F484830

General Info

Members Datasets Scaffolds Average Seq Length
890 290 890 183

Family's Representative Sequence

Representative Sequence 3300046683|Ga0495658_0365726|Ga0495658_0365726_159_836
Length 225
Sequence MSRRFAKAALQGWAFGCAARDDSAVACSREAIIMNRSTLFPPPMNLDRVPAGKDAPEDCNVIIEIPMHGDAIKYEVDKETGAVFVDRFMSTSMHYPCNYGYIPQTLSDDGDPCDVLVLSPVPLITGVVVRCRPIGMLKMEDEAGGDAKILAVPIDRLSGLYRAIQSPRDLPEITIKQIAHFFEHYKDLEPGKWVRVSTWVEAAEAKKEVMAGIARYGAAVRSTPP

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
197 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 3.26
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1008514 3300001976 Bacteria 1338
2 JGI24743J22301_10001507 3300001991 Bacteria 3246
3 JGI24750J21931_1047374 3300002070 Bacteria 664
4 JGI24749J21850_1003442 3300002076 Bacteria 2214
5 JGI24035J26624_1019386 3300002126 Bacteria 712
6 JGI24034J26672_10002151 3300002239 Bacteria 2687
7 JGI24751J29686_10013755 3300002459 Bacteria 1670
8 Ga0065712_10209245 3300005290 Bacteria 1079
9 Ga0065715_10034978 3300005293 Bacteria 1593
10 Ga0065715_10287265 3300005293 Bacteria 1072
11 Ga0070658_10007975 3300005327 Bacteria 8521
12 Ga0070658_10678966 3300005327 Bacteria 894
13 Ga0070676_10000214 3300005328 Bacteria 24753
14 Ga0070676_10000744 3300005328 Bacteria 16010
15 Ga0070676_10021975 3300005328 Bacteria 3575
16 Ga0070676_10045208 3300005328 Bacteria 2564
17 Ga0070676_10138379 3300005328 Bacteria 1547
18 Ga0070676_10170916 3300005328 Bacteria 1406
19 Ga0070676_10184095 3300005328 Bacteria 1360
20 Ga0070676_10395994 3300005328 Bacteria 960
21 Ga0070683_100013846 3300005329 Bacteria 7044
22 Ga0070683_100052990 3300005329 Bacteria 3759
23 Ga0070683_100097679 3300005329 Bacteria 2763
24 Ga0070690_100006539 3300005330 Bacteria 6615
25 Ga0070690_100031081 3300005330 Bacteria 3323
26 Ga0070690_100040227 3300005330 Bacteria 2956
27 Ga0070670_100001469 3300005331 Bacteria 18968
28 Ga0070670_100005022 3300005331 Bacteria 11132
29 Ga0070670_100148860 3300005331 Bacteria 2026
30 Ga0070670_100203236 3300005331 Bacteria 1722
31 Ga0070670_100403816 3300005331 Bacteria 1206
32 Ga0070670_100438276 3300005331 Bacteria 1157
33 Ga0070677_10010206 3300005333 Bacteria 3207
34 Ga0070677_10023366 3300005333 Bacteria 2288
35 Ga0068869_100005557 3300005334 Bacteria 7934
36 Ga0068869_100053049 3300005334 Bacteria 2946
37 Ga0068869_100190880 3300005334 Bacteria 1611
38 Ga0068869_100201317 3300005334 Bacteria 1570
39 Ga0068869_100297666 3300005334 Bacteria 1302
40 Ga0068869_100347343 3300005334 Bacteria 1208
41 Ga0070666_10005903 3300005335 Bacteria 7522
42 Ga0070666_10014709 3300005335 Bacteria 4984
43 Ga0070666_10019443 3300005335 Bacteria 4384
44 Ga0070666_10024618 3300005335 Bacteria 3923
45 Ga0070666_10337158 3300005335 Bacteria 1077
46 Ga0070680_100120481 3300005336 Bacteria 2190
47 Ga0070680_100571407 3300005336 Bacteria 970
48 Ga0070682_100023737 3300005337 Bacteria 3644
49 Ga0070682_100693550 3300005337 Bacteria 816
50 Ga0068868_100004061 3300005338 Bacteria 10207
51 Ga0068868_100017518 3300005338 Bacteria 5340
52 Ga0068868_100022796 3300005338 Bacteria 4731
53 Ga0068868_100052991 3300005338 Bacteria 3195
54 Ga0068868_100106086 3300005338 Bacteria 2279
55 Ga0070660_100065988 3300005339 Bacteria 2817
56 Ga0070660_100076968 3300005339 Bacteria 2613
57 Ga0070660_100093703 3300005339 Bacteria 2372
58 Ga0070689_100000324 3300005340 Bacteria 27871
59 Ga0070689_100000650 3300005340 Bacteria 20990
60 Ga0070689_100032106 3300005340 Bacteria 3993
61 Ga0070687_100010907 3300005343 Bacteria 3954
62 Ga0070687_100016406 3300005343 Bacteria 3378
63 Ga0070661_100008349 3300005344 Bacteria 7154
64 Ga0070661_100157376 3300005344 Bacteria 1719
65 Ga0070661_100393450 3300005344 Bacteria 1094
66 Ga0070661_100850556 3300005344 Bacteria 751
67 Ga0070692_10046636 3300005345 Bacteria 2241
68 Ga0070692_10296993 3300005345 Bacteria 985
69 Ga0070668_100003856 3300005347 Bacteria 11068
70 Ga0070668_100004563 3300005347 Bacteria 10272
71 Ga0070668_100006505 3300005347 Bacteria 8664
72 Ga0070668_100018741 3300005347 Bacteria 5197
73 Ga0070668_100025622 3300005347 Bacteria 4473
74 Ga0070668_100032342 3300005347 Bacteria 3981
75 Ga0070668_100043430 3300005347 Bacteria 3447
76 Ga0070668_100107246 3300005347 Bacteria 2220
77 Ga0070668_100304243 3300005347 Bacteria 1338
78 Ga0070668_101070825 3300005347 Bacteria 727
79 Ga0070669_100008372 3300005353 Bacteria 7378
80 Ga0070669_100010664 3300005353 Bacteria 6521
81 Ga0070669_100026932 3300005353 Bacteria 4137
82 Ga0070669_100275635 3300005353 Bacteria 1346
83 Ga0070669_100287492 3300005353 Bacteria 1319
84 Ga0070669_100290198 3300005353 Bacteria 1313
85 Ga0070675_100000802 3300005354 Bacteria 22093
86 Ga0070675_100007226 3300005354 Bacteria 8561
87 Ga0070675_100009565 3300005354 Bacteria 7543
88 Ga0070675_100015454 3300005354 Bacteria 6036
89 Ga0070675_100016229 3300005354 Bacteria 5909
90 Ga0070675_100018750 3300005354 Bacteria 5508
91 Ga0070675_100125784 3300005354 Bacteria 2181
92 Ga0070671_100001313 3300005355 Bacteria 18668
93 Ga0070671_100029996 3300005355 Bacteria 4487
94 Ga0070671_100063870 3300005355 Bacteria 3067
95 Ga0070671_100249511 3300005355 Bacteria 1507
96 Ga0070671_100321566 3300005355 Bacteria 1318
97 Ga0070671_100464801 3300005355 Bacteria 1086
98 Ga0070671_100544628 3300005355 Bacteria 1000
99 Ga0070671_100774652 3300005355 Bacteria 834
100 Ga0070674_100000512 3300005356 Bacteria 19432
101 Ga0070674_100004443 3300005356 Bacteria 7998
102 Ga0070674_100004897 3300005356 Bacteria 7675
103 Ga0070674_100009097 3300005356 Bacteria 5942
104 Ga0070674_100067560 3300005356 Bacteria 2515
105 Ga0070674_100338322 3300005356 Bacteria 1211
106 Ga0070674_100512913 3300005356 Bacteria 1000
107 Ga0070673_100000898 3300005364 Bacteria 16796
108 Ga0070673_100006767 3300005364 Bacteria 7480
109 Ga0070673_100025616 3300005364 Bacteria 4345
110 Ga0070673_100213933 3300005364 Bacteria 1666
111 Ga0070673_100218979 3300005364 Bacteria 1647
112 Ga0070673_101302022 3300005364 Bacteria 682
113 Ga0070688_100003909 3300005365 Bacteria 7731
114 Ga0070688_100011922 3300005365 Bacteria 4853
115 Ga0070688_100057349 3300005365 Bacteria 2448
116 Ga0070688_100078175 3300005365 Bacteria 2134
117 Ga0070659_100023473 3300005366 Bacteria 4720
118 Ga0070659_100066353 3300005366 Bacteria 2859
119 Ga0070659_100195528 3300005366 Bacteria 1663
120 Ga0070667_100006506 3300005367 Bacteria 9713
121 Ga0070667_100018863 3300005367 Bacteria 5719
122 Ga0070667_100038861 3300005367 Bacteria 3989
123 Ga0070667_100048102 3300005367 Bacteria 3590
124 Ga0070667_100058862 3300005367 Bacteria 3249
125 Ga0070667_100101889 3300005367 Bacteria 2480
126 Ga0070667_100229378 3300005367 Bacteria 1655
127 Ga0070667_100345015 3300005367 Bacteria 1347
128 Ga0070709_10085217 3300005434 Bacteria 2072
129 Ga0070709_10127755 3300005434 Bacteria 1731
130 Ga0070709_10474162 3300005434 Bacteria 946
131 Ga0070714_100003295 3300005435 Bacteria 12036
132 Ga0070714_100012558 3300005435 Bacteria 6768
133 Ga0070714_100179862 3300005435 Bacteria 1924
134 Ga0070714_100234866 3300005435 Bacteria 1690
135 Ga0070713_100007196 3300005436 Bacteria 7787
136 Ga0070713_100016403 3300005436 Bacteria 5569
137 Ga0070713_100230985 3300005436 Bacteria 1681
138 Ga0070710_10009218 3300005437 Bacteria 4824
139 Ga0070710_10011674 3300005437 Bacteria 4346
140 Ga0070710_10036771 3300005437 Bacteria 2678
141 Ga0070701_10290377 3300005438 Bacteria 1002
142 Ga0070711_100009868 3300005439 Bacteria 5888
143 Ga0070711_100070966 3300005439 Bacteria 2454
144 Ga0070705_100056195 3300005440 Bacteria 2317
145 Ga0070700_100009084 3300005441 Bacteria 5448
146 Ga0070694_100119413 3300005444 Bacteria 1890
147 Ga0070708_100024762 3300005445 Bacteria 5125
148 Ga0070708_100103506 3300005445 Bacteria 2610
149 Ga0070708_100112294 3300005445 Bacteria 2506
150 Ga0070663_100042112 3300005455 Bacteria 3207
151 Ga0070663_100316960 3300005455 Bacteria 1253
152 Ga0070663_100369358 3300005455 Bacteria 1165
153 Ga0070678_100000282 3300005456 Bacteria 23627
154 Ga0070678_100001298 3300005456 Bacteria 13264
155 Ga0070678_100001846 3300005456 Bacteria 11419
156 Ga0070662_100005937 3300005457 Bacteria 7831
157 Ga0070662_100257470 3300005457 Bacteria 1405
158 Ga0070662_100686867 3300005457 Bacteria 865
159 Ga0068867_100004441 3300005459 Bacteria 9864
160 Ga0068867_100005854 3300005459 Bacteria 8719
161 Ga0068867_100025973 3300005459 Bacteria 4202
162 Ga0068867_100129999 3300005459 Bacteria 1956
163 Ga0068867_100130059 3300005459 Bacteria 1955
164 Ga0070685_10000522 3300005466 Bacteria 21790
165 Ga0070685_10012020 3300005466 Bacteria 4538
166 Ga0070706_100183581 3300005467 Bacteria 1954
167 Ga0070706_100252372 3300005467 Bacteria 1647
168 Ga0070707_100039853 3300005468 Bacteria 4492
169 Ga0070707_100149935 3300005468 Bacteria 2270
170 Ga0070707_100401546 3300005468 Bacteria 1331
171 Ga0070698_100016152 3300005471 Bacteria 7881
172 Ga0070699_100071083 3300005518 Bacteria 3026
173 Ga0070699_100354796 3300005518 Bacteria 1321
174 Ga0070699_100753511 3300005518 Bacteria 891
175 Ga0070679_100053614 3300005530 Bacteria 4014
176 Ga0070679_100441316 3300005530 Bacteria 1246
177 Ga0070679_101096423 3300005530 Bacteria 741
178 Ga0070684_100025324 3300005535 Bacteria 4986
179 Ga0070684_100097224 3300005535 Bacteria 2625
180 Ga0070684_100247198 3300005535 Bacteria 1630
181 Ga0070697_100026299 3300005536 Bacteria 4647
182 Ga0070697_100048014 3300005536 Bacteria 3461
183 Ga0070697_100140130 3300005536 Bacteria 2033
184 Ga0068853_100011343 3300005539 Bacteria 7237
185 Ga0068853_100339975 3300005539 Bacteria 1394
186 Ga0068853_100343594 3300005539 Bacteria 1387
187 Ga0068853_100631304 3300005539 Bacteria 1019
188 Ga0068853_101228963 3300005539 Bacteria 724
189 Ga0070672_100001800 3300005543 Bacteria 13407
190 Ga0070672_100007333 3300005543 Bacteria 7479
191 Ga0070672_100007488 3300005543 Bacteria 7411
192 Ga0070672_100029001 3300005543 Bacteria 4145
193 Ga0070672_100042454 3300005543 Bacteria 3502
194 Ga0070672_100067015 3300005543 Bacteria 2844
195 Ga0070672_100276883 3300005543 Bacteria 1418
196 Ga0070672_100665361 3300005543 Bacteria 910
197 Ga0070686_100018280 3300005544 Bacteria 4110
198 Ga0070686_100029097 3300005544 Bacteria 3356
199 Ga0070695_100499207 3300005545 Bacteria 941
200 Ga0070696_100033653 3300005546 Bacteria 3523
201 Ga0070696_100117190 3300005546 Bacteria 1924
202 Ga0070696_100128568 3300005546 Bacteria 1841
203 Ga0070693_100019866 3300005547 Bacteria 3532
204 Ga0070693_100428143 3300005547 Bacteria 924
205 Ga0070693_101050469 3300005547 Bacteria 619
206 Ga0070665_100000755 3300005548 Bacteria 42946
207 Ga0070665_100007656 3300005548 Bacteria 10981
208 Ga0070665_100009807 3300005548 Bacteria 9683
209 Ga0070665_100012260 3300005548 Bacteria 8641
210 Ga0070665_100059749 3300005548 Bacteria 3821
211 Ga0070665_100137403 3300005548 Bacteria 2447
212 Ga0070665_100310380 3300005548 Bacteria 1581
213 Ga0070665_100349784 3300005548 Bacteria 1483
214 Ga0070704_100022083 3300005549 Bacteria 4137
215 Ga0070704_100091877 3300005549 Bacteria 2264
216 Ga0068855_100022600 3300005563 Bacteria 7536
217 Ga0068855_100062766 3300005563 Bacteria 4337
218 Ga0068855_100063552 3300005563 Bacteria 4308
219 Ga0068855_100220290 3300005563 Bacteria 2128
220 Ga0068855_101254028 3300005563 Bacteria 769
221 Ga0070664_100021792 3300005564 Bacteria 5283
222 Ga0070664_100023145 3300005564 Bacteria 5129
223 Ga0070664_100098547 3300005564 Bacteria 2539
224 Ga0070664_100099412 3300005564 Bacteria 2528
225 Ga0070664_100113311 3300005564 Bacteria 2368
226 Ga0070664_100245891 3300005564 Bacteria 1607
227 Ga0070664_100691049 3300005564 Bacteria 950
228 Ga0068857_100027579 3300005577 Bacteria 5010
229 Ga0068857_100047088 3300005577 Bacteria 3827
230 Ga0068854_100003556 3300005578 Bacteria 9747
231 Ga0068854_100225093 3300005578 Bacteria 1486
232 Ga0068854_100296237 3300005578 Bacteria 1307
233 Ga0068854_100353165 3300005578 Bacteria 1204
234 Ga0068856_100002173 3300005614 Bacteria 20321
235 Ga0068856_100178286 3300005614 Bacteria 2137
236 Ga0068856_100300789 3300005614 Bacteria 1622
237 Ga0068856_100516198 3300005614 Bacteria 1216
238 Ga0070702_100002946 3300005615 Bacteria 7500
239 Ga0070702_100006577 3300005615 Bacteria 5513
240 Ga0068852_100007283 3300005616 Bacteria 8068
241 Ga0068852_100016008 3300005616 Bacteria 5838
242 Ga0068852_100055896 3300005616 Bacteria 3408
243 Ga0068852_100098686 3300005616 Bacteria 2631
244 Ga0068852_100352976 3300005616 Bacteria 1436
245 Ga0068852_100465588 3300005616 Bacteria 1254
246 Ga0068852_100493197 3300005616 Bacteria 1219
247 Ga0068859_100014387 3300005617 Bacteria 7939
248 Ga0068859_100014902 3300005617 Bacteria 7806
249 Ga0068859_100069675 3300005617 Bacteria 3552
250 Ga0068864_100001000 3300005618 Bacteria 23647
251 Ga0068864_100002501 3300005618 Bacteria 15198
252 Ga0068864_100003431 3300005618 Bacteria 13103
253 Ga0068864_100003931 3300005618 Bacteria 12235
254 Ga0068864_100004467 3300005618 Bacteria 11496
255 Ga0068864_100008156 3300005618 Bacteria 8638
256 Ga0068864_100136358 3300005618 Bacteria 2210
257 Ga0068864_100141381 3300005618 Bacteria 2171
258 Ga0068864_100216211 3300005618 Bacteria 1767
259 Ga0068864_100889976 3300005618 Bacteria 879
260 Ga0068866_10031772 3300005718 Bacteria 2546
261 Ga0068866_10046376 3300005718 Bacteria 2185
262 Ga0068861_100009969 3300005719 Bacteria 6578
263 Ga0068861_100017014 3300005719 Bacteria 5155
264 Ga0068861_100029852 3300005719 Bacteria 3992
265 Ga0068861_100041017 3300005719 Bacteria 3465
266 Ga0068861_100056920 3300005719 Bacteria 2985
267 Ga0068861_100189356 3300005719 Bacteria 1719
268 Ga0068861_100304880 3300005719 Bacteria 1381
269 Ga0068861_100334229 3300005719 Bacteria 1324
270 Ga0068861_100612572 3300005719 Bacteria 1001
271 Ga0068851_10000760 3300005834 Bacteria 13876
272 Ga0068851_10002900 3300005834 Bacteria 7575
273 Ga0068851_10018417 3300005834 Bacteria 3362
274 Ga0068851_10029588 3300005834 Bacteria 2713
275 Ga0068870_10010351 3300005840 Bacteria 4283
276 Ga0068870_10034223 3300005840 Bacteria 2599
277 Ga0068870_10123666 3300005840 Bacteria 1493
278 Ga0068870_10329207 3300005840 Bacteria 973
279 Ga0068863_100002509 3300005841 Bacteria 18242
280 Ga0068863_100004438 3300005841 Bacteria 13833
281 Ga0068863_100007482 3300005841 Bacteria 10687
282 Ga0068863_100014344 3300005841 Bacteria 7632
283 Ga0068863_100019177 3300005841 Bacteria 6547
284 Ga0068863_100024468 3300005841 Bacteria 5758
285 Ga0068863_100056261 3300005841 Bacteria 3724
286 Ga0068863_100520796 3300005841 Bacteria 1172
287 Ga0068863_100693825 3300005841 Bacteria 1012
288 Ga0068858_100001616 3300005842 Bacteria 22981
289 Ga0068858_100003832 3300005842 Bacteria 14871
290 Ga0068858_100013427 3300005842 Bacteria 7729
291 Ga0068858_100040010 3300005842 Bacteria 4347
292 Ga0068858_100356369 3300005842 Bacteria 1402
293 Ga0068860_100012240 3300005843 Bacteria 8454
294 Ga0068860_100022453 3300005843 Bacteria 6103
295 Ga0068860_100045549 3300005843 Bacteria 4183
296 Ga0068860_100070846 3300005843 Bacteria 3314
297 Ga0068860_100100895 3300005843 Bacteria 2754
298 Ga0068860_100113608 3300005843 Bacteria 2589
299 Ga0068860_100277201 3300005843 Bacteria 1638
300 Ga0068860_100726973 3300005843 Bacteria 1003
301 Ga0068862_100040093 3300005844 Bacteria 3980
302 Ga0068862_100094281 3300005844 Bacteria 2611
303 Ga0068862_100226873 3300005844 Bacteria 1693
304 Ga0081539_10120190 3300005985 Bacteria 1306
305 Ga0081539_10194889 3300005985 Bacteria 940
306 Ga0070715_10005421 3300006163 Bacteria 4252
307 Ga0070716_100208729 3300006173 Bacteria 1304
308 Ga0070712_100005685 3300006175 Bacteria 7710
309 Ga0070712_101124297 3300006175 Bacteria 682
310 Ga0097621_100004791 3300006237 Bacteria 9468
311 Ga0097621_100012757 3300006237 Bacteria 6244
312 Ga0097621_100048808 3300006237 Bacteria 3436
313 Ga0097621_100115684 3300006237 Bacteria 2270
314 Ga0097621_100862876 3300006237 Bacteria 841
315 Ga0068871_100010378 3300006358 Bacteria 6794
316 Ga0068871_100024045 3300006358 Bacteria 4721
317 Ga0068871_100069668 3300006358 Bacteria 2889
318 Ga0068871_100131550 3300006358 Bacteria 2122
319 Ga0068871_100237936 3300006358 Bacteria 1582
320 Ga0068871_101097707 3300006358 Bacteria 744
321 Ga0068871_101141649 3300006358 Bacteria 729
322 Ga0075428_100099878 3300006844 Bacteria 3165
323 Ga0075431_100002144 3300006847 Bacteria 18865
324 Ga0075433_10231821 3300006852 Bacteria 1639
325 Ga0075433_10644211 3300006852 Bacteria 929
326 Ga0075434_100019391 3300006871 Bacteria 6582
327 Ga0075434_100056491 3300006871 Bacteria 3901
328 Ga0075434_100725418 3300006871 Bacteria 1011
329 Ga0075429_100034475 3300006880 Bacteria 4399
330 Ga0068865_100010750 3300006881 Bacteria 5706
331 Ga0068865_100025893 3300006881 Bacteria 3864
332 Ga0068865_100029292 3300006881 Bacteria 3651
333 Ga0068865_100077974 3300006881 Bacteria 2369
334 Ga0097620_100014386 3300006931 Bacteria 7939
335 Ga0097620_100014900 3300006931 Bacteria 7806
336 Ga0097620_100069680 3300006931 Bacteria 3552
337 Ga0075435_100041477 3300007076 Bacteria 3679
338 Ga0075435_100195672 3300007076 Bacteria 1712
339 Ga0075435_100748968 3300007076 Bacteria 850
340 Ga0075435_100828482 3300007076 Bacteria 806
341 Ga0105240_10051113 3300009093 Bacteria 5204
342 Ga0105240_10054022 3300009093 Bacteria 5037
343 Ga0105240_10482605 3300009093 Bacteria 1381
344 Ga0111539_10137058 3300009094 Bacteria 2866
345 Ga0111539_10243173 3300009094 Bacteria 2095
346 Ga0105245_10036008 3300009098 Bacteria 4395
347 Ga0105245_10044063 3300009098 Bacteria 3981
348 Ga0105245_10469787 3300009098 Bacteria 1269
349 Ga0105247_10013579 3300009101 Bacteria 4884
350 Ga0105247_10138616 3300009101 Bacteria 1592
351 Ga0105247_10336001 3300009101 Bacteria 1058
352 Ga0114129_10097191 3300009147 Bacteria 4076
353 Ga0114129_10328673 3300009147 Bacteria 2031
354 Ga0105243_10221975 3300009148 Bacteria 1671
355 Ga0105241_10003899 3300009174 Bacteria 11049
356 Ga0105241_10042070 3300009174 Bacteria 3455
357 Ga0105241_10070821 3300009174 Bacteria 2706
358 Ga0105241_10275689 3300009174 Bacteria 1434
359 Ga0105241_10534313 3300009174 Bacteria 1050
360 Ga0105242_10176047 3300009176 Bacteria 1884
361 Ga0105248_10015655 3300009177 Bacteria 8357
362 Ga0105248_10023395 3300009177 Bacteria 6863
363 Ga0105248_10159540 3300009177 Bacteria 2544
364 Ga0105248_10303349 3300009177 Bacteria 1798
365 Ga0105248_10495674 3300009177 Bacteria 1377
366 Ga0105248_10792728 3300009177 Bacteria 1069
367 Ga0105237_10026918 3300009545 Bacteria 5875
368 Ga0105238_10006515 3300009551 Bacteria 11619
369 Ga0105238_10008114 3300009551 Bacteria 10501
370 Ga0105238_10077572 3300009551 Bacteria 3313
371 Ga0105249_10038854 3300009553 Bacteria 4319
372 Ga0105249_10209728 3300009553 Bacteria 1911
373 Ga0105249_10544205 3300009553 Bacteria 1211
374 Ga0105249_10841150 3300009553 Bacteria 983
375 Ga0105239_10609064 3300010375 Bacteria 1246
376 Ga0105239_10805496 3300010375 Bacteria 1076
377 Ga0105246_10176709 3300011119 Bacteria 1640
378 Ga0157373_10005591 3300013100 Bacteria 9424
379 Ga0157373_10041623 3300013100 Bacteria 3286
380 Ga0157373_10055969 3300013100 Bacteria 2801
381 Ga0157373_10199852 3300013100 Bacteria 1409
382 Ga0157373_10479416 3300013100 Bacteria 897
383 Ga0157371_10019019 3300013102 Bacteria 5070
384 Ga0157371_10033685 3300013102 Bacteria 3679
385 Ga0157371_10069094 3300013102 Bacteria 2501
386 Ga0157371_10254125 3300013102 Bacteria 1266
387 Ga0157370_10026926 3300013104 Bacteria 5670
388 Ga0157370_10047064 3300013104 Bacteria 4135
389 Ga0157370_10066379 3300013104 Bacteria 3412
390 Ga0157370_10090956 3300013104 Bacteria 2865
391 Ga0157370_10240945 3300013104 Bacteria 1673
392 Ga0157369_10010583 3300013105 Bacteria 10501
393 Ga0157369_10049776 3300013105 Bacteria 4540
394 Ga0157374_10002330 3300013296 Bacteria 16033
395 Ga0157374_10002543 3300013296 Bacteria 15382
396 Ga0157374_10009894 3300013296 Bacteria 8183
397 Ga0157374_10045485 3300013296 Bacteria 4063
398 Ga0157374_10134511 3300013296 Bacteria 2395
399 Ga0157374_11212014 3300013296 Bacteria 776
400 Ga0157378_10022056 3300013297 Bacteria 5601
401 Ga0157378_10273371 3300013297 Bacteria 1626
402 Ga0157378_10343746 3300013297 Bacteria 1456
403 Ga0157378_10895463 3300013297 Bacteria 918
404 Ga0157378_11622463 3300013297 Bacteria 693
405 Ga0163162_10003179 3300013306 Bacteria 15705
406 Ga0163162_10035896 3300013306 Bacteria 4938
407 Ga0163162_10064452 3300013306 Bacteria 3709
408 Ga0163162_10072782 3300013306 Bacteria 3492
409 Ga0163162_10160734 3300013306 Bacteria 2368
410 Ga0163162_10431019 3300013306 Bacteria 1451
411 Ga0163162_10628880 3300013306 Bacteria 1198
412 Ga0163162_11055796 3300013306 Bacteria 920
413 Ga0157372_10004917 3300013307 Bacteria 14202
414 Ga0157372_10046075 3300013307 Bacteria 4839
415 Ga0157372_10194528 3300013307 Bacteria 2349
416 Ga0157372_10489255 3300013307 Bacteria 1434
417 Ga0157372_11551509 3300013307 Bacteria 763
418 Ga0157375_10003041 3300013308 Bacteria 14564
419 Ga0157375_10017959 3300013308 Bacteria 6402
420 Ga0157375_10198476 3300013308 Bacteria 2162
421 Ga0157375_10205753 3300013308 Bacteria 2124
422 Ga0157375_10241910 3300013308 Bacteria 1964
423 Ga0157375_10282132 3300013308 Bacteria 1824
424 Ga0157375_10416057 3300013308 Bacteria 1510
425 Ga0157375_10491502 3300013308 Bacteria 1392
426 Ga0157375_10510583 3300013308 Bacteria 1366
427 Ga0157375_11387818 3300013308 Bacteria 827
428 Ga0163163_10004410 3300014325 Bacteria 11996
429 Ga0163163_10019921 3300014325 Bacteria 6309
430 Ga0163163_10382093 3300014325 Bacteria 1466
431 Ga0163163_10900563 3300014325 Bacteria 948
432 Ga0163163_11043633 3300014325 Bacteria 881
433 Ga0163163_12108928 3300014325 Bacteria 623
434 Ga0157380_10015361 3300014326 Bacteria 5628
435 Ga0157380_10042701 3300014326 Bacteria 3545
436 Ga0157380_10092123 3300014326 Bacteria 2504
437 Ga0157380_10317265 3300014326 Bacteria 1443
438 Ga0157380_10452150 3300014326 Bacteria 1234
439 Ga0157380_11626316 3300014326 Bacteria 702
440 Ga0182008_10183890 3300014497 Bacteria 1058
441 Ga0157377_10014844 3300014745 Bacteria 3973
442 Ga0157379_10000544 3300014968 Bacteria 30401
443 Ga0157379_10013818 3300014968 Bacteria 7075
444 Ga0157379_10031598 3300014968 Bacteria 4718
445 Ga0157379_10446611 3300014968 Bacteria 1193
446 Ga0157379_10563792 3300014968 Bacteria 1060
447 Ga0157376_10017692 3300014969 Bacteria 5444
448 Ga0157376_10060056 3300014969 Bacteria 3191
449 Ga0157376_10076386 3300014969 Bacteria 2862
450 Ga0157376_10083894 3300014969 Bacteria 2742
451 Ga0157376_10185216 3300014969 Bacteria 1906
452 Ga0157376_10442756 3300014969 Bacteria 1266
453 Ga0163161_10007139 3300017792 Bacteria 7723
454 Ga0163161_10012679 3300017792 Bacteria 5854
455 Ga0163161_10054057 3300017792 Bacteria 2914
456 Ga0163161_10136415 3300017792 Bacteria 1855
457 Ga0163161_10139148 3300017792 Bacteria 1837
458 Ga0207666_1002641 3300025271 Bacteria 2168
459 Ga0207673_1004095 3300025290 Bacteria 1731
460 Ga0207697_10000474 3300025315 Bacteria 22692
461 Ga0207697_10014153 3300025315 Bacteria 3316
462 Ga0207656_10009549 3300025321 Bacteria 3604
463 Ga0207682_10000224 3300025893 Bacteria 25591
464 Ga0207682_10002853 3300025893 Bacteria 7625
465 Ga0207692_10035074 3300025898 Bacteria 2435
466 Ga0207692_10075173 3300025898 Bacteria 1791
467 Ga0207642_10051950 3300025899 Bacteria 1857
468 Ga0207642_10076098 3300025899 Bacteria 1614
469 Ga0207710_10020412 3300025900 Bacteria 2832
470 Ga0207688_10001248 3300025901 Bacteria 13208
471 Ga0207688_10421448 3300025901 Bacteria 829
472 Ga0207680_10017979 3300025903 Bacteria 3746
473 Ga0207680_10065128 3300025903 Bacteria 2236
474 Ga0207680_10320205 3300025903 Bacteria 1084
475 Ga0207685_10022878 3300025905 Bacteria 2119
476 Ga0207699_10008850 3300025906 Bacteria 4987
477 Ga0207699_10059254 3300025906 Bacteria 2294
478 Ga0207645_10000488 3300025907 Bacteria 32821
479 Ga0207645_10001172 3300025907 Bacteria 21640
480 Ga0207645_10003895 3300025907 Bacteria 11158
481 Ga0207645_10020904 3300025907 Bacteria 4276
482 Ga0207645_10220063 3300025907 Bacteria 1251
483 Ga0207645_10276534 3300025907 Bacteria 1114
484 Ga0207645_10471002 3300025907 Bacteria 849
485 Ga0207643_10000241 3300025908 Bacteria 38063
486 Ga0207643_10009328 3300025908 Bacteria 5274
487 Ga0207643_10044848 3300025908 Bacteria 2496
488 Ga0207643_10155832 3300025908 Bacteria 1372
489 Ga0207705_10124679 3300025909 Bacteria 1913
490 Ga0207684_10031913 3300025910 Bacteria 4481
491 Ga0207684_10887322 3300025910 Bacteria 750
492 Ga0207654_10188960 3300025911 Bacteria 1349
493 Ga0207707_10010933 3300025912 Bacteria 7893
494 Ga0207707_10092524 3300025912 Bacteria 2642
495 Ga0207695_10042039 3300025913 Bacteria 4887
496 Ga0207695_10184913 3300025913 Bacteria 2003
497 Ga0207693_10000069 3300025915 Bacteria 90103
498 Ga0207693_10006208 3300025915 Bacteria 9911
499 Ga0207663_10009044 3300025916 Bacteria 5246
500 Ga0207663_10171738 3300025916 Bacteria 1540
501 Ga0207663_10308783 3300025916 Bacteria 1184
502 Ga0207660_10003901 3300025917 Bacteria 9720
503 Ga0207660_10055842 3300025917 Bacteria 2824
504 Ga0207662_10010967 3300025918 Bacteria 5013
505 Ga0207662_10036933 3300025918 Bacteria 2857
506 Ga0207657_10021040 3300025919 Bacteria 6150
507 Ga0207649_10061084 3300025920 Bacteria 2371
508 Ga0207649_10583947 3300025920 Bacteria 858
509 Ga0207652_10001143 3300025921 Bacteria 23866
510 Ga0207652_10023819 3300025921 Bacteria 5076
511 Ga0207652_10101505 3300025921 Bacteria 2541
512 Ga0207646_10027520 3300025922 Bacteria 5185
513 Ga0207646_10242741 3300025922 Bacteria 1627
514 Ga0207646_10285750 3300025922 Bacteria 1491
515 Ga0207681_10008866 3300025923 Bacteria 6145
516 Ga0207681_10016156 3300025923 Bacteria 4663
517 Ga0207681_10166400 3300025923 Bacteria 1667
518 Ga0207694_10011462 3300025924 Bacteria 6691
519 Ga0207694_10141237 3300025924 Bacteria 1936
520 Ga0207694_10236969 3300025924 Bacteria 1491
521 Ga0207650_10006364 3300025925 Bacteria 8041
522 Ga0207650_10007771 3300025925 Bacteria 7309
523 Ga0207650_10007867 3300025925 Bacteria 7257
524 Ga0207650_10029683 3300025925 Bacteria 3933
525 Ga0207650_10076551 3300025925 Bacteria 2528
526 Ga0207650_10084892 3300025925 Bacteria 2407
527 Ga0207650_10157528 3300025925 Bacteria 1797
528 Ga0207650_10506673 3300025925 Bacteria 1009
529 Ga0207650_10679555 3300025925 Bacteria 869
530 Ga0207659_10004534 3300025926 Bacteria 8405
531 Ga0207659_10005318 3300025926 Bacteria 7803
532 Ga0207659_10007612 3300025926 Bacteria 6678
533 Ga0207659_10014481 3300025926 Bacteria 5089
534 Ga0207659_10048788 3300025926 Bacteria 3001
535 Ga0207659_10070001 3300025926 Bacteria 2557
536 Ga0207687_10008061 3300025927 Bacteria 6893
537 Ga0207687_10837358 3300025927 Bacteria 786
538 Ga0207700_10001882 3300025928 Bacteria 11909
539 Ga0207700_10010851 3300025928 Bacteria 5779
540 Ga0207700_10363638 3300025928 Bacteria 1262
541 Ga0207664_10001100 3300025929 Bacteria 18018
542 Ga0207664_10015121 3300025929 Bacteria 5591
543 Ga0207664_10040208 3300025929 Bacteria 3635
544 Ga0207664_10079989 3300025929 Bacteria 2655
545 Ga0207644_10001001 3300025931 Bacteria 18052
546 Ga0207644_10010748 3300025931 Bacteria 6037
547 Ga0207644_10016811 3300025931 Bacteria 4927
548 Ga0207644_10041280 3300025931 Bacteria 3263
549 Ga0207644_10171178 3300025931 Bacteria 1695
550 Ga0207644_10313396 3300025931 Bacteria 1267
551 Ga0207644_10359193 3300025931 Bacteria 1184
552 Ga0207644_10610095 3300025931 Bacteria 906
553 Ga0207690_10074874 3300025932 Bacteria 2346
554 Ga0207690_10162037 3300025932 Bacteria 1668
555 Ga0207706_10000488 3300025933 Bacteria 42317
556 Ga0207706_10012193 3300025933 Bacteria 7833
557 Ga0207706_10043521 3300025933 Bacteria 3979
558 Ga0207706_10895797 3300025933 Bacteria 749
559 Ga0207686_10000118 3300025934 Bacteria 64531
560 Ga0207686_10177606 3300025934 Bacteria 1507
561 Ga0207670_10003274 3300025936 Bacteria 8578
562 Ga0207670_10006315 3300025936 Bacteria 6565
563 Ga0207670_10022230 3300025936 Bacteria 3928
564 Ga0207669_10000937 3300025937 Bacteria 12328
565 Ga0207669_10004593 3300025937 Bacteria 6094
566 Ga0207669_10006911 3300025937 Bacteria 5218
567 Ga0207669_10012907 3300025937 Bacteria 4127
568 Ga0207669_10024282 3300025937 Bacteria 3255
569 Ga0207669_10079181 3300025937 Bacteria 2097
570 Ga0207669_10175489 3300025937 Bacteria 1530
571 Ga0207669_10210315 3300025937 Bacteria 1419
572 Ga0207704_10008365 3300025938 Bacteria 4943
573 Ga0207704_10155440 3300025938 Bacteria 1620
574 Ga0207704_10280151 3300025938 Bacteria 1267
575 Ga0207665_10031075 3300025939 Bacteria 3532
576 Ga0207665_10045530 3300025939 Bacteria 2938
577 Ga0207665_10161882 3300025939 Bacteria 1610
578 Ga0207665_10639471 3300025939 Bacteria 833
579 Ga0207691_10000458 3300025940 Bacteria 40362
580 Ga0207691_10000572 3300025940 Bacteria 36827
581 Ga0207691_10024787 3300025940 Bacteria 5638
582 Ga0207691_10026691 3300025940 Bacteria 5419
583 Ga0207691_10030643 3300025940 Bacteria 5025
584 Ga0207691_10043789 3300025940 Bacteria 4123
585 Ga0207691_10165429 3300025940 Bacteria 1939
586 Ga0207691_10172875 3300025940 Bacteria 1891
587 Ga0207691_10697946 3300025940 Bacteria 856
588 Ga0207711_10000515 3300025941 Bacteria 39690
589 Ga0207711_10003360 3300025941 Bacteria 13861
590 Ga0207711_10014797 3300025941 Bacteria 6483
591 Ga0207711_10065514 3300025941 Bacteria 3141
592 Ga0207711_10089785 3300025941 Bacteria 2700
593 Ga0207689_10000421 3300025942 Bacteria 39749
594 Ga0207689_10000719 3300025942 Bacteria 31673
595 Ga0207689_10101654 3300025942 Bacteria 2361
596 Ga0207689_10163357 3300025942 Bacteria 1835
597 Ga0207689_10200950 3300025942 Bacteria 1645
598 Ga0207661_10092618 3300025944 Bacteria 2520
599 Ga0207661_10109892 3300025944 Bacteria 2329
600 Ga0207661_10129118 3300025944 Bacteria 2162
601 Ga0207679_10005081 3300025945 Bacteria 8228
602 Ga0207679_10030087 3300025945 Bacteria 3788
603 Ga0207679_10037021 3300025945 Bacteria 3465
604 Ga0207679_10089146 3300025945 Bacteria 2380
605 Ga0207679_10248824 3300025945 Bacteria 1510
606 Ga0207679_10357807 3300025945 Bacteria 1274
607 Ga0207679_10600580 3300025945 Bacteria 992
608 Ga0207667_10030255 3300025949 Bacteria 5860
609 Ga0207667_10091512 3300025949 Bacteria 3142
610 Ga0207667_10246114 3300025949 Bacteria 1829
611 Ga0207667_10346050 3300025949 Bacteria 1516
612 Ga0207651_10001969 3300025960 Bacteria 9653
613 Ga0207651_10002981 3300025960 Bacteria 8191
614 Ga0207651_10009524 3300025960 Bacteria 5327
615 Ga0207651_10067538 3300025960 Bacteria 2516
616 Ga0207651_10187409 3300025960 Bacteria 1647
617 Ga0207651_10289339 3300025960 Bacteria 1358
618 Ga0207651_11210998 3300025960 Bacteria 678
619 Ga0207712_10098595 3300025961 Bacteria 2168
620 Ga0207712_10115059 3300025961 Bacteria 2024
621 Ga0207712_10764334 3300025961 Bacteria 847
622 Ga0207712_11296989 3300025961 Bacteria 651
623 Ga0207668_10003117 3300025972 Bacteria 9711
624 Ga0207668_10003880 3300025972 Bacteria 8813
625 Ga0207668_10005978 3300025972 Bacteria 7174
626 Ga0207668_10021299 3300025972 Bacteria 4133
627 Ga0207668_10024979 3300025972 Bacteria 3862
628 Ga0207668_10052264 3300025972 Bacteria 2826
629 Ga0207668_10063277 3300025972 Bacteria 2609
630 Ga0207668_10088887 3300025972 Bacteria 2264
631 Ga0207668_10091659 3300025972 Bacteria 2234
632 Ga0207668_10170227 3300025972 Bacteria 1707
633 Ga0207668_10317924 3300025972 Bacteria 1291
634 Ga0207640_10008553 3300025981 Bacteria 5684
635 Ga0207640_10494244 3300025981 Bacteria 1017
636 Ga0207640_10817150 3300025981 Bacteria 809
637 Ga0207658_10007690 3300025986 Bacteria 7338
638 Ga0207658_10011693 3300025986 Bacteria 5976
639 Ga0207658_10012660 3300025986 Bacteria 5761
640 Ga0207658_10014000 3300025986 Bacteria 5490
641 Ga0207658_10014476 3300025986 Bacteria 5401
642 Ga0207658_10049696 3300025986 Bacteria 3082
643 Ga0207658_10141366 3300025986 Bacteria 1948
644 Ga0207658_10267733 3300025986 Bacteria 1459
645 Ga0207677_10003500 3300026023 Bacteria 8322
646 Ga0207677_10006248 3300026023 Bacteria 6515
647 Ga0207677_10047725 3300026023 Bacteria 2877
648 Ga0207677_10105985 3300026023 Bacteria 2081
649 Ga0207677_10169989 3300026023 Bacteria 1703
650 Ga0207677_10446257 3300026023 Bacteria 1107
651 Ga0207677_11469471 3300026023 Bacteria 629
652 Ga0207703_10002644 3300026035 Bacteria 15435
653 Ga0207703_10011990 3300026035 Bacteria 6751
654 Ga0207703_10015545 3300026035 Bacteria 5935
655 Ga0207703_10023846 3300026035 Bacteria 4812
656 Ga0207703_10124618 3300026035 Bacteria 2216
657 Ga0207703_10139403 3300026035 Bacteria 2103
658 Ga0207639_10022474 3300026041 Bacteria 4543
659 Ga0207639_10315171 3300026041 Bacteria 1387
660 Ga0207639_10549341 3300026041 Bacteria 1060
661 Ga0207639_10680972 3300026041 Bacteria 953
662 Ga0207639_10992572 3300026041 Bacteria 786
663 Ga0207678_10005480 3300026067 Bacteria 11348
664 Ga0207678_10006243 3300026067 Bacteria 10586
665 Ga0207678_10011514 3300026067 Bacteria 7770
666 Ga0207678_10116000 3300026067 Bacteria 2285
667 Ga0207678_10127320 3300026067 Bacteria 2172
668 Ga0207708_10005086 3300026075 Bacteria 9702
669 Ga0207702_10008839 3300026078 Bacteria 8491
670 Ga0207641_10000588 3300026088 Bacteria 39984
671 Ga0207641_10002776 3300026088 Bacteria 15957
672 Ga0207641_10009170 3300026088 Bacteria 8170
673 Ga0207641_10020806 3300026088 Bacteria 5392
674 Ga0207641_10022296 3300026088 Bacteria 5212
675 Ga0207641_10032620 3300026088 Bacteria 4324
676 Ga0207641_10095043 3300026088 Bacteria 2615
677 Ga0207641_10382301 3300026088 Bacteria 1348
678 Ga0207641_10669220 3300026088 Bacteria 1021
679 Ga0207648_10000364 3300026089 Bacteria 49697
680 Ga0207648_10003329 3300026089 Bacteria 16878
681 Ga0207648_10007103 3300026089 Bacteria 11049
682 Ga0207648_10008038 3300026089 Bacteria 10277
683 Ga0207648_10019354 3300026089 Bacteria 6145
684 Ga0207648_10139771 3300026089 Bacteria 2134
685 Ga0207648_10164325 3300026089 Bacteria 1961
686 Ga0207648_10801163 3300026089 Bacteria 877
687 Ga0207676_10001838 3300026095 Bacteria 15554
688 Ga0207676_10005263 3300026095 Bacteria 9157
689 Ga0207676_10010876 3300026095 Bacteria 6491
690 Ga0207676_10029303 3300026095 Bacteria 4119
691 Ga0207676_10042063 3300026095 Bacteria 3513
692 Ga0207676_10076846 3300026095 Bacteria 2699
693 Ga0207676_10094604 3300026095 Bacteria 2462
694 Ga0207676_10118451 3300026095 Bacteria 2228
695 Ga0207676_10309243 3300026095 Bacteria 1446
696 Ga0207676_10519036 3300026095 Bacteria 1134
697 Ga0207674_10002737 3300026116 Bacteria 21985
698 Ga0207674_10006639 3300026116 Bacteria 13591
699 Ga0207674_10066888 3300026116 Bacteria 3619
700 Ga0207675_100008479 3300026118 Bacteria 9683
701 Ga0207675_100013544 3300026118 Bacteria 7611
702 Ga0207675_100021323 3300026118 Bacteria 6035
703 Ga0207675_100024335 3300026118 Bacteria 5631
704 Ga0207675_100033578 3300026118 Bacteria 4780
705 Ga0207675_100177647 3300026118 Bacteria 2037
706 Ga0207675_100367875 3300026118 Bacteria 1412
707 Ga0207675_100472446 3300026118 Bacteria 1245
708 Ga0207675_100810817 3300026118 Bacteria 950
709 Ga0207675_101721798 3300026118 Bacteria 647
710 Ga0207683_10000076 3300026121 Bacteria 77762
711 Ga0207683_10000218 3300026121 Bacteria 50151
712 Ga0207683_10001799 3300026121 Bacteria 18984
713 Ga0207683_10005087 3300026121 Bacteria 11285
714 Ga0207683_10017518 3300026121 Bacteria 6106
715 Ga0207683_10024809 3300026121 Bacteria 5166
716 Ga0207683_10096864 3300026121 Bacteria 2631
717 Ga0207683_10438216 3300026121 Bacteria 1204
718 Ga0207698_10002381 3300026142 Bacteria 11142
719 Ga0207698_10018570 3300026142 Bacteria 4741
720 Ga0207698_10035981 3300026142 Bacteria 3629
721 Ga0207698_10109945 3300026142 Bacteria 2307
722 Ga0207698_10122160 3300026142 Bacteria 2206
723 Ga0207698_10239913 3300026142 Bacteria 1651
724 Ga0207428_10199808 3300027907 Bacteria 1504
725 Ga0268266_10003578 3300028379 Bacteria 15404
726 Ga0268266_10014526 3300028379 Bacteria 6769
727 Ga0268266_10017452 3300028379 Bacteria 6121
728 Ga0268266_10018819 3300028379 Bacteria 5885
729 Ga0268266_10086443 3300028379 Bacteria 2742
730 Ga0268266_10141465 3300028379 Bacteria 2159
731 Ga0268266_10361952 3300028379 Bacteria 1365
732 Ga0268265_10024064 3300028380 Bacteria 4303
733 Ga0268265_10024477 3300028380 Bacteria 4272
734 Ga0268265_10190097 3300028380 Bacteria 1772
735 Ga0268265_10467838 3300028380 Bacteria 1181
736 Ga0268264_10003660 3300028381 Bacteria 13217
737 Ga0268264_10009693 3300028381 Bacteria 7977
738 Ga0268264_10017111 3300028381 Bacteria 5936
739 Ga0268264_10057016 3300028381 Bacteria 3266
740 Ga0268264_10078712 3300028381 Bacteria 2811
741 Ga0268264_10092446 3300028381 Bacteria 2612
742 Ga0268264_10110620 3300028381 Bacteria 2406
743 Ga0268264_10139271 3300028381 Bacteria 2161
744 Ga0265330_10000546 3300031235 Bacteria 24652
745 Ga0265332_10003000 3300031238 Bacteria 8280
746 Ga0265339_10072728 3300031249 Bacteria 1829
747 Ga0265331_10001620 3300031250 Bacteria 16437
748 Ga0265327_10007592 3300031251 Bacteria 8325
749 Ga0265316_10044839 3300031344 Bacteria 3514
750 Ga0307408_100029133 3300031548 Bacteria 3821
751 Ga0265314_10005632 3300031711 Bacteria 11251
752 Ga0265342_10034247 3300031712 Bacteria 3117
753 Ga0307405_10029979 3300031731 Bacteria 3185
754 Ga0307410_10001615 3300031852 Bacteria 10350
755 Ga0307410_10019419 3300031852 Bacteria 4134
756 Ga0307406_10016654 3300031901 Bacteria 4277
757 Ga0307407_10003364 3300031903 Bacteria 6544
758 Ga0307412_10007245 3300031911 Bacteria 6288
759 Ga0307409_100031116 3300031995 Bacteria 3846
760 Ga0307409_100069496 3300031995 Bacteria 2791
761 Ga0307416_100001805 3300032002 Bacteria 11892
762 Ga0307416_100053428 3300032002 Bacteria 3241
763 Ga0307416_101013295 3300032002 Bacteria 934
764 Ga0307416_101786294 3300032002 Bacteria 719
765 Ga0307414_10015815 3300032004 Bacteria 4568
766 Ga0307411_10029859 3300032005 Bacteria 3335
767 Ga0307411_10106600 3300032005 Bacteria 1995
768 Ga0307411_10466678 3300032005 Bacteria 1060
769 Ga0373934_0040718 3300035086 Bacteria 1833
770 Ga0373944_0037954 3300035089 Bacteria 1478
771 Ga0373953_0093506 3300035117 Bacteria 1259
772 Ga0373954_0195839 3300035118 Bacteria 992
773 Ga0373956_0009855 3300035119 Bacteria 3892
774 Ga0373957_0006995 3300035120 Bacteria 3586
775 Ga0373943_0032494 3300035170 Bacteria 2481
776 Ga0373943_0174358 3300035170 Bacteria 1178
777 Ga0373946_0060219 3300035171 Bacteria 1613
778 Ga0373946_0136708 3300035171 Bacteria 1132
779 Ga0373955_0013907 3300035172 Bacteria 3904
780 Ga0373955_0081354 3300035172 Bacteria 1831
781 Ga0373924_0098616 3300035410 Bacteria 1255
782 Ga0373931_0126129 3300035691 Bacteria 1468
783 Ga0373927_0034038 3300035695 Bacteria 3315
784 Ga0373927_0085289 3300035695 Bacteria 2049
785 Ga0373933_0005379 3300035724 Bacteria 6973
786 Ga0373933_0149262 3300035724 Bacteria 1480
787 Ga0373933_0247253 3300035724 Bacteria 1148
788 Ga0373933_0631218 3300035724 Bacteria 704
789 Ga0373947_0016015 3300035725 Bacteria 4308
790 Ga0373947_0068067 3300035725 Bacteria 2177
791 Ga0373947_0074117 3300035725 Bacteria 2093
792 Ga0373947_0293063 3300035725 Bacteria 1084
793 Ga0373947_0507943 3300035725 Bacteria 819
794 Ga0373937_0002839 3300036401 Bacteria 14477
795 Ga0373937_0010161 3300036401 Bacteria 8210
796 Ga0373937_0137801 3300036401 Bacteria 2282
797 Ga0373937_0228209 3300036401 Bacteria 1753
798 Ga0373937_0518248 3300036401 Bacteria 1133
799 Ga0373937_0531811 3300036401 Bacteria 1117
800 Ga0373925_0027705 3300037068 Bacteria 4147
801 Ga0373925_0363635 3300037068 Bacteria 1176
802 Ga0373925_0764890 3300037068 Bacteria 796
803 Ga0395898_0365052 3300037466 Bacteria 1377
804 Ga0395905_0396226 3300037471 Bacteria 1275
805 Ga0451802_1191024 3300041460 Bacteria 848
806 Ga0451845_0059238 3300041501 Bacteria 792
807 Ga0439448_0062518 3300042005 Bacteria 1232
808 Ga0451577_0258166 3300042876 Bacteria 1578
809 Ga0466957_0603850 3300044842 Bacteria 768
810 Ga0495580_0026036 3300046472 Bacteria 4268
811 Ga0495580_0115264 3300046472 Bacteria 1866
812 Ga0495582_0032219 3300046473 Bacteria 2883
813 Ga0495639_0142314 3300046475 Bacteria 1153
814 Ga0495662_0246951 3300046476 Bacteria 879
815 Ga0495664_0174276 3300046477 Bacteria 1305
816 Ga0495628_0460430 3300046516 Bacteria 923
817 Ga0495665_0149935 3300046531 Bacteria 1217
818 Ga0495586_0118326 3300046535 Bacteria 1479
819 Ga0495621_0004963 3300046539 Bacteria 3787
820 Ga0495645_0020392 3300046543 Bacteria 4781
821 Ga0495647_0013845 3300046681 Bacteria 2802
822 Ga0495658_0009925 3300046683 Bacteria 4750
823 Ga0495658_0365726 3300046683 Bacteria 917
824 Ga0495581_0001804 3300047315 Bacteria 11968
825 Ga0495684_0011314 3300047471 Bacteria 6888
826 Ga0495602_0200549 3300048088 Bacteria 1523
827 Ga0496100_0004262 3300048903 Bacteria 7564
828 Ga0496101_0006151 3300048904 Bacteria 7707
829 Ga0496102_0011726 3300048905 Bacteria 7565
830 Ga0496102_0112457 3300048905 Bacteria 2540
831 Ga0496103_0190656 3300048906 Bacteria 1318
832 Ga0496104_0004333 3300048907 Bacteria 12345
833 Ga0496104_0010541 3300048907 Bacteria 8254
834 Ga0496105_0008136 3300048908 Bacteria 8155
835 Ga0496106_0040063 3300048909 Bacteria 3507
836 Ga0496106_0348158 3300048909 Bacteria 1190
837 Ga0496106_1123322 3300048909 Bacteria 615
838 Ga0496107_0027057 3300048910 Bacteria 4071
839 Ga0496107_0138205 3300048910 Bacteria 1801
840 Ga0496107_0278923 3300048910 Bacteria 1244
841 Ga0496108_0134239 3300048911 Bacteria 2128
842 Ga0496108_0621271 3300048911 Bacteria 941
843 Ga0496108_0629278 3300048911 Bacteria 934
844 Ga0496109_0002292 3300048912 Bacteria 15916
845 Ga0496109_0176900 3300048912 Bacteria 2003
846 Ga0496109_0429556 3300048912 Bacteria 1248
847 Ga0496110_0001542 3300048913 Bacteria 16768
848 Ga0496110_0095256 3300048913 Bacteria 2666
849 Ga0496112_0003810 3300048915 Bacteria 12602
850 Ga0496112_0201440 3300048915 Bacteria 1950
851 Ga0496114_0157771 3300048917 Bacteria 1971
852 Ga0496114_0522999 3300048917 Bacteria 1049
853 Ga0496115_0161289 3300048918 Bacteria 1853
854 Ga0496115_0909124 3300048918 Bacteria 678
855 Ga0501031_0065118 3300049568 Bacteria 2374
856 Ga0501032_0003756 3300049569 Bacteria 11518
857 Ga0501033_0001343 3300049570 Bacteria 21882
858 Ga0501034_0039070 3300049571 Bacteria 4807
859 Ga0501036_0003237 3300049572 Bacteria 12983
860 Ga0501036_0044422 3300049572 Bacteria 3763
861 Ga0501037_0129590 3300049573 Bacteria 1809
862 Ga0501038_0045132 3300049574 Bacteria 3826
863 Ga0501038_0427386 3300049574 Bacteria 1021
864 Ga0501039_0001150 3300049575 Bacteria 19517
865 Ga0501043_0016804 3300049579 Bacteria 5734
866 Ga0501046_0007421 3300049580 Bacteria 9637
867 Ga0501046_0010791 3300049580 Bacteria 7833
868 Ga0501069_0459588 3300049585 Bacteria 757
869 Ga0501035_0000158 3300049822 Bacteria 82890
870 Ga0501044_0041405 3300049823 Bacteria 4795
871 nmdc:mga0k408_324036_c1 3300050493 Bacteria 919
872 nmdc:mga05p37_1110231_c1 3300050507 Bacteria 827
873 nmdc:mga09592_36973_c1 3300050508 Bacteria 4092
874 nmdc:mga08y16_1006394_c1 3300050511 Bacteria 813
875 nmdc:mga08y16_51608_c1 3300050511 Bacteria 4303
876 nmdc:mga0n895_431500_c1 3300050512 Bacteria 1331
877 nmdc:mga0n895_45001_c1 3300050512 Bacteria 4305
878 nmdc:mga0n895_71750_c1 3300050512 Bacteria 3434
879 nmdc:mga0rr50_117377_c1 3300050513 Bacteria 2113
880 nmdc:mga0rr50_45287_c1 3300050513 Bacteria 3232
881 nmdc:mga08x19_106069_c1 3300050514 Bacteria 1869
882 nmdc:mga08x19_392199_c1 3300050514 Bacteria 973
883 nmdc:mga0a205_123229_c1 3300050515 Bacteria 2492
884 nmdc:mga0a205_540523_c1 3300050515 Bacteria 1021
885 Ga0495612_0021443 3300053078 Bacteria 2592
886 Ga0495612_0451942 3300053078 Bacteria 587
887 Ga0495595_0074127 3300053084 Bacteria 1613
888 Ga0495619_0132791 3300053085 Bacteria 1711
889 Ga0495619_0291805 3300053085 Bacteria 1130
890 Ga0501082_0495701 3300060353 Bacteria 1068

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10343746 Ga0157378_103437461 176
2 3300026116 Ga0207674_10066888 Ga0207674_100668886 176
3 3300005347 Ga0070668_100304243 Ga0070668_1003042432 177
4 3300005719 Ga0068861_100029852 Ga0068861_1000298523 177
5 3300013306 Ga0163162_10431019 Ga0163162_104310192 177
6 3300026118 Ga0207675_100021323 Ga0207675_1000213233 177
7 3300005336 Ga0070680_100120481 Ga0070680_1001204812 178
8 3300005339 Ga0070660_100093703 Ga0070660_1000937032 178
9 3300005344 Ga0070661_100850556 Ga0070661_1008505562 178
10 3300005355 Ga0070671_100464801 Ga0070671_1004648012 178
11 3300005434 Ga0070709_10085217 Ga0070709_100852173 178
12 3300005435 Ga0070714_100179862 Ga0070714_1001798623 178
13 3300005530 Ga0070679_100053614 Ga0070679_1000536142 178
14 3300005547 Ga0070693_100428143 Ga0070693_1004281432 178
15 3300005563 Ga0068855_100062766 Ga0068855_1000627662 178
16 3300005564 Ga0070664_100113311 Ga0070664_1001133113 178
17 3300005578 Ga0068854_100353165 Ga0068854_1003531652 178
18 3300005614 Ga0068856_100002173 Ga0068856_10000217310 178
19 3300005841 Ga0068863_100693825 Ga0068863_1006938252 178
20 3300009093 Ga0105240_10482605 Ga0105240_104826052 178
21 3300009174 Ga0105241_10534313 Ga0105241_105343132 178
22 3300013104 Ga0157370_10240945 Ga0157370_102409452 178
23 3300013105 Ga0157369_10049776 Ga0157369_100497762 178
24 3300013307 Ga0157372_10046075 Ga0157372_100460752 178
25 3300025906 Ga0207699_10059254 Ga0207699_100592542 178
26 3300025913 Ga0207695_10184913 Ga0207695_101849133 178
27 3300025917 Ga0207660_10055842 Ga0207660_100558422 178
28 3300025921 Ga0207652_10023819 Ga0207652_100238195 178
29 3300025929 Ga0207664_10040208 Ga0207664_100402084 178
30 3300025931 Ga0207644_10313396 Ga0207644_103133962 178
31 3300025945 Ga0207679_10248824 Ga0207679_102488241 178
32 3300025949 Ga0207667_10091512 Ga0207667_100915124 178
33 3300025981 Ga0207640_10817150 Ga0207640_108171502 178
34 3300005329 Ga0070683_100097679 Ga0070683_1000976791 179
35 3300005366 Ga0070659_100023473 Ga0070659_1000234733 179
36 3300005367 Ga0070667_100345015 Ga0070667_1003450152 179
37 3300005440 Ga0070705_100056195 Ga0070705_1000561953 179
38 3300005467 Ga0070706_100183581 Ga0070706_1001835813 179
39 3300005518 Ga0070699_100354796 Ga0070699_1003547962 179
40 3300005536 Ga0070697_100026299 Ga0070697_1000262994 179
41 3300005546 Ga0070696_100117190 Ga0070696_1001171903 179
42 3300005547 Ga0070693_101050469 Ga0070693_1010504691 179
43 3300005564 Ga0070664_100021792 Ga0070664_1000217925 179
44 3300005616 Ga0068852_100016008 Ga0068852_1000160085 179
45 3300005616 Ga0068852_100055896 Ga0068852_1000558962 179
46 3300005618 Ga0068864_100216211 Ga0068864_1002162113 179
47 3300005719 Ga0068861_100056920 Ga0068861_1000569203 179
48 3300005834 Ga0068851_10018417 Ga0068851_100184173 179
49 3300007076 Ga0075435_100748968 Ga0075435_1007489682 179
50 3300009147 Ga0114129_10097191 Ga0114129_100971911 179
51 3300009147 Ga0114129_10328673 Ga0114129_103286732 179
52 3300013296 Ga0157374_10045485 Ga0157374_100454853 179
53 3300013307 Ga0157372_10194528 Ga0157372_101945282 179
54 3300025910 Ga0207684_10887322 Ga0207684_108873222 179
55 3300026142 Ga0207698_10035981 Ga0207698_100359815 179
56 3300031995 Ga0307409_100069496 Ga0307409_1000694963 179
57 3300032002 Ga0307416_101013295 Ga0307416_1010132952 179
58 3300032002 Ga0307416_101786294 Ga0307416_1017862941 179
59 3300032005 Ga0307411_10106600 Ga0307411_101066002 179
60 3300036401 Ga0373937_0518248 Ga0373937_0518248_91_648 179
61 3300050507 nmdc:mga05p37_1110231_c1 nmdc:mga05p37_1110231_c1_116_664 179
62 3300001976 JGI24752J21851_1008514 JGI24752J21851_10085142 180
63 3300001991 JGI24743J22301_10001507 JGI24743J22301_100015072 180
64 3300002070 JGI24750J21931_1047374 JGI24750J21931_10473741 180
65 3300002076 JGI24749J21850_1003442 JGI24749J21850_10034422 180
66 3300002126 JGI24035J26624_1019386 JGI24035J26624_10193861 180
67 3300002239 JGI24034J26672_10002151 JGI24034J26672_100021513 180
68 3300002459 JGI24751J29686_10013755 JGI24751J29686_100137552 180
69 3300005290 Ga0065712_10209245 Ga0065712_102092452 180
70 3300005293 Ga0065715_10034978 Ga0065715_100349782 180
71 3300005293 Ga0065715_10287265 Ga0065715_102872651 180
72 3300005327 Ga0070658_10007975 Ga0070658_100079755 180
73 3300005327 Ga0070658_10678966 Ga0070658_106789661 180
74 3300005328 Ga0070676_10000214 Ga0070676_1000021428 180
75 3300005328 Ga0070676_10000744 Ga0070676_100007443 180
76 3300005328 Ga0070676_10021975 Ga0070676_100219753 180
77 3300005328 Ga0070676_10045208 Ga0070676_100452084 180
78 3300005328 Ga0070676_10138379 Ga0070676_101383792 180
79 3300005328 Ga0070676_10170916 Ga0070676_101709162 180
80 3300005328 Ga0070676_10184095 Ga0070676_101840952 180
81 3300005328 Ga0070676_10395994 Ga0070676_103959942 180
82 3300005329 Ga0070683_100013846 Ga0070683_10001384610 180
83 3300005329 Ga0070683_100052990 Ga0070683_1000529905 180
84 3300005330 Ga0070690_100006539 Ga0070690_1000065398 180
85 3300005330 Ga0070690_100031081 Ga0070690_1000310813 180
86 3300005330 Ga0070690_100040227 Ga0070690_1000402274 180
87 3300005331 Ga0070670_100001469 Ga0070670_10000146916 180
88 3300005331 Ga0070670_100005022 Ga0070670_1000050228 180
89 3300005331 Ga0070670_100148860 Ga0070670_1001488601 180
90 3300005331 Ga0070670_100203236 Ga0070670_1002032362 180
91 3300005331 Ga0070670_100403816 Ga0070670_1004038162 180
92 3300005331 Ga0070670_100438276 Ga0070670_1004382762 180
93 3300005333 Ga0070677_10010206 Ga0070677_100102061 180
94 3300005333 Ga0070677_10023366 Ga0070677_100233662 180
95 3300005334 Ga0068869_100005557 Ga0068869_1000055579 180
96 3300005334 Ga0068869_100053049 Ga0068869_1000530493 180
97 3300005334 Ga0068869_100190880 Ga0068869_1001908803 180
98 3300005334 Ga0068869_100201317 Ga0068869_1002013172 180
99 3300005334 Ga0068869_100297666 Ga0068869_1002976661 180
100 3300005334 Ga0068869_100347343 Ga0068869_1003473432 180
101 3300005335 Ga0070666_10005903 Ga0070666_100059034 180
102 3300005335 Ga0070666_10014709 Ga0070666_100147097 180
103 3300005335 Ga0070666_10019443 Ga0070666_100194432 180
104 3300005335 Ga0070666_10024618 Ga0070666_100246186 180
105 3300005335 Ga0070666_10337158 Ga0070666_103371582 180
106 3300005336 Ga0070680_100571407 Ga0070680_1005714072 180
107 3300005337 Ga0070682_100023737 Ga0070682_1000237373 180
108 3300005337 Ga0070682_100693550 Ga0070682_1006935501 180
109 3300005338 Ga0068868_100004061 Ga0068868_1000040618 180
110 3300005338 Ga0068868_100017518 Ga0068868_1000175182 180
111 3300005338 Ga0068868_100022796 Ga0068868_1000227962 180
112 3300005338 Ga0068868_100052991 Ga0068868_1000529912 180
113 3300005338 Ga0068868_100106086 Ga0068868_1001060863 180
114 3300005339 Ga0070660_100065988 Ga0070660_1000659882 180
115 3300005339 Ga0070660_100076968 Ga0070660_1000769683 180
116 3300005340 Ga0070689_100000324 Ga0070689_10000032421 180
117 3300005340 Ga0070689_100000650 Ga0070689_10000065012 180
118 3300005340 Ga0070689_100032106 Ga0070689_1000321063 180
119 3300005343 Ga0070687_100010907 Ga0070687_1000109075 180
120 3300005343 Ga0070687_100016406 Ga0070687_1000164062 180
121 3300005344 Ga0070661_100008349 Ga0070661_10000834910 180
122 3300005344 Ga0070661_100157376 Ga0070661_1001573762 180
123 3300005344 Ga0070661_100393450 Ga0070661_1003934502 180
124 3300005345 Ga0070692_10046636 Ga0070692_100466362 180
125 3300005345 Ga0070692_10296993 Ga0070692_102969932 180
126 3300005347 Ga0070668_100003856 Ga0070668_10000385610 180
127 3300005347 Ga0070668_100004563 Ga0070668_1000045638 180
128 3300005347 Ga0070668_100006505 Ga0070668_1000065059 180
129 3300005347 Ga0070668_100018741 Ga0070668_1000187416 180
130 3300005347 Ga0070668_100025622 Ga0070668_1000256222 180
131 3300005347 Ga0070668_100032342 Ga0070668_1000323426 180
132 3300005347 Ga0070668_100043430 Ga0070668_1000434302 180
133 3300005347 Ga0070668_100107246 Ga0070668_1001072462 180
134 3300005347 Ga0070668_101070825 Ga0070668_1010708251 180
135 3300005353 Ga0070669_100008372 Ga0070669_1000083723 180
136 3300005353 Ga0070669_100010664 Ga0070669_1000106642 180
137 3300005353 Ga0070669_100026932 Ga0070669_1000269322 180
138 3300005353 Ga0070669_100275635 Ga0070669_1002756351 180
139 3300005353 Ga0070669_100287492 Ga0070669_1002874921 180
140 3300005353 Ga0070669_100290198 Ga0070669_1002901981 180
141 3300005354 Ga0070675_100000802 Ga0070675_1000008028 180
142 3300005354 Ga0070675_100007226 Ga0070675_1000072263 180
143 3300005354 Ga0070675_100009565 Ga0070675_1000095655 180
144 3300005354 Ga0070675_100015454 Ga0070675_1000154547 180
145 3300005354 Ga0070675_100016229 Ga0070675_1000162296 180
146 3300005354 Ga0070675_100018750 Ga0070675_1000187503 180
147 3300005354 Ga0070675_100125784 Ga0070675_1001257843 180
148 3300005355 Ga0070671_100001313 Ga0070671_1000013132 180
149 3300005355 Ga0070671_100029996 Ga0070671_1000299962 180
150 3300005355 Ga0070671_100063870 Ga0070671_1000638704 180
151 3300005355 Ga0070671_100249511 Ga0070671_1002495112 180
152 3300005355 Ga0070671_100321566 Ga0070671_1003215662 180
153 3300005355 Ga0070671_100544628 Ga0070671_1005446282 180
154 3300005355 Ga0070671_100774652 Ga0070671_1007746522 180
155 3300005356 Ga0070674_100000512 Ga0070674_10000051221 180
156 3300005356 Ga0070674_100004443 Ga0070674_1000044436 180
157 3300005356 Ga0070674_100004897 Ga0070674_1000048975 180
158 3300005356 Ga0070674_100009097 Ga0070674_1000090974 180
159 3300005356 Ga0070674_100067560 Ga0070674_1000675602 180
160 3300005356 Ga0070674_100338322 Ga0070674_1003383222 180
161 3300005356 Ga0070674_100512913 Ga0070674_1005129131 180
162 3300005364 Ga0070673_100000898 Ga0070673_10000089811 180
163 3300005364 Ga0070673_100006767 Ga0070673_1000067673 180
164 3300005364 Ga0070673_100025616 Ga0070673_1000256165 180
165 3300005364 Ga0070673_100213933 Ga0070673_1002139332 180
166 3300005364 Ga0070673_100218979 Ga0070673_1002189792 180
167 3300005364 Ga0070673_101302022 Ga0070673_1013020221 180
168 3300005365 Ga0070688_100003909 Ga0070688_1000039098 180
169 3300005365 Ga0070688_100011922 Ga0070688_1000119226 180
170 3300005365 Ga0070688_100057349 Ga0070688_1000573492 180
171 3300005365 Ga0070688_100078175 Ga0070688_1000781753 180
172 3300005366 Ga0070659_100066353 Ga0070659_1000663532 180
173 3300005366 Ga0070659_100195528 Ga0070659_1001955282 180
174 3300005367 Ga0070667_100006506 Ga0070667_1000065068 180
175 3300005367 Ga0070667_100018863 Ga0070667_1000188638 180
176 3300005367 Ga0070667_100038861 Ga0070667_1000388616 180
177 3300005367 Ga0070667_100048102 Ga0070667_1000481025 180
178 3300005367 Ga0070667_100058862 Ga0070667_1000588624 180
179 3300005367 Ga0070667_100101889 Ga0070667_1001018894 180
180 3300005367 Ga0070667_100229378 Ga0070667_1002293782 180
181 3300005434 Ga0070709_10127755 Ga0070709_101277552 180
182 3300005434 Ga0070709_10474162 Ga0070709_104741622 180
183 3300005435 Ga0070714_100003295 Ga0070714_1000032952 180
184 3300005435 Ga0070714_100012558 Ga0070714_1000125588 180
185 3300005435 Ga0070714_100234866 Ga0070714_1002348662 180
186 3300005436 Ga0070713_100007196 Ga0070713_1000071967 180
187 3300005436 Ga0070713_100016403 Ga0070713_1000164037 180
188 3300005436 Ga0070713_100230985 Ga0070713_1002309852 180
189 3300005437 Ga0070710_10009218 Ga0070710_100092182 180
190 3300005437 Ga0070710_10011674 Ga0070710_100116742 180
191 3300005437 Ga0070710_10036771 Ga0070710_100367713 180
192 3300005438 Ga0070701_10290377 Ga0070701_102903772 180
193 3300005439 Ga0070711_100009868 Ga0070711_1000098687 180
194 3300005439 Ga0070711_100070966 Ga0070711_1000709662 180
195 3300005441 Ga0070700_100009084 Ga0070700_1000090845 180
196 3300005444 Ga0070694_100119413 Ga0070694_1001194132 180
197 3300005445 Ga0070708_100024762 Ga0070708_1000247626 180
198 3300005445 Ga0070708_100103506 Ga0070708_1001035063 180
199 3300005445 Ga0070708_100112294 Ga0070708_1001122942 180
200 3300005455 Ga0070663_100042112 Ga0070663_1000421123 180
201 3300005455 Ga0070663_100316960 Ga0070663_1003169602 180
202 3300005455 Ga0070663_100369358 Ga0070663_1003693582 180
203 3300005456 Ga0070678_100000282 Ga0070678_10000028210 180
204 3300005456 Ga0070678_100001298 Ga0070678_1000012987 180
205 3300005456 Ga0070678_100001846 Ga0070678_1000018465 180
206 3300005457 Ga0070662_100005937 Ga0070662_1000059379 180
207 3300005457 Ga0070662_100257470 Ga0070662_1002574702 180
208 3300005457 Ga0070662_100686867 Ga0070662_1006868671 180
209 3300005459 Ga0068867_100004441 Ga0068867_10000444111 180
210 3300005459 Ga0068867_100005854 Ga0068867_10000585410 180
211 3300005459 Ga0068867_100025973 Ga0068867_1000259734 180
212 3300005459 Ga0068867_100129999 Ga0068867_1001299993 180
213 3300005459 Ga0068867_100130059 Ga0068867_1001300592 180
214 3300005466 Ga0070685_10000522 Ga0070685_100005221 180
215 3300005466 Ga0070685_10012020 Ga0070685_100120201 180
216 3300005467 Ga0070706_100252372 Ga0070706_1002523723 180
217 3300005468 Ga0070707_100039853 Ga0070707_1000398536 180
218 3300005468 Ga0070707_100149935 Ga0070707_1001499352 180
219 3300005468 Ga0070707_100401546 Ga0070707_1004015462 180
220 3300005471 Ga0070698_100016152 Ga0070698_1000161523 180
221 3300005518 Ga0070699_100071083 Ga0070699_1000710833 180
222 3300005518 Ga0070699_100753511 Ga0070699_1007535111 180
223 3300005530 Ga0070679_100441316 Ga0070679_1004413162 180
224 3300005530 Ga0070679_101096423 Ga0070679_1010964231 180
225 3300005535 Ga0070684_100025324 Ga0070684_1000253242 180
226 3300005535 Ga0070684_100097224 Ga0070684_1000972244 180
227 3300005535 Ga0070684_100247198 Ga0070684_1002471982 180
228 3300005536 Ga0070697_100048014 Ga0070697_1000480143 180
229 3300005536 Ga0070697_100140130 Ga0070697_1001401303 180
230 3300005539 Ga0068853_100011343 Ga0068853_1000113438 180
231 3300005539 Ga0068853_100339975 Ga0068853_1003399752 180
232 3300005539 Ga0068853_100343594 Ga0068853_1003435943 180
233 3300005539 Ga0068853_100631304 Ga0068853_1006313042 180
234 3300005539 Ga0068853_101228963 Ga0068853_1012289631 180
235 3300005543 Ga0070672_100001800 Ga0070672_10000180011 180
236 3300005543 Ga0070672_100007333 Ga0070672_1000073336 180
237 3300005543 Ga0070672_100007488 Ga0070672_1000074888 180
238 3300005543 Ga0070672_100029001 Ga0070672_1000290013 180
239 3300005543 Ga0070672_100042454 Ga0070672_1000424543 180
240 3300005543 Ga0070672_100067015 Ga0070672_1000670152 180
241 3300005543 Ga0070672_100276883 Ga0070672_1002768832 180
242 3300005543 Ga0070672_100665361 Ga0070672_1006653612 180
243 3300005544 Ga0070686_100018280 Ga0070686_1000182804 180
244 3300005544 Ga0070686_100029097 Ga0070686_1000290973 180
245 3300005545 Ga0070695_100499207 Ga0070695_1004992071 180
246 3300005546 Ga0070696_100033653 Ga0070696_1000336534 180
247 3300005546 Ga0070696_100128568 Ga0070696_1001285683 180
248 3300005547 Ga0070693_100019866 Ga0070693_1000198664 180
249 3300005548 Ga0070665_100000755 Ga0070665_10000075519 180
250 3300005548 Ga0070665_100007656 Ga0070665_10000765610 180
251 3300005548 Ga0070665_100009807 Ga0070665_10000980710 180
252 3300005548 Ga0070665_100012260 Ga0070665_1000122607 180
253 3300005548 Ga0070665_100059749 Ga0070665_1000597492 180
254 3300005548 Ga0070665_100137403 Ga0070665_1001374033 180
255 3300005548 Ga0070665_100310380 Ga0070665_1003103802 180
256 3300005548 Ga0070665_100349784 Ga0070665_1003497841 180
257 3300005549 Ga0070704_100022083 Ga0070704_1000220832 180
258 3300005549 Ga0070704_100091877 Ga0070704_1000918772 180
259 3300005563 Ga0068855_100022600 Ga0068855_10002260010 180
260 3300005563 Ga0068855_100063552 Ga0068855_1000635522 180
261 3300005563 Ga0068855_100220290 Ga0068855_1002202902 180
262 3300005563 Ga0068855_101254028 Ga0068855_1012540281 180
263 3300005564 Ga0070664_100023145 Ga0070664_1000231452 180
264 3300005564 Ga0070664_100098547 Ga0070664_1000985472 180
265 3300005564 Ga0070664_100099412 Ga0070664_1000994124 180
266 3300005564 Ga0070664_100245891 Ga0070664_1002458912 180
267 3300005564 Ga0070664_100691049 Ga0070664_1006910492 180
268 3300005577 Ga0068857_100027579 Ga0068857_1000275794 180
269 3300005577 Ga0068857_100047088 Ga0068857_1000470884 180
270 3300005578 Ga0068854_100003556 Ga0068854_10000355612 180
271 3300005578 Ga0068854_100225093 Ga0068854_1002250931 180
272 3300005578 Ga0068854_100296237 Ga0068854_1002962372 180
273 3300005614 Ga0068856_100178286 Ga0068856_1001782862 180
274 3300005614 Ga0068856_100300789 Ga0068856_1003007893 180
275 3300005614 Ga0068856_100516198 Ga0068856_1005161982 180
276 3300005615 Ga0070702_100002946 Ga0070702_10000294610 180
277 3300005615 Ga0070702_100006577 Ga0070702_1000065775 180
278 3300005616 Ga0068852_100007283 Ga0068852_1000072838 180
279 3300005616 Ga0068852_100098686 Ga0068852_1000986863 180
280 3300005616 Ga0068852_100352976 Ga0068852_1003529762 180
281 3300005616 Ga0068852_100465588 Ga0068852_1004655882 180
282 3300005616 Ga0068852_100493197 Ga0068852_1004931972 180
283 3300005617 Ga0068859_100014387 Ga0068859_1000143877 180
284 3300005617 Ga0068859_100014902 Ga0068859_1000149025 180
285 3300005617 Ga0068859_100069675 Ga0068859_1000696752 180
286 3300005618 Ga0068864_100001000 Ga0068864_1000010006 180
287 3300005618 Ga0068864_100002501 Ga0068864_10000250113 180
288 3300005618 Ga0068864_100003431 Ga0068864_10000343110 180
289 3300005618 Ga0068864_100003931 Ga0068864_10000393110 180
290 3300005618 Ga0068864_100004467 Ga0068864_1000044674 180
291 3300005618 Ga0068864_100008156 Ga0068864_1000081565 180
292 3300005618 Ga0068864_100136358 Ga0068864_1001363582 180
293 3300005618 Ga0068864_100141381 Ga0068864_1001413813 180
294 3300005618 Ga0068864_100889976 Ga0068864_1008899761 180
295 3300005718 Ga0068866_10031772 Ga0068866_100317723 180
296 3300005718 Ga0068866_10046376 Ga0068866_100463763 180
297 3300005719 Ga0068861_100009969 Ga0068861_1000099695 180
298 3300005719 Ga0068861_100017014 Ga0068861_1000170148 180
299 3300005719 Ga0068861_100041017 Ga0068861_1000410175 180
300 3300005719 Ga0068861_100189356 Ga0068861_1001893562 180
301 3300005719 Ga0068861_100304880 Ga0068861_1003048802 180
302 3300005719 Ga0068861_100334229 Ga0068861_1003342292 180
303 3300005719 Ga0068861_100612572 Ga0068861_1006125722 180
304 3300005834 Ga0068851_10000760 Ga0068851_100007607 180
305 3300005834 Ga0068851_10002900 Ga0068851_100029003 180
306 3300005834 Ga0068851_10029588 Ga0068851_100295883 180
307 3300005840 Ga0068870_10010351 Ga0068870_100103517 180
308 3300005840 Ga0068870_10034223 Ga0068870_100342232 180
309 3300005840 Ga0068870_10123666 Ga0068870_101236662 180
310 3300005840 Ga0068870_10329207 Ga0068870_103292072 180
311 3300005841 Ga0068863_100002509 Ga0068863_1000025092 180
312 3300005841 Ga0068863_100004438 Ga0068863_1000044385 180
313 3300005841 Ga0068863_100007482 Ga0068863_1000074823 180
314 3300005841 Ga0068863_100014344 Ga0068863_1000143449 180
315 3300005841 Ga0068863_100019177 Ga0068863_1000191776 180
316 3300005841 Ga0068863_100024468 Ga0068863_1000244681 180
317 3300005841 Ga0068863_100056261 Ga0068863_1000562614 180
318 3300005841 Ga0068863_100520796 Ga0068863_1005207962 180
319 3300005842 Ga0068858_100001616 Ga0068858_10000161620 180
320 3300005842 Ga0068858_100003832 Ga0068858_10000383218 180
321 3300005842 Ga0068858_100013427 Ga0068858_1000134272 180
322 3300005842 Ga0068858_100040010 Ga0068858_1000400101 180
323 3300005842 Ga0068858_100356369 Ga0068858_1003563691 180
324 3300005843 Ga0068860_100012240 Ga0068860_1000122409 180
325 3300005843 Ga0068860_100022453 Ga0068860_1000224534 180
326 3300005843 Ga0068860_100045549 Ga0068860_1000455495 180
327 3300005843 Ga0068860_100070846 Ga0068860_1000708464 180
328 3300005843 Ga0068860_100100895 Ga0068860_1001008954 180
329 3300005843 Ga0068860_100113608 Ga0068860_1001136084 180
330 3300005843 Ga0068860_100277201 Ga0068860_1002772012 180
331 3300005843 Ga0068860_100726973 Ga0068860_1007269732 180
332 3300005844 Ga0068862_100040093 Ga0068862_1000400932 180
333 3300005844 Ga0068862_100094281 Ga0068862_1000942812 180
334 3300005844 Ga0068862_100226873 Ga0068862_1002268732 180
335 3300005985 Ga0081539_10120190 Ga0081539_101201902 180
336 3300005985 Ga0081539_10194889 Ga0081539_101948891 180
337 3300006163 Ga0070715_10005421 Ga0070715_100054213 180
338 3300006173 Ga0070716_100208729 Ga0070716_1002087292 180
339 3300006175 Ga0070712_100005685 Ga0070712_1000056858 180
340 3300006175 Ga0070712_101124297 Ga0070712_1011242971 180
341 3300006237 Ga0097621_100004791 Ga0097621_1000047915 180
342 3300006237 Ga0097621_100012757 Ga0097621_1000127574 180
343 3300006237 Ga0097621_100048808 Ga0097621_1000488084 180
344 3300006237 Ga0097621_100115684 Ga0097621_1001156843 180
345 3300006237 Ga0097621_100862876 Ga0097621_1008628762 180
346 3300006358 Ga0068871_100010378 Ga0068871_1000103782 180
347 3300006358 Ga0068871_100024045 Ga0068871_1000240453 180
348 3300006358 Ga0068871_100069668 Ga0068871_1000696682 180
349 3300006358 Ga0068871_100131550 Ga0068871_1001315502 180
350 3300006358 Ga0068871_100237936 Ga0068871_1002379362 180
351 3300006358 Ga0068871_101097707 Ga0068871_1010977071 180
352 3300006358 Ga0068871_101141649 Ga0068871_1011416492 180
353 3300006844 Ga0075428_100099878 Ga0075428_1000998782 180
354 3300006847 Ga0075431_100002144 Ga0075431_10000214415 180
355 3300006852 Ga0075433_10231821 Ga0075433_102318213 180
356 3300006852 Ga0075433_10644211 Ga0075433_106442112 180
357 3300006871 Ga0075434_100019391 Ga0075434_1000193915 180
358 3300006871 Ga0075434_100056491 Ga0075434_1000564912 180
359 3300006871 Ga0075434_100725418 Ga0075434_1007254182 180
360 3300006880 Ga0075429_100034475 Ga0075429_1000344753 180
361 3300006881 Ga0068865_100010750 Ga0068865_1000107505 180
362 3300006881 Ga0068865_100025893 Ga0068865_1000258935 180
363 3300006881 Ga0068865_100029292 Ga0068865_1000292923 180
364 3300006881 Ga0068865_100077974 Ga0068865_1000779742 180
365 3300006931 Ga0097620_100014386 Ga0097620_1000143867 180
366 3300006931 Ga0097620_100014900 Ga0097620_1000149005 180
367 3300006931 Ga0097620_100069680 Ga0097620_1000696802 180
368 3300007076 Ga0075435_100041477 Ga0075435_1000414775 180
369 3300007076 Ga0075435_100195672 Ga0075435_1001956721 180
370 3300007076 Ga0075435_100828482 Ga0075435_1008284821 180
371 3300009093 Ga0105240_10051113 Ga0105240_100511136 180
372 3300009093 Ga0105240_10054022 Ga0105240_100540224 180
373 3300009094 Ga0111539_10137058 Ga0111539_101370584 180
374 3300009094 Ga0111539_10243173 Ga0111539_102431732 180
375 3300009098 Ga0105245_10036008 Ga0105245_100360083 180
376 3300009098 Ga0105245_10044063 Ga0105245_100440632 180
377 3300009098 Ga0105245_10469787 Ga0105245_104697872 180
378 3300009101 Ga0105247_10013579 Ga0105247_100135794 180
379 3300009101 Ga0105247_10138616 Ga0105247_101386162 180
380 3300009101 Ga0105247_10336001 Ga0105247_103360012 180
381 3300009148 Ga0105243_10221975 Ga0105243_102219752 180
382 3300009174 Ga0105241_10003899 Ga0105241_100038996 180
383 3300009174 Ga0105241_10042070 Ga0105241_100420704 180
384 3300009174 Ga0105241_10070821 Ga0105241_100708211 180
385 3300009174 Ga0105241_10275689 Ga0105241_102756892 180
386 3300009176 Ga0105242_10176047 Ga0105242_101760473 180
387 3300009177 Ga0105248_10015655 Ga0105248_1001565510 180
388 3300009177 Ga0105248_10023395 Ga0105248_100233957 180
389 3300009177 Ga0105248_10159540 Ga0105248_101595403 180
390 3300009177 Ga0105248_10303349 Ga0105248_103033492 180
391 3300009177 Ga0105248_10495674 Ga0105248_104956742 180
392 3300009177 Ga0105248_10792728 Ga0105248_107927282 180
393 3300009545 Ga0105237_10026918 Ga0105237_100269184 180
394 3300009551 Ga0105238_10006515 Ga0105238_1000651511 180
395 3300009551 Ga0105238_10008114 Ga0105238_100081143 180
396 3300009551 Ga0105238_10077572 Ga0105238_100775725 180
397 3300009553 Ga0105249_10038854 Ga0105249_100388544 180
398 3300009553 Ga0105249_10209728 Ga0105249_102097282 180
399 3300009553 Ga0105249_10544205 Ga0105249_105442052 180
400 3300009553 Ga0105249_10841150 Ga0105249_108411502 180
401 3300010375 Ga0105239_10609064 Ga0105239_106090642 180
402 3300010375 Ga0105239_10805496 Ga0105239_108054962 180
403 3300011119 Ga0105246_10176709 Ga0105246_101767093 180
404 3300013100 Ga0157373_10005591 Ga0157373_100055918 180
405 3300013100 Ga0157373_10041623 Ga0157373_100416233 180
406 3300013100 Ga0157373_10055969 Ga0157373_100559692 180
407 3300013100 Ga0157373_10199852 Ga0157373_101998521 180
408 3300013100 Ga0157373_10479416 Ga0157373_104794161 180
409 3300013102 Ga0157371_10019019 Ga0157371_100190194 180
410 3300013102 Ga0157371_10033685 Ga0157371_100336854 180
411 3300013102 Ga0157371_10069094 Ga0157371_100690943 180
412 3300013102 Ga0157371_10254125 Ga0157371_102541252 180
413 3300013104 Ga0157370_10026926 Ga0157370_100269267 180
414 3300013104 Ga0157370_10047064 Ga0157370_100470643 180
415 3300013104 Ga0157370_10066379 Ga0157370_100663794 180
416 3300013104 Ga0157370_10090956 Ga0157370_100909564 180
417 3300013105 Ga0157369_10010583 Ga0157369_100105834 180
418 3300013296 Ga0157374_10002330 Ga0157374_100023309 180
419 3300013296 Ga0157374_10002543 Ga0157374_100025435 180
420 3300013296 Ga0157374_10009894 Ga0157374_100098944 180
421 3300013296 Ga0157374_10134511 Ga0157374_101345112 180
422 3300013296 Ga0157374_11212014 Ga0157374_112120142 180
423 3300013297 Ga0157378_10022056 Ga0157378_100220564 180
424 3300013297 Ga0157378_10273371 Ga0157378_102733712 180
425 3300013297 Ga0157378_10895463 Ga0157378_108954632 180
426 3300013297 Ga0157378_11622463 Ga0157378_116224631 180
427 3300013306 Ga0163162_10003179 Ga0163162_1000317915 180
428 3300013306 Ga0163162_10035896 Ga0163162_100358962 180
429 3300013306 Ga0163162_10064452 Ga0163162_100644524 180
430 3300013306 Ga0163162_10072782 Ga0163162_100727823 180
431 3300013306 Ga0163162_10160734 Ga0163162_101607342 180
432 3300013306 Ga0163162_10628880 Ga0163162_106288802 180
433 3300013306 Ga0163162_11055796 Ga0163162_110557962 180
434 3300013307 Ga0157372_10004917 Ga0157372_100049175 180
435 3300013307 Ga0157372_10489255 Ga0157372_104892552 180
436 3300013307 Ga0157372_11551509 Ga0157372_115515091 180
437 3300013308 Ga0157375_10003041 Ga0157375_100030419 180
438 3300013308 Ga0157375_10017959 Ga0157375_100179595 180
439 3300013308 Ga0157375_10198476 Ga0157375_101984762 180
440 3300013308 Ga0157375_10205753 Ga0157375_102057532 180
441 3300013308 Ga0157375_10241910 Ga0157375_102419103 180
442 3300013308 Ga0157375_10282132 Ga0157375_102821323 180
443 3300013308 Ga0157375_10416057 Ga0157375_104160572 180
444 3300013308 Ga0157375_10491502 Ga0157375_104915022 180
445 3300013308 Ga0157375_10510583 Ga0157375_105105832 180
446 3300013308 Ga0157375_11387818 Ga0157375_113878181 180
447 3300014325 Ga0163163_10004410 Ga0163163_1000441014 180
448 3300014325 Ga0163163_10019921 Ga0163163_100199214 180
449 3300014325 Ga0163163_10382093 Ga0163163_103820932 180
450 3300014325 Ga0163163_10900563 Ga0163163_109005632 180
451 3300014325 Ga0163163_11043633 Ga0163163_110436331 180
452 3300014325 Ga0163163_12108928 Ga0163163_121089281 180
453 3300014326 Ga0157380_10015361 Ga0157380_100153617 180
454 3300014326 Ga0157380_10042701 Ga0157380_100427013 180
455 3300014326 Ga0157380_10092123 Ga0157380_100921232 180
456 3300014326 Ga0157380_10317265 Ga0157380_103172651 180
457 3300014326 Ga0157380_10452150 Ga0157380_104521502 180
458 3300014326 Ga0157380_11626316 Ga0157380_116263161 180
459 3300014497 Ga0182008_10183890 Ga0182008_101838901 180
460 3300014745 Ga0157377_10014844 Ga0157377_100148443 180
461 3300014968 Ga0157379_10000544 Ga0157379_100005443 180
462 3300014968 Ga0157379_10013818 Ga0157379_100138185 180
463 3300014968 Ga0157379_10031598 Ga0157379_100315984 180
464 3300014968 Ga0157379_10446611 Ga0157379_104466112 180
465 3300014968 Ga0157379_10563792 Ga0157379_105637922 180
466 3300014969 Ga0157376_10017692 Ga0157376_100176922 180
467 3300014969 Ga0157376_10060056 Ga0157376_100600561 180
468 3300014969 Ga0157376_10076386 Ga0157376_100763863 180
469 3300014969 Ga0157376_10083894 Ga0157376_100838944 180
470 3300014969 Ga0157376_10185216 Ga0157376_101852162 180
471 3300014969 Ga0157376_10442756 Ga0157376_104427562 180
472 3300017792 Ga0163161_10007139 Ga0163161_100071399 180
473 3300017792 Ga0163161_10012679 Ga0163161_100126796 180
474 3300017792 Ga0163161_10054057 Ga0163161_100540573 180
475 3300017792 Ga0163161_10136415 Ga0163161_101364152 180
476 3300017792 Ga0163161_10139148 Ga0163161_101391483 180
477 3300025271 Ga0207666_1002641 Ga0207666_10026412 180
478 3300025290 Ga0207673_1004095 Ga0207673_10040952 180
479 3300025315 Ga0207697_10000474 Ga0207697_100004747 180
480 3300025315 Ga0207697_10014153 Ga0207697_100141534 180
481 3300025321 Ga0207656_10009549 Ga0207656_100095493 180
482 3300025893 Ga0207682_10000224 Ga0207682_1000022425 180
483 3300025893 Ga0207682_10002853 Ga0207682_100028535 180
484 3300025898 Ga0207692_10035074 Ga0207692_100350741 180
485 3300025898 Ga0207692_10075173 Ga0207692_100751732 180
486 3300025899 Ga0207642_10051950 Ga0207642_100519502 180
487 3300025899 Ga0207642_10076098 Ga0207642_100760982 180
488 3300025900 Ga0207710_10020412 Ga0207710_100204123 180
489 3300025901 Ga0207688_10001248 Ga0207688_1000124814 180
490 3300025901 Ga0207688_10421448 Ga0207688_104214482 180
491 3300025903 Ga0207680_10017979 Ga0207680_100179792 180
492 3300025903 Ga0207680_10065128 Ga0207680_100651283 180
493 3300025903 Ga0207680_10320205 Ga0207680_103202052 180
494 3300025905 Ga0207685_10022878 Ga0207685_100228783 180
495 3300025906 Ga0207699_10008850 Ga0207699_100088504 180
496 3300025907 Ga0207645_10000488 Ga0207645_100004888 180
497 3300025907 Ga0207645_10001172 Ga0207645_1000117225 180
498 3300025907 Ga0207645_10003895 Ga0207645_1000389512 180
499 3300025907 Ga0207645_10020904 Ga0207645_100209044 180
500 3300025907 Ga0207645_10220063 Ga0207645_102200632 180
501 3300025907 Ga0207645_10276534 Ga0207645_102765342 180
502 3300025907 Ga0207645_10471002 Ga0207645_104710022 180
503 3300025908 Ga0207643_10000241 Ga0207643_1000024112 180
504 3300025908 Ga0207643_10009328 Ga0207643_100093282 180
505 3300025908 Ga0207643_10044848 Ga0207643_100448482 180
506 3300025908 Ga0207643_10155832 Ga0207643_101558322 180
507 3300025909 Ga0207705_10124679 Ga0207705_101246793 180
508 3300025910 Ga0207684_10031913 Ga0207684_100319137 180
509 3300025911 Ga0207654_10188960 Ga0207654_101889602 180
510 3300025912 Ga0207707_10010933 Ga0207707_100109338 180
511 3300025912 Ga0207707_10092524 Ga0207707_100925244 180
512 3300025913 Ga0207695_10042039 Ga0207695_100420394 180
513 3300025915 Ga0207693_10000069 Ga0207693_1000006981 180
514 3300025915 Ga0207693_10006208 Ga0207693_100062088 180
515 3300025916 Ga0207663_10009044 Ga0207663_100090446 180
516 3300025916 Ga0207663_10171738 Ga0207663_101717382 180
517 3300025916 Ga0207663_10308783 Ga0207663_103087832 180
518 3300025917 Ga0207660_10003901 Ga0207660_1000390112 180
519 3300025918 Ga0207662_10010967 Ga0207662_100109675 180
520 3300025918 Ga0207662_10036933 Ga0207662_100369332 180
521 3300025919 Ga0207657_10021040 Ga0207657_100210407 180
522 3300025920 Ga0207649_10061084 Ga0207649_100610842 180
523 3300025920 Ga0207649_10583947 Ga0207649_105839472 180
524 3300025921 Ga0207652_10001143 Ga0207652_1000114316 180
525 3300025921 Ga0207652_10101505 Ga0207652_101015054 180
526 3300025922 Ga0207646_10027520 Ga0207646_100275204 180
527 3300025922 Ga0207646_10242741 Ga0207646_102427413 180
528 3300025922 Ga0207646_10285750 Ga0207646_102857502 180
529 3300025923 Ga0207681_10008866 Ga0207681_100088668 180
530 3300025923 Ga0207681_10016156 Ga0207681_100161565 180
531 3300025923 Ga0207681_10166400 Ga0207681_101664002 180
532 3300025924 Ga0207694_10011462 Ga0207694_100114622 180
533 3300025924 Ga0207694_10141237 Ga0207694_101412373 180
534 3300025924 Ga0207694_10236969 Ga0207694_102369692 180
535 3300025925 Ga0207650_10006364 Ga0207650_100063646 180
536 3300025925 Ga0207650_10007771 Ga0207650_100077713 180
537 3300025925 Ga0207650_10007867 Ga0207650_100078679 180
538 3300025925 Ga0207650_10029683 Ga0207650_100296831 180
539 3300025925 Ga0207650_10076551 Ga0207650_100765513 180
540 3300025925 Ga0207650_10084892 Ga0207650_100848923 180
541 3300025925 Ga0207650_10157528 Ga0207650_101575282 180
542 3300025925 Ga0207650_10506673 Ga0207650_105066732 180
543 3300025925 Ga0207650_10679555 Ga0207650_106795552 180
544 3300025926 Ga0207659_10004534 Ga0207659_100045345 180
545 3300025926 Ga0207659_10005318 Ga0207659_1000531810 180
546 3300025926 Ga0207659_10007612 Ga0207659_100076125 180
547 3300025926 Ga0207659_10014481 Ga0207659_100144817 180
548 3300025926 Ga0207659_10048788 Ga0207659_100487882 180
549 3300025926 Ga0207659_10070001 Ga0207659_100700012 180
550 3300025927 Ga0207687_10008061 Ga0207687_100080615 180
551 3300025927 Ga0207687_10837358 Ga0207687_108373581 180
552 3300025928 Ga0207700_10001882 Ga0207700_1000188214 180
553 3300025928 Ga0207700_10010851 Ga0207700_100108514 180
554 3300025928 Ga0207700_10363638 Ga0207700_103636382 180
555 3300025929 Ga0207664_10001100 Ga0207664_100011005 180
556 3300025929 Ga0207664_10015121 Ga0207664_100151216 180
557 3300025929 Ga0207664_10079989 Ga0207664_100799892 180
558 3300025931 Ga0207644_10001001 Ga0207644_1000100119 180
559 3300025931 Ga0207644_10010748 Ga0207644_100107487 180
560 3300025931 Ga0207644_10016811 Ga0207644_100168115 180
561 3300025931 Ga0207644_10041280 Ga0207644_100412804 180
562 3300025931 Ga0207644_10171178 Ga0207644_101711782 180
563 3300025931 Ga0207644_10359193 Ga0207644_103591932 180
564 3300025931 Ga0207644_10610095 Ga0207644_106100952 180
565 3300025932 Ga0207690_10074874 Ga0207690_100748743 180
566 3300025932 Ga0207690_10162037 Ga0207690_101620372 180
567 3300025933 Ga0207706_10000488 Ga0207706_1000048829 180
568 3300025933 Ga0207706_10012193 Ga0207706_100121932 180
569 3300025933 Ga0207706_10043521 Ga0207706_100435214 180
570 3300025933 Ga0207706_10895797 Ga0207706_108957971 180
571 3300025934 Ga0207686_10000118 Ga0207686_1000011830 180
572 3300025934 Ga0207686_10177606 Ga0207686_101776062 180
573 3300025936 Ga0207670_10003274 Ga0207670_1000327410 180
574 3300025936 Ga0207670_10006315 Ga0207670_100063154 180
575 3300025936 Ga0207670_10022230 Ga0207670_100222303 180
576 3300025937 Ga0207669_10000937 Ga0207669_100009375 180
577 3300025937 Ga0207669_10004593 Ga0207669_100045934 180
578 3300025937 Ga0207669_10006911 Ga0207669_100069112 180
579 3300025937 Ga0207669_10012907 Ga0207669_100129075 180
580 3300025937 Ga0207669_10024282 Ga0207669_100242824 180
581 3300025937 Ga0207669_10079181 Ga0207669_100791813 180
582 3300025937 Ga0207669_10175489 Ga0207669_101754892 180
583 3300025937 Ga0207669_10210315 Ga0207669_102103152 180
584 3300025938 Ga0207704_10008365 Ga0207704_100083656 180
585 3300025938 Ga0207704_10155440 Ga0207704_101554402 180
586 3300025938 Ga0207704_10280151 Ga0207704_102801512 180
587 3300025939 Ga0207665_10031075 Ga0207665_100310753 180
588 3300025939 Ga0207665_10045530 Ga0207665_100455302 180
589 3300025939 Ga0207665_10161882 Ga0207665_101618822 180
590 3300025939 Ga0207665_10639471 Ga0207665_106394711 180
591 3300025940 Ga0207691_10000458 Ga0207691_1000045836 180
592 3300025940 Ga0207691_10000572 Ga0207691_1000057230 180
593 3300025940 Ga0207691_10024787 Ga0207691_100247878 180
594 3300025940 Ga0207691_10026691 Ga0207691_100266912 180
595 3300025940 Ga0207691_10030643 Ga0207691_100306434 180
596 3300025940 Ga0207691_10043789 Ga0207691_100437893 180
597 3300025940 Ga0207691_10165429 Ga0207691_101654293 180
598 3300025940 Ga0207691_10172875 Ga0207691_101728752 180
599 3300025940 Ga0207691_10697946 Ga0207691_106979462 180
600 3300025941 Ga0207711_10000515 Ga0207711_1000051528 180
601 3300025941 Ga0207711_10003360 Ga0207711_1000336018 180
602 3300025941 Ga0207711_10014797 Ga0207711_100147977 180
603 3300025941 Ga0207711_10065514 Ga0207711_100655144 180
604 3300025941 Ga0207711_10089785 Ga0207711_100897853 180
605 3300025942 Ga0207689_10000421 Ga0207689_100004219 180
606 3300025942 Ga0207689_10000719 Ga0207689_1000071925 180
607 3300025942 Ga0207689_10101654 Ga0207689_101016541 180
608 3300025942 Ga0207689_10163357 Ga0207689_101633572 180
609 3300025942 Ga0207689_10200950 Ga0207689_102009501 180
610 3300025944 Ga0207661_10092618 Ga0207661_100926183 180
611 3300025944 Ga0207661_10109892 Ga0207661_101098922 180
612 3300025944 Ga0207661_10129118 Ga0207661_101291183 180
613 3300025945 Ga0207679_10005081 Ga0207679_100050814 180
614 3300025945 Ga0207679_10030087 Ga0207679_100300872 180
615 3300025945 Ga0207679_10037021 Ga0207679_100370214 180
616 3300025945 Ga0207679_10089146 Ga0207679_100891463 180
617 3300025945 Ga0207679_10357807 Ga0207679_103578072 180
618 3300025945 Ga0207679_10600580 Ga0207679_106005802 180
619 3300025949 Ga0207667_10030255 Ga0207667_100302558 180
620 3300025949 Ga0207667_10246114 Ga0207667_102461142 180
621 3300025949 Ga0207667_10346050 Ga0207667_103460502 180
622 3300025960 Ga0207651_10001969 Ga0207651_100019697 180
623 3300025960 Ga0207651_10002981 Ga0207651_100029816 180
624 3300025960 Ga0207651_10009524 Ga0207651_100095243 180
625 3300025960 Ga0207651_10067538 Ga0207651_100675384 180
626 3300025960 Ga0207651_10187409 Ga0207651_101874092 180
627 3300025960 Ga0207651_10289339 Ga0207651_102893392 180
628 3300025960 Ga0207651_11210998 Ga0207651_112109982 180
629 3300025961 Ga0207712_10098595 Ga0207712_100985953 180
630 3300025961 Ga0207712_10115059 Ga0207712_101150593 180
631 3300025961 Ga0207712_10764334 Ga0207712_107643341 180
632 3300025961 Ga0207712_11296989 Ga0207712_112969891 180
633 3300025972 Ga0207668_10003117 Ga0207668_100031176 180
634 3300025972 Ga0207668_10003880 Ga0207668_100038805 180
635 3300025972 Ga0207668_10005978 Ga0207668_100059788 180
636 3300025972 Ga0207668_10021299 Ga0207668_100212994 180
637 3300025972 Ga0207668_10024979 Ga0207668_100249792 180
638 3300025972 Ga0207668_10052264 Ga0207668_100522644 180
639 3300025972 Ga0207668_10063277 Ga0207668_100632772 180
640 3300025972 Ga0207668_10088887 Ga0207668_100888872 180
641 3300025972 Ga0207668_10091659 Ga0207668_100916592 180
642 3300025972 Ga0207668_10170227 Ga0207668_101702272 180
643 3300025972 Ga0207668_10317924 Ga0207668_103179242 180
644 3300025981 Ga0207640_10008553 Ga0207640_100085532 180
645 3300025981 Ga0207640_10494244 Ga0207640_104942441 180
646 3300025986 Ga0207658_10007690 Ga0207658_100076907 180
647 3300025986 Ga0207658_10011693 Ga0207658_100116933 180
648 3300025986 Ga0207658_10012660 Ga0207658_100126605 180
649 3300025986 Ga0207658_10014000 Ga0207658_100140003 180
650 3300025986 Ga0207658_10014476 Ga0207658_100144765 180
651 3300025986 Ga0207658_10049696 Ga0207658_100496962 180
652 3300025986 Ga0207658_10141366 Ga0207658_101413663 180
653 3300025986 Ga0207658_10267733 Ga0207658_102677333 180
654 3300026023 Ga0207677_10003500 Ga0207677_100035006 180
655 3300026023 Ga0207677_10006248 Ga0207677_100062487 180
656 3300026023 Ga0207677_10047725 Ga0207677_100477254 180
657 3300026023 Ga0207677_10105985 Ga0207677_101059852 180
658 3300026023 Ga0207677_10169989 Ga0207677_101699892 180
659 3300026023 Ga0207677_10446257 Ga0207677_104462572 180
660 3300026023 Ga0207677_11469471 Ga0207677_114694711 180
661 3300026035 Ga0207703_10002644 Ga0207703_1000264418 180
662 3300026035 Ga0207703_10011990 Ga0207703_100119905 180
663 3300026035 Ga0207703_10015545 Ga0207703_100155454 180
664 3300026035 Ga0207703_10023846 Ga0207703_100238465 180
665 3300026035 Ga0207703_10124618 Ga0207703_101246181 180
666 3300026035 Ga0207703_10139403 Ga0207703_101394032 180
667 3300026041 Ga0207639_10022474 Ga0207639_100224744 180
668 3300026041 Ga0207639_10315171 Ga0207639_103151713 180
669 3300026041 Ga0207639_10549341 Ga0207639_105493412 180
670 3300026041 Ga0207639_10680972 Ga0207639_106809722 180
671 3300026041 Ga0207639_10992572 Ga0207639_109925721 180
672 3300026067 Ga0207678_10005480 Ga0207678_100054808 180
673 3300026067 Ga0207678_10006243 Ga0207678_100062438 180
674 3300026067 Ga0207678_10011514 Ga0207678_100115143 180
675 3300026067 Ga0207678_10116000 Ga0207678_101160002 180
676 3300026067 Ga0207678_10127320 Ga0207678_101273203 180
677 3300026075 Ga0207708_10005086 Ga0207708_100050865 180
678 3300026078 Ga0207702_10008839 Ga0207702_100088394 180
679 3300026088 Ga0207641_10000588 Ga0207641_1000058836 180
680 3300026088 Ga0207641_10002776 Ga0207641_100027763 180
681 3300026088 Ga0207641_10009170 Ga0207641_100091704 180
682 3300026088 Ga0207641_10020806 Ga0207641_100208067 180
683 3300026088 Ga0207641_10022296 Ga0207641_100222967 180
684 3300026088 Ga0207641_10032620 Ga0207641_100326201 180
685 3300026088 Ga0207641_10095043 Ga0207641_100950432 180
686 3300026088 Ga0207641_10382301 Ga0207641_103823011 180
687 3300026088 Ga0207641_10669220 Ga0207641_106692201 180
688 3300026089 Ga0207648_10000364 Ga0207648_1000036443 180
689 3300026089 Ga0207648_10003329 Ga0207648_1000332911 180
690 3300026089 Ga0207648_10007103 Ga0207648_100071037 180
691 3300026089 Ga0207648_10008038 Ga0207648_100080385 180
692 3300026089 Ga0207648_10019354 Ga0207648_100193545 180
693 3300026089 Ga0207648_10139771 Ga0207648_101397713 180
694 3300026089 Ga0207648_10164325 Ga0207648_101643252 180
695 3300026089 Ga0207648_10801163 Ga0207648_108011632 180
696 3300026095 Ga0207676_10001838 Ga0207676_100018384 180
697 3300026095 Ga0207676_10005263 Ga0207676_100052635 180
698 3300026095 Ga0207676_10010876 Ga0207676_100108768 180
699 3300026095 Ga0207676_10029303 Ga0207676_100293034 180
700 3300026095 Ga0207676_10042063 Ga0207676_100420633 180
701 3300026095 Ga0207676_10076846 Ga0207676_100768462 180
702 3300026095 Ga0207676_10094604 Ga0207676_100946044 180
703 3300026095 Ga0207676_10118451 Ga0207676_101184512 180
704 3300026095 Ga0207676_10309243 Ga0207676_103092431 180
705 3300026095 Ga0207676_10519036 Ga0207676_105190362 180
706 3300026116 Ga0207674_10002737 Ga0207674_1000273715 180
707 3300026116 Ga0207674_10006639 Ga0207674_100066396 180
708 3300026118 Ga0207675_100008479 Ga0207675_1000084796 180
709 3300026118 Ga0207675_100013544 Ga0207675_1000135443 180
710 3300026118 Ga0207675_100024335 Ga0207675_1000243356 180
711 3300026118 Ga0207675_100033578 Ga0207675_1000335784 180
712 3300026118 Ga0207675_100177647 Ga0207675_1001776472 180
713 3300026118 Ga0207675_100367875 Ga0207675_1003678752 180
714 3300026118 Ga0207675_100472446 Ga0207675_1004724462 180
715 3300026118 Ga0207675_100810817 Ga0207675_1008108172 180
716 3300026118 Ga0207675_101721798 Ga0207675_1017217981 180
717 3300026121 Ga0207683_10000076 Ga0207683_1000007641 180
718 3300026121 Ga0207683_10000218 Ga0207683_1000021843 180
719 3300026121 Ga0207683_10001799 Ga0207683_100017998 180
720 3300026121 Ga0207683_10005087 Ga0207683_100050872 180
721 3300026121 Ga0207683_10017518 Ga0207683_100175182 180
722 3300026121 Ga0207683_10024809 Ga0207683_100248095 180
723 3300026121 Ga0207683_10096864 Ga0207683_100968644 180
724 3300026121 Ga0207683_10438216 Ga0207683_104382161 180
725 3300026142 Ga0207698_10002381 Ga0207698_100023814 180
726 3300026142 Ga0207698_10018570 Ga0207698_100185705 180
727 3300026142 Ga0207698_10109945 Ga0207698_101099454 180
728 3300026142 Ga0207698_10122160 Ga0207698_101221604 180
729 3300026142 Ga0207698_10239913 Ga0207698_102399132 180
730 3300027907 Ga0207428_10199808 Ga0207428_101998082 180
731 3300028379 Ga0268266_10003578 Ga0268266_100035784 180
732 3300028379 Ga0268266_10014526 Ga0268266_100145264 180
733 3300028379 Ga0268266_10017452 Ga0268266_100174525 180
734 3300028379 Ga0268266_10018819 Ga0268266_100188194 180
735 3300028379 Ga0268266_10086443 Ga0268266_100864433 180
736 3300028379 Ga0268266_10141465 Ga0268266_101414652 180
737 3300028379 Ga0268266_10361952 Ga0268266_103619522 180
738 3300028380 Ga0268265_10024064 Ga0268265_100240646 180
739 3300028380 Ga0268265_10024477 Ga0268265_100244775 180
740 3300028380 Ga0268265_10190097 Ga0268265_101900972 180
741 3300028380 Ga0268265_10467838 Ga0268265_104678382 180
742 3300028381 Ga0268264_10003660 Ga0268264_1000366011 180
743 3300028381 Ga0268264_10009693 Ga0268264_100096937 180
744 3300028381 Ga0268264_10017111 Ga0268264_100171113 180
745 3300028381 Ga0268264_10057016 Ga0268264_100570163 180
746 3300028381 Ga0268264_10078712 Ga0268264_100787122 180
747 3300028381 Ga0268264_10092446 Ga0268264_100924463 180
748 3300028381 Ga0268264_10110620 Ga0268264_101106204 180
749 3300028381 Ga0268264_10139271 Ga0268264_101392712 180
750 3300031235 Ga0265330_10000546 Ga0265330_100005467 180
751 3300031238 Ga0265332_10003000 Ga0265332_100030005 180
752 3300031249 Ga0265339_10072728 Ga0265339_100727283 180
753 3300031250 Ga0265331_10001620 Ga0265331_100016206 180
754 3300031251 Ga0265327_10007592 Ga0265327_100075927 180
755 3300031344 Ga0265316_10044839 Ga0265316_100448394 180
756 3300031548 Ga0307408_100029133 Ga0307408_1000291334 180
757 3300031711 Ga0265314_10005632 Ga0265314_100056327 180
758 3300031712 Ga0265342_10034247 Ga0265342_100342472 180
759 3300031731 Ga0307405_10029979 Ga0307405_100299794 180
760 3300031852 Ga0307410_10001615 Ga0307410_100016155 180
761 3300031852 Ga0307410_10019419 Ga0307410_100194194 180
762 3300031901 Ga0307406_10016654 Ga0307406_100166543 180
763 3300031903 Ga0307407_10003364 Ga0307407_100033647 180
764 3300031911 Ga0307412_10007245 Ga0307412_100072455 180
765 3300031995 Ga0307409_100031116 Ga0307409_1000311163 180
766 3300032002 Ga0307416_100001805 Ga0307416_1000018053 180
767 3300032002 Ga0307416_100053428 Ga0307416_1000534282 180
768 3300032004 Ga0307414_10015815 Ga0307414_100158154 180
769 3300032005 Ga0307411_10029859 Ga0307411_100298594 180
770 3300032005 Ga0307411_10466678 Ga0307411_104666782 180
771 3300035086 Ga0373934_0040718 Ga0373934_0040718_1255_1803 180
772 3300035089 Ga0373944_0037954 Ga0373944_0037954_339_887 180
773 3300035117 Ga0373953_0093506 Ga0373953_0093506_301_849 180
774 3300035118 Ga0373954_0195839 Ga0373954_0195839_78_626 180
775 3300035119 Ga0373956_0009855 Ga0373956_0009855_1602_2150 180
776 3300035120 Ga0373957_0006995 Ga0373957_0006995_3011_3559 180
777 3300035170 Ga0373943_0032494 Ga0373943_0032494_1325_1873 180
778 3300035170 Ga0373943_0174358 Ga0373943_0174358_40_588 180
779 3300035171 Ga0373946_0060219 Ga0373946_0060219_140_682 180
780 3300035171 Ga0373946_0136708 Ga0373946_0136708_498_1046 180
781 3300035172 Ga0373955_0013907 Ga0373955_0013907_2950_3498 180
782 3300035172 Ga0373955_0081354 Ga0373955_0081354_271_819 180
783 3300035410 Ga0373924_0098616 Ga0373924_0098616_288_836 180
784 3300035691 Ga0373931_0126129 Ga0373931_0126129_395_937 180
785 3300035695 Ga0373927_0034038 Ga0373927_0034038_1656_2204 180
786 3300035695 Ga0373927_0085289 Ga0373927_0085289_56_604 180
787 3300035724 Ga0373933_0005379 Ga0373933_0005379_3534_4082 180
788 3300035724 Ga0373933_0149262 Ga0373933_0149262_305_853 180
789 3300035724 Ga0373933_0247253 Ga0373933_0247253_576_1124 180
790 3300035724 Ga0373933_0631218 Ga0373933_0631218_109_660 180
791 3300035725 Ga0373947_0016015 Ga0373947_0016015_2197_2745 180
792 3300035725 Ga0373947_0068067 Ga0373947_0068067_821_1363 180
793 3300035725 Ga0373947_0074117 Ga0373947_0074117_1389_1937 180
794 3300035725 Ga0373947_0293063 Ga0373947_0293063_360_908 180
795 3300035725 Ga0373947_0507943 Ga0373947_0507943_135_683 180
796 3300036401 Ga0373937_0002839 Ga0373937_0002839_7462_8010 180
797 3300036401 Ga0373937_0010161 Ga0373937_0010161_4592_5140 180
798 3300036401 Ga0373937_0137801 Ga0373937_0137801_1143_1691 180
799 3300036401 Ga0373937_0228209 Ga0373937_0228209_916_1464 180
800 3300036401 Ga0373937_0531811 Ga0373937_0531811_223_774 180
801 3300037068 Ga0373925_0027705 Ga0373925_0027705_1394_1942 180
802 3300037068 Ga0373925_0363635 Ga0373925_0363635_478_1020 180
803 3300037068 Ga0373925_0764890 Ga0373925_0764890_218_766 180
804 3300037466 Ga0395898_0365052 Ga0395898_0365052_301_909 180
805 3300037471 Ga0395905_0396226 Ga0395905_0396226_233_841 180
806 3300041460 Ga0451802_1191024 Ga0451802_1191024_35_622 180
807 3300041501 Ga0451845_0059238 Ga0451845_0059238_70_618 180
808 3300042005 Ga0439448_0062518 Ga0439448_0062518_46_594 180
809 3300042876 Ga0451577_0258166 Ga0451577_0258166_1007_1555 180
810 3300044842 Ga0466957_0603850 Ga0466957_0603850_28_693 180
811 3300046472 Ga0495580_0026036 Ga0495580_0026036_1087_1635 180
812 3300046472 Ga0495580_0115264 Ga0495580_0115264_334_882 180
813 3300046473 Ga0495582_0032219 Ga0495582_0032219_1079_1627 180
814 3300046475 Ga0495639_0142314 Ga0495639_0142314_35_583 180
815 3300046476 Ga0495662_0246951 Ga0495662_0246951_60_608 180
816 3300046477 Ga0495664_0174276 Ga0495664_0174276_609_1157 180
817 3300046516 Ga0495628_0460430 Ga0495628_0460430_258_806 180
818 3300046531 Ga0495665_0149935 Ga0495665_0149935_35_583 180
819 3300046535 Ga0495586_0118326 Ga0495586_0118326_796_1344 180
820 3300046539 Ga0495621_0004963 Ga0495621_0004963_1487_2035 180
821 3300046543 Ga0495645_0020392 Ga0495645_0020392_2844_3392 180
822 3300046681 Ga0495647_0013845 Ga0495647_0013845_363_911 180
823 3300046683 Ga0495658_0009925 Ga0495658_0009925_4167_4715 180
824 3300046683 Ga0495658_0365726 Ga0495658_0365726_159_836 180
825 3300047315 Ga0495581_0001804 Ga0495581_0001804_7540_8088 180
826 3300047471 Ga0495684_0011314 Ga0495684_0011314_5810_6358 180
827 3300048088 Ga0495602_0200549 Ga0495602_0200549_949_1497 180
828 3300048903 Ga0496100_0004262 Ga0496100_0004262_928_1470 180
829 3300048904 Ga0496101_0006151 Ga0496101_0006151_4023_4571 180
830 3300048905 Ga0496102_0011726 Ga0496102_0011726_4941_5483 180
831 3300048905 Ga0496102_0112457 Ga0496102_0112457_901_1449 180
832 3300048906 Ga0496103_0190656 Ga0496103_0190656_680_1228 180
833 3300048907 Ga0496104_0004333 Ga0496104_0004333_5354_5902 180
834 3300048907 Ga0496104_0010541 Ga0496104_0010541_706_1248 180
835 3300048908 Ga0496105_0008136 Ga0496105_0008136_5080_5628 180
836 3300048909 Ga0496106_0040063 Ga0496106_0040063_1783_2325 180
837 3300048909 Ga0496106_0348158 Ga0496106_0348158_189_737 180
838 3300048909 Ga0496106_1123322 Ga0496106_1123322_28_579 180
839 3300048910 Ga0496107_0027057 Ga0496107_0027057_812_1354 180
840 3300048910 Ga0496107_0138205 Ga0496107_0138205_1222_1770 180
841 3300048910 Ga0496107_0278923 Ga0496107_0278923_522_1070 180
842 3300048911 Ga0496108_0134239 Ga0496108_0134239_1181_1729 180
843 3300048911 Ga0496108_0621271 Ga0496108_0621271_345_896 180
844 3300048911 Ga0496108_0629278 Ga0496108_0629278_100_648 180
845 3300048912 Ga0496109_0002292 Ga0496109_0002292_135_677 180
846 3300048912 Ga0496109_0176900 Ga0496109_0176900_1431_1979 180
847 3300048912 Ga0496109_0429556 Ga0496109_0429556_494_1042 180
848 3300048913 Ga0496110_0001542 Ga0496110_0001542_13754_14296 180
849 3300048913 Ga0496110_0095256 Ga0496110_0095256_137_685 180
850 3300048915 Ga0496112_0003810 Ga0496112_0003810_10377_10925 180
851 3300048915 Ga0496112_0201440 Ga0496112_0201440_769_1311 180
852 3300048917 Ga0496114_0157771 Ga0496114_0157771_1195_1743 180
853 3300048917 Ga0496114_0522999 Ga0496114_0522999_458_1009 180
854 3300048918 Ga0496115_0161289 Ga0496115_0161289_882_1430 180
855 3300048918 Ga0496115_0909124 Ga0496115_0909124_53_595 180
856 3300049568 Ga0501031_0065118 Ga0501031_0065118_735_1283 180
857 3300049569 Ga0501032_0003756 Ga0501032_0003756_10614_11162 180
858 3300049570 Ga0501033_0001343 Ga0501033_0001343_4199_4747 180
859 3300049571 Ga0501034_0039070 Ga0501034_0039070_3440_3988 180
860 3300049572 Ga0501036_0003237 Ga0501036_0003237_662_1210 180
861 3300049572 Ga0501036_0044422 Ga0501036_0044422_3022_3570 180
862 3300049573 Ga0501037_0129590 Ga0501037_0129590_166_774 180
863 3300049574 Ga0501038_0045132 Ga0501038_0045132_2272_2820 180
864 3300049574 Ga0501038_0427386 Ga0501038_0427386_198_746 180
865 3300049575 Ga0501039_0001150 Ga0501039_0001150_16891_17439 180
866 3300049579 Ga0501043_0016804 Ga0501043_0016804_2241_2789 180
867 3300049580 Ga0501046_0007421 Ga0501046_0007421_8868_9476 180
868 3300049580 Ga0501046_0010791 Ga0501046_0010791_4665_5213 180
869 3300049585 Ga0501069_0459588 Ga0501069_0459588_132_680 180
870 3300049822 Ga0501035_0000158 Ga0501035_0000158_11484_12032 180
871 3300049823 Ga0501044_0041405 Ga0501044_0041405_2947_3495 180
872 3300050493 nmdc:mga0k408_324036_c1 nmdc:mga0k408_324036_c1_106_654 180
873 3300050508 nmdc:mga09592_36973_c1 nmdc:mga09592_36973_c1_2310_2900 180
874 3300050511 nmdc:mga08y16_1006394_c1 nmdc:mga08y16_1006394_c1_57_608 180
875 3300050511 nmdc:mga08y16_51608_c1 nmdc:mga08y16_51608_c1_3536_4078 180
876 3300050512 nmdc:mga0n895_431500_c1 nmdc:mga0n895_431500_c1_493_1041 180
877 3300050512 nmdc:mga0n895_45001_c1 nmdc:mga0n895_45001_c1_1130_1678 180
878 3300050512 nmdc:mga0n895_71750_c1 nmdc:mga0n895_71750_c1_2748_3296 180
879 3300050513 nmdc:mga0rr50_117377_c1 nmdc:mga0rr50_117377_c1_1433_1981 180
880 3300050513 nmdc:mga0rr50_45287_c1 nmdc:mga0rr50_45287_c1_1929_2477 180
881 3300050514 nmdc:mga08x19_106069_c1 nmdc:mga08x19_106069_c1_945_1553 180
882 3300050514 nmdc:mga08x19_392199_c1 nmdc:mga08x19_392199_c1_14_562 180
883 3300050515 nmdc:mga0a205_123229_c1 nmdc:mga0a205_123229_c1_329_877 180
884 3300050515 nmdc:mga0a205_540523_c1 nmdc:mga0a205_540523_c1_276_824 180
885 3300053078 Ga0495612_0021443 Ga0495612_0021443_1012_1560 180
886 3300053078 Ga0495612_0451942 Ga0495612_0451942_21_569 180
887 3300053084 Ga0495595_0074127 Ga0495595_0074127_553_1101 180
888 3300053085 Ga0495619_0132791 Ga0495619_0132791_536_1084 180
889 3300053085 Ga0495619_0291805 Ga0495619_0291805_501_1049 180
890 3300060353 Ga0501082_0495701 Ga0501082_0495701_245_796 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

61

217

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xel-assembly1.cif.gz_A crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9357 2 174
4xel-assembly2.cif.gz_B crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9352 2 174
4xel-assembly1.cif.gz_A crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9253 2 174
4xel-assembly2.cif.gz_B crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa 0.9246 2 174
3i4q-assembly1.cif.gz_A structure of a putative inorganic pyrophosphatase from the oil-degrading bacterium oleispira antarctica 0.9219 4 173
ID Description Score Start End Superfamily
1i40A00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9189 2 175 3.90.80.10
1i40A00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9088 2 175 3.90.80.10
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9071 3 175 3.90.80.10
3emjE00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.8978 17 172 3.90.80.10
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.8894 15 176 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A257JFP8-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.991 68 176 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A3D5Q6T3-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.99 50 174 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A2M8TYQ3-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9875 73 175 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A1Y5ETG5-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9829 57 175 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A3M6FPT4-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9828 73 174 GO:0000287
GO:0004427
GO:0005737
GO:0006796

Feature Viewer

pLDDT pTM Quality
90.81 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map