Ga0496124_0077684 | |||
| 1637 | Ga0496124_0168032 | |||
| 1638 | Ga0496124_0337340 | |||
| 1639 | Ga0496124_0466726 | |||
| 1640 | Ga0496125_0001638 | |||
| 1641 | Ga0496125_0033897 | |||
| 1642 | Ga0496125_0036908 | |||
| 1643 | Ga0496125_0132219 | |||
| 1644 | Ga0496125_0158301 | |||
| 1645 | Ga0496125_0320160 | |||
| 1646 | Ga0496126_0133652 | |||
| 1647 | Ga0496126_0178471 | |||
| 1648 | Ga0496126_0479461 | |||
| 1649 | Ga0495678_106703 | |||
| 1650 | Ga0501031_0353708 | |||
| 1651 | Ga0501032_0156858 | |||
| 1652 | Ga0501033_0056838 | |||
| 1653 | Ga0501034_0053289 | |||
| 1654 | Ga0501036_0372060 | |||
| 1655 | Ga0501037_0060577 | |||
| 1656 | Ga0501038_0516179 | |||
| 1657 | Ga0501039_0757851 | |||
| 1658 | Ga0501043_0115453 | |||
| 1659 | Ga0501046_0307583 | |||
| 1660 | Ga0501047_0083028 | |||
| 1661 | Ga0501047_0299824 | |||
| 1662 | Ga0501073_0467381 | |||
| 1663 | Ga0501073_0651054 | |||
| 1664 | Ga0501202_093042 | |||
| 1665 | Ga0501217_237112 | |||
| 1666 | Ga0501222_007776 | |||
| 1667 | Ga0501223_043000 | |||
| 1668 | Ga0501227_086972 | |||
| 1669 | Ga0501249_004009 | |||
| 1670 | Ga0501250_087720 | |||
| 1671 | Ga0501257_100559 | |||
| 1672 | Ga0501225_0007716 | |||
| 1673 | Ga0501080_0014745 | |||
| 1674 | Ga0501083_0335777 | |||
| 1675 | Ga0501241_010478 | |||
| 1676 | Ga0501262_000513 | |||
| 1677 | Ga0501263_019471 | |||
| 1678 | Ga0501268_122528 | |||
| 1679 | Ga0501276_034326 | |||
| 1680 | Ga0501279_084610 | |||
| 1681 | Ga0501035_0031308 | |||
| 1682 | Ga0501035_0373786 | |||
| 1683 | Ga0501044_0060322 | |||
| 1684 | Ga0501044_0935345 | |||
| 1685 | nmdc:mga03683_11246_c1 | |||
| 1686 | nmdc:mga03683_123766_c1 | |||
| 1687 | nmdc:mga03683_166557_c1 | |||
| 1688 | nmdc:mga03683_22662_c1 | |||
| 1689 | nmdc:mga03683_406521_c1 | |||
| 1690 | nmdc:mga03683_413827_c1 | |||
| 1691 | nmdc:mga03683_97770_c1 | |||
| 1692 | nmdc:mga03n38_144487_c1 | |||
| 1693 | nmdc:mga03n38_176977_c1 | |||
| 1694 | nmdc:mga03n38_20471_c1 | |||
| 1695 | nmdc:mga03n38_232587_c1 | |||
| 1696 | nmdc:mga00v17_12651_c1 | |||
| 1697 | nmdc:mga00v17_36016_c1 | |||
| 1698 | nmdc:mga00v17_365046_c1 | |||
| 1699 | nmdc:mga0yw44_171054_c1 | |||
| 1700 | nmdc:mga0yw44_240572_c1 | |||
| 1701 | nmdc:mga0yw44_307585_c1 | |||
| 1702 | nmdc:mga0yw44_375349_c1 | |||
| 1703 | nmdc:mga0yw44_537366_c1 | |||
| 1704 | nmdc:mga0k408_103583_c1 | |||
| 1705 | nmdc:mga0k408_158161_c1 | |||
| 1706 | nmdc:mga0k408_166660_c1 | |||
| 1707 | nmdc:mga0k408_22290_c1 | |||
| 1708 | nmdc:mga0k408_28590_c1 | |||
| 1709 | nmdc:mga0k408_738_c1 | |||
| 1710 | nmdc:mga0k408_761577_c1 | |||
| 1711 | nmdc:mga0k408_7755_c1 | |||
| 1712 | nmdc:mga0k408_9853_c2 | |||
| 1713 | nmdc:mga06z11_160996_c1 | |||
| 1714 | nmdc:mga06z11_396102_c1 | |||
| 1715 | nmdc:mga06z11_80956_c1 | |||
| 1716 | nmdc:mga07m45_108489_c1 | |||
| 1717 | nmdc:mga07m45_155597_c1 | |||
| 1718 | nmdc:mga07m45_22375_c1 | |||
| 1719 | nmdc:mga07m45_23384_c1 | |||
| 1720 | nmdc:mga07m45_264321_c1 | |||
| 1721 | nmdc:mga07m45_28633_c1 | |||
| 1722 | nmdc:mga07m45_326734_c1 | |||
| 1723 | nmdc:mga07m45_397530_c1 | |||
| 1724 | nmdc:mga07m45_3986_c1 | |||
| 1725 | nmdc:mga07m45_548386_c1 | |||
| 1726 | nmdc:mga07m45_8729_c1 | |||
| 1727 | nmdc:mga09592_196814_c1 | |||
| 1728 | nmdc:mga0qj67_245762_c1 | |||
| 1729 | nmdc:mga06r32_1124761_c1 | |||
| 1730 | nmdc:mga0sz30_145677_c1 | |||
| 1731 | nmdc:mga0sz30_24531_c1 | |||
| 1732 | nmdc:mga0sz30_394199_c1 | |||
| 1733 | Ga0495612_0489445 | |||
| 1734 | Ga0500610_0060324 | |||
| 1735 | Ga0500610_0104821 | |||
| 1736 | Ga0500643_011950 | |||
| 1737 | Ga0500643_014775 | |||
| 1738 | Ga0500651_0008924 | |||
| 1739 | Ga0500651_0035169 | |||
| 1740 | Ga0500566_0129632 | |||
| 1741 | Ga0500641_0177406 | |||
| 1742 | Ga0500555_073697 | |||
| 1743 | Ga0500571_007027 | |||
| 1744 | Ga0500572_043135 | |||
| 1745 | Ga0500593_008356 | |||
| 1746 | Ga0500594_0002788 | |||
| 1747 | Ga0500594_0003939 | |||
| 1748 | Ga0500607_008438 | |||
| 1749 | Ga0500608_182094 | |||
| 1750 | Ga0500626_021831 | |||
| 1751 | Ga0500628_051806 | |||
| 1752 | Ga0500655_000855 | |||
| 1753 | Ga0500658_0074236 | |||
| 1754 | Ga0500559_0006052 | |||
| 1755 | Ga0500559_0031588 | |||
| 1756 | Ga0500564_018419 | |||
| 1757 | Ga0500573_0268522 | |||
| 1758 | Ga0500574_056804 | |||
| 1759 | Ga0500577_0382880 | |||
| 1760 | Ga0500604_0107760 | |||
| 1761 | Ga0500604_0164307 | |||
| 1762 | Ga0500616_0004050 | |||
| 1763 | Ga0500620_171538 | |||
| 1764 | Ga0500627_0006594 | |||
| 1765 | Ga0500627_0282291 | |||
| 1766 | Ga0500633_0366922 | |||
| 1767 | Ga0500634_0023270 | |||
| 1768 | Ga0500634_0039635 | |||
| 1769 | Ga0500634_0213995 | |||
| 1770 | Ga0500638_003554 | |||
| 1771 | Ga0500625_085942 | |||
| 1772 | Ga0500596_010039 | |||
| 1773 | Ga0587108_013452 | |||
| 1774 | 2644071422 | |||
| 1775 | 2885196975 | |||
| 1776 | 2932424005 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uvm-assembly1.cif.gz_A | hit family hydrolase from clostridium thermocellum cth-393 | 0.9204 | 3 | 115 |
| 4egu-assembly1.cif.gz_B | 0.95a resolution structure of a histidine triad protein from clostridium difficile | 0.9084 | 3 | 114 |
| 3omf-assembly1.cif.gz_A | crystal structure of a histidine triad family protein from entamoeba histolytica, bound to amp | 0.9006 | 6 | 114 |
| 3n1s-assembly2.cif.gz_F | crystal structure of wild type echint gmp complex | 0.8982 | 4 | 115 |
| 3n1t-assembly2.cif.gz_E | crystal structure of the h101a mutant echint gmp complex | 0.8962 | 8 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5uvmA00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9285 | 3 | 114 | 3.30.428.10 |
| 4eguB00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9084 | 3 | 114 | 3.30.428.10 |
| 3oxkA00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8995 | 6 | 114 | 3.30.428.10 |
| 4q61B00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.886 | 7 | 113 | 3.30.428.10 |
| 4zglE00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8847 | 8 | 113 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3PTY9-F1-model_v4 | deleted | 0.9723 | 1 | 110 |
|
| AF-A0A1I7EZ11-F1-model_v4 | Histidine triad (HIT) family protein | 0.9666 | 4 | 114 |
GO:0003824
|
| AF-A0A536SZ33-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9649 | 4 | 114 |
GO:0003824
|
| AF-A0A0P8DWU0-F1-model_v4 | Hit-like protein | 0.9582 | 3 | 114 |
GO:0003824
|
| AF-A0A4Q1TAI9-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9567 | 3 | 111 |
GO:0003824
|