F484785

General Info

Members Datasets Scaffolds Average Seq Length
889 255 1778 143

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100039155|Ga0070671_1000391555
Length 151
Sequence MLAMRIALAADHAGYVLKDELVAWLRDAGHEVSDLGTNGPESVDYPRFGAKLANAIASGNVERGIVVCGSGIGISIAVNRNPACRCARVSDPLSAQLAREHNDANVLALGARLIGSDMARACAAIFLDTDFAGGRHQRRVDQLSHLLQDSD

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
203 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
255 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.22
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 5.06
Rhizosphere 94.38
Stem 0
Stem Tuber 0.11
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100039155 3300005355 Bacteria 3935
2 JGI24752J21851_1004840 3300001976 Bacteria 1760
3 JGI24740J21852_10005844 3300001979 Bacteria 5160
4 JGI24740J21852_10033082 3300001979 Bacteria 1647
5 JGI24739J22299_10000986 3300001989 Bacteria 10619
6 JGI24739J22299_10054434 3300001989 Bacteria 1282
7 JGI24737J22298_10000178 3300001990 Bacteria 20564
8 JGI24737J22298_10001788 3300001990 Bacteria 7695
9 JGI24737J22298_10011626 3300001990 Bacteria 2880
10 JGI24737J22298_10164511 3300001990 Bacteria 655
11 JGI24735J21928_10038730 3300002067 Bacteria 1394
12 JGI24750J21931_1062571 3300002070 Bacteria 597
13 JGI24738J21930_10000019 3300002075 Bacteria 30317
14 JGI24738J21930_10019155 3300002075 Bacteria 1429
15 JGI24749J21850_1000981 3300002076 Bacteria 4063
16 JGI24034J26672_10049928 3300002239 Bacteria 718
17 JGI24742J22300_10063806 3300002244 Bacteria 680
18 JGI24751J29686_10062656 3300002459 Bacteria 766
19 Ga0065715_10098022 3300005293 Bacteria 3609
20 Ga0070658_10014597 3300005327 Bacteria 6304
21 Ga0070658_10069253 3300005327 Bacteria 2886
22 Ga0070658_10130354 3300005327 Bacteria 2095
23 Ga0070658_10143861 3300005327 Bacteria 1993
24 Ga0070658_10183856 3300005327 Bacteria 1759
25 Ga0070658_10461107 3300005327 Bacteria 1095
26 Ga0070658_11096441 3300005327 Bacteria 692
27 Ga0070676_10004650 3300005328 Bacteria 7249
28 Ga0070676_10016959 3300005328 Bacteria 4026
29 Ga0070683_100011140 3300005329 Bacteria 7757
30 Ga0070683_100043658 3300005329 Bacteria 4132
31 Ga0070683_100226583 3300005329 Bacteria 1776
32 Ga0070683_100491747 3300005329 Bacteria 1172
33 Ga0070683_101997500 3300005329 Bacteria 557
34 Ga0070690_100240700 3300005330 Bacteria 1276
35 Ga0070690_100241789 3300005330 Bacteria 1273
36 Ga0070670_100002756 3300005331 Bacteria 14515
37 Ga0070670_100007934 3300005331 Bacteria 9032
38 Ga0070670_100024830 3300005331 Bacteria 5155
39 Ga0070670_100051620 3300005331 Bacteria 3531
40 Ga0070670_100233630 3300005331 Bacteria 1600
41 Ga0070670_100307705 3300005331 Bacteria 1387
42 Ga0070670_102145378 3300005331 Bacteria 515
43 Ga0070677_10109221 3300005333 Bacteria 1232
44 Ga0068869_100005344 3300005334 Bacteria 8076
45 Ga0070666_10161980 3300005335 Bacteria 1564
46 Ga0070666_10163966 3300005335 Bacteria 1554
47 Ga0070680_100029453 3300005336 Bacteria 4410
48 Ga0070680_100032619 3300005336 Bacteria 4193
49 Ga0070680_100060218 3300005336 Bacteria 3107
50 Ga0070680_100240970 3300005336 Bacteria 1528
51 Ga0070680_100307079 3300005336 Bacteria 1345
52 Ga0070680_100391560 3300005336 Bacteria 1184
53 Ga0070680_100481738 3300005336 Bacteria 1060
54 Ga0070682_100117710 3300005337 Bacteria 1779
55 Ga0070682_100176851 3300005337 Bacteria 1487
56 Ga0068868_100005396 3300005338 Bacteria 8983
57 Ga0068868_100073237 3300005338 Bacteria 2735
58 Ga0070660_100000423 3300005339 Bacteria 28044
59 Ga0070660_100035431 3300005339 Bacteria 3777
60 Ga0070660_100042485 3300005339 Bacteria 3470
61 Ga0070660_100108280 3300005339 Bacteria 2209
62 Ga0070660_100122164 3300005339 Bacteria 2079
63 Ga0070660_100210990 3300005339 Bacteria 1577
64 Ga0070660_100291188 3300005339 Bacteria 1337
65 Ga0070660_101084628 3300005339 Bacteria 677
66 Ga0070689_100190866 3300005340 Bacteria 1668
67 Ga0070691_10533760 3300005341 Bacteria 683
68 Ga0070661_100007304 3300005344 Bacteria 7621
69 Ga0070661_100009456 3300005344 Bacteria 6748
70 Ga0070661_100041572 3300005344 Bacteria 3355
71 Ga0070661_100042051 3300005344 Bacteria 3335
72 Ga0070661_100064758 3300005344 Bacteria 2686
73 Ga0070661_100129611 3300005344 Bacteria 1894
74 Ga0070661_100231040 3300005344 Bacteria 1421
75 Ga0070661_100246851 3300005344 Bacteria 1376
76 Ga0070661_100537818 3300005344 Bacteria 939
77 Ga0070661_100587366 3300005344 Bacteria 899
78 Ga0070661_100739213 3300005344 Bacteria 804
79 Ga0070661_100776763 3300005344 Bacteria 785
80 Ga0070692_10163068 3300005345 Bacteria 1279
81 Ga0070692_10212200 3300005345 Bacteria 1140
82 Ga0070692_10816302 3300005345 Bacteria 638
83 Ga0070668_100026024 3300005347 Bacteria 4437
84 Ga0070668_100310237 3300005347 Bacteria 1325
85 Ga0070669_100000892 3300005353 Bacteria 21717
86 Ga0070669_100003371 3300005353 Bacteria 11487
87 Ga0070669_100209240 3300005353 Bacteria 1538
88 Ga0070675_100001809 3300005354 Bacteria 15814
89 Ga0070675_101046837 3300005354 Bacteria 750
90 Ga0070671_100000712 3300005355 Bacteria 23902
91 Ga0070671_100007958 3300005355 Bacteria 8478
92 Ga0070671_100027970 3300005355 Bacteria 4643
93 Ga0070671_100042418 3300005355 Bacteria 3781
94 Ga0070671_100044153 3300005355 Bacteria 3703
95 Ga0070671_100106258 3300005355 Bacteria 2356
96 Ga0070671_100319731 3300005355 Bacteria 1322
97 Ga0070671_100641112 3300005355 Bacteria 919
98 Ga0070674_100001014 3300005356 Bacteria 14649
99 Ga0070674_100101960 3300005356 Bacteria 2093
100 Ga0070673_100004134 3300005364 Bacteria 9142
101 Ga0070673_100020701 3300005364 Bacteria 4748
102 Ga0070673_100038539 3300005364 Bacteria 3651
103 Ga0070673_100857945 3300005364 Bacteria 840
104 Ga0070659_100001538 3300005366 Bacteria 16622
105 Ga0070659_100002296 3300005366 Bacteria 13620
106 Ga0070659_100044019 3300005366 Bacteria 3493
107 Ga0070659_100108678 3300005366 Bacteria 2238
108 Ga0070659_100160385 3300005366 Bacteria 1838
109 Ga0070659_100518523 3300005366 Bacteria 1017
110 Ga0070659_100631028 3300005366 Bacteria 923
111 Ga0070659_100852083 3300005366 Bacteria 794
112 Ga0070659_101408219 3300005366 Bacteria 620
113 Ga0070659_101425264 3300005366 Bacteria 616
114 Ga0070667_100001807 3300005367 Bacteria 19046
115 Ga0070667_100003644 3300005367 Bacteria 13107
116 Ga0070667_100065977 3300005367 Bacteria 3074
117 Ga0070667_100097161 3300005367 Bacteria 2541
118 Ga0070667_100112697 3300005367 Bacteria 2360
119 Ga0070667_100219127 3300005367 Bacteria 1693
120 Ga0070667_100571972 3300005367 Bacteria 1040
121 Ga0070709_10815991 3300005434 Bacteria 733
122 Ga0070714_100004266 3300005435 Bacteria 10767
123 Ga0070714_100046703 3300005435 Bacteria 3675
124 Ga0070714_100928091 3300005435 Bacteria 845
125 Ga0070713_100009365 3300005436 Bacteria 7005
126 Ga0070713_101093222 3300005436 Bacteria 770
127 Ga0070663_100031309 3300005455 Bacteria 3656
128 Ga0070663_100038228 3300005455 Bacteria 3347
129 Ga0070663_100042522 3300005455 Bacteria 3193
130 Ga0070663_100127199 3300005455 Bacteria 1931
131 Ga0070663_101057341 3300005455 Bacteria 708
132 Ga0070663_101311114 3300005455 Bacteria 639
133 Ga0070678_100002562 3300005456 Bacteria 9981
134 Ga0070678_100023223 3300005456 Bacteria 4128
135 Ga0070678_101630155 3300005456 Bacteria 606
136 Ga0070662_100007085 3300005457 Bacteria 7256
137 Ga0070662_100019060 3300005457 Bacteria 4653
138 Ga0070662_100034545 3300005457 Bacteria 3566
139 Ga0070662_100038256 3300005457 Bacteria 3407
140 Ga0070662_100101957 3300005457 Bacteria 2173
141 Ga0070662_100142786 3300005457 Bacteria 1857
142 Ga0070662_100514885 3300005457 Bacteria 999
143 Ga0070662_100544980 3300005457 Bacteria 971
144 Ga0070681_10120116 3300005458 Bacteria 2563
145 Ga0070681_10156609 3300005458 Bacteria 2202
146 Ga0068867_100088841 3300005459 Bacteria 2343
147 Ga0068867_100097936 3300005459 Bacteria 2236
148 Ga0068867_100106016 3300005459 Bacteria 2152
149 Ga0068867_100260541 3300005459 Bacteria 1413
150 Ga0068867_100260700 3300005459 Bacteria 1413
151 Ga0070685_10094256 3300005466 Bacteria 1818
152 Ga0070699_101190257 3300005518 Bacteria 699
153 Ga0070679_100027723 3300005530 Bacteria 5578
154 Ga0070679_100068369 3300005530 Bacteria 3544
155 Ga0070679_100313042 3300005530 Bacteria 1519
156 Ga0070684_100051520 3300005535 Bacteria 3576
157 Ga0070684_100071576 3300005535 Bacteria 3051
158 Ga0070684_101460903 3300005535 Bacteria 644
159 Ga0068853_100002073 3300005539 Bacteria 14876
160 Ga0068853_100020059 3300005539 Bacteria 5555
161 Ga0068853_100107279 3300005539 Bacteria 2476
162 Ga0068853_100215172 3300005539 Bacteria 1753
163 Ga0068853_100405415 3300005539 Bacteria 1277
164 Ga0068853_100548680 3300005539 Bacteria 1095
165 Ga0068853_100613681 3300005539 Bacteria 1033
166 Ga0068853_100757631 3300005539 Bacteria 928
167 Ga0068853_101091269 3300005539 Bacteria 769
168 Ga0068853_101894852 3300005539 Bacteria 578
169 Ga0070672_100016536 3300005543 Bacteria 5283
170 Ga0070672_100024761 3300005543 Bacteria 4441
171 Ga0070672_100038130 3300005543 Bacteria 3670
172 Ga0070672_100061272 3300005543 Bacteria 2965
173 Ga0070672_100165100 3300005543 Bacteria 1839
174 Ga0070693_100224730 3300005547 Bacteria 1232
175 Ga0070693_100323036 3300005547 Bacteria 1048
176 Ga0070665_100317150 3300005548 Bacteria 1563
177 Ga0070665_100624116 3300005548 Bacteria 1091
178 Ga0070704_101210268 3300005549 Bacteria 689
179 Ga0068855_100015087 3300005563 Bacteria 9302
180 Ga0068855_100031856 3300005563 Bacteria 6294
181 Ga0068855_100099451 3300005563 Bacteria 3350
182 Ga0068855_100230153 3300005563 Bacteria 2076
183 Ga0068855_100257040 3300005563 Bacteria 1947
184 Ga0068855_100317529 3300005563 Bacteria 1723
185 Ga0068855_100330984 3300005563 Bacteria 1681
186 Ga0070664_100008445 3300005564 Bacteria 8329
187 Ga0070664_100008637 3300005564 Bacteria 8244
188 Ga0070664_100019637 3300005564 Bacteria 5561
189 Ga0070664_100029864 3300005564 Bacteria 4545
190 Ga0070664_100260742 3300005564 Bacteria 1560
191 Ga0070664_102239025 3300005564 Bacteria 518
192 Ga0068857_100001908 3300005577 Bacteria 16796
193 Ga0068857_100002339 3300005577 Bacteria 15428
194 Ga0068857_100002386 3300005577 Bacteria 15324
195 Ga0068857_100114503 3300005577 Bacteria 2425
196 Ga0068857_100327028 3300005577 Bacteria 1416
197 Ga0068857_101365942 3300005577 Bacteria 689
198 Ga0068854_100011842 3300005578 Bacteria 5695
199 Ga0068854_100128427 3300005578 Bacteria 1933
200 Ga0068854_100230276 3300005578 Bacteria 1470
201 Ga0068854_100292758 3300005578 Bacteria 1314
202 Ga0068854_100624385 3300005578 Bacteria 922
203 Ga0068856_100022493 3300005614 Bacteria 6130
204 Ga0068856_100027852 3300005614 Bacteria 5513
205 Ga0068856_100042798 3300005614 Bacteria 4456
206 Ga0068856_100067832 3300005614 Bacteria 3525
207 Ga0068856_100141628 3300005614 Bacteria 2412
208 Ga0068856_100222153 3300005614 Bacteria 1904
209 Ga0068856_101822278 3300005614 Bacteria 620
210 Ga0068852_100000701 3300005616 Bacteria 21899
211 Ga0068852_100090713 3300005616 Bacteria 2733
212 Ga0068852_100141178 3300005616 Bacteria 2229
213 Ga0068852_100756618 3300005616 Bacteria 984
214 Ga0068852_100936011 3300005616 Bacteria 884
215 Ga0068859_100006464 3300005617 Bacteria 11889
216 Ga0068859_100027420 3300005617 Bacteria 5712
217 Ga0068864_100005384 3300005618 Bacteria 10485
218 Ga0068864_100006956 3300005618 Bacteria 9278
219 Ga0068864_100018481 3300005618 Bacteria 5825
220 Ga0068864_100063773 3300005618 Bacteria 3194
221 Ga0068864_100387043 3300005618 Bacteria 1326
222 Ga0068864_100466555 3300005618 Bacteria 1210
223 Ga0068861_100024656 3300005719 Bacteria 4353
224 Ga0068861_100057430 3300005719 Bacteria 2973
225 Ga0068851_10008558 3300005834 Bacteria 4735
226 Ga0068851_10011442 3300005834 Bacteria 4162
227 Ga0068851_10118637 3300005834 Bacteria 1420
228 Ga0068851_10120696 3300005834 Bacteria 1408
229 Ga0068851_10228243 3300005834 Bacteria 1049
230 Ga0068870_10431853 3300005840 Bacteria 864
231 Ga0068863_100001683 3300005841 Bacteria 21885
232 Ga0068863_100009537 3300005841 Bacteria 9464
233 Ga0068863_100033101 3300005841 Bacteria 4924
234 Ga0068863_100103851 3300005841 Bacteria 2703
235 Ga0068863_100614272 3300005841 Bacteria 1077
236 Ga0068863_101230555 3300005841 Bacteria 755
237 Ga0068858_100009735 3300005842 Bacteria 9154
238 Ga0068858_100036512 3300005842 Bacteria 4557
239 Ga0068860_100008834 3300005843 Bacteria 10035
240 Ga0068860_100063178 3300005843 Bacteria 3518
241 Ga0068862_100139603 3300005844 Bacteria 2150
242 Ga0068862_100155970 3300005844 Bacteria 2035
243 Ga0070717_10004039 3300006028 Bacteria 10571
244 Ga0075366_10098214 3300006195 Bacteria 1757
245 Ga0097621_100023123 3300006237 Bacteria 4834
246 Ga0097621_100095360 3300006237 Bacteria 2495
247 Ga0097621_100171687 3300006237 Bacteria 1869
248 Ga0097621_100279265 3300006237 Bacteria 1470
249 Ga0097621_100471702 3300006237 Bacteria 1133
250 Ga0075370_10490078 3300006353 Bacteria 741
251 Ga0068871_100020850 3300006358 Bacteria 5027
252 Ga0068871_100027598 3300006358 Bacteria 4442
253 Ga0068871_100031082 3300006358 Bacteria 4208
254 Ga0068871_100299296 3300006358 Bacteria 1412
255 Ga0068871_100715917 3300006358 Bacteria 918
256 Ga0068871_101387631 3300006358 Bacteria 662
257 Ga0075428_100488913 3300006844 Bacteria 1317
258 Ga0075431_100022236 3300006847 Bacteria 6484
259 Ga0075434_100411586 3300006871 Bacteria 1373
260 Ga0075434_100857051 3300006871 Bacteria 924
261 Ga0068865_100009858 3300006881 Bacteria 5935
262 Ga0068865_100881888 3300006881 Bacteria 777
263 Ga0097620_100006464 3300006931 Bacteria 11889
264 Ga0097620_100027420 3300006931 Bacteria 5712
265 Ga0105240_10112581 3300009093 Bacteria 3289
266 Ga0105240_10376382 3300009093 Bacteria 1604
267 Ga0111539_10004793 3300009094 Bacteria 17647
268 Ga0105245_10000285 3300009098 Bacteria 48237
269 Ga0105243_10397563 3300009148 Bacteria 1279
270 Ga0105241_10237537 3300009174 Bacteria 1539
271 Ga0105241_10429567 3300009174 Bacteria 1164
272 Ga0105241_10460335 3300009174 Bacteria 1127
273 Ga0105241_10766591 3300009174 Bacteria 886
274 Ga0105241_10969078 3300009174 Bacteria 794
275 Ga0105242_10133119 3300009176 Bacteria 2149
276 Ga0105242_10305557 3300009176 Bacteria 1453
277 Ga0105242_10576560 3300009176 Bacteria 1083
278 Ga0105242_10609450 3300009176 Bacteria 1056
279 Ga0105248_10010330 3300009177 Bacteria 10275
280 Ga0105248_10012012 3300009177 Bacteria 9550
281 Ga0105248_10012166 3300009177 Bacteria 9492
282 Ga0105248_10059122 3300009177 Bacteria 4305
283 Ga0105248_10059421 3300009177 Bacteria 4294
284 Ga0105248_10097341 3300009177 Bacteria 3315
285 Ga0105248_10112342 3300009177 Bacteria 3073
286 Ga0105248_10330471 3300009177 Bacteria 1717
287 Ga0105248_10359963 3300009177 Bacteria 1638
288 Ga0105248_10744693 3300009177 Bacteria 1106
289 Ga0105237_10263102 3300009545 Bacteria 1727
290 Ga0105237_10643577 3300009545 Bacteria 1067
291 Ga0105238_10036351 3300009551 Bacteria 5006
292 Ga0105238_10417398 3300009551 Bacteria 1336
293 Ga0105238_10699870 3300009551 Bacteria 1025
294 Ga0105238_10773192 3300009551 Bacteria 975
295 Ga0105238_12022421 3300009551 Bacteria 610
296 Ga0105249_10002745 3300009553 Bacteria 15234
297 Ga0105249_10176509 3300009553 Bacteria 2075
298 Ga0105246_10178278 3300011119 Bacteria 1634
299 Ga0105246_10200653 3300011119 Bacteria 1550
300 Ga0157373_10036877 3300013100 Bacteria 3507
301 Ga0157373_10049263 3300013100 Bacteria 3002
302 Ga0157373_10076088 3300013100 Bacteria 2369
303 Ga0157373_10112415 3300013100 Bacteria 1915
304 Ga0157373_10141371 3300013100 Bacteria 1693
305 Ga0157373_10163133 3300013100 Bacteria 1568
306 Ga0157373_10233544 3300013100 Bacteria 1299
307 Ga0157371_10001670 3300013102 Bacteria 22644
308 Ga0157371_10004693 3300013102 Bacteria 11811
309 Ga0157371_10112355 3300013102 Bacteria 1934
310 Ga0157371_10136648 3300013102 Bacteria 1746
311 Ga0157371_10326387 3300013102 Bacteria 1114
312 Ga0157371_10411039 3300013102 Bacteria 991
313 Ga0157371_10648050 3300013102 Bacteria 788
314 Ga0157370_10007886 3300013104 Bacteria 11542
315 Ga0157370_10012692 3300013104 Bacteria 8719
316 Ga0157370_10047619 3300013104 Bacteria 4109
317 Ga0157370_10719663 3300013104 Bacteria 910
318 Ga0157369_10042840 3300013105 Bacteria 4937
319 Ga0157369_10080465 3300013105 Bacteria 3488
320 Ga0157369_10177643 3300013105 Bacteria 2241
321 Ga0157369_10293987 3300013105 Bacteria 1691
322 Ga0157369_10325344 3300013105 Bacteria 1598
323 Ga0157369_10353856 3300013105 Bacteria 1525
324 Ga0157369_10360693 3300013105 Bacteria 1509
325 Ga0157369_11551582 3300013105 Bacteria 673
326 Ga0157369_11666519 3300013105 Bacteria 648
327 Ga0157369_11814217 3300013105 Bacteria 619
328 Ga0157374_10007910 3300013296 Bacteria 9076
329 Ga0157374_10176717 3300013296 Bacteria 2084
330 Ga0157378_10017165 3300013297 Bacteria 6345
331 Ga0163162_10013549 3300013306 Bacteria 7962
332 Ga0163162_10158398 3300013306 Bacteria 2385
333 Ga0163162_10416478 3300013306 Bacteria 1476
334 Ga0163162_11200785 3300013306 Bacteria 861
335 Ga0157372_10060893 3300013307 Bacteria 4224
336 Ga0157372_10094809 3300013307 Bacteria 3399
337 Ga0157372_10190637 3300013307 Bacteria 2375
338 Ga0157372_10257558 3300013307 Bacteria 2026
339 Ga0157372_11401183 3300013307 Bacteria 806
340 Ga0157372_12944650 3300013307 Bacteria 545
341 Ga0157372_13201938 3300013307 Bacteria 522
342 Ga0157375_10014464 3300013308 Bacteria 7039
343 Ga0157375_10193359 3300013308 Bacteria 2190
344 Ga0157375_10203764 3300013308 Bacteria 2135
345 Ga0163163_10053606 3300014325 Bacteria 3982
346 Ga0163163_10234044 3300014325 Bacteria 1886
347 Ga0163163_10243001 3300014325 Bacteria 1850
348 Ga0157380_10000705 3300014326 Bacteria 20846
349 Ga0157380_10012744 3300014326 Bacteria 6105
350 Ga0182008_10015215 3300014497 Bacteria 4017
351 Ga0157377_10756731 3300014745 Bacteria 712
352 Ga0157379_10002119 3300014968 Bacteria 16448
353 Ga0157379_10305558 3300014968 Bacteria 1450
354 Ga0163161_10004895 3300017792 Bacteria 9331
355 Ga0206354_11019307 3300020081 Bacteria 662
356 Ga0207673_1003471 3300025290 Bacteria 1845
357 Ga0207673_1005750 3300025290 Bacteria 1520
358 Ga0207697_10000058 3300025315 Bacteria 45446
359 Ga0207697_10002920 3300025315 Bacteria 8649
360 Ga0207697_10217631 3300025315 Bacteria 842
361 Ga0207656_10005330 3300025321 Bacteria 4537
362 Ga0207656_10018371 3300025321 Bacteria 2753
363 Ga0207656_10172211 3300025321 Bacteria 1035
364 Ga0207710_10615541 3300025900 Bacteria 568
365 Ga0207688_10039282 3300025901 Bacteria 2629
366 Ga0207688_10503437 3300025901 Bacteria 759
367 Ga0207680_10092030 3300025903 Bacteria 1931
368 Ga0207680_10144345 3300025903 Bacteria 1581
369 Ga0207680_10233633 3300025903 Bacteria 1264
370 Ga0207680_10388629 3300025903 Bacteria 985
371 Ga0207647_10000253 3300025904 Bacteria 43758
372 Ga0207647_10004667 3300025904 Bacteria 10150
373 Ga0207647_10006724 3300025904 Bacteria 8348
374 Ga0207647_10023893 3300025904 Bacteria 4037
375 Ga0207647_10029809 3300025904 Bacteria 3525
376 Ga0207647_10042891 3300025904 Bacteria 2834
377 Ga0207645_10008485 3300025907 Bacteria 7164
378 Ga0207645_10013482 3300025907 Bacteria 5505
379 Ga0207643_10642553 3300025908 Bacteria 684
380 Ga0207705_10001709 3300025909 Bacteria 17419
381 Ga0207705_10002772 3300025909 Bacteria 13391
382 Ga0207705_10003854 3300025909 Bacteria 11413
383 Ga0207705_10026901 3300025909 Bacteria 4099
384 Ga0207705_10032390 3300025909 Bacteria 3735
385 Ga0207705_10237384 3300025909 Bacteria 1388
386 Ga0207705_10349346 3300025909 Bacteria 1139
387 Ga0207705_10425071 3300025909 Bacteria 1029
388 Ga0207705_10946395 3300025909 Bacteria 666
389 Ga0207705_11310777 3300025909 Bacteria 553
390 Ga0207654_10207160 3300025911 Bacteria 1294
391 Ga0207654_10655370 3300025911 Bacteria 752
392 Ga0207707_10119921 3300025912 Bacteria 2299
393 Ga0207707_10320566 3300025912 Bacteria 1338
394 Ga0207707_11171676 3300025912 Bacteria 623
395 Ga0207695_10021452 3300025913 Bacteria 7368
396 Ga0207671_10129153 3300025914 Bacteria 1938
397 Ga0207671_10186038 3300025914 Bacteria 1618
398 Ga0207671_10381740 3300025914 Bacteria 1119
399 Ga0207660_10051207 3300025917 Bacteria 2935
400 Ga0207660_10090632 3300025917 Bacteria 2266
401 Ga0207660_10173048 3300025917 Bacteria 1672
402 Ga0207660_10196700 3300025917 Bacteria 1573
403 Ga0207660_10411088 3300025917 Bacteria 1090
404 Ga0207660_10652795 3300025917 Bacteria 858
405 Ga0207657_10000498 3300025919 Bacteria 41427
406 Ga0207657_10015676 3300025919 Bacteria 7331
407 Ga0207657_10025937 3300025919 Bacteria 5396
408 Ga0207657_10110190 3300025919 Bacteria 2274
409 Ga0207657_10110680 3300025919 Bacteria 2268
410 Ga0207657_10164515 3300025919 Bacteria 1800
411 Ga0207657_10208029 3300025919 Bacteria 1571
412 Ga0207657_10402806 3300025919 Bacteria 1076
413 Ga0207657_10443999 3300025919 Bacteria 1018
414 Ga0207657_10444495 3300025919 Bacteria 1018
415 Ga0207657_10941903 3300025919 Bacteria 664
416 Ga0207649_10015637 3300025920 Bacteria 4262
417 Ga0207649_10027806 3300025920 Bacteria 3324
418 Ga0207649_10066892 3300025920 Bacteria 2279
419 Ga0207649_10529448 3300025920 Bacteria 899
420 Ga0207649_10620881 3300025920 Bacteria 833
421 Ga0207649_10972906 3300025920 Bacteria 667
422 Ga0207649_11036369 3300025920 Bacteria 646
423 Ga0207652_10160595 3300025921 Bacteria 2015
424 Ga0207652_10272302 3300025921 Bacteria 1527
425 Ga0207652_10686358 3300025921 Bacteria 914
426 Ga0207681_10000831 3300025923 Bacteria 20385
427 Ga0207681_10062437 3300025923 Bacteria 2565
428 Ga0207681_10580839 3300025923 Bacteria 924
429 Ga0207681_10919412 3300025923 Bacteria 733
430 Ga0207694_10138863 3300025924 Bacteria 1953
431 Ga0207694_10294581 3300025924 Bacteria 1335
432 Ga0207694_10727309 3300025924 Bacteria 837
433 Ga0207694_10824861 3300025924 Bacteria 784
434 Ga0207650_10002137 3300025925 Bacteria 13823
435 Ga0207650_10002559 3300025925 Bacteria 12600
436 Ga0207650_10022349 3300025925 Bacteria 4475
437 Ga0207650_10093206 3300025925 Bacteria 2305
438 Ga0207650_10122878 3300025925 Bacteria 2023
439 Ga0207650_10529085 3300025925 Bacteria 987
440 Ga0207650_11178644 3300025925 Bacteria 652
441 Ga0207659_10001933 3300025926 Bacteria 12291
442 Ga0207659_10076675 3300025926 Bacteria 2458
443 Ga0207659_10312267 3300025926 Bacteria 1295
444 Ga0207659_11439563 3300025926 Bacteria 590
445 Ga0207687_10034955 3300025927 Bacteria 3416
446 Ga0207700_10005815 3300025928 Bacteria 7408
447 Ga0207700_10060988 3300025928 Bacteria 2859
448 Ga0207664_10017354 3300025929 Bacteria 5275
449 Ga0207664_10383266 3300025929 Bacteria 1248
450 Ga0207644_10004456 3300025931 Bacteria 9092
451 Ga0207644_10009917 3300025931 Bacteria 6266
452 Ga0207644_10011493 3300025931 Bacteria 5859
453 Ga0207644_10024088 3300025931 Bacteria 4175
454 Ga0207644_10031224 3300025931 Bacteria 3710
455 Ga0207644_10033928 3300025931 Bacteria 3570
456 Ga0207644_10402141 3300025931 Bacteria 1119
457 Ga0207644_10408973 3300025931 Bacteria 1110
458 Ga0207644_10458404 3300025931 Bacteria 1048
459 Ga0207690_10004368 3300025932 Bacteria 8346
460 Ga0207690_10052734 3300025932 Bacteria 2726
461 Ga0207690_10063126 3300025932 Bacteria 2525
462 Ga0207690_10140438 3300025932 Bacteria 1779
463 Ga0207690_10205644 3300025932 Bacteria 1498
464 Ga0207690_10285988 3300025932 Bacteria 1285
465 Ga0207690_10442085 3300025932 Bacteria 1044
466 Ga0207690_10720553 3300025932 Bacteria 821
467 Ga0207706_10000434 3300025933 Bacteria 44818
468 Ga0207706_10000643 3300025933 Bacteria 37034
469 Ga0207706_10006155 3300025933 Bacteria 11145
470 Ga0207706_10020105 3300025933 Bacteria 6000
471 Ga0207706_10040073 3300025933 Bacteria 4152
472 Ga0207706_10051535 3300025933 Bacteria 3634
473 Ga0207706_10151116 3300025933 Bacteria 2042
474 Ga0207706_10321040 3300025933 Bacteria 1348
475 Ga0207686_10480809 3300025934 Bacteria 960
476 Ga0207709_10276532 3300025935 Bacteria 1238
477 Ga0207670_10965042 3300025936 Bacteria 716
478 Ga0207704_10223352 3300025938 Bacteria 1395
479 Ga0207704_10258601 3300025938 Bacteria 1311
480 Ga0207691_10000848 3300025940 Bacteria 30357
481 Ga0207691_10006573 3300025940 Bacteria 11229
482 Ga0207691_10012290 3300025940 Bacteria 8206
483 Ga0207691_10034100 3300025940 Bacteria 4737
484 Ga0207691_10141473 3300025940 Bacteria 2120
485 Ga0207711_10001567 3300025941 Bacteria 21131
486 Ga0207711_10007842 3300025941 Bacteria 8924
487 Ga0207711_10008771 3300025941 Bacteria 8457
488 Ga0207711_10095340 3300025941 Bacteria 2624
489 Ga0207711_10157718 3300025941 Bacteria 2052
490 Ga0207711_10493690 3300025941 Bacteria 1141
491 Ga0207689_10000017 3300025942 Bacteria 117159
492 Ga0207689_10149305 3300025942 Bacteria 1926
493 Ga0207661_10006807 3300025944 Bacteria 8097
494 Ga0207661_10103793 3300025944 Bacteria 2393
495 Ga0207661_10650032 3300025944 Bacteria 969
496 Ga0207679_10021149 3300025945 Bacteria 4403
497 Ga0207679_10044885 3300025945 Bacteria 3193
498 Ga0207679_10054602 3300025945 Bacteria 2942
499 Ga0207679_10226056 3300025945 Bacteria 1577
500 Ga0207679_10705025 3300025945 Bacteria 916
501 Ga0207679_11685947 3300025945 Bacteria 580
502 Ga0207667_10006366 3300025949 Bacteria 14313
503 Ga0207667_10025673 3300025949 Bacteria 6446
504 Ga0207667_10033723 3300025949 Bacteria 5502
505 Ga0207667_10140147 3300025949 Bacteria 2490
506 Ga0207667_10360992 3300025949 Bacteria 1481
507 Ga0207667_10389063 3300025949 Bacteria 1420
508 Ga0207667_10748518 3300025949 Bacteria 977
509 Ga0207667_10920156 3300025949 Bacteria 865
510 Ga0207651_10029489 3300025960 Bacteria 3477
511 Ga0207651_10154925 3300025960 Bacteria 1788
512 Ga0207651_11685780 3300025960 Bacteria 571
513 Ga0207712_10059802 3300025961 Bacteria 2699
514 Ga0207668_10002511 3300025972 Bacteria 10714
515 Ga0207668_10068185 3300025972 Bacteria 2528
516 Ga0207668_11095151 3300025972 Bacteria 714
517 Ga0207640_10007439 3300025981 Bacteria 6044
518 Ga0207640_10082427 3300025981 Bacteria 2202
519 Ga0207640_10111299 3300025981 Bacteria 1941
520 Ga0207640_10250264 3300025981 Bacteria 1375
521 Ga0207640_10525321 3300025981 Bacteria 990
522 Ga0207640_11498483 3300025981 Bacteria 606
523 Ga0207658_10012708 3300025986 Bacteria 5750
524 Ga0207658_10023843 3300025986 Bacteria 4275
525 Ga0207658_10052281 3300025986 Bacteria 3014
526 Ga0207658_10157041 3300025986 Bacteria 1860
527 Ga0207658_10230225 3300025986 Bacteria 1564
528 Ga0207658_10367412 3300025986 Bacteria 1257
529 Ga0207658_10574915 3300025986 Bacteria 1010
530 Ga0207677_10234197 3300026023 Bacteria 1481
531 Ga0207677_10448896 3300026023 Bacteria 1104
532 Ga0207703_10006160 3300026035 Bacteria 9601
533 Ga0207703_10115565 3300026035 Bacteria 2296
534 Ga0207639_10014617 3300026041 Bacteria 5527
535 Ga0207639_10017808 3300026041 Bacteria 5038
536 Ga0207639_10288428 3300026041 Bacteria 1446
537 Ga0207639_10635176 3300026041 Bacteria 987
538 Ga0207639_11330388 3300026041 Bacteria 674
539 Ga0207678_10040754 3300026067 Bacteria 4026
540 Ga0207678_10055633 3300026067 Bacteria 3408
541 Ga0207678_10058506 3300026067 Bacteria 3316
542 Ga0207678_10066389 3300026067 Bacteria 3098
543 Ga0207678_10241284 3300026067 Bacteria 1548
544 Ga0207678_10409597 3300026067 Bacteria 1175
545 Ga0207678_11325875 3300026067 Bacteria 637
546 Ga0207702_10009761 3300026078 Bacteria 8056
547 Ga0207702_10025972 3300026078 Bacteria 4862
548 Ga0207702_10129822 3300026078 Bacteria 2266
549 Ga0207702_10146001 3300026078 Bacteria 2147
550 Ga0207702_10206942 3300026078 Bacteria 1822
551 Ga0207702_10210301 3300026078 Bacteria 1808
552 Ga0207702_10738362 3300026078 Bacteria 971
553 Ga0207641_10004849 3300026088 Bacteria 11583
554 Ga0207641_10009703 3300026088 Bacteria 7931
555 Ga0207641_10078747 3300026088 Bacteria 2855
556 Ga0207641_10190416 3300026088 Bacteria 1885
557 Ga0207641_10302105 3300026088 Bacteria 1512
558 Ga0207641_10831718 3300026088 Bacteria 914
559 Ga0207641_10970131 3300026088 Bacteria 846
560 Ga0207648_10001216 3300026089 Bacteria 28854
561 Ga0207648_10048278 3300026089 Bacteria 3727
562 Ga0207648_10058599 3300026089 Bacteria 3358
563 Ga0207648_10126213 3300026089 Bacteria 2251
564 Ga0207676_10006309 3300026095 Bacteria 8373
565 Ga0207676_10011151 3300026095 Bacteria 6418
566 Ga0207676_10028424 3300026095 Bacteria 4176
567 Ga0207676_10053258 3300026095 Bacteria 3167
568 Ga0207676_10674189 3300026095 Bacteria 999
569 Ga0207674_10000291 3300026116 Bacteria 63446
570 Ga0207674_10000945 3300026116 Bacteria 37959
571 Ga0207674_10001193 3300026116 Bacteria 33801
572 Ga0207674_10005118 3300026116 Bacteria 15649
573 Ga0207674_10016857 3300026116 Bacteria 7983
574 Ga0207674_10036580 3300026116 Bacteria 5112
575 Ga0207674_10418923 3300026116 Bacteria 1294
576 Ga0207675_100025857 3300026118 Bacteria 5460
577 Ga0207683_10004757 3300026121 Bacteria 11694
578 Ga0207683_10107768 3300026121 Bacteria 2493
579 Ga0207683_11473710 3300026121 Bacteria 629
580 Ga0207698_10005257 3300026142 Bacteria 7964
581 Ga0207698_10011284 3300026142 Bacteria 5786
582 Ga0207698_10024762 3300026142 Bacteria 4218
583 Ga0207698_10070914 3300026142 Bacteria 2763
584 Ga0207698_10094789 3300026142 Bacteria 2455
585 Ga0207698_10859516 3300026142 Bacteria 912
586 Ga0209984_1021948 3300027424 Bacteria 877
587 Ga0209971_1013608 3300027682 Bacteria 1926
588 Ga0209974_10001961 3300027876 Bacteria 7514
589 Ga0207428_10219894 3300027907 Bacteria 1424
590 Ga0268266_10164139 3300028379 Bacteria 2011
591 Ga0268266_10530908 3300028379 Bacteria 1126
592 Ga0268265_10149211 3300028380 Bacteria 1970
593 Ga0268265_10229882 3300028380 Bacteria 1629
594 Ga0268264_10026083 3300028381 Bacteria 4772
595 Ga0268264_10455225 3300028381 Bacteria 1241
596 Ga0268264_10532030 3300028381 Bacteria 1150
597 Ga0268264_11103686 3300028381 Bacteria 802
598 Ga0316176_1120040 3300030732 Bacteria 626
599 Ga0307408_100012989 3300031548 Bacteria 5522
600 Ga0307408_100052205 3300031548 Bacteria 2948
601 Ga0307408_100070049 3300031548 Bacteria 2588
602 Ga0307408_100178276 3300031548 Bacteria 1702
603 Ga0307408_100542001 3300031548 Bacteria 1025
604 Ga0307405_10000626 3300031731 Bacteria 13600
605 Ga0307405_10002297 3300031731 Bacteria 8380
606 Ga0307405_10022285 3300031731 Bacteria 3578
607 Ga0307405_10277877 3300031731 Bacteria 1259
608 Ga0307413_10004491 3300031824 Bacteria 6078
609 Ga0307413_10009177 3300031824 Bacteria 4720
610 Ga0307413_10348693 3300031824 Bacteria 1141
611 Ga0307413_10684879 3300031824 Bacteria 850
612 Ga0307410_10003112 3300031852 Bacteria 8233
613 Ga0307410_10005525 3300031852 Bacteria 6702
614 Ga0307410_10067979 3300031852 Bacteria 2459
615 Ga0307406_10003488 3300031901 Bacteria 8558
616 Ga0307406_10037316 3300031901 Bacteria 3000
617 Ga0307406_10047768 3300031901 Bacteria 2699
618 Ga0307406_10349733 3300031901 Bacteria 1154
619 Ga0307407_10002164 3300031903 Bacteria 7561
620 Ga0307407_10029704 3300031903 Bacteria 2940
621 Ga0307407_10059633 3300031903 Bacteria 2223
622 Ga0307407_10438104 3300031903 Bacteria 946
623 Ga0307412_10001854 3300031911 Bacteria 11712
624 Ga0307412_10020382 3300031911 Bacteria 4034
625 Ga0307412_10100260 3300031911 Bacteria 2047
626 Ga0307412_10132616 3300031911 Bacteria 1812
627 Ga0307412_10255301 3300031911 Bacteria 1363
628 Ga0307409_100001095 3300031995 Bacteria 12802
629 Ga0307409_100019937 3300031995 Bacteria 4555
630 Ga0307409_100456022 3300031995 Bacteria 1235
631 Ga0307409_101256337 3300031995 Bacteria 765
632 Ga0307409_102054761 3300031995 Bacteria 601
633 Ga0307416_100001984 3300032002 Bacteria 11477
634 Ga0307416_100004786 3300032002 Bacteria 8223
635 Ga0307416_100032267 3300032002 Bacteria 3954
636 Ga0307416_101674662 3300032002 Bacteria 741
637 Ga0307416_103402130 3300032002 Bacteria 532
638 Ga0307414_10034370 3300032004 Bacteria 3360
639 Ga0307414_10037566 3300032004 Bacteria 3244
640 Ga0307414_10061292 3300032004 Bacteria 2664
641 Ga0307414_10089951 3300032004 Bacteria 2277
642 Ga0307411_10007882 3300032005 Bacteria 5470
643 Ga0307411_10009212 3300032005 Bacteria 5174
644 Ga0307411_10050703 3300032005 Bacteria 2704
645 Ga0307411_10062292 3300032005 Bacteria 2487
646 Ga0307411_10340059 3300032005 Bacteria 1219
647 Ga0307411_10362328 3300032005 Bacteria 1186
648 Ga0307411_11042131 3300032005 Bacteria 734
649 Ga0307415_100005907 3300032126 Bacteria 6550
650 Ga0307415_100017321 3300032126 Bacteria 4318
651 Ga0307415_100061686 3300032126 Bacteria 2597
652 Ga0307415_100120534 3300032126 Bacteria 1966
653 Ga0307415_100229362 3300032126 Bacteria 1494
654 Ga0307415_101569314 3300032126 Bacteria 631
655 Ga0373929_0051313 3300035085 Bacteria 943
656 Ga0373940_0217241 3300035088 Bacteria 634
657 Ga0373923_0005226 3300035111 Bacteria 4394
658 Ga0373954_0023501 3300035118 Bacteria 2803
659 Ga0373956_0055759 3300035119 Bacteria 1783
660 Ga0373957_0077792 3300035120 Unclassified 1306
661 Ga0373955_0020079 3300035172 Bacteria 3353
662 Ga0373961_0054344 3300035241 Bacteria 1197
663 Ga0373931_0882461 3300035691 Unclassified 600
664 Ga0373935_0118829 3300035692 Bacteria 1763
665 Ga0373927_0474661 3300035695 Unclassified 826
666 Ga0373933_0044188 3300035724 Bacteria 2638
667 Ga0373937_0012365 3300036401 Bacteria 7506
668 Ga0395899_0000812 3300037312 Bacteria 30409
669 Ga0395899_0009444 3300037312 Bacteria 7490
670 Ga0395899_0022362 3300037312 Bacteria 4795
671 Ga0395899_0029913 3300037312 Bacteria 4098
672 Ga0395899_0035075 3300037312 Bacteria 3767
673 Ga0395899_0103661 3300037312 Bacteria 2051
674 Ga0395899_0111177 3300037312 Bacteria 1970
675 Ga0395899_0133540 3300037312 Bacteria 1771
676 Ga0395899_0175177 3300037312 Bacteria 1509
677 Ga0395899_0185263 3300037312 Bacteria 1459
678 Ga0395899_0284555 3300037312 Bacteria 1124
679 Ga0395900_0002024 3300037418 Bacteria 22806
680 Ga0395900_0013285 3300037418 Bacteria 8418
681 Ga0395900_0040455 3300037418 Bacteria 4804
682 Ga0395900_0041223 3300037418 Bacteria 4760
683 Ga0395900_0048165 3300037418 Bacteria 4390
684 Ga0395900_0112839 3300037418 Bacteria 2790
685 Ga0395900_0260243 3300037418 Bacteria 1733
686 Ga0395900_0317527 3300037418 Bacteria 1539
687 Ga0395900_0394902 3300037418 Bacteria 1348
688 Ga0395900_0415280 3300037418 Bacteria 1307
689 Ga0395900_0423778 3300037418 Bacteria 1291
690 Ga0395900_0476798 3300037418 Bacteria 1200
691 Ga0395900_0544187 3300037418 Bacteria 1106
692 Ga0395900_0770734 3300037418 Bacteria 891
693 Ga0395900_0774495 3300037418 Bacteria 889
694 Ga0395900_0914374 3300037418 Bacteria 800
695 Ga0395900_0927411 3300037418 Bacteria 793
696 Ga0395900_1261344 3300037418 Bacteria 653
697 Ga0395900_1697718 3300037418 Bacteria 542
698 Ga0395898_0002775 3300037466 Bacteria 20134
699 Ga0395898_0059780 3300037466 Bacteria 3706
700 Ga0395898_0071650 3300037466 Bacteria 3348
701 Ga0395898_0077679 3300037466 Bacteria 3205
702 Ga0395898_0128155 3300037466 Bacteria 2431
703 Ga0395898_0138592 3300037466 Bacteria 2329
704 Ga0395898_0236669 3300037466 Bacteria 1741
705 Ga0395898_0476343 3300037466 Bacteria 1188
706 Ga0395898_0489624 3300037466 Bacteria 1170
707 Ga0395898_0575167 3300037466 Bacteria 1069
708 Ga0395898_1068086 3300037466 Bacteria 741
709 Ga0395905_0005582 3300037471 Bacteria 12816
710 Ga0395905_0009405 3300037471 Bacteria 9557
711 Ga0395905_0017282 3300037471 Bacteria 6850
712 Ga0395905_0025660 3300037471 Bacteria 5557
713 Ga0395905_0040141 3300037471 Bacteria 4390
714 Ga0395905_0042805 3300037471 Bacteria 4248
715 Ga0395905_0043567 3300037471 Bacteria 4210
716 Ga0395905_0048497 3300037471 Bacteria 3980
717 Ga0395905_0061157 3300037471 Bacteria 3522
718 Ga0395905_0063290 3300037471 Bacteria 3461
719 Ga0395905_0070782 3300037471 Bacteria 3269
720 Ga0395905_0091876 3300037471 Bacteria 2846
721 Ga0395905_0118065 3300037471 Bacteria 2493
722 Ga0395905_0142641 3300037471 Bacteria 2253
723 Ga0395905_0156502 3300037471 Bacteria 2143
724 Ga0395905_0207868 3300037471 Bacteria 1834
725 Ga0395905_0217519 3300037471 Bacteria 1789
726 Ga0395905_0311527 3300037471 Bacteria 1462
727 Ga0395905_0768996 3300037471 Bacteria 866
728 Ga0395905_0932954 3300037471 Bacteria 771
729 Ga0395905_0976812 3300037471 Bacteria 750
730 Ga0395905_0994515 3300037471 Bacteria 742
731 Ga0395905_1038585 3300037471 Bacteria 723
732 Ga0395905_1051375 3300037471 Bacteria 717
733 Ga0395905_1061559 3300037471 Bacteria 713
734 Ga0395905_1083190 3300037471 Unclassified 704
735 Ga0395905_1105885 3300037471 Bacteria 696
736 Ga0395905_1389695 3300037471 Bacteria 606
737 Ga0395901_0006117 3300038443 Bacteria 12197
738 Ga0395901_0006917 3300038443 Bacteria 11463
739 Ga0395901_0008144 3300038443 Bacteria 10588
740 Ga0395901_0021112 3300038443 Bacteria 6672
741 Ga0395901_0050395 3300038443 Bacteria 4326
742 Ga0395901_0083417 3300038443 Bacteria 3340
743 Ga0395901_0088931 3300038443 Bacteria 3231
744 Ga0395901_0095141 3300038443 Bacteria 3121
745 Ga0395901_0163530 3300038443 Bacteria 2337
746 Ga0395901_0207550 3300038443 Bacteria 2051
747 Ga0395901_0208133 3300038443 Bacteria 2048
748 Ga0395901_0278976 3300038443 Bacteria 1737
749 Ga0395901_0285301 3300038443 Bacteria 1714
750 Ga0395901_0348133 3300038443 Bacteria 1529
751 Ga0395901_0549286 3300038443 Bacteria 1171
752 Ga0395901_0793452 3300038443 Bacteria 936
753 Ga0439436_0037937 3300041404 Bacteria 1387
754 Ga0439445_0000105 3300042004 Bacteria 13878
755 Ga0439445_0082210 3300042004 Bacteria 901
756 Ga0439448_0010114 3300042005 Bacteria 2789
757 Ga0439458_0000046 3300042157 Bacteria 19982
758 Ga0439458_0006115 3300042157 Bacteria 2687
759 Ga0439458_0006417 3300042157 Bacteria 2624
760 Ga0439460_0028968 3300042461 Bacteria 1565
761 Ga0466969_0019829 3300044656 Bacteria 3488
762 Ga0466972_0083136 3300044658 Bacteria 1523
763 Ga0466966_0011986 3300044684 Bacteria 5745
764 Ga0466966_0015446 3300044684 Bacteria 5047
765 Ga0466966_0124213 3300044684 Bacteria 1584
766 Ga0466966_0430520 3300044684 Bacteria 793
767 Ga0466961_0012441 3300044693 Bacteria 5444
768 Ga0466961_0047553 3300044693 Bacteria 2743
769 Ga0466961_0216435 3300044693 Bacteria 1181
770 Ga0466961_0909799 3300044693 Bacteria 524
771 Ga0466963_0003141 3300044694 Bacteria 9368
772 Ga0466963_0027424 3300044694 Bacteria 3647
773 Ga0466963_0033240 3300044694 Bacteria 3346
774 Ga0466963_0061123 3300044694 Bacteria 2518
775 Ga0466963_0276293 3300044694 Bacteria 1180
776 Ga0466963_0384489 3300044694 Bacteria 989
777 Ga0466963_0547356 3300044694 Bacteria 817
778 Ga0466963_1020901 3300044694 Bacteria 582
779 Ga0466964_0159966 3300044706 Bacteria 1052
780 Ga0466971_0004427 3300044719 Bacteria 6062
781 Ga0466971_0045695 3300044719 Bacteria 1967
782 Ga0466971_0326577 3300044719 Bacteria 740
783 Ga0466971_0390288 3300044719 Bacteria 677
784 Ga0466970_0022753 3300044765 Bacteria 3270
785 Ga0466970_0126849 3300044765 Bacteria 1400
786 Ga0466970_0249076 3300044765 Bacteria 995
787 Ga0466970_0274312 3300044765 Bacteria 948
788 Ga0466970_0335868 3300044765 Bacteria 856
789 Ga0466957_0003622 3300044842 Bacteria 8514
790 Ga0466957_0007619 3300044842 Bacteria 6121
791 Ga0466957_0110016 3300044842 Bacteria 1746
792 Ga0466957_0116975 3300044842 Bacteria 1696
793 Ga0466957_0339306 3300044842 Bacteria 1017
794 Ga0466957_0668991 3300044842 Bacteria 731
795 Ga0466959_0087680 3300045049 Bacteria 2238
796 Ga0466959_0141268 3300045049 Bacteria 1701
797 Ga0466959_0890987 3300045049 Unclassified 594
798 Ga0466958_0001545 3300045836 Bacteria 11025
799 Ga0466958_0007544 3300045836 Bacteria 5987
800 Ga0466958_0017892 3300045836 Bacteria 4106
801 Ga0466958_0029457 3300045836 Bacteria 3258
802 Ga0466958_0565306 3300045836 Bacteria 739
803 Ga0466967_0008598 3300045976 Bacteria 7502
804 Ga0466967_0036666 3300045976 Bacteria 4188
805 Ga0466967_0087784 3300045976 Bacteria 2820
806 Ga0466967_0215313 3300045976 Bacteria 1823
807 Ga0466967_0254949 3300045976 Bacteria 1677
808 Ga0466967_0315541 3300045976 Bacteria 1507
809 Ga0466967_0381177 3300045976 Bacteria 1369
810 Ga0466967_0541500 3300045976 Bacteria 1145
811 Ga0466967_1488162 3300045976 Bacteria 674
812 Ga0495585_0326146 3300046492 Bacteria 750
813 Ga0495594_0395258 3300046499 Bacteria 787
814 Ga0495663_0013499 3300046525 Bacteria 2284
815 Ga0495663_0293516 3300046525 Bacteria 584
816 Ga0495642_0043634 3300046528 Bacteria 1829
817 Ga0495621_0240423 3300046539 Bacteria 737
818 Ga0495621_0262762 3300046539 Bacteria 707
819 Ga0495633_0211366 3300046558 Bacteria 889
820 Ga0495659_0039421 3300046664 Bacteria 1680
821 Ga0495623_0042082 3300046679 Bacteria 2911
822 Ga0495647_0210576 3300046681 Bacteria 855
823 Ga0495669_0176675 3300046684 Bacteria 1017
824 Ga0495669_0303790 3300046684 Bacteria 769
825 Ga0495669_0550935 3300046684 Bacteria 561
826 Ga0495670_0060332 3300046691 Bacteria 1905
827 Ga0495670_0169221 3300046691 Bacteria 1150
828 Ga0495636_0384244 3300047318 Bacteria 667
829 Ga0495677_0268722 3300047445 Bacteria 668
830 Ga0495677_0295767 3300047445 Bacteria 636
831 Ga0495602_0035064 3300048088 Bacteria 4684
832 Ga0496100_0171348 3300048903 Bacteria 1563
833 Ga0496100_0183791 3300048903 Bacteria 1513
834 Ga0496101_0021683 3300048904 Bacteria 4415
835 Ga0496101_0074074 3300048904 Bacteria 2503
836 Ga0496101_0122287 3300048904 Bacteria 1969
837 Ga0496101_0413143 3300048904 Bacteria 1063
838 Ga0496101_0450634 3300048904 Bacteria 1015
839 Ga0496102_0014137 3300048905 Bacteria 6934
840 Ga0496103_0006147 3300048906 Bacteria 7175
841 Ga0496104_0169749 3300048907 Bacteria 2092
842 Ga0496104_1035918 3300048907 Bacteria 724
843 Ga0496105_0228884 3300048908 Bacteria 1511
844 Ga0496106_0016983 3300048909 Bacteria 5385
845 Ga0496106_0052969 3300048909 Bacteria 3063
846 Ga0496106_0644336 3300048909 Bacteria 847
847 Ga0496107_0009566 3300048910 Bacteria 6723
848 Ga0496107_0045144 3300048910 Bacteria 3169
849 Ga0496107_0128850 3300048910 Bacteria 1867
850 Ga0496108_0006025 3300048911 Bacteria 9816
851 Ga0496108_0019916 3300048911 Bacteria 5511
852 Ga0496108_0020380 3300048911 Bacteria 5450
853 Ga0496108_0186000 3300048911 Bacteria 1799
854 Ga0496109_0004440 3300048912 Bacteria 11716
855 Ga0496109_0007928 3300048912 Bacteria 9001
856 Ga0496109_0557844 3300048912 Bacteria 1080
857 Ga0496109_0766756 3300048912 Bacteria 902
858 Ga0496110_0011287 3300048913 Bacteria 7304
859 Ga0496110_0015206 3300048913 Bacteria 6402
860 Ga0496110_0032011 3300048913 Bacteria 4539
861 Ga0496110_0223753 3300048913 Bacteria 1711
862 Ga0496110_1001178 3300048913 Bacteria 743
863 Ga0496111_0006733 3300048914 Bacteria 7482
864 Ga0496111_0007954 3300048914 Bacteria 6993
865 Ga0496111_0054578 3300048914 Bacteria 2888
866 Ga0496112_0013956 3300048915 Bacteria 7434
867 Ga0496112_0028899 3300048915 Bacteria 5357
868 Ga0496112_0049956 3300048915 Bacteria 4100
869 Ga0496112_0589934 3300048915 Bacteria 1043
870 Ga0496112_0652185 3300048915 Bacteria 982
871 Ga0496113_0001208 3300048916 Bacteria 14160
872 Ga0496113_0033612 3300048916 Bacteria 3736
873 Ga0496113_0383162 3300048916 Bacteria 1128
874 Ga0496113_0390849 3300048916 Bacteria 1116
875 Ga0496114_0049901 3300048917 Bacteria 3482
876 Ga0496115_0001276 3300048918 Bacteria 18017
877 Ga0501067_0280272 3300049583 Bacteria 928
878 Ga0501071_0435646 3300049587 Bacteria 1003
879 Ga0501224_047305 3300049664 Bacteria 655
880 nmdc:mga07m45_439095_c1 3300050496 Bacteria 757
881 nmdc:mga06r32_58772_c1 3300050510 Bacteria 3696
882 nmdc:mga08y16_276147_c1 3300050511 Bacteria 1734
883 Ga0500616_0014806 3300053153 Bacteria 4472
884 Ga0587068_161741 3300059641 Bacteria 513
885 Ga0466962_0030127 3300061719 Bacteria 2598
886 Ga0466962_0103970 3300061719 Bacteria 1364
887 Ga0466962_0127051 3300061719 Bacteria 1231
888 Ga0466962_0134009 3300061719 Bacteria 1198
889 2885427995 2885427238 Bacteria 2291351
890 Ga0070671_100039155
891 JGI24752J21851_1004840
892 JGI24740J21852_10005844
893 JGI24740J21852_10033082
894 JGI24739J22299_10000986
895 JGI24739J22299_10054434
896 JGI24737J22298_10000178
897 JGI24737J22298_10001788
898 JGI24737J22298_10011626
899 JGI24737J22298_10164511
900 JGI24735J21928_10038730
901 JGI24750J21931_1062571
902 JGI24738J21930_10000019
903 JGI24738J21930_10019155
904 JGI24749J21850_1000981
905 JGI24034J26672_10049928
906 JGI24742J22300_10063806
907 JGI24751J29686_10062656
908 Ga0065715_10098022
909 Ga0070658_10014597
910 Ga0070658_10069253
911 Ga0070658_10130354
912 Ga0070658_10143861
913 Ga0070658_10183856
914 Ga0070658_10461107
915 Ga0070658_11096441
916 Ga0070676_10004650
917 Ga0070676_10016959
918 Ga0070683_100011140
919 Ga0070683_100043658
920 Ga0070683_100226583
921 Ga0070683_100491747
922 Ga0070683_101997500
923 Ga0070690_100240700
924 Ga0070690_100241789
925 Ga0070670_100002756
926 Ga0070670_100007934
927 Ga0070670_100024830
928 Ga0070670_100051620
929 Ga0070670_100233630
930 Ga0070670_100307705
931 Ga0070670_102145378
932 Ga0070677_10109221
933 Ga0068869_100005344
934 Ga0070666_10161980
935 Ga0070666_10163966
936 Ga0070680_100029453
937 Ga0070680_100032619
938 Ga0070680_100060218
939 Ga0070680_100240970
940 Ga0070680_100307079
941 Ga0070680_100391560
942 Ga0070680_100481738
943 Ga0070682_100117710
944 Ga0070682_100176851
945 Ga0068868_100005396
946 Ga0068868_100073237
947 Ga0070660_100000423
948 Ga0070660_100035431
949 Ga0070660_100042485
950 Ga0070660_100108280
951 Ga0070660_100122164
952 Ga0070660_100210990
953 Ga0070660_100291188
954 Ga0070660_101084628
955 Ga0070689_100190866
956 Ga0070691_10533760
957 Ga0070661_100007304
958 Ga0070661_100009456
959 Ga0070661_100041572
960 Ga0070661_100042051
961 Ga0070661_100064758
962 Ga0070661_100129611
963 Ga0070661_100231040
964 Ga0070661_100246851
965 Ga0070661_100537818
966 Ga0070661_100587366
967 Ga0070661_100739213
968 Ga0070661_100776763
969 Ga0070692_10163068
970 Ga0070692_10212200
971 Ga0070692_10816302
972 Ga0070668_100026024
973 Ga0070668_100310237
974 Ga0070669_100000892
975 Ga0070669_100003371
976 Ga0070669_100209240
977 Ga0070675_100001809
978 Ga0070675_101046837
979 Ga0070671_100000712
980 Ga0070671_100007958
981 Ga0070671_100027970
982 Ga0070671_100042418
983 Ga0070671_100044153
984 Ga0070671_100106258
985 Ga0070671_100319731
986 Ga0070671_100641112
987 Ga0070674_100001014
988 Ga0070674_100101960
989 Ga0070673_100004134
990 Ga0070673_100020701
991 Ga0070673_100038539
992 Ga0070673_100857945
993 Ga0070659_100001538
994 Ga0070659_100002296
995 Ga0070659_100044019
996 Ga0070659_100108678
997 Ga0070659_100160385
998 Ga0070659_100518523
999 Ga0070659_100631028
1000 Ga0070659_100852083
1001 Ga0070659_101408219
1002 Ga0070659_101425264
1003 Ga0070667_100001807
1004 Ga0070667_100003644
1005 Ga0070667_100065977
1006 Ga0070667_100097161
1007 Ga0070667_100112697
1008 Ga0070667_100219127
1009 Ga0070667_100571972
1010 Ga0070709_10815991
1011 Ga0070714_100004266
1012 Ga0070714_100046703
1013 Ga0070714_100928091
1014 Ga0070713_100009365
1015 Ga0070713_101093222
1016 Ga0070663_100031309
1017 Ga0070663_100038228
1018 Ga0070663_100042522
1019 Ga0070663_100127199
1020 Ga0070663_101057341
1021 Ga0070663_101311114
1022 Ga0070678_100002562
1023 Ga0070678_100023223
1024 Ga0070678_101630155
1025 Ga0070662_100007085
1026 Ga0070662_100019060
1027 Ga0070662_100034545
1028 Ga0070662_100038256
1029 Ga0070662_100101957
1030 Ga0070662_100142786
1031 Ga0070662_100514885
1032 Ga0070662_100544980
1033 Ga0070681_10120116
1034 Ga0070681_10156609
1035 Ga0068867_100088841
1036 Ga0068867_100097936
1037 Ga0068867_100106016
1038 Ga0068867_100260541
1039 Ga0068867_100260700
1040 Ga0070685_10094256
1041 Ga0070699_101190257
1042 Ga0070679_100027723
1043 Ga0070679_100068369
1044 Ga0070679_100313042
1045 Ga0070684_100051520
1046 Ga0070684_100071576
1047 Ga0070684_101460903
1048 Ga0068853_100002073
1049 Ga0068853_100020059
1050 Ga0068853_100107279
1051 Ga0068853_100215172
1052 Ga0068853_100405415
1053 Ga0068853_100548680
1054 Ga0068853_100613681
1055 Ga0068853_100757631
1056 Ga0068853_101091269
1057 Ga0068853_101894852
1058 Ga0070672_100016536
1059 Ga0070672_100024761
1060 Ga0070672_100038130
1061 Ga0070672_100061272
1062 Ga0070672_100165100
1063 Ga0070693_100224730
1064 Ga0070693_100323036
1065 Ga0070665_100317150
1066 Ga0070665_100624116
1067 Ga0070704_101210268
1068 Ga0068855_100015087
1069 Ga0068855_100031856
1070 Ga0068855_100099451
1071 Ga0068855_100230153
1072 Ga0068855_100257040
1073 Ga0068855_100317529
1074 Ga0068855_100330984
1075 Ga0070664_100008445
1076 Ga0070664_100008637
1077 Ga0070664_100019637
1078 Ga0070664_100029864
1079 Ga0070664_100260742
1080 Ga0070664_102239025
1081 Ga0068857_100001908
1082 Ga0068857_100002339
1083 Ga0068857_100002386
1084 Ga0068857_100114503
1085 Ga0068857_100327028
1086 Ga0068857_101365942
1087 Ga0068854_100011842
1088 Ga0068854_100128427
1089 Ga0068854_100230276
1090 Ga0068854_100292758
1091 Ga0068854_100624385
1092 Ga0068856_100022493
1093 Ga0068856_100027852
1094 Ga0068856_100042798
1095 Ga0068856_100067832
1096 Ga0068856_100141628
1097 Ga0068856_100222153
1098 Ga0068856_101822278
1099 Ga0068852_100000701
1100 Ga0068852_100090713
1101 Ga0068852_100141178
1102 Ga0068852_100756618
1103 Ga0068852_100936011
1104 Ga0068859_100006464
1105 Ga0068859_100027420
1106 Ga0068864_100005384
1107 Ga0068864_100006956
1108 Ga0068864_100018481
1109 Ga0068864_100063773
1110 Ga0068864_100387043
1111 Ga0068864_100466555
1112 Ga0068861_100024656
1113 Ga0068861_100057430
1114 Ga0068851_10008558
1115 Ga0068851_10011442
1116 Ga0068851_10118637
1117 Ga0068851_10120696
1118 Ga0068851_10228243
1119 Ga0068870_10431853
1120 Ga0068863_100001683
1121 Ga0068863_100009537
1122 Ga0068863_100033101
1123 Ga0068863_100103851
1124 Ga0068863_100614272
1125 Ga0068863_101230555
1126 Ga0068858_100009735
1127 Ga0068858_100036512
1128 Ga0068860_100008834
1129 Ga0068860_100063178
1130 Ga0068862_100139603
1131 Ga0068862_100155970
1132 Ga0070717_10004039
1133 Ga0075366_10098214
1134 Ga0097621_100023123
1135 Ga0097621_100095360
1136 Ga0097621_100171687
1137 Ga0097621_100279265
1138 Ga0097621_100471702
1139 Ga0075370_10490078
1140 Ga0068871_100020850
1141 Ga0068871_100027598
1142 Ga0068871_100031082
1143 Ga0068871_100299296
1144 Ga0068871_100715917
1145 Ga0068871_101387631
1146 Ga0075428_100488913
1147 Ga0075431_100022236
1148 Ga0075434_100411586
1149 Ga0075434_100857051
1150 Ga0068865_100009858
1151 Ga0068865_100881888
1152 Ga0097620_100006464
1153 Ga0097620_100027420
1154 Ga0105240_10112581
1155 Ga0105240_10376382
1156 Ga0111539_10004793
1157 Ga0105245_10000285
1158 Ga0105243_10397563
1159 Ga0105241_10237537
1160 Ga0105241_10429567
1161 Ga0105241_10460335
1162 Ga0105241_10766591
1163 Ga0105241_10969078
1164 Ga0105242_10133119
1165 Ga0105242_10305557
1166 Ga0105242_10576560
1167 Ga0105242_10609450
1168 Ga0105248_10010330
1169 Ga0105248_10012012
1170 Ga0105248_10012166
1171 Ga0105248_10059122
1172 Ga0105248_10059421
1173 Ga0105248_10097341
1174 Ga0105248_10112342
1175 Ga0105248_10330471
1176 Ga0105248_10359963
1177 Ga0105248_10744693
1178 Ga0105237_10263102
1179 Ga0105237_10643577
1180 Ga0105238_10036351
1181 Ga0105238_10417398
1182 Ga0105238_10699870
1183 Ga0105238_10773192
1184 Ga0105238_12022421
1185 Ga0105249_10002745
1186 Ga0105249_10176509
1187 Ga0105246_10178278
1188 Ga0105246_10200653
1189 Ga0157373_10036877
1190 Ga0157373_10049263
1191 Ga0157373_10076088
1192 Ga0157373_10112415
1193 Ga0157373_10141371
1194 Ga0157373_10163133
1195 Ga0157373_10233544
1196 Ga0157371_10001670
1197 Ga0157371_10004693
1198 Ga0157371_10112355
1199 Ga0157371_10136648
1200 Ga0157371_10326387
1201 Ga0157371_10411039
1202 Ga0157371_10648050
1203 Ga0157370_10007886
1204 Ga0157370_10012692
1205 Ga0157370_10047619
1206 Ga0157370_10719663
1207 Ga0157369_10042840
1208 Ga0157369_10080465
1209 Ga0157369_10177643
1210 Ga0157369_10293987
1211 Ga0157369_10325344
1212 Ga0157369_10353856
1213 Ga0157369_10360693
1214 Ga0157369_11551582
1215 Ga0157369_11666519
1216 Ga0157369_11814217
1217 Ga0157374_10007910
1218 Ga0157374_10176717
1219 Ga0157378_10017165
1220 Ga0163162_10013549
1221 Ga0163162_10158398
1222 Ga0163162_10416478
1223 Ga0163162_11200785
1224 Ga0157372_10060893
1225 Ga0157372_10094809
1226 Ga0157372_10190637
1227 Ga0157372_10257558
1228 Ga0157372_11401183
1229 Ga0157372_12944650
1230 Ga0157372_13201938
1231 Ga0157375_10014464
1232 Ga0157375_10193359
1233 Ga0157375_10203764
1234 Ga0163163_10053606
1235 Ga0163163_10234044
1236 Ga0163163_10243001
1237 Ga0157380_10000705
1238 Ga0157380_10012744
1239 Ga0182008_10015215
1240 Ga0157377_10756731
1241 Ga0157379_10002119
1242 Ga0157379_10305558
1243 Ga0163161_10004895
1244 Ga0206354_11019307
1245 Ga0207673_1003471
1246 Ga0207673_1005750
1247 Ga0207697_10000058
1248 Ga0207697_10002920
1249 Ga0207697_10217631
1250 Ga0207656_10005330
1251 Ga0207656_10018371
1252 Ga0207656_10172211
1253 Ga0207710_10615541
1254 Ga0207688_10039282
1255 Ga0207688_10503437
1256 Ga0207680_10092030
1257 Ga0207680_10144345
1258 Ga0207680_10233633
1259 Ga0207680_10388629
1260 Ga0207647_10000253
1261 Ga0207647_10004667
1262 Ga0207647_10006724
1263 Ga0207647_10023893
1264 Ga0207647_10029809
1265 Ga0207647_10042891
1266 Ga0207645_10008485
1267 Ga0207645_10013482
1268 Ga0207643_10642553
1269 Ga0207705_10001709
1270 Ga0207705_10002772
1271 Ga0207705_10003854
1272 Ga0207705_10026901
1273 Ga0207705_10032390
1274 Ga0207705_10237384
1275 Ga0207705_10349346
1276 Ga0207705_10425071
1277 Ga0207705_10946395
1278 Ga0207705_11310777
1279 Ga0207654_10207160
1280 Ga0207654_10655370
1281 Ga0207707_10119921
1282 Ga0207707_10320566
1283 Ga0207707_11171676
1284 Ga0207695_10021452
1285 Ga0207671_10129153
1286 Ga0207671_10186038
1287 Ga0207671_10381740
1288 Ga0207660_10051207
1289 Ga0207660_10090632
1290 Ga0207660_10173048
1291 Ga0207660_10196700
1292 Ga0207660_10411088
1293 Ga0207660_10652795
1294 Ga0207657_10000498
1295 Ga0207657_10015676
1296 Ga0207657_10025937
1297 Ga0207657_10110190
1298 Ga0207657_10110680
1299 Ga0207657_10164515
1300 Ga0207657_10208029
1301 Ga0207657_10402806
1302 Ga0207657_10443999
1303 Ga0207657_10444495
1304 Ga0207657_10941903
1305 Ga0207649_10015637
1306 Ga0207649_10027806
1307 Ga0207649_10066892
1308 Ga0207649_10529448
1309 Ga0207649_10620881
1310 Ga0207649_10972906
1311 Ga0207649_11036369
1312 Ga0207652_10160595
1313 Ga0207652_10272302
1314 Ga0207652_10686358
1315 Ga0207681_10000831
1316 Ga0207681_10062437
1317 Ga0207681_10580839
1318 Ga0207681_10919412
1319 Ga0207694_10138863
1320 Ga0207694_10294581
1321 Ga0207694_10727309
1322 Ga0207694_10824861
1323 Ga0207650_10002137
1324 Ga0207650_10002559
1325 Ga0207650_10022349
1326 Ga0207650_10093206
1327 Ga0207650_10122878
1328 Ga0207650_10529085
1329 Ga0207650_11178644
1330 Ga0207659_10001933
1331 Ga0207659_10076675
1332 Ga0207659_10312267
1333 Ga0207659_11439563
1334 Ga0207687_10034955
1335 Ga0207700_10005815
1336 Ga0207700_10060988
1337 Ga0207664_10017354
1338 Ga0207664_10383266
1339 Ga0207644_10004456
1340 Ga0207644_10009917
1341 Ga0207644_10011493
1342 Ga0207644_10024088
1343 Ga0207644_10031224
1344 Ga0207644_10033928
1345 Ga0207644_10402141
1346 Ga0207644_10408973
1347 Ga0207644_10458404
1348 Ga0207690_10004368
1349 Ga0207690_10052734
1350 Ga0207690_10063126
1351 Ga0207690_10140438
1352 Ga0207690_10205644
1353 Ga0207690_10285988
1354 Ga0207690_10442085
1355 Ga0207690_10720553
1356 Ga0207706_10000434
1357 Ga0207706_10000643
1358 Ga0207706_10006155
1359 Ga0207706_10020105
1360 Ga0207706_10040073
1361 Ga0207706_10051535
1362 Ga0207706_10151116
1363 Ga0207706_10321040
1364 Ga0207686_10480809
1365 Ga0207709_10276532
1366 Ga0207670_10965042
1367 Ga0207704_10223352
1368 Ga0207704_10258601
1369 Ga0207691_10000848
1370 Ga0207691_10006573
1371 Ga0207691_10012290
1372 Ga0207691_10034100
1373 Ga0207691_10141473
1374 Ga0207711_10001567
1375 Ga0207711_10007842
1376 Ga0207711_10008771
1377 Ga0207711_10095340
1378 Ga0207711_10157718
1379 Ga0207711_10493690
1380 Ga0207689_10000017
1381 Ga0207689_10149305
1382 Ga0207661_10006807
1383 Ga0207661_10103793
1384 Ga0207661_10650032
1385 Ga0207679_10021149
1386 Ga0207679_10044885
1387 Ga0207679_10054602
1388 Ga0207679_10226056
1389 Ga0207679_10705025
1390 Ga0207679_11685947
1391 Ga0207667_10006366
1392 Ga0207667_10025673
1393 Ga0207667_10033723
1394 Ga0207667_10140147
1395 Ga0207667_10360992
1396 Ga0207667_10389063
1397 Ga0207667_10748518
1398 Ga0207667_10920156
1399 Ga0207651_10029489
1400 Ga0207651_10154925
1401 Ga0207651_11685780
1402 Ga0207712_10059802
1403 Ga0207668_10002511
1404 Ga0207668_10068185
1405 Ga0207668_11095151
1406 Ga0207640_10007439
1407 Ga0207640_10082427
1408 Ga0207640_10111299
1409 Ga0207640_10250264
1410 Ga0207640_10525321
1411 Ga0207640_11498483
1412 Ga0207658_10012708
1413 Ga0207658_10023843
1414 Ga0207658_10052281
1415 Ga0207658_10157041
1416 Ga0207658_10230225
1417 Ga0207658_10367412
1418 Ga0207658_10574915
1419 Ga0207677_10234197
1420 Ga0207677_10448896
1421 Ga0207703_10006160
1422 Ga0207703_10115565
1423 Ga0207639_10014617
1424 Ga0207639_10017808
1425 Ga0207639_10288428
1426 Ga0207639_10635176
1427 Ga0207639_11330388
1428 Ga0207678_10040754
1429 Ga0207678_10055633
1430 Ga0207678_10058506
1431 Ga0207678_10066389
1432 Ga0207678_10241284
1433 Ga0207678_10409597
1434 Ga0207678_11325875
1435 Ga0207702_10009761
1436 Ga0207702_10025972
1437 Ga0207702_10129822
1438 Ga0207702_10146001
1439 Ga0207702_10206942
1440 Ga0207702_10210301
1441 Ga0207702_10738362
1442 Ga0207641_10004849
1443 Ga0207641_10009703
1444 Ga0207641_10078747
1445 Ga0207641_10190416
1446 Ga0207641_10302105
1447 Ga0207641_10831718
1448 Ga0207641_10970131
1449 Ga0207648_10001216
1450 Ga0207648_10048278
1451 Ga0207648_10058599
1452 Ga0207648_10126213
1453 Ga0207676_10006309
1454 Ga0207676_10011151
1455 Ga0207676_10028424
1456 Ga0207676_10053258
1457 Ga0207676_10674189
1458 Ga0207674_10000291
1459 Ga0207674_10000945
1460 Ga0207674_10001193
1461 Ga0207674_10005118
1462 Ga0207674_10016857
1463 Ga0207674_10036580
1464 Ga0207674_10418923
1465 Ga0207675_100025857
1466 Ga0207683_10004757
1467 Ga0207683_10107768
1468 Ga0207683_11473710
1469 Ga0207698_10005257
1470 Ga0207698_10011284
1471 Ga0207698_10024762
1472 Ga0207698_10070914
1473 Ga0207698_10094789
1474 Ga0207698_10859516
1475 Ga0209984_1021948
1476 Ga0209971_1013608
1477 Ga0209974_10001961
1478 Ga0207428_10219894
1479 Ga0268266_10164139
1480 Ga0268266_10530908
1481 Ga0268265_10149211
1482 Ga0268265_10229882
1483 Ga0268264_10026083
1484 Ga0268264_10455225
1485 Ga0268264_10532030
1486 Ga0268264_11103686
1487 Ga0316176_1120040
1488 Ga0307408_100012989
1489 Ga0307408_100052205
1490 Ga0307408_100070049
1491 Ga0307408_100178276
1492 Ga0307408_100542001
1493 Ga0307405_10000626
1494 Ga0307405_10002297
1495 Ga0307405_10022285
1496 Ga0307405_10277877
1497 Ga0307413_10004491
1498 Ga0307413_10009177
1499 Ga0307413_10348693
1500 Ga0307413_10684879
1501 Ga0307410_10003112
1502 Ga0307410_10005525
1503 Ga0307410_10067979
1504 Ga0307406_10003488
1505 Ga0307406_10037316
1506 Ga0307406_10047768
1507 Ga0307406_10349733
1508 Ga0307407_10002164
1509 Ga0307407_10029704
1510 Ga0307407_10059633
1511 Ga0307407_10438104
1512 Ga0307412_10001854
1513 Ga0307412_10020382
1514 Ga0307412_10100260
1515 Ga0307412_10132616
1516 Ga0307412_10255301
1517 Ga0307409_100001095
1518 Ga0307409_100019937
1519 Ga0307409_100456022
1520 Ga0307409_101256337
1521 Ga0307409_102054761
1522 Ga0307416_100001984
1523 Ga0307416_100004786
1524 Ga0307416_100032267
1525 Ga0307416_101674662
1526 Ga0307416_103402130
1527 Ga0307414_10034370
1528 Ga0307414_10037566
1529 Ga0307414_10061292
1530 Ga0307414_10089951
1531 Ga0307411_10007882
1532 Ga0307411_10009212
1533 Ga0307411_10050703
1534 Ga0307411_10062292
1535 Ga0307411_10340059
1536 Ga0307411_10362328
1537 Ga0307411_11042131
1538 Ga0307415_100005907
1539 Ga0307415_100017321
1540 Ga0307415_100061686
1541 Ga0307415_100120534
1542 Ga0307415_100229362
1543 Ga0307415_101569314
1544 Ga0373929_0051313
1545 Ga0373940_0217241
1546 Ga0373923_0005226
1547 Ga0373954_0023501
1548 Ga0373956_0055759
1549 Ga0373957_0077792
1550 Ga0373955_0020079
1551 Ga0373961_0054344
1552 Ga0373931_0882461
1553 Ga0373935_0118829
1554 Ga0373927_0474661
1555 Ga0373933_0044188
1556 Ga0373937_0012365
1557 Ga0395899_0000812
1558 Ga0395899_0009444
1559 Ga0395899_0022362
1560 Ga0395899_0029913
1561 Ga0395899_0035075
1562 Ga0395899_0103661
1563 Ga0395899_0111177
1564 Ga0395899_0133540
1565 Ga0395899_0175177
1566 Ga0395899_0185263
1567 Ga0395899_0284555
1568 Ga0395900_0002024
1569 Ga0395900_0013285
1570 Ga0395900_0040455
1571 Ga0395900_0041223
1572 Ga0395900_0048165
1573 Ga0395900_0112839
1574 Ga0395900_0260243
1575 Ga0395900_0317527
1576 Ga0395900_0394902
1577 Ga0395900_0415280
1578 Ga0395900_0423778
1579 Ga0395900_0476798
1580 Ga0395900_0544187
1581 Ga0395900_0770734
1582 Ga0395900_0774495
1583 Ga0395900_0914374
1584 Ga0395900_0927411
1585 Ga0395900_1261344
1586 Ga0395900_1697718
1587 Ga0395898_0002775
1588 Ga0395898_0059780
1589 Ga0395898_0071650
1590 Ga0395898_0077679
1591 Ga0395898_0128155
1592 Ga0395898_0138592
1593 Ga0395898_0236669
1594 Ga0395898_0476343
1595 Ga0395898_0489624
1596 Ga0395898_0575167
1597 Ga0395898_1068086
1598 Ga0395905_0005582
1599 Ga0395905_0009405
1600 Ga0395905_0017282
1601 Ga0395905_0025660
1602 Ga0395905_0040141
1603 Ga0395905_0042805
1604 Ga0395905_0043567
1605 Ga0395905_0048497
1606 Ga0395905_0061157
1607 Ga0395905_0063290
1608 Ga0395905_0070782
1609 Ga0395905_0091876
1610 Ga0395905_0118065
1611 Ga0395905_0142641
1612 Ga0395905_0156502
1613 Ga0395905_0207868
1614 Ga0395905_0217519
1615 Ga0395905_0311527
1616 Ga0395905_0768996
1617 Ga0395905_0932954
1618 Ga0395905_0976812
1619 Ga0395905_0994515
1620 Ga0395905_1038585
1621 Ga0395905_1051375
1622 Ga0395905_1061559
1623 Ga0395905_1083190
1624 Ga0395905_1105885
1625 Ga0395905_1389695
1626 Ga0395901_0006117
1627 Ga0395901_0006917
1628 Ga0395901_0008144
1629 Ga0395901_0021112
1630 Ga0395901_0050395
1631 Ga0395901_0083417
1632 Ga0395901_0088931
1633 Ga0395901_0095141
1634 Ga0395901_0163530
1635 Ga0395901_0207550
1636 Ga0395901_0208133
1637 Ga0395901_0278976
1638 Ga0395901_0285301
1639 Ga0395901_0348133
1640 Ga0395901_0549286
1641 Ga0395901_0793452
1642 Ga0439436_0037937
1643 Ga0439445_0000105
1644 Ga0439445_0082210
1645 Ga0439448_0010114
1646 Ga0439458_0000046
1647 Ga0439458_0006115
1648 Ga0439458_0006417
1649 Ga0439460_0028968
1650 Ga0466969_0019829
1651 Ga0466972_0083136
1652 Ga0466966_0011986
1653 Ga0466966_0015446
1654 Ga0466966_0124213
1655 Ga0466966_0430520
1656 Ga0466961_0012441
1657 Ga0466961_0047553
1658 Ga0466961_0216435
1659 Ga0466961_0909799
1660 Ga0466963_0003141
1661 Ga0466963_0027424
1662 Ga0466963_0033240
1663 Ga0466963_0061123
1664 Ga0466963_0276293
1665 Ga0466963_0384489
1666 Ga0466963_0547356
1667 Ga0466963_1020901
1668 Ga0466964_0159966
1669 Ga0466971_0004427
1670 Ga0466971_0045695
1671 Ga0466971_0326577
1672 Ga0466971_0390288
1673 Ga0466970_0022753
1674 Ga0466970_0126849
1675 Ga0466970_0249076
1676 Ga0466970_0274312
1677 Ga0466970_0335868
1678 Ga0466957_0003622
1679 Ga0466957_0007619
1680 Ga0466957_0110016
1681 Ga0466957_0116975
1682 Ga0466957_0339306
1683 Ga0466957_0668991
1684 Ga0466959_0087680
1685 Ga0466959_0141268
1686 Ga0466959_0890987
1687 Ga0466958_0001545
1688 Ga0466958_0007544
1689 Ga0466958_0017892
1690 Ga0466958_0029457
1691 Ga0466958_0565306
1692 Ga0466967_0008598
1693 Ga0466967_0036666
1694 Ga0466967_0087784
1695 Ga0466967_0215313
1696 Ga0466967_0254949
1697 Ga0466967_0315541
1698 Ga0466967_0381177
1699 Ga0466967_0541500
1700 Ga0466967_1488162
1701 Ga0495585_0326146
1702 Ga0495594_0395258
1703 Ga0495663_0013499
1704 Ga0495663_0293516
1705 Ga0495642_0043634
1706 Ga0495621_0240423
1707 Ga0495621_0262762
1708 Ga0495633_0211366
1709 Ga0495659_0039421
1710 Ga0495623_0042082
1711 Ga0495647_0210576
1712 Ga0495669_0176675
1713 Ga0495669_0303790
1714 Ga0495669_0550935
1715 Ga0495670_0060332
1716 Ga0495670_0169221
1717 Ga0495636_0384244
1718 Ga0495677_0268722
1719 Ga0495677_0295767
1720 Ga0495602_0035064
1721 Ga0496100_0171348
1722 Ga0496100_0183791
1723 Ga0496101_0021683
1724 Ga0496101_0074074
1725 Ga0496101_0122287
1726 Ga0496101_0413143
1727 Ga0496101_0450634
1728 Ga0496102_0014137
1729 Ga0496103_0006147
1730 Ga0496104_0169749
1731 Ga0496104_1035918
1732 Ga0496105_0228884
1733 Ga0496106_0016983
1734 Ga0496106_0052969
1735 Ga0496106_0644336
1736 Ga0496107_0009566
1737 Ga0496107_0045144
1738 Ga0496107_0128850
1739 Ga0496108_0006025
1740 Ga0496108_0019916
1741 Ga0496108_0020380
1742 Ga0496108_0186000
1743 Ga0496109_0004440
1744 Ga0496109_0007928
1745 Ga0496109_0557844
1746 Ga0496109_0766756
1747 Ga0496110_0011287
1748 Ga0496110_0015206
1749 Ga0496110_0032011
1750 Ga0496110_0223753
1751 Ga0496110_1001178
1752 Ga0496111_0006733
1753 Ga0496111_0007954
1754 Ga0496111_0054578
1755 Ga0496112_0013956
1756 Ga0496112_0028899
1757 Ga0496112_0049956
1758 Ga0496112_0589934
1759 Ga0496112_0652185
1760 Ga0496113_0001208
1761 Ga0496113_0033612
1762 Ga0496113_0383162
1763 Ga0496113_0390849
1764 Ga0496114_0049901
1765 Ga0496115_0001276
1766 Ga0501067_0280272
1767 Ga0501071_0435646
1768 Ga0501224_047305
1769 nmdc:mga07m45_439095_c1
1770 nmdc:mga06r32_58772_c1
1771 nmdc:mga08y16_276147_c1
1772 Ga0500616_0014806
1773 Ga0587068_161741
1774 Ga0466962_0030127
1775 Ga0466962_0103970
1776 Ga0466962_0127051
1777 Ga0466962_0134009
1778 2885427995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

6

143

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ifz-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m 0.9644 1 128
3s5p-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase b rpib from giardia lamblia 0.9643 1 128
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.962 1 137
3s5p-assembly1.cif.gz_A crystal structure of ribose-5-phosphate isomerase b rpib from giardia lamblia 0.9565 1 133
5ifz-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m 0.9564 1 128
ID Description Score Start End Superfamily
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9644 1 128 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9643 1 128 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.962 1 137 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9564 1 128 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9487 2 139 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A258XS88-F1-model_v4 Ribose-5-phosphate isomerase 0.9965 1 123 GO:0005975
GO:0016861
AF-A0A521WPV9-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.994 1 120 GO:0005975
GO:0016861
AF-A0A7X6X9T7-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.993 1 116 GO:0004751
GO:0009052
GO:0019316
AF-A0A7X2TVL1-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9912 1 108 GO:0004751
GO:0009052
GO:0019316
AF-A0A2G4GJC8-F1-model_v4 Ribose-5-phosphate isomerase 0.9911 1 119 GO:0004751
GO:0009052
GO:0019316

Map