F484801

General Info

Members Datasets Scaffolds Average Seq Length
889 747 1778 155

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10149330|Ga0307405_101493302
Length 171
Sequence MFNDEHCCTTMNKKQATIEHHHFPWDHPRFRSWIAVARACQLMQQTLTRALADLEIKPPHLDILINLYRFEGISQHELARKLLVGRSNMSMLLPQLEKRGLIERRGDEKDKRVLRLSLTRSGRELTEQAMEIQTALIEKSLDNEPIEECLIVAQSMERLIARLLKEENDLG

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
67 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
68 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
80 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
81 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
137 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
138 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
139 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
140 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
141 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
144 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
145 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
146 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
147 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
148 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
149 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
150 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
155 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
156 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
157 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
158 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
159 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
160 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
161 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
246 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
249 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
250 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
256 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
257 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
258 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
259 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
262 2509276019 Ensifer aridi TW10 Isolate Nodule
263 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
264 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
265 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
266 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
267 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
268 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
269 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
270 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
271 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
272 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
273 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
274 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
275 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
276 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
277 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
278 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
279 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
280 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
281 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
282 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
283 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
284 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
285 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
286 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
287 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
288 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
289 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
290 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
291 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
292 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
293 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
294 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
295 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
296 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
297 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
298 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
299 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
300 2519899620 Rhizobium sp. Pop5 Isolate Nodule
301 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
302 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
303 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
304 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
305 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
306 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
307 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
308 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
309 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
310 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
311 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
312 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
313 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
314 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
315 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
316 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
317 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
318 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
319 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
320 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
321 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
322 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
323 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
324 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
325 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
326 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
327 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
328 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
329 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
330 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
331 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
332 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
333 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
334 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
335 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
336 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
337 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
338 2643221599 Rhizobium sp. Root708 Isolate Unclassified
339 2643221607 Rhizobium sp. Root73 Isolate Unclassified
340 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
341 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
342 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
343 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
344 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
345 2643221688 Rhizobium sp. Root482 Isolate Unclassified
346 2643221719 Rhizobium sp. Root274 Isolate Unclassified
347 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
348 2718217882 Rhizobium sp. N741 Isolate Nodule
349 2718217927 Rhizobium sp. N324 Isolate Nodule
350 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
351 2718218009 Rhizobium sp. N561 Isolate Nodule
352 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
353 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
354 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
355 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
356 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
357 2718218363 Rhizobium sp. N113 Isolate Nodule
358 2718218365 Rhizobium sp. N731 Isolate Nodule
359 2718218366 Rhizobium sp. N621 Isolate Nodule
360 2718218423 Rhizobium sp. N941 Isolate Nodule
361 2721755514 Rhizobium sp. N6212 Isolate Nodule
362 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
363 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
364 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
365 2721755809 Rhizobium sp. N541 Isolate Nodule
366 2721755810 Rhizobium sp. N871 Isolate Nodule
367 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
368 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
369 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
370 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
371 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
372 2728369365 Rhizobium sp. N1341 Isolate Nodule
373 2728369397 Rhizobium sp. N1314 Isolate Nodule
374 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
375 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
376 2738543024 Aminobacter sp. AP02 Isolate Unclassified
377 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
378 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
379 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
380 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
381 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
382 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
383 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
384 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
385 2791355256 Rhizobium sp. M10 Isolate Nodule
386 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
387 2791355260 Rhizobium sp. L9 Isolate Nodule
388 2791355261 Rhizobium sp. J15 Isolate Nodule
389 2791355262 Rhizobium sp. M1 Isolate Nodule
390 2791355263 Rhizobium chutanense C5 Isolate Nodule
391 2791355264 Rhizobium sp. S9 Isolate Nodule
392 2791355265 Rhizobium sp. H4 Isolate Nodule
393 2791355266 Rhizobium sp. L43 Isolate Nodule
394 2791355267 Rhizobium sp. L18 Isolate Nodule
395 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
396 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
397 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
398 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
399 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
400 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
401 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
402 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
403 2802429633 Rhizobium anhuiense J3 Isolate Nodule
404 2802429634 Rhizobium anhuiense S10 Isolate Nodule
405 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
406 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
407 2802429637 Rhizobium anhuiense C15 Isolate Nodule
408 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
409 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
410 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
411 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
412 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
413 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
414 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
415 2838048938 Rhizobium pisi 27/80 Isolate Nodule
416 2838061910 Rhizobium phaseoli L15 Isolate Nodule
417 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
418 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
419 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
420 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
421 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
422 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
423 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
424 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
425 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
426 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
427 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
428 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
429 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
430 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
431 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
432 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
433 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
434 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
435 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
436 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
437 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
438 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
439 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
440 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
441 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
442 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
443 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
444 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
445 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
446 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
447 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
448 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
449 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
450 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
451 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
452 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
453 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
454 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
455 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
456 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
457 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
458 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
459 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
460 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
461 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
462 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
463 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
464 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
465 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
466 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
467 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
468 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
469 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
470 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
471 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
472 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
473 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
474 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
475 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
476 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
477 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
478 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
479 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
480 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
481 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
482 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
483 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
484 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
485 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
486 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
487 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
488 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
489 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
490 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
491 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
492 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
493 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
494 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
495 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
496 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
497 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
498 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
499 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
500 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
501 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
502 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
503 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
504 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
505 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
506 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
507 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
508 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
509 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
510 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
511 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
512 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
513 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
514 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
515 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
516 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
517 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
518 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
519 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
520 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
521 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
522 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
523 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
524 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
525 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
526 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
527 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
528 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
529 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
530 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
531 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
532 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
533 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
534 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
535 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
536 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
537 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
538 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
539 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
540 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
541 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
542 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
543 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
544 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
545 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
546 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
547 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
548 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
549 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
550 2933599457 Rhizobium phaseoli M3 Isolate Nodule
551 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
552 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
553 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
554 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
555 2936381700 Rhizobium chutanense C16 Isolate Unclassified
556 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
557 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
558 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
559 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
560 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
561 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
562 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
563 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
564 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
565 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
566 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
567 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
568 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
569 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
570 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
571 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
572 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
573 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
574 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
575 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
576 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
577 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
578 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
579 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
580 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
581 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
582 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
583 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
584 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
585 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
586 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
587 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
588 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
589 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
590 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
591 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
592 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
593 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
594 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
595 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
596 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
597 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
598 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
599 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
600 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
601 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
602 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
603 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
604 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
605 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
606 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
607 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
608 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
609 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
610 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
611 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
612 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
613 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
614 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
615 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
616 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
617 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
618 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
619 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
620 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
621 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
622 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
623 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
624 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
625 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
626 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
627 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
628 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
629 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
630 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
631 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
632 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
633 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
634 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
635 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
636 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
637 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
638 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
639 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
640 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
641 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
642 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
643 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
644 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
645 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
646 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
647 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
648 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
649 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
650 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
651 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
652 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
653 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
654 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
655 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
656 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
657 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
658 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
659 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
660 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
661 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
662 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
663 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
664 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
665 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
666 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
667 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
668 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
669 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
670 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
671 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
672 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
673 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
674 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
675 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
676 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
677 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
678 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
679 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
680 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
681 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
682 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
683 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
684 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
685 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
686 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
687 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
688 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
689 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
690 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
691 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
692 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
693 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
694 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
695 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
696 2996887358 Rhizobium sp. R711 Isolate Nodule
697 2996893221 Rhizobium sp. R635 Isolate Nodule
698 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
699 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
700 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
701 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
702 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
703 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
704 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
705 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
706 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
707 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
708 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
709 8005258706 Rhizobium sp. R693 Isolate Nodule
710 8005275841 Rhizobium sp. N4311 Isolate Nodule
711 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
712 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
713 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
714 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
715 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
716 8005321885 Rhizobium sp. R72 Isolate Nodule
717 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
718 8005382845 Rhizobium sp. R634 Isolate Nodule
719 8005395548 Rhizobium sp. R339 Isolate Nodule
720 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
721 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
722 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
723 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
724 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
725 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
726 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
727 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
728 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
729 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
730 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
731 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
732 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
733 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
734 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
735 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
736 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
737 8018176218 Rhizobium sp. N122 Isolate Nodule
738 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
739 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
740 8024501048 Rhizobium sp. H4 Isolate Nodule
741 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
742 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
743 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
744 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
745 8056382006 Rhizobium croatiense 13T Isolate Nodule
746 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
747 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.88
Metatranscriptomes 0.11
Isolates 55.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.55
Nodule 47.24
Rhizoplane 1.8
Rhizosphere 20.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10149330 3300031731 Bacteria 1641
2 JGI25156J39149_1000001 3300002705 Bacteria 354557
3 JGI25162J39368_1000209 3300002737 Bacteria 61889
4 JGI25154J39366_1000011 3300002738 Bacteria 296007
5 JGI25157J39369_1000030 3300002741 Bacteria 146112
6 JGI25152J39213_1021550 3300002773 Bacteria 1128
7 JGI25150J39212_1018397 3300002774 Bacteria 1112
8 JGI25159J45721_1001269 3300002987 Bacteria 10660
9 JGI25151J46595_10000694 3300003187 Bacteria 28345
10 JGI25165J46597_1000302 3300003214 Bacteria 61889
11 JGI25153J46596_10000571 3300003215 Bacteria 22690
12 JGI25153J46596_10005200 3300003215 Bacteria 6848
13 JGI25153J46596_10043215 3300003215 Bacteria 1367
14 JGI25153J46596_10043224 3300003215 Bacteria 1367
15 rootH2_10013403 3300003320 Bacteria 4078
16 rootL2_10012994 3300003322 Bacteria 5052
17 rootH1_10157404 3300003323 Bacteria 2468
18 JGI25160J50197_1001053 3300003354 Bacteria 14187
19 JGI25160J50197_1004407 3300003354 Bacteria 6098
20 JGI25160J50197_1048674 3300003354 Bacteria 914
21 JGI25161J50226_1000006 3300003374 Bacteria 279563
22 JGI25161J50226_1000196 3300003374 Bacteria 39595
23 JGI25161J50226_1003805 3300003374 Bacteria 3335
24 Ga0055539_1025270 3300003752 Bacteria 692
25 Ga0055526_1000781 3300003771 Bacteria 23736
26 Ga0055526_1002722 3300003771 Bacteria 11747
27 Ga0055526_1097729 3300003771 Bacteria 543
28 Ga0055524_1002229 3300003775 Bacteria 10153
29 Ga0055524_1026478 3300003775 Bacteria 1790
30 Ga0055524_1036966 3300003775 Bacteria 1302
31 Ga0055536_1004405 3300003781 Bacteria 7212
32 Ga0055528_1000284 3300003790 Bacteria 43328
33 Ga0055528_1005786 3300003790 Bacteria 5688
34 Ga0055528_1014021 3300003790 Bacteria 2994
35 Ga0055528_1015021 3300003790 Bacteria 2819
36 Ga0055528_1033834 3300003790 Bacteria 1272
37 Ga0055530_10021499 3300003791 Bacteria 1900
38 Ga0055540_1000644 3300003792 Bacteria 24654
39 Ga0055540_1002882 3300003792 Bacteria 8725
40 Ga0055540_1009913 3300003792 Bacteria 3224
41 Ga0055540_1055169 3300003792 Bacteria 808
42 Ga0055531_10000733 3300003794 Bacteria 27746
43 Ga0058692_1038954 3300003856 Bacteria 845
44 Ga0055543_1000020 3300004625 Bacteria 150535
45 Ga0065165_1011534 3300005262 Bacteria 3672
46 Ga0070670_100758095 3300005331 Bacteria 875
47 Ga0070661_100620101 3300005344 Bacteria 876
48 Ga0070668_101440973 3300005347 Bacteria 629
49 Ga0070669_100222559 3300005353 Bacteria 1493
50 Ga0070671_100013497 3300005355 Bacteria 6586
51 Ga0070659_100874580 3300005366 Bacteria 784
52 Ga0070663_100146190 3300005455 Bacteria 1809
53 Ga0070662_100356560 3300005457 Bacteria 1199
54 Ga0068867_100565201 3300005459 Bacteria 987
55 Ga0068853_101141623 3300005539 Bacteria 752
56 Ga0070665_100178472 3300005548 Bacteria 2125
57 Ga0070665_100583393 3300005548 Bacteria 1131
58 Ga0068855_100397730 3300005563 Bacteria 1510
59 Ga0068854_100425152 3300005578 Bacteria 1104
60 Ga0068856_100051132 3300005614 Bacteria 4075
61 Ga0068856_101928547 3300005614 Bacteria 601
62 Ga0068852_100148653 3300005616 Bacteria 2176
63 Ga0068859_102182651 3300005617 Bacteria 611
64 Ga0081455_10174345 3300005937 Bacteria 1635
65 Ga0081540_1004036 3300005983 Bacteria 11369
66 Ga0081539_10038898 3300005985 Bacteria 2813
67 Ga0075365_10000878 3300006038 Bacteria 12566
68 Ga0075365_10002271 3300006038 Bacteria 9328
69 Ga0075365_10084398 3300006038 Bacteria 2155
70 Ga0075365_10179172 3300006038 Bacteria 1481
71 Ga0075368_10119616 3300006042 Bacteria 1090
72 Ga0075363_100093904 3300006048 Bacteria 1653
73 Ga0075363_100283102 3300006048 Bacteria 959
74 Ga0075364_10057730 3300006051 Bacteria 2543
75 Ga0075364_10620274 3300006051 Bacteria 739
76 Ga0075362_10001797 3300006177 Bacteria 6996
77 Ga0075362_10262545 3300006177 Bacteria 851
78 Ga0075367_10009732 3300006178 Bacteria 5034
79 Ga0075367_10027611 3300006178 Bacteria 3231
80 Ga0075367_10061605 3300006178 Bacteria 2239
81 Ga0075367_10315034 3300006178 Bacteria 986
82 Ga0075367_10328187 3300006178 Bacteria 965
83 Ga0075367_11054255 3300006178 Bacteria 519
84 Ga0075369_10017690 3300006186 Bacteria 2894
85 Ga0075369_10102455 3300006186 Bacteria 1285
86 Ga0075369_10214342 3300006186 Bacteria 891
87 Ga0075366_10051911 3300006195 Bacteria 2436
88 Ga0075370_10128253 3300006353 Bacteria 1479
89 Ga0075370_10262902 3300006353 Bacteria 1023
90 Ga0097620_102183263 3300006931 Bacteria 611
91 Ga0079104_1005883 3300006946 Bacteria 4776
92 Ga0105251_10012763 3300009011 Bacteria 4735
93 Ga0105244_10193434 3300009036 Bacteria 961
94 Ga0105250_10327115 3300009092 Bacteria 667
95 Ga0105240_10000005 3300009093 Bacteria 702630
96 Ga0105247_10754103 3300009101 Bacteria 738
97 Ga0105243_10103599 3300009148 Bacteria 2367
98 Ga0105248_10098178 3300009177 Bacteria 3300
99 Ga0105248_10649686 3300009177 Bacteria 1190
100 Ga0105237_10003120 3300009545 Bacteria 19949
101 Ga0123340_1084051 3300009763 Bacteria 608
102 Ga0123341_1001797 3300009765 Bacteria 16795
103 Ga0123341_1049735 3300009765 Bacteria 2402
104 Ga0123342_1024227 3300009766 Bacteria 3828
105 Ga0105239_10102928 3300010375 Bacteria 3160
106 Ga0157370_10006428 3300013104 Bacteria 12963
107 Ga0157369_10205865 3300013105 Bacteria 2064
108 Ga0157369_10602010 3300013105 Bacteria 1134
109 Ga0157369_11875689 3300013105 Bacteria 608
110 Ga0163162_12323803 3300013306 Bacteria 616
111 Ga0157372_10965503 3300013307 Bacteria 988
112 Ga0157375_11394857 3300013308 Bacteria 825
113 Ga0157380_11601184 3300014326 Bacteria 707
114 Ga0182008_10028326 3300014497 Bacteria 2833
115 Ga0182007_10001048 3300015262 Bacteria 15153
116 Ga0182005_1002574 3300015265 Bacteria 6424
117 Ga0214542_1029734 3300021321 Bacteria 2201
118 Ga0214543_1000011 3300021327 Bacteria 344093
119 Ga0209435_100012 3300025206 Bacteria 401621
120 Ga0209436_100020 3300025208 Bacteria 104602
121 Ga0209436_122264 3300025208 Bacteria 820
122 Ga0209437_100047 3300025233 Bacteria 405163
123 Ga0209437_100165 3300025233 Bacteria 145009
124 Ga0207425_1015745 3300025245 Bacteria 1690
125 Ga0207425_1039499 3300025245 Bacteria 904
126 Ga0209646_1000026 3300025246 Bacteria 401621
127 Ga0209026_1000014 3300025250 Bacteria 401621
128 Ga0209677_100511 3300025253 Bacteria 21677
129 Ga0209759_1000012 3300025256 Bacteria 401621
130 Ga0209129_1000418 3300025258 Bacteria 32796
131 Ga0209129_1000659 3300025258 Bacteria 23019
132 Ga0209129_1014882 3300025258 Bacteria 1632
133 Ga0209129_1031954 3300025258 Bacteria 874
134 Ga0209233_1000048 3300025261 Bacteria 453669
135 Ga0209233_1000069 3300025261 Bacteria 367639
136 Ga0209233_1000195 3300025261 Bacteria 125863
137 Ga0209565_1047860 3300025263 Bacteria 776
138 Ga0209455_1025257 3300025272 Bacteria 1084
139 Ga0209673_1000013 3300025273 Bacteria 571633
140 Ga0209673_1001041 3300025273 Bacteria 32420
141 Ga0209673_1001070 3300025273 Bacteria 31181
142 Ga0209673_1010316 3300025273 Bacteria 3944
143 Ga0209673_1019270 3300025273 Bacteria 2454
144 Ga0209130_1000004 3300025284 Bacteria 633436
145 Ga0209130_1000021 3300025284 Bacteria 374278
146 Ga0209130_1027518 3300025284 Bacteria 1206
147 Ga0209130_1029747 3300025284 Bacteria 1135
148 Ga0209130_1042134 3300025284 Bacteria 875
149 Ga0209675_1025095 3300025291 Bacteria 1510
150 Ga0209676_1022322 3300025292 Bacteria 2101
151 Ga0209676_1046125 3300025292 Bacteria 1181
152 Ga0209676_1051759 3300025292 Bacteria 1075
153 Ga0209025_1000166 3300025294 Bacteria 164692
154 Ga0209025_1061291 3300025294 Bacteria 1405
155 Ga0209564_1000273 3300025295 Bacteria 108165
156 Ga0209564_1000469 3300025295 Bacteria 67659
157 Ga0209564_1002229 3300025295 Bacteria 16024
158 Ga0209564_1029910 3300025295 Bacteria 1700
159 Ga0209758_1000218 3300025297 Bacteria 124300
160 Ga0209758_1000694 3300025297 Bacteria 49934
161 Ga0209758_1038255 3300025297 Bacteria 1842
162 Ga0209758_1122973 3300025297 Bacteria 698
163 Ga0209050_1006104 3300025298 Bacteria 7269
164 Ga0209050_1024298 3300025298 Bacteria 2101
165 Ga0209256_1000917 3300025299 Bacteria 35995
166 Ga0209256_1001513 3300025299 Bacteria 23507
167 Ga0209256_1006962 3300025299 Bacteria 5761
168 Ga0209256_1031428 3300025299 Bacteria 1452
169 Ga0207426_1000003 3300025302 Bacteria 1063212
170 Ga0207426_1000010 3300025302 Bacteria 796003
171 Ga0207426_1000039 3300025302 Bacteria 439937
172 Ga0207426_1001473 3300025302 Bacteria 19356
173 Ga0209051_1000142 3300025303 Bacteria 135337
174 Ga0209051_1017667 3300025303 Bacteria 3181
175 Ga0209051_1029991 3300025303 Bacteria 2119
176 Ga0209051_1067490 3300025303 Bacteria 1093
177 Ga0209257_1002347 3300025304 Bacteria 19033
178 Ga0209257_1003669 3300025304 Bacteria 12850
179 Ga0207713_1084448 3300025735 Bacteria 1133
180 Ga0207680_10273175 3300025903 Bacteria 1173
181 Ga0207695_10000011 3300025913 Bacteria 910221
182 Ga0207671_10000241 3300025914 Bacteria 81847
183 Ga0207657_10091142 3300025919 Bacteria 2543
184 Ga0207681_10482099 3300025923 Bacteria 1013
185 Ga0207644_10075576 3300025931 Bacteria 2476
186 Ga0207706_10247888 3300025933 Bacteria 1556
187 Ga0207711_10079645 3300025941 Bacteria 2860
188 Ga0207711_10108022 3300025941 Bacteria 2471
189 Ga0207667_10340856 3300025949 Bacteria 1530
190 Ga0207668_10240552 3300025972 Bacteria 1464
191 Ga0207640_10032818 3300025981 Bacteria 3223
192 Ga0207678_10183497 3300026067 Bacteria 1787
193 Ga0207678_10303378 3300026067 Bacteria 1372
194 Ga0207702_10096757 3300026078 Bacteria 2597
195 Ga0207698_10234126 3300026142 Bacteria 1669
196 Ga0209281_1000483 3300027111 Bacteria 55407
197 Ga0209813_10211035 3300027866 Bacteria 723
198 Ga0268266_10043363 3300028379 Bacteria 3844
199 Ga0268266_10325101 3300028379 Bacteria 1440
200 Ga0307515_10000023 3300028794 Bacteria 400846
201 Ga0307515_10000945 3300028794 Bacteria 66458
202 Ga0307515_10093561 3300028794 Bacteria 3725
203 Ga0307513_10016547 3300031456 Bacteria 8889
204 Ga0307408_100029770 3300031548 Bacteria 3786
205 Ga0307408_101643806 3300031548 Bacteria 611
206 Ga0316575_10028445 3300031665 Bacteria 2180
207 Ga0307410_10119041 3300031852 Bacteria 1923
208 Ga0307409_100471558 3300031995 Bacteria 1216
209 Ga0307414_10373555 3300032004 Bacteria 1230
210 Ga0307414_11344925 3300032004 Bacteria 663
211 Ga0373939_0303110 3300035114 Bacteria 637
212 Ga0395900_0000509 3300037418 Bacteria 54852
213 Ga0395898_0000908 3300037466 Bacteria 47632
214 Ga0395905_0000623 3300037471 Bacteria 47316
215 Ga0395901_0000142 3300038443 Bacteria 92246
216 Ga0439436_0000347 3300041404 Bacteria 11473
217 Ga0439465_0006346 3300041413 Bacteria 3756
218 Ga0439465_0033992 3300041413 Bacteria 1631
219 Ga0439465_0034178 3300041413 Bacteria 1627
220 Ga0439465_0061650 3300041413 Bacteria 1244
221 Ga0439465_0088052 3300041413 Bacteria 1060
222 Ga0451787_298666 3300041441 Bacteria 2703
223 Ga0451795_0679508 3300041456 Bacteria 903
224 Ga0451798_0279347 3300041458 Bacteria 3794
225 Ga0451833_0234757 3300041491 Bacteria 4197
226 Ga0451835_0848253 3300041492 Bacteria 4959
227 Ga0451837_0526918 3300041494 Bacteria 761
228 Ga0451839_1338330 3300041496 Bacteria 3723
229 Ga0451841_0510039 3300041498 Bacteria 4180
230 Ga0451845_0104391 3300041501 Bacteria 5680
231 Ga0451845_0344438 3300041501 Bacteria 760
232 Ga0451845_0660139 3300041501 Bacteria 914
233 Ga0451847_0286667 3300041503 Bacteria 2898
234 Ga0451849_0320370 3300041505 Bacteria 1201
235 Ga0451849_1239995 3300041505 Bacteria 2366
236 Ga0451851_1027828 3300041507 Bacteria 1044
237 Ga0451843_0643462 3300041509 Bacteria 2345
238 Ga0451843_1103898 3300041509 Bacteria 1135
239 Ga0451855_0832465 3300041511 Bacteria 2392
240 Ga0451853_0707082 3300041512 Bacteria 6588
241 Ga0452271_42778 3300041916 Bacteria 563
242 Ga0439431_0109690 3300041997 Bacteria 763
243 Ga0439432_012299 3300042006 Bacteria 2933
244 Ga0439462_0012197 3300042015 Bacteria 2194
245 Ga0450920_007352 3300042122 Bacteria 1996
246 Ga0450897_019016 3300042128 Bacteria 724
247 Ga0450907_007388 3300042146 Bacteria 1835
248 Ga0450909_012830 3300042185 Bacteria 1230
249 Ga0439434_0007072 3300042435 Bacteria 3280
250 Ga0450918_024916 3300042531 Bacteria 1047
251 Ga0466970_0001346 3300044765 Bacteria 11843
252 Ga0466957_0026871 3300044842 Bacteria 3417
253 Ga0466959_0083583 3300045049 Bacteria 2299
254 Ga0466958_0017505 3300045836 Bacteria 4145
255 Ga0466967_0152577 3300045976 Bacteria 2161
256 Ga0495617_023039 3300046452 Bacteria 2104
257 Ga0495638_0133474 3300046460 Bacteria 1456
258 Ga0495585_0044165 3300046492 Bacteria 2490
259 Ga0495596_0221753 3300046500 Bacteria 734
260 Ga0495607_0024207 3300046501 Bacteria 3789
261 Ga0495607_0053196 3300046501 Bacteria 2341
262 Ga0495583_0092749 3300046506 Bacteria 1298
263 Ga0495606_0012599 3300046507 Bacteria 6761
264 Ga0495606_0103179 3300046507 Bacteria 1733
265 Ga0495606_0425648 3300046507 Bacteria 685
266 Ga0495610_0075464 3300046512 Bacteria 1561
267 Ga0495610_0182497 3300046512 Bacteria 871
268 Ga0495616_0064883 3300046513 Bacteria 1781
269 Ga0495620_0019021 3300046515 Bacteria 3389
270 Ga0495632_0406110 3300046519 Bacteria 594
271 Ga0495643_0010535 3300046522 Bacteria 5685
272 Ga0495643_0079056 3300046522 Bacteria 1715
273 Ga0495663_0053542 3300046525 Bacteria 1255
274 Ga0495609_0052092 3300046538 Bacteria 1821
275 Ga0495597_0068071 3300046542 Bacteria 1539
276 Ga0495633_0014629 3300046558 Bacteria 4093
277 Ga0495633_0060673 3300046558 Bacteria 1772
278 Ga0495656_0093942 3300046615 Bacteria 1376
279 Ga0495668_0061271 3300046616 Bacteria 2075
280 Ga0495611_0068760 3300046648 Bacteria 1617
281 Ga0495661_0084210 3300046665 Bacteria 1826
282 Ga0495670_0013546 3300046691 Bacteria 4011
283 Ga0495671_0070728 3300046692 Bacteria 1714
284 Ga0495649_0581215 3300046694 Bacteria 553
285 Ga0495660_0067176 3300046810 Bacteria 1910
286 Ga0495672_0479511 3300047320 Bacteria 556
287 Ga0495683_0077831 3300047323 Bacteria 1621
288 Ga0495687_056492 3300047443 Bacteria 1637
289 Ga0495677_0166539 3300047445 Bacteria 852
290 Ga0495685_220722 3300047447 Bacteria 605
291 Ga0495673_0324411 3300047469 Bacteria 548
292 Ga0495686_0128236 3300047472 Bacteria 1506
293 Ga0495615_0036067 3300048090 Bacteria 1211
294 Ga0496100_0043660 3300048903 Bacteria 2868
295 Ga0496101_0545127 3300048904 Bacteria 917
296 Ga0496102_0007361 3300048905 Bacteria 9405
297 Ga0496102_0723840 3300048905 Bacteria 918
298 Ga0496103_0012306 3300048906 Bacteria 5078
299 Ga0496105_0161301 3300048908 Bacteria 1841
300 Ga0496106_0000050 3300048909 Bacteria 96126
301 Ga0496106_0027944 3300048909 Bacteria 4200
302 Ga0496110_1823850 3300048913 Bacteria 518
303 Ga0496111_0512494 3300048914 Bacteria 882
304 Ga0496113_0111043 3300048916 Bacteria 2134
305 Ga0496114_0045044 3300048917 Bacteria 3663
306 Ga0496116_0008243 3300048919 Bacteria 9078
307 Ga0496116_0052274 3300048919 Bacteria 2708
308 Ga0496116_0176571 3300048919 Bacteria 1149
309 Ga0496117_0000353 3300048920 Bacteria 81061
310 Ga0496117_0002546 3300048920 Bacteria 22722
311 Ga0496117_0014332 3300048920 Bacteria 6837
312 Ga0496118_0000204 3300048921 Bacteria 104260
313 Ga0496118_0017776 3300048921 Bacteria 6454
314 Ga0496118_0045436 3300048921 Bacteria 3429
315 Ga0496119_0001824 3300048922 Bacteria 24672
316 Ga0496119_0006614 3300048922 Bacteria 10672
317 Ga0496120_0003339 3300048923 Bacteria 14740
318 Ga0496120_0016908 3300048923 Bacteria 4749
319 Ga0496120_0050756 3300048923 Bacteria 2374
320 Ga0496121_0000378 3300048924 Bacteria 91381
321 Ga0496121_0038141 3300048924 Bacteria 4260
322 Ga0496121_0116303 3300048924 Bacteria 2028
323 Ga0496121_0302126 3300048924 Bacteria 1085
324 Ga0496121_0573677 3300048924 Bacteria 701
325 Ga0496122_0023423 3300048925 Bacteria 5443
326 Ga0496122_0025427 3300048925 Bacteria 5141
327 Ga0496122_0250943 3300048925 Bacteria 989
328 Ga0496122_0259136 3300048925 Bacteria 966
329 Ga0496123_0016997 3300048926 Bacteria 5874
330 Ga0496123_0086062 3300048926 Bacteria 1887
331 Ga0496123_0250693 3300048926 Bacteria 873
332 Ga0496124_0032700 3300048927 Bacteria 4587
333 Ga0496124_0113396 3300048927 Bacteria 2178
334 Ga0496124_0319098 3300048927 Bacteria 1113
335 Ga0496125_0004077 3300048928 Bacteria 17098
336 Ga0496125_0013737 3300048928 Bacteria 7939
337 Ga0496125_0034670 3300048928 Bacteria 4443
338 Ga0496126_0041490 3300048929 Bacteria 4258
339 Ga0496126_0105964 3300048929 Bacteria 2454
340 Ga0496126_0892805 3300048929 Bacteria 674
341 Ga0495682_0048911 3300049460 Bacteria 1541
342 Ga0501031_0621154 3300049568 Bacteria 695
343 Ga0501033_0001044 3300049570 Bacteria 25238
344 Ga0501034_0000960 3300049571 Bacteria 41575
345 Ga0501034_0064331 3300049571 Bacteria 3682
346 Ga0501034_0066590 3300049571 Bacteria 3615
347 Ga0501036_1076908 3300049572 Bacteria 657
348 Ga0501037_0369737 3300049573 Bacteria 987
349 Ga0501038_0602360 3300049574 Bacteria 831
350 Ga0501039_0584743 3300049575 Bacteria 875
351 Ga0501043_0064570 3300049579 Bacteria 2875
352 Ga0501046_0052503 3300049580 Bacteria 3213
353 Ga0501047_0031547 3300049581 Bacteria 5111
354 Ga0501047_0674611 3300049581 Bacteria 852
355 Ga0501067_0069915 3300049583 Bacteria 1944
356 Ga0501068_0112809 3300049584 Bacteria 1691
357 Ga0501076_0229682 3300049592 Bacteria 1517
358 Ga0501083_0731483 3300049744 Bacteria 643
359 Ga0501035_0001225 3300049822 Bacteria 26738
360 Ga0501045_0803207 3300049824 Bacteria 693
361 nmdc:mga03683_320902_c1 3300050489 Bacteria 729
362 nmdc:mga03683_90168_c1 3300050489 Bacteria 1336
363 nmdc:mga03n38_86307_c1 3300050490 Bacteria 1485
364 nmdc:mga00v17_738229_c1 3300050491 Bacteria 630
365 nmdc:mga0yw44_12562_c1 3300050492 Bacteria 4421
366 nmdc:mga0yw44_168367_c1 3300050492 Bacteria 1438
367 nmdc:mga0yw44_197763_c1 3300050492 Bacteria 1327
368 nmdc:mga0yw44_30688_c1 3300050492 Bacteria 3118
369 nmdc:mga0yw44_8617_c1 3300050492 Bacteria 5092
370 nmdc:mga0yw44_951330_c1 3300050492 Bacteria 582
371 nmdc:mga0k408_21196_c1 3300050493 Bacteria 1932
372 nmdc:mga06z11_31069_c1 3300050494 Bacteria 2591
373 nmdc:mga06z11_964809_c1 3300050494 Bacteria 520
374 nmdc:mga07m45_158134_c1 3300050496 Bacteria 1315
375 nmdc:mga07m45_93074_c1 3300050496 Bacteria 1728
376 nmdc:mga0sz30_2081_c1 3300050516 Bacteria 7147
377 nmdc:mga0sz30_3493_c2 3300050516 Bacteria 1668
378 Ga0500578_0251799 3300053086 Bacteria 1063
379 Ga0500643_009470 3300053087 Bacteria 3720
380 Ga0500651_0068166 3300053093 Bacteria 2216
381 Ga0500569_026822 3300053109 Bacteria 1582
382 Ga0500594_0006847 3300053118 Bacteria 2568
383 Ga0500642_0083296 3300053130 Bacteria 1472
384 Ga0500658_0000599 3300053134 Bacteria 14955
385 Ga0500568_0000140 3300053139 Bacteria 65109
386 Ga0500568_0015217 3300053139 Bacteria 3448
387 Ga0500588_0140204 3300053146 Bacteria 868
388 Ga0500616_0010920 3300053153 Bacteria 5406
389 Ga0500616_0011648 3300053153 Bacteria 5181
390 Ga0500616_0361961 3300053153 Bacteria 587
391 Ga0500616_0390483 3300053153 Bacteria 558
392 Ga0500620_000777 3300053155 Bacteria 5503
393 Ga0500622_0000265 3300053156 Bacteria 53529
394 Ga0500627_0042641 3300053158 Bacteria 1954
395 Ga0500627_0200098 3300053158 Bacteria 895
396 Ga0500627_0278153 3300053158 Bacteria 735
397 Ga0500627_0338216 3300053158 Bacteria 651
398 Ga0500636_0110106 3300053177 Bacteria 1557
399 Ga0500611_094628 3300053727 Bacteria 766
400 Ga0501084_0162890 3300054114 Bacteria 1882
401 2509107484 2508501122 Bacteria 6292184
402 2509375819 2509276019 Bacteria 6802256
403 2509386635 2509276021 Bacteria 7634384
404 2509392876 2509276021 Bacteria 7634384
405 2509443315 2509276033 Bacteria 7180565
406 2510133362 2510065019 Bacteria 6903379
407 2510303350 2510065057 Bacteria 6649661
408 2510842536 2510461069 Bacteria 5505000
409 2510894744 2510461076 Bacteria 8618824
410 2511186819 2510917028 Bacteria 6185411
411 2511501833 2511231052 Bacteria 6974333
412 2512533270 2512047086 Bacteria 6850303
413 2512971234 2512875026 Bacteria 6861065
414 2513572449 2513237084 Bacteria 7231967
415 2513577338 2513237085 Bacteria 7695351
416 2513584692 2513237086 Bacteria 7265287
417 2513603944 2513237089 Bacteria 6553624
418 2513615402 2513237091 Bacteria 6900273
419 2513630035 2513237093 Bacteria 7545552
420 2513708675 2513237103 Bacteria 7647401
421 2513864679 2513237138 Bacteria 7368160
422 2513881190 2513237140 Bacteria 7076289
423 2513905669 2513237143 Bacteria 6664116
424 2513984382 2513237156 Bacteria 6402557
425 2513997153 2513237159 Bacteria 6810126
426 2514006169 2513237160 Bacteria 6650282
427 2514021681 2513237162 Bacteria 7468464
428 2514038420 2513237164 Bacteria 7563725
429 2514590119 2513237351 Bacteria 6968952
430 2515112327 2515075009 Bacteria 7288508
431 2515632678 2515154113 Bacteria 7807172
432 2515639826 2515154114 Bacteria 7848616
433 2515661275 2515154116 Bacteria 7552979
434 2515744185 2515154134 Bacteria 7220242
435 2516893128 2516653046 Bacteria 6989037
436 2517036057 2516653077 Bacteria 7555578
437 2517076452 2516653085 Bacteria 7346596
438 2517095213 2517093000 Bacteria 7412387
439 2517406830 2517287029 Bacteria 6905599
440 2517569884 2517487022 Bacteria 7227575
441 2520375950 2519899620 Bacteria 6499161
442 2524448901 2524023207 Bacteria 6813453
443 2524460230 2524023209 Bacteria 6679728
444 2530645582 2529292951 Bacteria 6916614
445 2551677978 2551306084 Bacteria 8942552
446 2551686749 2551306085 Bacteria 7347181
447 2551690974 2551306086 Bacteria 6843938
448 2551698959 2551306087 Bacteria 7351905
449 2551713834 2551306089 Bacteria 7162724
450 2551717852 2551306090 Bacteria 7953713
451 2551719332 2551306090 Bacteria 7953713
452 2551727835 2551306091 Bacteria 7086830
453 2551743896 2551306093 Bacteria 7064773
454 2558868089 2558860100 Bacteria 8458965
455 2585166049 2582581283 Bacteria 6030556
456 2585200203 2582581294 Bacteria 6626667
457 2585224455 2582581298 Bacteria 7315509
458 2585229955 2582581299 Bacteria 6518058
459 2585268072 2582581306 Bacteria 6450535
460 2585277252 2582581308 Bacteria 7413247
461 2585323740 2582581315 Bacteria 7318924
462 2585331715 2582581316 Bacteria 7774528
463 2585386826 2582581865 Bacteria 6644329
464 2585396711 2582581866 Bacteria 6859583
465 2585402044 2582581867 Bacteria 7184437
466 2585527692 2585427526 Bacteria 7258840
467 2585534014 2585427527 Bacteria 7273426
468 2585537588 2585427528 Bacteria 6842387
469 2585546576 2585427529 Bacteria 7395659
470 2585552136 2585427530 Bacteria 7383882
471 2585821829 2585427590 Bacteria 6824633
472 2585835538 2585427593 Bacteria 7141551
473 2616292407 2615840624 Bacteria 6557588
474 2616308629 2615840626 Bacteria 7921970
475 2616557067 2615840698 Bacteria 7319877
476 2643774251 2643221550 Bacteria 4619371
477 2643775338 2643221551 Bacteria 3750538
478 2643793784 2643221555 Bacteria 3749717
479 2643837589 2643221564 Bacteria 4193379
480 2644003799 2643221599 Bacteria 6292121
481 2644049121 2643221607 Bacteria 6314006
482 2644132257 2643221623 Bacteria 5239945
483 2644192737 2643221634 Bacteria 6705461
484 2644204535 2643221636 Bacteria 6583769
485 2644298538 2643221653 Bacteria 4569637
486 2644482155 2643221686 Bacteria 6310811
487 2644496509 2643221688 Bacteria 5260751
488 2644656767 2643221719 Bacteria 4568197
489 2671111670 2667528174 Bacteria 6435400
490 2719181230 2718217882 Bacteria 6556348
491 2719385840 2718217927 Bacteria 6972593
492 2719665654 2718217997 Bacteria 6740740
493 2719731979 2718218009 Bacteria 6478651
494 2720492074 2718218199 Bacteria 6740745
495 2720613338 2718218232 Bacteria 6720332
496 2720620214 2718218233 Bacteria 6662049
497 2720631639 2718218235 Bacteria 6630699
498 2720775367 2718218269 Bacteria 6906114
499 2721147324 2718218363 Bacteria 6524337
500 2721158857 2718218365 Bacteria 6274507
501 2721164242 2718218366 Bacteria 6425255
502 2721399619 2718218423 Bacteria 6438183
503 2722840412 2721755514 Bacteria 6424414
504 2723026987 2721755556 Bacteria 6745503
505 2723560599 2721755684 Bacteria 6859907
506 2723567186 2721755685 Bacteria 6704835
507 2724038432 2721755809 Bacteria 6438790
508 2724044735 2721755810 Bacteria 6479005
509 2724089974 2721755819 Bacteria 6906405
510 2724104451 2721755822 Bacteria 6726041
511 2724110246 2721755823 Bacteria 6752556
512 2725952131 2724679232 Bacteria 7646494
513 2730107923 2728369352 Bacteria 6745171
514 2730164467 2728369365 Bacteria 6555560
515 2730298489 2728369397 Bacteria 6274511
516 2738946258 2738541317 Bacteria 5340176
517 2739036551 2738541333 Bacteria 7106503
518 2739308076 2738543024 Bacteria 5603683
519 2753458819 2751185821 Bacteria 6189929
520 2757570965 2757320392 Bacteria 3737298
521 2766067506 2765235942 Bacteria 7445910
522 2776913735 2775507049 Bacteria 6284736
523 2778174065 2775507266 Bacteria 7392367
524 2792581863 2791355082 Bacteria 5973319
525 2792620091 2791355091 Bacteria 6135441
526 2792626490 2791355092 Bacteria 6248105
527 2793294725 2791355256 Bacteria 6798008
528 2793312306 2791355259 Bacteria 7254731
529 2793324954 2791355260 Bacteria 6598818
530 2793330587 2791355261 Bacteria 6661293
531 2793335680 2791355262 Bacteria 6774204
532 2793341576 2791355263 Bacteria 6872478
533 2793349021 2791355264 Bacteria 6429314
534 2793353018 2791355265 Bacteria 6539969
535 2793361119 2791355266 Bacteria 7116587
536 2793369213 2791355267 Bacteria 7222458
537 2802719158 2802428858 Bacteria 6636079
538 2802727389 2802428859 Bacteria 6667919
539 2802732171 2802428860 Bacteria 6525526
540 2802739101 2802428861 Bacteria 6534206
541 2802745001 2802428862 Bacteria 6633353
542 2802752276 2802428863 Bacteria 6410669
543 2805925753 2802429605 Bacteria 6875453
544 2805933522 2802429606 Bacteria 6346811
545 2806046101 2802429633 Bacteria 7341974
546 2806054480 2802429634 Bacteria 7083200
547 2806060485 2802429635 Bacteria 7650140
548 2806065057 2802429636 Bacteria 7597525
549 2806072322 2802429637 Bacteria 7067217
550 2819241596 2818991272 Bacteria 4622173
551 2819608910 2818991448 Bacteria 6772224
552 2819637860 2818991453 Bacteria 7181617
553 2838021422 2838016132 Bacteria 6577831
554 2838028095 2838022645 Bacteria 6494267
555 2838030042 2838029111 Bacteria 6603031
556 2838043499 2838042994 Bacteria 6046894
557 2838052373 2838048938 Bacteria 6044578
558 2838065763 2838061910 Bacteria 6794874
559 2838073634 2838068647 Bacteria 6208656
560 2838671979 2838668709 Bacteria 6671819
561 2838682164 2838680041 Bacteria 6545511
562 2838691835 2838686498 Bacteria 7807632
563 2838696736 2838694306 Bacteria 6853137
564 2838704741 2838701080 Bacteria 6669771
565 2838710025 2838707686 Bacteria 6619912
566 2838733018 2838729681 Bacteria 7400765
567 2838745896 2838742623 Bacteria 7396178
568 2841855645 2841851746 Bacteria 7532261
569 2841864508 2841864319 Bacteria 6742987
570 2842078198 2842077413 Bacteria 6508645
571 2842114362 2842110456 Bacteria 7656360
572 2842119294 2842118031 Bacteria 7033875
573 2842148519 2842146304 Bacteria 5957337
574 2842157363 2842156927 Bacteria 6894975
575 2842168022 2842163707 Bacteria 6916235
576 2842181053 2842180545 Bacteria 6888678
577 2842194462 2842192696 Bacteria 6147454
578 2842203982 2842198810 Bacteria 6608673
579 2842205987 2842205361 Bacteria 6340321
580 2842217293 2842217011 Bacteria 7497767
581 2842230889 2842229732 Bacteria 7475766
582 2842239437 2842237096 Bacteria 6620661
583 2842245005 2842243621 Bacteria 7421798
584 2842254421 2842250916 Bacteria 6579627
585 2842258818 2842257432 Bacteria 7401195
586 2842265997 2842264693 Bacteria 6472963
587 2842276512 2842271015 Bacteria 7807131
588 2842279444 2842278818 Bacteria 6340002
589 2842286090 2842285085 Bacteria 6011953
590 2842291860 2842291075 Bacteria 7076806
591 2842301992 2842298080 Bacteria 6123127
592 2842304348 2842304105 Bacteria 7023636
593 2842317566 2842311132 Bacteria 6616990
594 2842317858 2842317721 Bacteria 6793725
595 2842345784 2842341865 Bacteria 7003929
596 2842357541 2842357229 Bacteria 6485165
597 2842364587 2842363717 Bacteria 6844742
598 2842372731 2842370503 Bacteria 7038661
599 2842378256 2842377471 Bacteria 7140707
600 2842385803 2842384541 Bacteria 7057858
601 2842398724 2842395702 Bacteria 6780583
602 2842403450 2842402390 Bacteria 6681310
603 2842409177 2842409023 Bacteria 6687331
604 2842415831 2842415677 Bacteria 6596907
605 2842428119 2842422224 Bacteria 6239196
606 2842429366 2842428310 Bacteria 6767288
607 2842435979 2842434925 Bacteria 6502746
608 2842442326 2842441272 Bacteria 6769273
609 2842450617 2842447887 Bacteria 6754142
610 2842463787 2842462802 Bacteria 6588055
611 2842470308 2842469257 Bacteria 6752936
612 2842476673 2842475841 Bacteria 6603183
613 2842484788 2842482326 Bacteria 7212537
614 2842490073 2842489311 Bacteria 6620893
615 2842496128 2842495871 Bacteria 6820686
616 2842503570 2842502639 Bacteria 6604161
617 2842511383 2842509118 Bacteria 6850950
618 2842522605 2842521101 Bacteria 6569494
619 2844459109 2844454524 Bacteria 7952546
620 2850082069 2850079185 Bacteria 6848280
621 2852389949 2852387548 Bacteria 8025568
622 2855825929 2855825444 Bacteria 6785811
623 2855841279 2855839649 Bacteria 7135830
624 2856350739 2856349417 Bacteria 6230045
625 2856364087 2856356410 Bacteria 6297484
626 2857523604 2857516855 Bacteria 7787325
627 2858802257 2858800743 Bacteria 6603254
628 2871495162 2871488783 Bacteria 6929816
629 2876395116 2876392853 Bacteria 6660880
630 2878758172 2878753008 Bacteria 6922523
631 2881156070 2881155292 Bacteria 6461656
632 2881852964 2881845957 Bacteria 6611900
633 2881853347 2881853255 Bacteria 6698367
634 2881866718 2881861095 Bacteria 7128710
635 2882634017 2882632389 Bacteria 8154593
636 2882914524 2882912400 Bacteria 6801539
637 2885323007 2885318864 Bacteria 6729568
638 2885351354 2885350715 Bacteria 6787678
639 2889791869 2889790730 Bacteria 5689708
640 2889918858 2889914905 Bacteria 5702301
641 2899807710 2899803654 Bacteria 5577784
642 2903496096 2903492973 Bacteria 13473544
643 2904661747 2904659560 Bacteria 6685615
644 2913311155 2913308742 Bacteria 5350706
645 2915653704 2915650412 Bacteria 4288180
646 2915985526 2915980308 Bacteria 6624279
647 2915990341 2915986958 Bacteria 6739310
648 2915994860 2915993759 Bacteria 7016183
649 2916002758 2916000859 Bacteria 6865702
650 2916014474 2916007675 Bacteria 6898660
651 2916017368 2916014648 Bacteria 6946486
652 2916024013 2916021584 Bacteria 6854472
653 2916033225 2916028427 Bacteria 6748433
654 2916036715 2916035215 Bacteria 6755766
655 2916044283 2916041962 Bacteria 6820487
656 2916052221 2916048683 Bacteria 6543552
657 2916055540 2916055098 Bacteria 6758838
658 2916065280 2916061851 Bacteria 6737736
659 2916072079 2916068649 Bacteria 6943657
660 2916082019 2916076590 Bacteria 6596108
661 2919106740 2919100787 Bacteria 7710546
662 2919175256 2919171160 Bacteria 6499771
663 2919411641 2919408235 Bacteria 6149349
664 2921204860 2921201388 Bacteria 6926299
665 2921212607 2921208531 Bacteria 6745326
666 2921242341 2921237296 Bacteria 6876710
667 2921246576 2921244191 Bacteria 6568419
668 2921255170 2921250672 Bacteria 6677771
669 2921259598 2921257292 Bacteria 6808382
670 2921266971 2921263974 Bacteria 6864552
671 2921287349 2921282425 Bacteria 6826397
672 2921294143 2921289301 Bacteria 7316391
673 2921297838 2921296804 Bacteria 7176999
674 2923557964 2923556063 Bacteria 6793593
675 2924145992 2924144063 Bacteria 6883928
676 2924154550 2924150972 Bacteria 7169444
677 2924163057 2924158325 Bacteria 7188855
678 2924170313 2924165586 Bacteria 7260590
679 2924176339 2924172951 Bacteria 6749356
680 2924181394 2924179722 Bacteria 6843264
681 2924189841 2924186466 Bacteria 6876637
682 2924196539 2924193448 Bacteria 6955718
683 2924205823 2924200457 Bacteria 6757188
684 2924211226 2924207177 Bacteria 6917007
685 2924217373 2924214083 Bacteria 7080103
686 2924225022 2924221636 Bacteria 7113495
687 2924231446 2924228884 Bacteria 6633132
688 2924721079 2924718760 Bacteria 6331356
689 2924785912 2924784321 Bacteria 7416538
690 2933571623 2933570622 Bacteria 7023390
691 2933590456 2933586486 Bacteria 7667493
692 2933603885 2933599457 Bacteria 5858799
693 2935897409 2935894831 Bacteria 6620579
694 2935905630 2935901341 Bacteria 7341747
695 2936372652 2936367885 Bacteria 7324495
696 2936378503 2936375103 Bacteria 6652732
697 2936388241 2936381700 Bacteria 7006523
698 2937005990 2937002841 Bacteria 6934057
699 2937013280 2937009748 Bacteria 6746052
700 2937019335 2937016420 Bacteria 6782579
701 2937028910 2937023124 Bacteria 6815156
702 2937033646 2937029754 Bacteria 6424026
703 2937036781 2937036028 Bacteria 6846469
704 2937047517 2937042894 Bacteria 6741576
705 2937050715 2937049772 Bacteria 6757901
706 2937063621 2937056579 Bacteria 7107896
707 2937068087 2937063883 Bacteria 7199456
708 2937072997 2937071275 Bacteria 6984483
709 2937079313 2937078374 Bacteria 6610289
710 2937085221 2937084907 Bacteria 6618516
711 2937094083 2937091812 Bacteria 6979387
712 2937106232 2937098957 Bacteria 7249374
713 2937109768 2937106411 Bacteria 6947143
714 2937115217 2937113482 Bacteria 6505872
715 2937123356 2937119839 Bacteria 6597547
716 2937129107 2937126314 Bacteria 6771275
717 2937847430 2937843397 Bacteria 5256375
718 2937983894 2937980651 Bacteria 6517427
719 2957381481 2957375807 Bacteria 6425588
720 2957387506 2957382221 Bacteria 6737050
721 2957391790 2957388812 Bacteria 6778072
722 2957396625 2957395598 Bacteria 6822399
723 2957404878 2957402308 Bacteria 6741770
724 2957410915 2957408893 Bacteria 6558585
725 2957420137 2957415311 Bacteria 6991633
726 2957426244 2957422303 Bacteria 7172205
727 2957433931 2957430029 Bacteria 7022557
728 2957441127 2957437181 Bacteria 6568994
729 2957445700 2957443900 Bacteria 6869977
730 2957454634 2957450854 Bacteria 6765715
731 2957464011 2957457609 Bacteria 6967680
732 2957467823 2957464669 Bacteria 6568877
733 2957472452 2957471148 Bacteria 6797643
734 2957480720 2957478035 Bacteria 6756658
735 2957488534 2957484790 Bacteria 6703082
736 2957496659 2957491536 Bacteria 6695180
737 2957502664 2957498199 Bacteria 7126688
738 2957506822 2957505466 Bacteria 7253085
739 2960590101 2960584000 Bacteria 6864594
740 2960597311 2960591022 Bacteria 6622873
741 2960598258 2960597568 Bacteria 6550735
742 2960609665 2960603979 Bacteria 6898737
743 2960615179 2960610863 Bacteria 6691244
744 2960620888 2960617483 Bacteria 6727748
745 2960627592 2960624210 Bacteria 6875384
746 2960635915 2960631154 Bacteria 6732508
747 2960649034 2960645483 Bacteria 7211087
748 2960659246 2960652885 Bacteria 7083688
749 2960662183 2960660292 Bacteria 7041660
750 2960672722 2960667422 Bacteria 6763020
751 2960676451 2960674078 Bacteria 6609048
752 2960687263 2960680706 Bacteria 6624464
753 2960689913 2960687367 Bacteria 6535474
754 2960698412 2960693952 Bacteria 6749742
755 2961116900 2961114664 Bacteria 6680456
756 2961135612 2961127735 Bacteria 7196641
757 2961174803 2961170736 Bacteria 7072258
758 2964611733 2964607997 Bacteria 7101408
759 2964616923 2964615318 Bacteria 6809089
760 2964624621 2964621998 Bacteria 6834995
761 2964631111 2964628898 Bacteria 7083044
762 2964637551 2964636051 Bacteria 7091832
763 2964646444 2964643177 Bacteria 6820887
764 2964651665 2964649959 Bacteria 6675118
765 2964661627 2964656573 Bacteria 7100150
766 2964669886 2964663802 Bacteria 7019362
767 2964673908 2964670856 Bacteria 6851364
768 2964678481 2964678106 Bacteria 6792020
769 2964686873 2964685014 Bacteria 6839111
770 2964694401 2964691889 Bacteria 6802758
771 2964701574 2964698721 Bacteria 6765331
772 2964710984 2964705432 Bacteria 7114648
773 2964714173 2964712639 Bacteria 6695970
774 2965068195 2965062239 Bacteria 7412989
775 2967665133 2967664464 Bacteria 6948836
776 2967675535 2967671571 Bacteria 7021409
777 2967686162 2967678726 Bacteria 7264382
778 2967690096 2967686174 Bacteria 6678622
779 2967697469 2967693043 Bacteria 6804451
780 2967702830 2967699805 Bacteria 6854538
781 2967709046 2967706974 Bacteria 7186053
782 2967716817 2967714385 Bacteria 7000047
783 2967726366 2967721400 Bacteria 7073753
784 2967732739 2967728569 Bacteria 6641507
785 2967740062 2967735183 Bacteria 6827012
786 2967743293 2967742019 Bacteria 6794534
787 2967753752 2967748971 Bacteria 6733771
788 2967758687 2967755722 Bacteria 6814706
789 2967769281 2967762386 Bacteria 6923502
790 2967770912 2967769361 Bacteria 6587838
791 2967780323 2967775926 Bacteria 6738189
792 2968000738 2967996073 Bacteria 6787468
793 2968009890 2968003550 Bacteria 6929263
794 2968112807 2968110612 Bacteria 6814636
795 2970020402 2970019648 Bacteria 7072033
796 2970030847 2970026789 Bacteria 6785236
797 2970034453 2970033650 Bacteria 7118744
798 2970042544 2970040964 Bacteria 6731123
799 2970048925 2970047711 Bacteria 7088379
800 2970057103 2970054988 Bacteria 6611507
801 2970066189 2970061556 Bacteria 7099761
802 2970070864 2970068827 Bacteria 7123112
803 2970079279 2970076120 Bacteria 6697332
804 2970083683 2970082768 Bacteria 6183754
805 2970090459 2970088815 Bacteria 6933825
806 2970099185 2970095765 Bacteria 6936963
807 2970107437 2970102677 Bacteria 6812532
808 2970111637 2970109326 Bacteria 6863976
809 2970121943 2970116247 Bacteria 6501857
810 2970126714 2970122695 Bacteria 6625855
811 2970133431 2970129317 Bacteria 6806560
812 2970143240 2970136068 Bacteria 7207982
813 2970148095 2970143518 Bacteria 6446480
814 2970156384 2970149975 Bacteria 6779706
815 2970161628 2970156795 Bacteria 7168044
816 2970168181 2970164137 Bacteria 6861252
817 2970174707 2970170962 Bacteria 6876229
818 2970180533 2970177841 Bacteria 6768001
819 2970189326 2970184632 Bacteria 7054431
820 2970195801 2970191845 Bacteria 7032787
821 2970507389 2970503327 Bacteria 7099517
822 2970543987 2970540015 Bacteria 6977556
823 2977529290 2977523885 Bacteria 6960446
824 2977534796 2977530762 Bacteria 6951399
825 2977542577 2977537788 Bacteria 6929320
826 2977547768 2977544691 Bacteria 6875412
827 2977556376 2977551784 Bacteria 7125765
828 2977560946 2977558990 Bacteria 6863948
829 2977567905 2977565890 Bacteria 6901543
830 2977575174 2977572785 Bacteria 6763888
831 2977584251 2977579622 Bacteria 6772100
832 2977828754 2977821940 Bacteria 6906439
833 2977832227 2977828996 Bacteria 7007971
834 2979771359 2979764755 Bacteria 6610066
835 2979812585 2979808191 Bacteria 7179355
836 2989779068 2989776772 Bacteria 4843317
837 2996337946 2996336353 Bacteria 5511628
838 2996891735 2996887358 Bacteria 5795980
839 2996894116 2996893221 Bacteria 5823108
840 3005420058 3005416602 Bacteria 7064308
841 3005447616 3005445848 Bacteria 6906074
842 3005454250 3005452660 Bacteria 5889319
843 639648586 639633055 Bacteria 7751309
844 643825909 643692032 Bacteria 6891900
845 648737497 648276728 Bacteria 6968865
846 8002286287 8002285264 Bacteria 6717907
847 8003993784 8003992118 Bacteria 7266902
848 8004001250 8003999396 Bacteria 7063185
849 8004379684 8004374579 Bacteria 6898112
850 8005248625 8005246636 Bacteria 4933972
851 8005263065 8005258706 Bacteria 6184835
852 8005280620 8005275841 Bacteria 6929066
853 8005283234 8005282627 Bacteria 6675747
854 8005290210 8005289223 Bacteria 6634003
855 8005302613 8005301065 Bacteria 6614431
856 8005309776 8005307578 Bacteria 7395396
857 8005317009 8005314921 Bacteria 7072929
858 8005326262 8005321885 Bacteria 5795980
859 8005379268 8005376324 Bacteria 6590079
860 8005388381 8005382845 Bacteria 6732062
861 8005399229 8005395548 Bacteria 6806915
862 8005434588 8005430974 Bacteria 6689030
863 8005462997 8005460587 Bacteria 7157962
864 8005485196 8005484373 Bacteria 6297373
865 8005500381 8005497431 Bacteria 6477605
866 8005545183 8005542996 Bacteria 7077758
867 8005557663 8005556819 Bacteria 6908598
868 8005568835 8005563573 Bacteria 7153261
869 8005574284 8005570704 Bacteria 6957481
870 8005621756 8005619151 Bacteria 7030230
871 8005626574 8005626139 Bacteria 6534237
872 8005649821 8005645114 Bacteria 6950293
873 8005671799 8005668836 Bacteria 6953162
874 8005683139 8005682033 Bacteria 6726518
875 8005694627 8005688590 Bacteria 6610080
876 8005699970 8005695170 Bacteria 6912330
877 8018129971 8018127388 Bacteria 7351159
878 8018166751 8018163183 Bacteria 7277977
879 8018179783 8018176218 Bacteria 6896178
880 8023685332 8023680758 Bacteria 7729763
881 8024483494 8024479707 Bacteria 6954785
882 8024506546 8024501048 Bacteria 6427847
883 8046773740 8046767195 Bacteria 7547379
884 8049294863 8049293176 Bacteria 6128433
885 8054559909 8054558443 Bacteria 5204801
886 8056376670 8056375014 Bacteria 7006639
887 8056387880 8056382006 Bacteria 6408074
888 8057575985 8057575449 Bacteria 7367519
889 8057875015 8057874678 Bacteria 7494653
890 Ga0307405_10149330
891 JGI25156J39149_1000001
892 JGI25162J39368_1000209
893 JGI25154J39366_1000011
894 JGI25157J39369_1000030
895 JGI25152J39213_1021550
896 JGI25150J39212_1018397
897 JGI25159J45721_1001269
898 JGI25151J46595_10000694
899 JGI25165J46597_1000302
900 JGI25153J46596_10000571
901 JGI25153J46596_10005200
902 JGI25153J46596_10043215
903 JGI25153J46596_10043224
904 rootH2_10013403
905 rootL2_10012994
906 rootH1_10157404
907 JGI25160J50197_1001053
908 JGI25160J50197_1004407
909 JGI25160J50197_1048674
910 JGI25161J50226_1000006
911 JGI25161J50226_1000196
912 JGI25161J50226_1003805
913 Ga0055539_1025270
914 Ga0055526_1000781
915 Ga0055526_1002722
916 Ga0055526_1097729
917 Ga0055524_1002229
918 Ga0055524_1026478
919 Ga0055524_1036966
920 Ga0055536_1004405
921 Ga0055528_1000284
922 Ga0055528_1005786
923 Ga0055528_1014021
924 Ga0055528_1015021
925 Ga0055528_1033834
926 Ga0055530_10021499
927 Ga0055540_1000644
928 Ga0055540_1002882
929 Ga0055540_1009913
930 Ga0055540_1055169
931 Ga0055531_10000733
932 Ga0058692_1038954
933 Ga0055543_1000020
934 Ga0065165_1011534
935 Ga0070670_100758095
936 Ga0070661_100620101
937 Ga0070668_101440973
938 Ga0070669_100222559
939 Ga0070671_100013497
940 Ga0070659_100874580
941 Ga0070663_100146190
942 Ga0070662_100356560
943 Ga0068867_100565201
944 Ga0068853_101141623
945 Ga0070665_100178472
946 Ga0070665_100583393
947 Ga0068855_100397730
948 Ga0068854_100425152
949 Ga0068856_100051132
950 Ga0068856_101928547
951 Ga0068852_100148653
952 Ga0068859_102182651
953 Ga0081455_10174345
954 Ga0081540_1004036
955 Ga0081539_10038898
956 Ga0075365_10000878
957 Ga0075365_10002271
958 Ga0075365_10084398
959 Ga0075365_10179172
960 Ga0075368_10119616
961 Ga0075363_100093904
962 Ga0075363_100283102
963 Ga0075364_10057730
964 Ga0075364_10620274
965 Ga0075362_10001797
966 Ga0075362_10262545
967 Ga0075367_10009732
968 Ga0075367_10027611
969 Ga0075367_10061605
970 Ga0075367_10315034
971 Ga0075367_10328187
972 Ga0075367_11054255
973 Ga0075369_10017690
974 Ga0075369_10102455
975 Ga0075369_10214342
976 Ga0075366_10051911
977 Ga0075370_10128253
978 Ga0075370_10262902
979 Ga0097620_102183263
980 Ga0079104_1005883
981 Ga0105251_10012763
982 Ga0105244_10193434
983 Ga0105250_10327115
984 Ga0105240_10000005
985 Ga0105247_10754103
986 Ga0105243_10103599
987 Ga0105248_10098178
988 Ga0105248_10649686
989 Ga0105237_10003120
990 Ga0123340_1084051
991 Ga0123341_1001797
992 Ga0123341_1049735
993 Ga0123342_1024227
994 Ga0105239_10102928
995 Ga0157370_10006428
996 Ga0157369_10205865
997 Ga0157369_10602010
998 Ga0157369_11875689
999 Ga0163162_12323803
1000 Ga0157372_10965503
1001 Ga0157375_11394857
1002 Ga0157380_11601184
1003 Ga0182008_10028326
1004 Ga0182007_10001048
1005 Ga0182005_1002574
1006 Ga0214542_1029734
1007 Ga0214543_1000011
1008 Ga0209435_100012
1009 Ga0209436_100020
1010 Ga0209436_122264
1011 Ga0209437_100047
1012 Ga0209437_100165
1013 Ga0207425_1015745
1014 Ga0207425_1039499
1015 Ga0209646_1000026
1016 Ga0209026_1000014
1017 Ga0209677_100511
1018 Ga0209759_1000012
1019 Ga0209129_1000418
1020 Ga0209129_1000659
1021 Ga0209129_1014882
1022 Ga0209129_1031954
1023 Ga0209233_1000048
1024 Ga0209233_1000069
1025 Ga0209233_1000195
1026 Ga0209565_1047860
1027 Ga0209455_1025257
1028 Ga0209673_1000013
1029 Ga0209673_1001041
1030 Ga0209673_1001070
1031 Ga0209673_1010316
1032 Ga0209673_1019270
1033 Ga0209130_1000004
1034 Ga0209130_1000021
1035 Ga0209130_1027518
1036 Ga0209130_1029747
1037 Ga0209130_1042134
1038 Ga0209675_1025095
1039 Ga0209676_1022322
1040 Ga0209676_1046125
1041 Ga0209676_1051759
1042 Ga0209025_1000166
1043 Ga0209025_1061291
1044 Ga0209564_1000273
1045 Ga0209564_1000469
1046 Ga0209564_1002229
1047 Ga0209564_1029910
1048 Ga0209758_1000218
1049 Ga0209758_1000694
1050 Ga0209758_1038255
1051 Ga0209758_1122973
1052 Ga0209050_1006104
1053 Ga0209050_1024298
1054 Ga0209256_1000917
1055 Ga0209256_1001513
1056 Ga0209256_1006962
1057 Ga0209256_1031428
1058 Ga0207426_1000003
1059 Ga0207426_1000010
1060 Ga0207426_1000039
1061 Ga0207426_1001473
1062 Ga0209051_1000142
1063 Ga0209051_1017667
1064 Ga0209051_1029991
1065 Ga0209051_1067490
1066 Ga0209257_1002347
1067 Ga0209257_1003669
1068 Ga0207713_1084448
1069 Ga0207680_10273175
1070 Ga0207695_10000011
1071 Ga0207671_10000241
1072 Ga0207657_10091142
1073 Ga0207681_10482099
1074 Ga0207644_10075576
1075 Ga0207706_10247888
1076 Ga0207711_10079645
1077 Ga0207711_10108022
1078 Ga0207667_10340856
1079 Ga0207668_10240552
1080 Ga0207640_10032818
1081 Ga0207678_10183497
1082 Ga0207678_10303378
1083 Ga0207702_10096757
1084 Ga0207698_10234126
1085 Ga0209281_1000483
1086 Ga0209813_10211035
1087 Ga0268266_10043363
1088 Ga0268266_10325101
1089 Ga0307515_10000023
1090 Ga0307515_10000945
1091 Ga0307515_10093561
1092 Ga0307513_10016547
1093 Ga0307408_100029770
1094 Ga0307408_101643806
1095 Ga0316575_10028445
1096 Ga0307410_10119041
1097 Ga0307409_100471558
1098 Ga0307414_10373555
1099 Ga0307414_11344925
1100 Ga0373939_0303110
1101 Ga0395900_0000509
1102 Ga0395898_0000908
1103 Ga0395905_0000623
1104 Ga0395901_0000142
1105 Ga0439436_0000347
1106 Ga0439465_0006346
1107 Ga0439465_0033992
1108 Ga0439465_0034178
1109 Ga0439465_0061650
1110 Ga0439465_0088052
1111 Ga0451787_298666
1112 Ga0451795_0679508
1113 Ga0451798_0279347
1114 Ga0451833_0234757
1115 Ga0451835_0848253
1116 Ga0451837_0526918
1117 Ga0451839_1338330
1118 Ga0451841_0510039
1119 Ga0451845_0104391
1120 Ga0451845_0344438
1121 Ga0451845_0660139
1122 Ga0451847_0286667
1123 Ga0451849_0320370
1124 Ga0451849_1239995
1125 Ga0451851_1027828
1126 Ga0451843_0643462
1127 Ga0451843_1103898
1128 Ga0451855_0832465
1129 Ga0451853_0707082
1130 Ga0452271_42778
1131 Ga0439431_0109690
1132 Ga0439432_012299
1133 Ga0439462_0012197
1134 Ga0450920_007352
1135 Ga0450897_019016
1136 Ga0450907_007388
1137 Ga0450909_012830
1138 Ga0439434_0007072
1139 Ga0450918_024916
1140 Ga0466970_0001346
1141 Ga0466957_0026871
1142 Ga0466959_0083583
1143 Ga0466958_0017505
1144 Ga0466967_0152577
1145 Ga0495617_023039
1146 Ga0495638_0133474
1147 Ga0495585_0044165
1148 Ga0495596_0221753
1149 Ga0495607_0024207
1150 Ga0495607_0053196
1151 Ga0495583_0092749
1152 Ga0495606_0012599
1153 Ga0495606_0103179
1154 Ga0495606_0425648
1155 Ga0495610_0075464
1156 Ga0495610_0182497
1157 Ga0495616_0064883
1158 Ga0495620_0019021
1159 Ga0495632_0406110
1160 Ga0495643_0010535
1161 Ga0495643_0079056
1162 Ga0495663_0053542
1163 Ga0495609_0052092
1164 Ga0495597_0068071
1165 Ga0495633_0014629
1166 Ga0495633_0060673
1167 Ga0495656_0093942
1168 Ga0495668_0061271
1169 Ga0495611_0068760
1170 Ga0495661_0084210
1171 Ga0495670_0013546
1172 Ga0495671_0070728
1173 Ga0495649_0581215
1174 Ga0495660_0067176
1175 Ga0495672_0479511
1176 Ga0495683_0077831
1177 Ga0495687_056492
1178 Ga0495677_0166539
1179 Ga0495685_220722
1180 Ga0495673_0324411
1181 Ga0495686_0128236
1182 Ga0495615_0036067
1183 Ga0496100_0043660
1184 Ga0496101_0545127
1185 Ga0496102_0007361
1186 Ga0496102_0723840
1187 Ga0496103_0012306
1188 Ga0496105_0161301
1189 Ga0496106_0000050
1190 Ga0496106_0027944
1191 Ga0496110_1823850
1192 Ga0496111_0512494
1193 Ga0496113_0111043
1194 Ga0496114_0045044
1195 Ga0496116_0008243
1196 Ga0496116_0052274
1197 Ga0496116_0176571
1198 Ga0496117_0000353
1199 Ga0496117_0002546
1200 Ga0496117_0014332
1201 Ga0496118_0000204
1202 Ga0496118_0017776
1203 Ga0496118_0045436
1204 Ga0496119_0001824
1205 Ga0496119_0006614
1206 Ga0496120_0003339
1207 Ga0496120_0016908
1208 Ga0496120_0050756
1209 Ga0496121_0000378
1210 Ga0496121_0038141
1211 Ga0496121_0116303
1212 Ga0496121_0302126
1213 Ga0496121_0573677
1214 Ga0496122_0023423
1215 Ga0496122_0025427
1216 Ga0496122_0250943
1217 Ga0496122_0259136
1218 Ga0496123_0016997
1219 Ga0496123_0086062
1220 Ga0496123_0250693
1221 Ga0496124_0032700
1222 Ga0496124_0113396
1223 Ga0496124_0319098
1224 Ga0496125_0004077
1225 Ga0496125_0013737
1226 Ga0496125_0034670
1227 Ga0496126_0041490
1228 Ga0496126_0105964
1229 Ga0496126_0892805
1230 Ga0495682_0048911
1231 Ga0501031_0621154
1232 Ga0501033_0001044
1233 Ga0501034_0000960
1234 Ga0501034_0064331
1235 Ga0501034_0066590
1236 Ga0501036_1076908
1237 Ga0501037_0369737
1238 Ga0501038_0602360
1239 Ga0501039_0584743
1240 Ga0501043_0064570
1241 Ga0501046_0052503
1242 Ga0501047_0031547
1243 Ga0501047_0674611
1244 Ga0501067_0069915
1245 Ga0501068_0112809
1246 Ga0501076_0229682
1247 Ga0501083_0731483
1248 Ga0501035_0001225
1249 Ga0501045_0803207
1250 nmdc:mga03683_320902_c1
1251 nmdc:mga03683_90168_c1
1252 nmdc:mga03n38_86307_c1
1253 nmdc:mga00v17_738229_c1
1254 nmdc:mga0yw44_12562_c1
1255 nmdc:mga0yw44_168367_c1
1256 nmdc:mga0yw44_197763_c1
1257 nmdc:mga0yw44_30688_c1
1258 nmdc:mga0yw44_8617_c1
1259 nmdc:mga0yw44_951330_c1
1260 nmdc:mga0k408_21196_c1
1261 nmdc:mga06z11_31069_c1
1262 nmdc:mga06z11_964809_c1
1263 nmdc:mga07m45_158134_c1
1264 nmdc:mga07m45_93074_c1
1265 nmdc:mga0sz30_2081_c1
1266 nmdc:mga0sz30_3493_c2
1267 Ga0500578_0251799
1268 Ga0500643_009470
1269 Ga0500651_0068166
1270 Ga0500569_026822
1271 Ga0500594_0006847
1272 Ga0500642_0083296
1273 Ga0500658_0000599
1274 Ga0500568_0000140
1275 Ga0500568_0015217
1276 Ga0500588_0140204
1277 Ga0500616_0010920
1278 Ga0500616_0011648
1279 Ga0500616_0361961
1280 Ga0500616_0390483
1281 Ga0500620_000777
1282 Ga0500622_0000265
1283 Ga0500627_0042641
1284 Ga0500627_0200098
1285 Ga0500627_0278153
1286 Ga0500627_0338216
1287 Ga0500636_0110106
1288 Ga0500611_094628
1289 Ga0501084_0162890
1290 2509107484
1291 2509375819
1292 2509386635
1293 2509392876
1294 2509443315
1295 2510133362
1296 2510303350
1297 2510842536
1298 2510894744
1299 2511186819
1300 2511501833
1301 2512533270
1302 2512971234
1303 2513572449
1304 2513577338
1305 2513584692
1306 2513603944
1307 2513615402
1308 2513630035
1309 2513708675
1310 2513864679
1311 2513881190
1312 2513905669
1313 2513984382
1314 2513997153
1315 2514006169
1316 2514021681
1317 2514038420
1318 2514590119
1319 2515112327
1320 2515632678
1321 2515639826
1322 2515661275
1323 2515744185
1324 2516893128
1325 2517036057
1326 2517076452
1327 2517095213
1328 2517406830
1329 2517569884
1330 2520375950
1331 2524448901
1332 2524460230
1333 2530645582
1334 2551677978
1335 2551686749
1336 2551690974
1337 2551698959
1338 2551713834
1339 2551717852
1340 2551719332
1341 2551727835
1342 2551743896
1343 2558868089
1344 2585166049
1345 2585200203
1346 2585224455
1347 2585229955
1348 2585268072
1349 2585277252
1350 2585323740
1351 2585331715
1352 2585386826
1353 2585396711
1354 2585402044
1355 2585527692
1356 2585534014
1357 2585537588
1358 2585546576
1359 2585552136
1360 2585821829
1361 2585835538
1362 2616292407
1363 2616308629
1364 2616557067
1365 2643774251
1366 2643775338
1367 2643793784
1368 2643837589
1369 2644003799
1370 2644049121
1371 2644132257
1372 2644192737
1373 2644204535
1374 2644298538
1375 2644482155
1376 2644496509
1377 2644656767
1378 2671111670
1379 2719181230
1380 2719385840
1381 2719665654
1382 2719731979
1383 2720492074
1384 2720613338
1385 2720620214
1386 2720631639
1387 2720775367
1388 2721147324
1389 2721158857
1390 2721164242
1391 2721399619
1392 2722840412
1393 2723026987
1394 2723560599
1395 2723567186
1396 2724038432
1397 2724044735
1398 2724089974
1399 2724104451
1400 2724110246
1401 2725952131
1402 2730107923
1403 2730164467
1404 2730298489
1405 2738946258
1406 2739036551
1407 2739308076
1408 2753458819
1409 2757570965
1410 2766067506
1411 2776913735
1412 2778174065
1413 2792581863
1414 2792620091
1415 2792626490
1416 2793294725
1417 2793312306
1418 2793324954
1419 2793330587
1420 2793335680
1421 2793341576
1422 2793349021
1423 2793353018
1424 2793361119
1425 2793369213
1426 2802719158
1427 2802727389
1428 2802732171
1429 2802739101
1430 2802745001
1431 2802752276
1432 2805925753
1433 2805933522
1434 2806046101
1435 2806054480
1436 2806060485
1437 2806065057
1438 2806072322
1439 2819241596
1440 2819608910
1441 2819637860
1442 2838021422
1443 2838028095
1444 2838030042
1445 2838043499
1446 2838052373
1447 2838065763
1448 2838073634
1449 2838671979
1450 2838682164
1451 2838691835
1452 2838696736
1453 2838704741
1454 2838710025
1455 2838733018
1456 2838745896
1457 2841855645
1458 2841864508
1459 2842078198
1460 2842114362
1461 2842119294
1462 2842148519
1463 2842157363
1464 2842168022
1465 2842181053
1466 2842194462
1467 2842203982
1468 2842205987
1469 2842217293
1470 2842230889
1471 2842239437
1472 2842245005
1473 2842254421
1474 2842258818
1475 2842265997
1476 2842276512
1477 2842279444
1478 2842286090
1479 2842291860
1480 2842301992
1481 2842304348
1482 2842317566
1483 2842317858
1484 2842345784
1485 2842357541
1486 2842364587
1487 2842372731
1488 2842378256
1489 2842385803
1490 2842398724
1491 2842403450
1492 2842409177
1493 2842415831
1494 2842428119
1495 2842429366
1496 2842435979
1497 2842442326
1498 2842450617
1499 2842463787
1500 2842470308
1501 2842476673
1502 2842484788
1503 2842490073
1504 2842496128
1505 2842503570
1506 2842511383
1507 2842522605
1508 2844459109
1509 2850082069
1510 2852389949
1511 2855825929
1512 2855841279
1513 2856350739
1514 2856364087
1515 2857523604
1516 2858802257
1517 2871495162
1518 2876395116
1519 2878758172
1520 2881156070
1521 2881852964
1522 2881853347
1523 2881866718
1524 2882634017
1525 2882914524
1526 2885323007
1527 2885351354
1528 2889791869
1529 2889918858
1530 2899807710
1531 2903496096
1532 2904661747
1533 2913311155
1534 2915653704
1535 2915985526
1536 2915990341
1537 2915994860
1538 2916002758
1539 2916014474
1540 2916017368
1541 2916024013
1542 2916033225
1543 2916036715
1544 2916044283
1545 2916052221
1546 2916055540
1547 2916065280
1548 2916072079
1549 2916082019
1550 2919106740
1551 2919175256
1552 2919411641
1553 2921204860
1554 2921212607
1555 2921242341
1556 2921246576
1557 2921255170
1558 2921259598
1559 2921266971
1560 2921287349
1561 2921294143
1562 2921297838
1563 2923557964
1564 2924145992
1565 2924154550
1566 2924163057
1567 2924170313
1568 2924176339
1569 2924181394
1570 2924189841
1571 2924196539
1572 2924205823
1573 2924211226
1574 2924217373
1575 2924225022
1576 2924231446
1577 2924721079
1578 2924785912
1579 2933571623
1580 2933590456
1581 2933603885
1582 2935897409
1583 2935905630
1584 2936372652
1585 2936378503
1586 2936388241
1587 2937005990
1588 2937013280
1589 2937019335
1590 2937028910
1591 2937033646
1592 2937036781
1593 2937047517
1594 2937050715
1595 2937063621
1596 2937068087
1597 2937072997
1598 2937079313
1599 2937085221
1600 2937094083
1601 2937106232
1602 2937109768
1603 2937115217
1604 2937123356
1605 2937129107
1606 2937847430
1607 2937983894
1608 2957381481
1609 2957387506
1610 2957391790
1611 2957396625
1612 2957404878
1613 2957410915
1614 2957420137
1615 2957426244
1616 2957433931
1617 2957441127
1618 2957445700
1619 2957454634
1620 2957464011
1621 2957467823
1622 2957472452
1623 2957480720
1624 2957488534
1625 2957496659
1626 2957502664
1627 2957506822
1628 2960590101
1629 2960597311
1630 2960598258
1631 2960609665
1632 2960615179
1633 2960620888
1634 2960627592
1635 2960635915
1636 2960649034
1637 2960659246
1638 2960662183
1639 2960672722
1640 2960676451
1641 2960687263
1642 2960689913
1643 2960698412
1644 2961116900
1645 2961135612
1646 2961174803
1647 2964611733
1648 2964616923
1649 2964624621
1650 2964631111
1651 2964637551
1652 2964646444
1653 2964651665
1654 2964661627
1655 2964669886
1656 2964673908
1657 2964678481
1658 2964686873
1659 2964694401
1660 2964701574
1661 2964710984
1662 2964714173
1663 2965068195
1664 2967665133
1665 2967675535
1666 2967686162
1667 2967690096
1668 2967697469
1669 2967702830
1670 2967709046
1671 2967716817
1672 2967726366
1673 2967732739
1674 2967740062
1675 2967743293
1676 2967753752
1677 2967758687
1678 2967769281
1679 2967770912
1680 2967780323
1681 2968000738
1682 2968009890
1683 2968112807
1684 2970020402
1685 2970030847
1686 2970034453
1687 2970042544
1688 2970048925
1689 2970057103
1690 2970066189
1691 2970070864
1692 2970079279
1693 2970083683
1694 2970090459
1695 2970099185
1696 2970107437
1697 2970111637
1698 2970121943
1699 2970126714
1700 2970133431
1701 2970143240
1702 2970148095
1703 2970156384
1704 2970161628
1705 2970168181
1706 2970174707
1707 2970180533
1708 2970189326
1709 2970195801
1710 2970507389
1711 2970543987
1712 2977529290
1713 2977534796
1714 2977542577
1715 2977547768
1716 2977556376
1717 2977560946
1718 2977567905
1719 2977575174
1720 2977584251
1721 2977828754
1722 2977832227
1723 2979771359
1724 2979812585
1725 2989779068
1726 2996337946
1727 2996891735
1728 2996894116
1729 3005420058
1730 3005447616
1731 3005454250
1732 639648586
1733 643825909
1734 648737497
1735 8002286287
1736 8003993784
1737 8004001250
1738 8004379684
1739 8005248625
1740 8005263065
1741 8005280620
1742 8005283234
1743 8005290210
1744 8005302613
1745 8005309776
1746 8005317009
1747 8005326262
1748 8005379268
1749 8005388381
1750 8005399229
1751 8005434588
1752 8005462997
1753 8005485196
1754 8005500381
1755 8005545183
1756 8005557663
1757 8005568835
1758 8005574284
1759 8005621756
1760 8005626574
1761 8005649821
1762 8005671799
1763 8005683139
1764 8005694627
1765 8005699970
1766 8018129971
1767 8018166751
1768 8018179783
1769 8023685332
1770 8024483494
1771 8024506546
1772 8046773740
1773 8049294863
1774 8054559909
1775 8056376670
1776 8056387880
1777 8057575985
1778 8057875015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

54

113

0.98

PF01047

MarR

MarR family

56

114

0.96

PF13463

HTH_27

Winged helix DNA-binding domain

56

122

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9426 45 111
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9414 42 93
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9333 44 103
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9317 42 103
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9285 42 102
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9472 40 101 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9432 41 104 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9427 56 104 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9394 44 102 1.10.10.10
af_Q4DKK4_76_138_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9368 46 104 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W5NE56-F1-model_v4 deleted 0.9833 1 152
AF-A0A286HLG9-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9732 1 150 GO:0003677
GO:0003700
AF-A0A7W5NE56-F1-model_v4 deleted 0.9645 1 152
AF-A0A318T7A3-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9644 22 148 GO:0003677
GO:0003700
AF-A0A434FNP0-F1-model_v4 MarR family transcriptional regulator 0.9635 1 133 GO:0003677
GO:0003700

Map