F484830
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 890 | 290 | 890 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300046683|Ga0495658_0365726|Ga0495658_0365726_159_836 |
| Length | 225 |
| Sequence | MSRRFAKAALQGWAFGCAARDDSAVACSREAIIMNRSTLFPPPMNLDRVPAGKDAPEDCNVIIEIPMHGDAIKYEVDKETGAVFVDRFMSTSMHYPCNYGYIPQTLSDDGDPCDVLVLSPVPLITGVVVRCRPIGMLKMEDEAGGDAKILAVPIDRLSGLYRAIQSPRDLPEITIKQIAHFFEHYKDLEPGKWVRVSTWVEAAEAKKEVMAGIARYGAAVRSTPP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 234 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 237 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 3.26 |
| Rhizosphere | 96.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1008514 | 3300001976 | Bacteria | 1338 |
| 2 | JGI24743J22301_10001507 | 3300001991 | Bacteria | 3246 |
| 3 | JGI24750J21931_1047374 | 3300002070 | Bacteria | 664 |
| 4 | JGI24749J21850_1003442 | 3300002076 | Bacteria | 2214 |
| 5 | JGI24035J26624_1019386 | 3300002126 | Bacteria | 712 |
| 6 | JGI24034J26672_10002151 | 3300002239 | Bacteria | 2687 |
| 7 | JGI24751J29686_10013755 | 3300002459 | Bacteria | 1670 |
| 8 | Ga0065712_10209245 | 3300005290 | Bacteria | 1079 |
| 9 | Ga0065715_10034978 | 3300005293 | Bacteria | 1593 |
| 10 | Ga0065715_10287265 | 3300005293 | Bacteria | 1072 |
| 11 | Ga0070658_10007975 | 3300005327 | Bacteria | 8521 |
| 12 | Ga0070658_10678966 | 3300005327 | Bacteria | 894 |
| 13 | Ga0070676_10000214 | 3300005328 | Bacteria | 24753 |
| 14 | Ga0070676_10000744 | 3300005328 | Bacteria | 16010 |
| 15 | Ga0070676_10021975 | 3300005328 | Bacteria | 3575 |
| 16 | Ga0070676_10045208 | 3300005328 | Bacteria | 2564 |
| 17 | Ga0070676_10138379 | 3300005328 | Bacteria | 1547 |
| 18 | Ga0070676_10170916 | 3300005328 | Bacteria | 1406 |
| 19 | Ga0070676_10184095 | 3300005328 | Bacteria | 1360 |
| 20 | Ga0070676_10395994 | 3300005328 | Bacteria | 960 |
| 21 | Ga0070683_100013846 | 3300005329 | Bacteria | 7044 |
| 22 | Ga0070683_100052990 | 3300005329 | Bacteria | 3759 |
| 23 | Ga0070683_100097679 | 3300005329 | Bacteria | 2763 |
| 24 | Ga0070690_100006539 | 3300005330 | Bacteria | 6615 |
| 25 | Ga0070690_100031081 | 3300005330 | Bacteria | 3323 |
| 26 | Ga0070690_100040227 | 3300005330 | Bacteria | 2956 |
| 27 | Ga0070670_100001469 | 3300005331 | Bacteria | 18968 |
| 28 | Ga0070670_100005022 | 3300005331 | Bacteria | 11132 |
| 29 | Ga0070670_100148860 | 3300005331 | Bacteria | 2026 |
| 30 | Ga0070670_100203236 | 3300005331 | Bacteria | 1722 |
| 31 | Ga0070670_100403816 | 3300005331 | Bacteria | 1206 |
| 32 | Ga0070670_100438276 | 3300005331 | Bacteria | 1157 |
| 33 | Ga0070677_10010206 | 3300005333 | Bacteria | 3207 |
| 34 | Ga0070677_10023366 | 3300005333 | Bacteria | 2288 |
| 35 | Ga0068869_100005557 | 3300005334 | Bacteria | 7934 |
| 36 | Ga0068869_100053049 | 3300005334 | Bacteria | 2946 |
| 37 | Ga0068869_100190880 | 3300005334 | Bacteria | 1611 |
| 38 | Ga0068869_100201317 | 3300005334 | Bacteria | 1570 |
| 39 | Ga0068869_100297666 | 3300005334 | Bacteria | 1302 |
| 40 | Ga0068869_100347343 | 3300005334 | Bacteria | 1208 |
| 41 | Ga0070666_10005903 | 3300005335 | Bacteria | 7522 |
| 42 | Ga0070666_10014709 | 3300005335 | Bacteria | 4984 |
| 43 | Ga0070666_10019443 | 3300005335 | Bacteria | 4384 |
| 44 | Ga0070666_10024618 | 3300005335 | Bacteria | 3923 |
| 45 | Ga0070666_10337158 | 3300005335 | Bacteria | 1077 |
| 46 | Ga0070680_100120481 | 3300005336 | Bacteria | 2190 |
| 47 | Ga0070680_100571407 | 3300005336 | Bacteria | 970 |
| 48 | Ga0070682_100023737 | 3300005337 | Bacteria | 3644 |
| 49 | Ga0070682_100693550 | 3300005337 | Bacteria | 816 |
| 50 | Ga0068868_100004061 | 3300005338 | Bacteria | 10207 |
| 51 | Ga0068868_100017518 | 3300005338 | Bacteria | 5340 |
| 52 | Ga0068868_100022796 | 3300005338 | Bacteria | 4731 |
| 53 | Ga0068868_100052991 | 3300005338 | Bacteria | 3195 |
| 54 | Ga0068868_100106086 | 3300005338 | Bacteria | 2279 |
| 55 | Ga0070660_100065988 | 3300005339 | Bacteria | 2817 |
| 56 | Ga0070660_100076968 | 3300005339 | Bacteria | 2613 |
| 57 | Ga0070660_100093703 | 3300005339 | Bacteria | 2372 |
| 58 | Ga0070689_100000324 | 3300005340 | Bacteria | 27871 |
| 59 | Ga0070689_100000650 | 3300005340 | Bacteria | 20990 |
| 60 | Ga0070689_100032106 | 3300005340 | Bacteria | 3993 |
| 61 | Ga0070687_100010907 | 3300005343 | Bacteria | 3954 |
| 62 | Ga0070687_100016406 | 3300005343 | Bacteria | 3378 |
| 63 | Ga0070661_100008349 | 3300005344 | Bacteria | 7154 |
| 64 | Ga0070661_100157376 | 3300005344 | Bacteria | 1719 |
| 65 | Ga0070661_100393450 | 3300005344 | Bacteria | 1094 |
| 66 | Ga0070661_100850556 | 3300005344 | Bacteria | 751 |
| 67 | Ga0070692_10046636 | 3300005345 | Bacteria | 2241 |
| 68 | Ga0070692_10296993 | 3300005345 | Bacteria | 985 |
| 69 | Ga0070668_100003856 | 3300005347 | Bacteria | 11068 |
| 70 | Ga0070668_100004563 | 3300005347 | Bacteria | 10272 |
| 71 | Ga0070668_100006505 | 3300005347 | Bacteria | 8664 |
| 72 | Ga0070668_100018741 | 3300005347 | Bacteria | 5197 |
| 73 | Ga0070668_100025622 | 3300005347 | Bacteria | 4473 |
| 74 | Ga0070668_100032342 | 3300005347 | Bacteria | 3981 |
| 75 | Ga0070668_100043430 | 3300005347 | Bacteria | 3447 |
| 76 | Ga0070668_100107246 | 3300005347 | Bacteria | 2220 |
| 77 | Ga0070668_100304243 | 3300005347 | Bacteria | 1338 |
| 78 | Ga0070668_101070825 | 3300005347 | Bacteria | 727 |
| 79 | Ga0070669_100008372 | 3300005353 | Bacteria | 7378 |
| 80 | Ga0070669_100010664 | 3300005353 | Bacteria | 6521 |
| 81 | Ga0070669_100026932 | 3300005353 | Bacteria | 4137 |
| 82 | Ga0070669_100275635 | 3300005353 | Bacteria | 1346 |
| 83 | Ga0070669_100287492 | 3300005353 | Bacteria | 1319 |
| 84 | Ga0070669_100290198 | 3300005353 | Bacteria | 1313 |
| 85 | Ga0070675_100000802 | 3300005354 | Bacteria | 22093 |
| 86 | Ga0070675_100007226 | 3300005354 | Bacteria | 8561 |
| 87 | Ga0070675_100009565 | 3300005354 | Bacteria | 7543 |
| 88 | Ga0070675_100015454 | 3300005354 | Bacteria | 6036 |
| 89 | Ga0070675_100016229 | 3300005354 | Bacteria | 5909 |
| 90 | Ga0070675_100018750 | 3300005354 | Bacteria | 5508 |
| 91 | Ga0070675_100125784 | 3300005354 | Bacteria | 2181 |
| 92 | Ga0070671_100001313 | 3300005355 | Bacteria | 18668 |
| 93 | Ga0070671_100029996 | 3300005355 | Bacteria | 4487 |
| 94 | Ga0070671_100063870 | 3300005355 | Bacteria | 3067 |
| 95 | Ga0070671_100249511 | 3300005355 | Bacteria | 1507 |
| 96 | Ga0070671_100321566 | 3300005355 | Bacteria | 1318 |
| 97 | Ga0070671_100464801 | 3300005355 | Bacteria | 1086 |
| 98 | Ga0070671_100544628 | 3300005355 | Bacteria | 1000 |
| 99 | Ga0070671_100774652 | 3300005355 | Bacteria | 834 |
| 100 | Ga0070674_100000512 | 3300005356 | Bacteria | 19432 |
| 101 | Ga0070674_100004443 | 3300005356 | Bacteria | 7998 |
| 102 | Ga0070674_100004897 | 3300005356 | Bacteria | 7675 |
| 103 | Ga0070674_100009097 | 3300005356 | Bacteria | 5942 |
| 104 | Ga0070674_100067560 | 3300005356 | Bacteria | 2515 |
| 105 | Ga0070674_100338322 | 3300005356 | Bacteria | 1211 |
| 106 | Ga0070674_100512913 | 3300005356 | Bacteria | 1000 |
| 107 | Ga0070673_100000898 | 3300005364 | Bacteria | 16796 |
| 108 | Ga0070673_100006767 | 3300005364 | Bacteria | 7480 |
| 109 | Ga0070673_100025616 | 3300005364 | Bacteria | 4345 |
| 110 | Ga0070673_100213933 | 3300005364 | Bacteria | 1666 |
| 111 | Ga0070673_100218979 | 3300005364 | Bacteria | 1647 |
| 112 | Ga0070673_101302022 | 3300005364 | Bacteria | 682 |
| 113 | Ga0070688_100003909 | 3300005365 | Bacteria | 7731 |
| 114 | Ga0070688_100011922 | 3300005365 | Bacteria | 4853 |
| 115 | Ga0070688_100057349 | 3300005365 | Bacteria | 2448 |
| 116 | Ga0070688_100078175 | 3300005365 | Bacteria | 2134 |
| 117 | Ga0070659_100023473 | 3300005366 | Bacteria | 4720 |
| 118 | Ga0070659_100066353 | 3300005366 | Bacteria | 2859 |
| 119 | Ga0070659_100195528 | 3300005366 | Bacteria | 1663 |
| 120 | Ga0070667_100006506 | 3300005367 | Bacteria | 9713 |
| 121 | Ga0070667_100018863 | 3300005367 | Bacteria | 5719 |
| 122 | Ga0070667_100038861 | 3300005367 | Bacteria | 3989 |
| 123 | Ga0070667_100048102 | 3300005367 | Bacteria | 3590 |
| 124 | Ga0070667_100058862 | 3300005367 | Bacteria | 3249 |
| 125 | Ga0070667_100101889 | 3300005367 | Bacteria | 2480 |
| 126 | Ga0070667_100229378 | 3300005367 | Bacteria | 1655 |
| 127 | Ga0070667_100345015 | 3300005367 | Bacteria | 1347 |
| 128 | Ga0070709_10085217 | 3300005434 | Bacteria | 2072 |
| 129 | Ga0070709_10127755 | 3300005434 | Bacteria | 1731 |
| 130 | Ga0070709_10474162 | 3300005434 | Bacteria | 946 |
| 131 | Ga0070714_100003295 | 3300005435 | Bacteria | 12036 |
| 132 | Ga0070714_100012558 | 3300005435 | Bacteria | 6768 |
| 133 | Ga0070714_100179862 | 3300005435 | Bacteria | 1924 |
| 134 | Ga0070714_100234866 | 3300005435 | Bacteria | 1690 |
| 135 | Ga0070713_100007196 | 3300005436 | Bacteria | 7787 |
| 136 | Ga0070713_100016403 | 3300005436 | Bacteria | 5569 |
| 137 | Ga0070713_100230985 | 3300005436 | Bacteria | 1681 |
| 138 | Ga0070710_10009218 | 3300005437 | Bacteria | 4824 |
| 139 | Ga0070710_10011674 | 3300005437 | Bacteria | 4346 |
| 140 | Ga0070710_10036771 | 3300005437 | Bacteria | 2678 |
| 141 | Ga0070701_10290377 | 3300005438 | Bacteria | 1002 |
| 142 | Ga0070711_100009868 | 3300005439 | Bacteria | 5888 |
| 143 | Ga0070711_100070966 | 3300005439 | Bacteria | 2454 |
| 144 | Ga0070705_100056195 | 3300005440 | Bacteria | 2317 |
| 145 | Ga0070700_100009084 | 3300005441 | Bacteria | 5448 |
| 146 | Ga0070694_100119413 | 3300005444 | Bacteria | 1890 |
| 147 | Ga0070708_100024762 | 3300005445 | Bacteria | 5125 |
| 148 | Ga0070708_100103506 | 3300005445 | Bacteria | 2610 |
| 149 | Ga0070708_100112294 | 3300005445 | Bacteria | 2506 |
| 150 | Ga0070663_100042112 | 3300005455 | Bacteria | 3207 |
| 151 | Ga0070663_100316960 | 3300005455 | Bacteria | 1253 |
| 152 | Ga0070663_100369358 | 3300005455 | Bacteria | 1165 |
| 153 | Ga0070678_100000282 | 3300005456 | Bacteria | 23627 |
| 154 | Ga0070678_100001298 | 3300005456 | Bacteria | 13264 |
| 155 | Ga0070678_100001846 | 3300005456 | Bacteria | 11419 |
| 156 | Ga0070662_100005937 | 3300005457 | Bacteria | 7831 |
| 157 | Ga0070662_100257470 | 3300005457 | Bacteria | 1405 |
| 158 | Ga0070662_100686867 | 3300005457 | Bacteria | 865 |
| 159 | Ga0068867_100004441 | 3300005459 | Bacteria | 9864 |
| 160 | Ga0068867_100005854 | 3300005459 | Bacteria | 8719 |
| 161 | Ga0068867_100025973 | 3300005459 | Bacteria | 4202 |
| 162 | Ga0068867_100129999 | 3300005459 | Bacteria | 1956 |
| 163 | Ga0068867_100130059 | 3300005459 | Bacteria | 1955 |
| 164 | Ga0070685_10000522 | 3300005466 | Bacteria | 21790 |
| 165 | Ga0070685_10012020 | 3300005466 | Bacteria | 4538 |
| 166 | Ga0070706_100183581 | 3300005467 | Bacteria | 1954 |
| 167 | Ga0070706_100252372 | 3300005467 | Bacteria | 1647 |
| 168 | Ga0070707_100039853 | 3300005468 | Bacteria | 4492 |
| 169 | Ga0070707_100149935 | 3300005468 | Bacteria | 2270 |
| 170 | Ga0070707_100401546 | 3300005468 | Bacteria | 1331 |
| 171 | Ga0070698_100016152 | 3300005471 | Bacteria | 7881 |
| 172 | Ga0070699_100071083 | 3300005518 | Bacteria | 3026 |
| 173 | Ga0070699_100354796 | 3300005518 | Bacteria | 1321 |
| 174 | Ga0070699_100753511 | 3300005518 | Bacteria | 891 |
| 175 | Ga0070679_100053614 | 3300005530 | Bacteria | 4014 |
| 176 | Ga0070679_100441316 | 3300005530 | Bacteria | 1246 |
| 177 | Ga0070679_101096423 | 3300005530 | Bacteria | 741 |
| 178 | Ga0070684_100025324 | 3300005535 | Bacteria | 4986 |
| 179 | Ga0070684_100097224 | 3300005535 | Bacteria | 2625 |
| 180 | Ga0070684_100247198 | 3300005535 | Bacteria | 1630 |
| 181 | Ga0070697_100026299 | 3300005536 | Bacteria | 4647 |
| 182 | Ga0070697_100048014 | 3300005536 | Bacteria | 3461 |
| 183 | Ga0070697_100140130 | 3300005536 | Bacteria | 2033 |
| 184 | Ga0068853_100011343 | 3300005539 | Bacteria | 7237 |
| 185 | Ga0068853_100339975 | 3300005539 | Bacteria | 1394 |
| 186 | Ga0068853_100343594 | 3300005539 | Bacteria | 1387 |
| 187 | Ga0068853_100631304 | 3300005539 | Bacteria | 1019 |
| 188 | Ga0068853_101228963 | 3300005539 | Bacteria | 724 |
| 189 | Ga0070672_100001800 | 3300005543 | Bacteria | 13407 |
| 190 | Ga0070672_100007333 | 3300005543 | Bacteria | 7479 |
| 191 | Ga0070672_100007488 | 3300005543 | Bacteria | 7411 |
| 192 | Ga0070672_100029001 | 3300005543 | Bacteria | 4145 |
| 193 | Ga0070672_100042454 | 3300005543 | Bacteria | 3502 |
| 194 | Ga0070672_100067015 | 3300005543 | Bacteria | 2844 |
| 195 | Ga0070672_100276883 | 3300005543 | Bacteria | 1418 |
| 196 | Ga0070672_100665361 | 3300005543 | Bacteria | 910 |
| 197 | Ga0070686_100018280 | 3300005544 | Bacteria | 4110 |
| 198 | Ga0070686_100029097 | 3300005544 | Bacteria | 3356 |
| 199 | Ga0070695_100499207 | 3300005545 | Bacteria | 941 |
| 200 | Ga0070696_100033653 | 3300005546 | Bacteria | 3523 |
| 201 | Ga0070696_100117190 | 3300005546 | Bacteria | 1924 |
| 202 | Ga0070696_100128568 | 3300005546 | Bacteria | 1841 |
| 203 | Ga0070693_100019866 | 3300005547 | Bacteria | 3532 |
| 204 | Ga0070693_100428143 | 3300005547 | Bacteria | 924 |
| 205 | Ga0070693_101050469 | 3300005547 | Bacteria | 619 |
| 206 | Ga0070665_100000755 | 3300005548 | Bacteria | 42946 |
| 207 | Ga0070665_100007656 | 3300005548 | Bacteria | 10981 |
| 208 | Ga0070665_100009807 | 3300005548 | Bacteria | 9683 |
| 209 | Ga0070665_100012260 | 3300005548 | Bacteria | 8641 |
| 210 | Ga0070665_100059749 | 3300005548 | Bacteria | 3821 |
| 211 | Ga0070665_100137403 | 3300005548 | Bacteria | 2447 |
| 212 | Ga0070665_100310380 | 3300005548 | Bacteria | 1581 |
| 213 | Ga0070665_100349784 | 3300005548 | Bacteria | 1483 |
| 214 | Ga0070704_100022083 | 3300005549 | Bacteria | 4137 |
| 215 | Ga0070704_100091877 | 3300005549 | Bacteria | 2264 |
| 216 | Ga0068855_100022600 | 3300005563 | Bacteria | 7536 |
| 217 | Ga0068855_100062766 | 3300005563 | Bacteria | 4337 |
| 218 | Ga0068855_100063552 | 3300005563 | Bacteria | 4308 |
| 219 | Ga0068855_100220290 | 3300005563 | Bacteria | 2128 |
| 220 | Ga0068855_101254028 | 3300005563 | Bacteria | 769 |
| 221 | Ga0070664_100021792 | 3300005564 | Bacteria | 5283 |
| 222 | Ga0070664_100023145 | 3300005564 | Bacteria | 5129 |
| 223 | Ga0070664_100098547 | 3300005564 | Bacteria | 2539 |
| 224 | Ga0070664_100099412 | 3300005564 | Bacteria | 2528 |
| 225 | Ga0070664_100113311 | 3300005564 | Bacteria | 2368 |
| 226 | Ga0070664_100245891 | 3300005564 | Bacteria | 1607 |
| 227 | Ga0070664_100691049 | 3300005564 | Bacteria | 950 |
| 228 | Ga0068857_100027579 | 3300005577 | Bacteria | 5010 |
| 229 | Ga0068857_100047088 | 3300005577 | Bacteria | 3827 |
| 230 | Ga0068854_100003556 | 3300005578 | Bacteria | 9747 |
| 231 | Ga0068854_100225093 | 3300005578 | Bacteria | 1486 |
| 232 | Ga0068854_100296237 | 3300005578 | Bacteria | 1307 |
| 233 | Ga0068854_100353165 | 3300005578 | Bacteria | 1204 |
| 234 | Ga0068856_100002173 | 3300005614 | Bacteria | 20321 |
| 235 | Ga0068856_100178286 | 3300005614 | Bacteria | 2137 |
| 236 | Ga0068856_100300789 | 3300005614 | Bacteria | 1622 |
| 237 | Ga0068856_100516198 | 3300005614 | Bacteria | 1216 |
| 238 | Ga0070702_100002946 | 3300005615 | Bacteria | 7500 |
| 239 | Ga0070702_100006577 | 3300005615 | Bacteria | 5513 |
| 240 | Ga0068852_100007283 | 3300005616 | Bacteria | 8068 |
| 241 | Ga0068852_100016008 | 3300005616 | Bacteria | 5838 |
| 242 | Ga0068852_100055896 | 3300005616 | Bacteria | 3408 |
| 243 | Ga0068852_100098686 | 3300005616 | Bacteria | 2631 |
| 244 | Ga0068852_100352976 | 3300005616 | Bacteria | 1436 |
| 245 | Ga0068852_100465588 | 3300005616 | Bacteria | 1254 |
| 246 | Ga0068852_100493197 | 3300005616 | Bacteria | 1219 |
| 247 | Ga0068859_100014387 | 3300005617 | Bacteria | 7939 |
| 248 | Ga0068859_100014902 | 3300005617 | Bacteria | 7806 |
| 249 | Ga0068859_100069675 | 3300005617 | Bacteria | 3552 |
| 250 | Ga0068864_100001000 | 3300005618 | Bacteria | 23647 |
| 251 | Ga0068864_100002501 | 3300005618 | Bacteria | 15198 |
| 252 | Ga0068864_100003431 | 3300005618 | Bacteria | 13103 |
| 253 | Ga0068864_100003931 | 3300005618 | Bacteria | 12235 |
| 254 | Ga0068864_100004467 | 3300005618 | Bacteria | 11496 |
| 255 | Ga0068864_100008156 | 3300005618 | Bacteria | 8638 |
| 256 | Ga0068864_100136358 | 3300005618 | Bacteria | 2210 |
| 257 | Ga0068864_100141381 | 3300005618 | Bacteria | 2171 |
| 258 | Ga0068864_100216211 | 3300005618 | Bacteria | 1767 |
| 259 | Ga0068864_100889976 | 3300005618 | Bacteria | 879 |
| 260 | Ga0068866_10031772 | 3300005718 | Bacteria | 2546 |
| 261 | Ga0068866_10046376 | 3300005718 | Bacteria | 2185 |
| 262 | Ga0068861_100009969 | 3300005719 | Bacteria | 6578 |
| 263 | Ga0068861_100017014 | 3300005719 | Bacteria | 5155 |
| 264 | Ga0068861_100029852 | 3300005719 | Bacteria | 3992 |
| 265 | Ga0068861_100041017 | 3300005719 | Bacteria | 3465 |
| 266 | Ga0068861_100056920 | 3300005719 | Bacteria | 2985 |
| 267 | Ga0068861_100189356 | 3300005719 | Bacteria | 1719 |
| 268 | Ga0068861_100304880 | 3300005719 | Bacteria | 1381 |
| 269 | Ga0068861_100334229 | 3300005719 | Bacteria | 1324 |
| 270 | Ga0068861_100612572 | 3300005719 | Bacteria | 1001 |
| 271 | Ga0068851_10000760 | 3300005834 | Bacteria | 13876 |
| 272 | Ga0068851_10002900 | 3300005834 | Bacteria | 7575 |
| 273 | Ga0068851_10018417 | 3300005834 | Bacteria | 3362 |
| 274 | Ga0068851_10029588 | 3300005834 | Bacteria | 2713 |
| 275 | Ga0068870_10010351 | 3300005840 | Bacteria | 4283 |
| 276 | Ga0068870_10034223 | 3300005840 | Bacteria | 2599 |
| 277 | Ga0068870_10123666 | 3300005840 | Bacteria | 1493 |
| 278 | Ga0068870_10329207 | 3300005840 | Bacteria | 973 |
| 279 | Ga0068863_100002509 | 3300005841 | Bacteria | 18242 |
| 280 | Ga0068863_100004438 | 3300005841 | Bacteria | 13833 |
| 281 | Ga0068863_100007482 | 3300005841 | Bacteria | 10687 |
| 282 | Ga0068863_100014344 | 3300005841 | Bacteria | 7632 |
| 283 | Ga0068863_100019177 | 3300005841 | Bacteria | 6547 |
| 284 | Ga0068863_100024468 | 3300005841 | Bacteria | 5758 |
| 285 | Ga0068863_100056261 | 3300005841 | Bacteria | 3724 |
| 286 | Ga0068863_100520796 | 3300005841 | Bacteria | 1172 |
| 287 | Ga0068863_100693825 | 3300005841 | Bacteria | 1012 |
| 288 | Ga0068858_100001616 | 3300005842 | Bacteria | 22981 |
| 289 | Ga0068858_100003832 | 3300005842 | Bacteria | 14871 |
| 290 | Ga0068858_100013427 | 3300005842 | Bacteria | 7729 |
| 291 | Ga0068858_100040010 | 3300005842 | Bacteria | 4347 |
| 292 | Ga0068858_100356369 | 3300005842 | Bacteria | 1402 |
| 293 | Ga0068860_100012240 | 3300005843 | Bacteria | 8454 |
| 294 | Ga0068860_100022453 | 3300005843 | Bacteria | 6103 |
| 295 | Ga0068860_100045549 | 3300005843 | Bacteria | 4183 |
| 296 | Ga0068860_100070846 | 3300005843 | Bacteria | 3314 |
| 297 | Ga0068860_100100895 | 3300005843 | Bacteria | 2754 |
| 298 | Ga0068860_100113608 | 3300005843 | Bacteria | 2589 |
| 299 | Ga0068860_100277201 | 3300005843 | Bacteria | 1638 |
| 300 | Ga0068860_100726973 | 3300005843 | Bacteria | 1003 |
| 301 | Ga0068862_100040093 | 3300005844 | Bacteria | 3980 |
| 302 | Ga0068862_100094281 | 3300005844 | Bacteria | 2611 |
| 303 | Ga0068862_100226873 | 3300005844 | Bacteria | 1693 |
| 304 | Ga0081539_10120190 | 3300005985 | Bacteria | 1306 |
| 305 | Ga0081539_10194889 | 3300005985 | Bacteria | 940 |
| 306 | Ga0070715_10005421 | 3300006163 | Bacteria | 4252 |
| 307 | Ga0070716_100208729 | 3300006173 | Bacteria | 1304 |
| 308 | Ga0070712_100005685 | 3300006175 | Bacteria | 7710 |
| 309 | Ga0070712_101124297 | 3300006175 | Bacteria | 682 |
| 310 | Ga0097621_100004791 | 3300006237 | Bacteria | 9468 |
| 311 | Ga0097621_100012757 | 3300006237 | Bacteria | 6244 |
| 312 | Ga0097621_100048808 | 3300006237 | Bacteria | 3436 |
| 313 | Ga0097621_100115684 | 3300006237 | Bacteria | 2270 |
| 314 | Ga0097621_100862876 | 3300006237 | Bacteria | 841 |
| 315 | Ga0068871_100010378 | 3300006358 | Bacteria | 6794 |
| 316 | Ga0068871_100024045 | 3300006358 | Bacteria | 4721 |
| 317 | Ga0068871_100069668 | 3300006358 | Bacteria | 2889 |
| 318 | Ga0068871_100131550 | 3300006358 | Bacteria | 2122 |
| 319 | Ga0068871_100237936 | 3300006358 | Bacteria | 1582 |
| 320 | Ga0068871_101097707 | 3300006358 | Bacteria | 744 |
| 321 | Ga0068871_101141649 | 3300006358 | Bacteria | 729 |
| 322 | Ga0075428_100099878 | 3300006844 | Bacteria | 3165 |
| 323 | Ga0075431_100002144 | 3300006847 | Bacteria | 18865 |
| 324 | Ga0075433_10231821 | 3300006852 | Bacteria | 1639 |
| 325 | Ga0075433_10644211 | 3300006852 | Bacteria | 929 |
| 326 | Ga0075434_100019391 | 3300006871 | Bacteria | 6582 |
| 327 | Ga0075434_100056491 | 3300006871 | Bacteria | 3901 |
| 328 | Ga0075434_100725418 | 3300006871 | Bacteria | 1011 |
| 329 | Ga0075429_100034475 | 3300006880 | Bacteria | 4399 |
| 330 | Ga0068865_100010750 | 3300006881 | Bacteria | 5706 |
| 331 | Ga0068865_100025893 | 3300006881 | Bacteria | 3864 |
| 332 | Ga0068865_100029292 | 3300006881 | Bacteria | 3651 |
| 333 | Ga0068865_100077974 | 3300006881 | Bacteria | 2369 |
| 334 | Ga0097620_100014386 | 3300006931 | Bacteria | 7939 |
| 335 | Ga0097620_100014900 | 3300006931 | Bacteria | 7806 |
| 336 | Ga0097620_100069680 | 3300006931 | Bacteria | 3552 |
| 337 | Ga0075435_100041477 | 3300007076 | Bacteria | 3679 |
| 338 | Ga0075435_100195672 | 3300007076 | Bacteria | 1712 |
| 339 | Ga0075435_100748968 | 3300007076 | Bacteria | 850 |
| 340 | Ga0075435_100828482 | 3300007076 | Bacteria | 806 |
| 341 | Ga0105240_10051113 | 3300009093 | Bacteria | 5204 |
| 342 | Ga0105240_10054022 | 3300009093 | Bacteria | 5037 |
| 343 | Ga0105240_10482605 | 3300009093 | Bacteria | 1381 |
| 344 | Ga0111539_10137058 | 3300009094 | Bacteria | 2866 |
| 345 | Ga0111539_10243173 | 3300009094 | Bacteria | 2095 |
| 346 | Ga0105245_10036008 | 3300009098 | Bacteria | 4395 |
| 347 | Ga0105245_10044063 | 3300009098 | Bacteria | 3981 |
| 348 | Ga0105245_10469787 | 3300009098 | Bacteria | 1269 |
| 349 | Ga0105247_10013579 | 3300009101 | Bacteria | 4884 |
| 350 | Ga0105247_10138616 | 3300009101 | Bacteria | 1592 |
| 351 | Ga0105247_10336001 | 3300009101 | Bacteria | 1058 |
| 352 | Ga0114129_10097191 | 3300009147 | Bacteria | 4076 |
| 353 | Ga0114129_10328673 | 3300009147 | Bacteria | 2031 |
| 354 | Ga0105243_10221975 | 3300009148 | Bacteria | 1671 |
| 355 | Ga0105241_10003899 | 3300009174 | Bacteria | 11049 |
| 356 | Ga0105241_10042070 | 3300009174 | Bacteria | 3455 |
| 357 | Ga0105241_10070821 | 3300009174 | Bacteria | 2706 |
| 358 | Ga0105241_10275689 | 3300009174 | Bacteria | 1434 |
| 359 | Ga0105241_10534313 | 3300009174 | Bacteria | 1050 |
| 360 | Ga0105242_10176047 | 3300009176 | Bacteria | 1884 |
| 361 | Ga0105248_10015655 | 3300009177 | Bacteria | 8357 |
| 362 | Ga0105248_10023395 | 3300009177 | Bacteria | 6863 |
| 363 | Ga0105248_10159540 | 3300009177 | Bacteria | 2544 |
| 364 | Ga0105248_10303349 | 3300009177 | Bacteria | 1798 |
| 365 | Ga0105248_10495674 | 3300009177 | Bacteria | 1377 |
| 366 | Ga0105248_10792728 | 3300009177 | Bacteria | 1069 |
| 367 | Ga0105237_10026918 | 3300009545 | Bacteria | 5875 |
| 368 | Ga0105238_10006515 | 3300009551 | Bacteria | 11619 |
| 369 | Ga0105238_10008114 | 3300009551 | Bacteria | 10501 |
| 370 | Ga0105238_10077572 | 3300009551 | Bacteria | 3313 |
| 371 | Ga0105249_10038854 | 3300009553 | Bacteria | 4319 |
| 372 | Ga0105249_10209728 | 3300009553 | Bacteria | 1911 |
| 373 | Ga0105249_10544205 | 3300009553 | Bacteria | 1211 |
| 374 | Ga0105249_10841150 | 3300009553 | Bacteria | 983 |
| 375 | Ga0105239_10609064 | 3300010375 | Bacteria | 1246 |
| 376 | Ga0105239_10805496 | 3300010375 | Bacteria | 1076 |
| 377 | Ga0105246_10176709 | 3300011119 | Bacteria | 1640 |
| 378 | Ga0157373_10005591 | 3300013100 | Bacteria | 9424 |
| 379 | Ga0157373_10041623 | 3300013100 | Bacteria | 3286 |
| 380 | Ga0157373_10055969 | 3300013100 | Bacteria | 2801 |
| 381 | Ga0157373_10199852 | 3300013100 | Bacteria | 1409 |
| 382 | Ga0157373_10479416 | 3300013100 | Bacteria | 897 |
| 383 | Ga0157371_10019019 | 3300013102 | Bacteria | 5070 |
| 384 | Ga0157371_10033685 | 3300013102 | Bacteria | 3679 |
| 385 | Ga0157371_10069094 | 3300013102 | Bacteria | 2501 |
| 386 | Ga0157371_10254125 | 3300013102 | Bacteria | 1266 |
| 387 | Ga0157370_10026926 | 3300013104 | Bacteria | 5670 |
| 388 | Ga0157370_10047064 | 3300013104 | Bacteria | 4135 |
| 389 | Ga0157370_10066379 | 3300013104 | Bacteria | 3412 |
| 390 | Ga0157370_10090956 | 3300013104 | Bacteria | 2865 |
| 391 | Ga0157370_10240945 | 3300013104 | Bacteria | 1673 |
| 392 | Ga0157369_10010583 | 3300013105 | Bacteria | 10501 |
| 393 | Ga0157369_10049776 | 3300013105 | Bacteria | 4540 |
| 394 | Ga0157374_10002330 | 3300013296 | Bacteria | 16033 |
| 395 | Ga0157374_10002543 | 3300013296 | Bacteria | 15382 |
| 396 | Ga0157374_10009894 | 3300013296 | Bacteria | 8183 |
| 397 | Ga0157374_10045485 | 3300013296 | Bacteria | 4063 |
| 398 | Ga0157374_10134511 | 3300013296 | Bacteria | 2395 |
| 399 | Ga0157374_11212014 | 3300013296 | Bacteria | 776 |
| 400 | Ga0157378_10022056 | 3300013297 | Bacteria | 5601 |
| 401 | Ga0157378_10273371 | 3300013297 | Bacteria | 1626 |
| 402 | Ga0157378_10343746 | 3300013297 | Bacteria | 1456 |
| 403 | Ga0157378_10895463 | 3300013297 | Bacteria | 918 |
| 404 | Ga0157378_11622463 | 3300013297 | Bacteria | 693 |
| 405 | Ga0163162_10003179 | 3300013306 | Bacteria | 15705 |
| 406 | Ga0163162_10035896 | 3300013306 | Bacteria | 4938 |
| 407 | Ga0163162_10064452 | 3300013306 | Bacteria | 3709 |
| 408 | Ga0163162_10072782 | 3300013306 | Bacteria | 3492 |
| 409 | Ga0163162_10160734 | 3300013306 | Bacteria | 2368 |
| 410 | Ga0163162_10431019 | 3300013306 | Bacteria | 1451 |
| 411 | Ga0163162_10628880 | 3300013306 | Bacteria | 1198 |
| 412 | Ga0163162_11055796 | 3300013306 | Bacteria | 920 |
| 413 | Ga0157372_10004917 | 3300013307 | Bacteria | 14202 |
| 414 | Ga0157372_10046075 | 3300013307 | Bacteria | 4839 |
| 415 | Ga0157372_10194528 | 3300013307 | Bacteria | 2349 |
| 416 | Ga0157372_10489255 | 3300013307 | Bacteria | 1434 |
| 417 | Ga0157372_11551509 | 3300013307 | Bacteria | 763 |
| 418 | Ga0157375_10003041 | 3300013308 | Bacteria | 14564 |
| 419 | Ga0157375_10017959 | 3300013308 | Bacteria | 6402 |
| 420 | Ga0157375_10198476 | 3300013308 | Bacteria | 2162 |
| 421 | Ga0157375_10205753 | 3300013308 | Bacteria | 2124 |
| 422 | Ga0157375_10241910 | 3300013308 | Bacteria | 1964 |
| 423 | Ga0157375_10282132 | 3300013308 | Bacteria | 1824 |
| 424 | Ga0157375_10416057 | 3300013308 | Bacteria | 1510 |
| 425 | Ga0157375_10491502 | 3300013308 | Bacteria | 1392 |
| 426 | Ga0157375_10510583 | 3300013308 | Bacteria | 1366 |
| 427 | Ga0157375_11387818 | 3300013308 | Bacteria | 827 |
| 428 | Ga0163163_10004410 | 3300014325 | Bacteria | 11996 |
| 429 | Ga0163163_10019921 | 3300014325 | Bacteria | 6309 |
| 430 | Ga0163163_10382093 | 3300014325 | Bacteria | 1466 |
| 431 | Ga0163163_10900563 | 3300014325 | Bacteria | 948 |
| 432 | Ga0163163_11043633 | 3300014325 | Bacteria | 881 |
| 433 | Ga0163163_12108928 | 3300014325 | Bacteria | 623 |
| 434 | Ga0157380_10015361 | 3300014326 | Bacteria | 5628 |
| 435 | Ga0157380_10042701 | 3300014326 | Bacteria | 3545 |
| 436 | Ga0157380_10092123 | 3300014326 | Bacteria | 2504 |
| 437 | Ga0157380_10317265 | 3300014326 | Bacteria | 1443 |
| 438 | Ga0157380_10452150 | 3300014326 | Bacteria | 1234 |
| 439 | Ga0157380_11626316 | 3300014326 | Bacteria | 702 |
| 440 | Ga0182008_10183890 | 3300014497 | Bacteria | 1058 |
| 441 | Ga0157377_10014844 | 3300014745 | Bacteria | 3973 |
| 442 | Ga0157379_10000544 | 3300014968 | Bacteria | 30401 |
| 443 | Ga0157379_10013818 | 3300014968 | Bacteria | 7075 |
| 444 | Ga0157379_10031598 | 3300014968 | Bacteria | 4718 |
| 445 | Ga0157379_10446611 | 3300014968 | Bacteria | 1193 |
| 446 | Ga0157379_10563792 | 3300014968 | Bacteria | 1060 |
| 447 | Ga0157376_10017692 | 3300014969 | Bacteria | 5444 |
| 448 | Ga0157376_10060056 | 3300014969 | Bacteria | 3191 |
| 449 | Ga0157376_10076386 | 3300014969 | Bacteria | 2862 |
| 450 | Ga0157376_10083894 | 3300014969 | Bacteria | 2742 |
| 451 | Ga0157376_10185216 | 3300014969 | Bacteria | 1906 |
| 452 | Ga0157376_10442756 | 3300014969 | Bacteria | 1266 |
| 453 | Ga0163161_10007139 | 3300017792 | Bacteria | 7723 |
| 454 | Ga0163161_10012679 | 3300017792 | Bacteria | 5854 |
| 455 | Ga0163161_10054057 | 3300017792 | Bacteria | 2914 |
| 456 | Ga0163161_10136415 | 3300017792 | Bacteria | 1855 |
| 457 | Ga0163161_10139148 | 3300017792 | Bacteria | 1837 |
| 458 | Ga0207666_1002641 | 3300025271 | Bacteria | 2168 |
| 459 | Ga0207673_1004095 | 3300025290 | Bacteria | 1731 |
| 460 | Ga0207697_10000474 | 3300025315 | Bacteria | 22692 |
| 461 | Ga0207697_10014153 | 3300025315 | Bacteria | 3316 |
| 462 | Ga0207656_10009549 | 3300025321 | Bacteria | 3604 |
| 463 | Ga0207682_10000224 | 3300025893 | Bacteria | 25591 |
| 464 | Ga0207682_10002853 | 3300025893 | Bacteria | 7625 |
| 465 | Ga0207692_10035074 | 3300025898 | Bacteria | 2435 |
| 466 | Ga0207692_10075173 | 3300025898 | Bacteria | 1791 |
| 467 | Ga0207642_10051950 | 3300025899 | Bacteria | 1857 |
| 468 | Ga0207642_10076098 | 3300025899 | Bacteria | 1614 |
| 469 | Ga0207710_10020412 | 3300025900 | Bacteria | 2832 |
| 470 | Ga0207688_10001248 | 3300025901 | Bacteria | 13208 |
| 471 | Ga0207688_10421448 | 3300025901 | Bacteria | 829 |
| 472 | Ga0207680_10017979 | 3300025903 | Bacteria | 3746 |
| 473 | Ga0207680_10065128 | 3300025903 | Bacteria | 2236 |
| 474 | Ga0207680_10320205 | 3300025903 | Bacteria | 1084 |
| 475 | Ga0207685_10022878 | 3300025905 | Bacteria | 2119 |
| 476 | Ga0207699_10008850 | 3300025906 | Bacteria | 4987 |
| 477 | Ga0207699_10059254 | 3300025906 | Bacteria | 2294 |
| 478 | Ga0207645_10000488 | 3300025907 | Bacteria | 32821 |
| 479 | Ga0207645_10001172 | 3300025907 | Bacteria | 21640 |
| 480 | Ga0207645_10003895 | 3300025907 | Bacteria | 11158 |
| 481 | Ga0207645_10020904 | 3300025907 | Bacteria | 4276 |
| 482 | Ga0207645_10220063 | 3300025907 | Bacteria | 1251 |
| 483 | Ga0207645_10276534 | 3300025907 | Bacteria | 1114 |
| 484 | Ga0207645_10471002 | 3300025907 | Bacteria | 849 |
| 485 | Ga0207643_10000241 | 3300025908 | Bacteria | 38063 |
| 486 | Ga0207643_10009328 | 3300025908 | Bacteria | 5274 |
| 487 | Ga0207643_10044848 | 3300025908 | Bacteria | 2496 |
| 488 | Ga0207643_10155832 | 3300025908 | Bacteria | 1372 |
| 489 | Ga0207705_10124679 | 3300025909 | Bacteria | 1913 |
| 490 | Ga0207684_10031913 | 3300025910 | Bacteria | 4481 |
| 491 | Ga0207684_10887322 | 3300025910 | Bacteria | 750 |
| 492 | Ga0207654_10188960 | 3300025911 | Bacteria | 1349 |
| 493 | Ga0207707_10010933 | 3300025912 | Bacteria | 7893 |
| 494 | Ga0207707_10092524 | 3300025912 | Bacteria | 2642 |
| 495 | Ga0207695_10042039 | 3300025913 | Bacteria | 4887 |
| 496 | Ga0207695_10184913 | 3300025913 | Bacteria | 2003 |
| 497 | Ga0207693_10000069 | 3300025915 | Bacteria | 90103 |
| 498 | Ga0207693_10006208 | 3300025915 | Bacteria | 9911 |
| 499 | Ga0207663_10009044 | 3300025916 | Bacteria | 5246 |
| 500 | Ga0207663_10171738 | 3300025916 | Bacteria | 1540 |
| 501 | Ga0207663_10308783 | 3300025916 | Bacteria | 1184 |
| 502 | Ga0207660_10003901 | 3300025917 | Bacteria | 9720 |
| 503 | Ga0207660_10055842 | 3300025917 | Bacteria | 2824 |
| 504 | Ga0207662_10010967 | 3300025918 | Bacteria | 5013 |
| 505 | Ga0207662_10036933 | 3300025918 | Bacteria | 2857 |
| 506 | Ga0207657_10021040 | 3300025919 | Bacteria | 6150 |
| 507 | Ga0207649_10061084 | 3300025920 | Bacteria | 2371 |
| 508 | Ga0207649_10583947 | 3300025920 | Bacteria | 858 |
| 509 | Ga0207652_10001143 | 3300025921 | Bacteria | 23866 |
| 510 | Ga0207652_10023819 | 3300025921 | Bacteria | 5076 |
| 511 | Ga0207652_10101505 | 3300025921 | Bacteria | 2541 |
| 512 | Ga0207646_10027520 | 3300025922 | Bacteria | 5185 |
| 513 | Ga0207646_10242741 | 3300025922 | Bacteria | 1627 |
| 514 | Ga0207646_10285750 | 3300025922 | Bacteria | 1491 |
| 515 | Ga0207681_10008866 | 3300025923 | Bacteria | 6145 |
| 516 | Ga0207681_10016156 | 3300025923 | Bacteria | 4663 |
| 517 | Ga0207681_10166400 | 3300025923 | Bacteria | 1667 |
| 518 | Ga0207694_10011462 | 3300025924 | Bacteria | 6691 |
| 519 | Ga0207694_10141237 | 3300025924 | Bacteria | 1936 |
| 520 | Ga0207694_10236969 | 3300025924 | Bacteria | 1491 |
| 521 | Ga0207650_10006364 | 3300025925 | Bacteria | 8041 |
| 522 | Ga0207650_10007771 | 3300025925 | Bacteria | 7309 |
| 523 | Ga0207650_10007867 | 3300025925 | Bacteria | 7257 |
| 524 | Ga0207650_10029683 | 3300025925 | Bacteria | 3933 |
| 525 | Ga0207650_10076551 | 3300025925 | Bacteria | 2528 |
| 526 | Ga0207650_10084892 | 3300025925 | Bacteria | 2407 |
| 527 | Ga0207650_10157528 | 3300025925 | Bacteria | 1797 |
| 528 | Ga0207650_10506673 | 3300025925 | Bacteria | 1009 |
| 529 | Ga0207650_10679555 | 3300025925 | Bacteria | 869 |
| 530 | Ga0207659_10004534 | 3300025926 | Bacteria | 8405 |
| 531 | Ga0207659_10005318 | 3300025926 | Bacteria | 7803 |
| 532 | Ga0207659_10007612 | 3300025926 | Bacteria | 6678 |
| 533 | Ga0207659_10014481 | 3300025926 | Bacteria | 5089 |
| 534 | Ga0207659_10048788 | 3300025926 | Bacteria | 3001 |
| 535 | Ga0207659_10070001 | 3300025926 | Bacteria | 2557 |
| 536 | Ga0207687_10008061 | 3300025927 | Bacteria | 6893 |
| 537 | Ga0207687_10837358 | 3300025927 | Bacteria | 786 |
| 538 | Ga0207700_10001882 | 3300025928 | Bacteria | 11909 |
| 539 | Ga0207700_10010851 | 3300025928 | Bacteria | 5779 |
| 540 | Ga0207700_10363638 | 3300025928 | Bacteria | 1262 |
| 541 | Ga0207664_10001100 | 3300025929 | Bacteria | 18018 |
| 542 | Ga0207664_10015121 | 3300025929 | Bacteria | 5591 |
| 543 | Ga0207664_10040208 | 3300025929 | Bacteria | 3635 |
| 544 | Ga0207664_10079989 | 3300025929 | Bacteria | 2655 |
| 545 | Ga0207644_10001001 | 3300025931 | Bacteria | 18052 |
| 546 | Ga0207644_10010748 | 3300025931 | Bacteria | 6037 |
| 547 | Ga0207644_10016811 | 3300025931 | Bacteria | 4927 |
| 548 | Ga0207644_10041280 | 3300025931 | Bacteria | 3263 |
| 549 | Ga0207644_10171178 | 3300025931 | Bacteria | 1695 |
| 550 | Ga0207644_10313396 | 3300025931 | Bacteria | 1267 |
| 551 | Ga0207644_10359193 | 3300025931 | Bacteria | 1184 |
| 552 | Ga0207644_10610095 | 3300025931 | Bacteria | 906 |
| 553 | Ga0207690_10074874 | 3300025932 | Bacteria | 2346 |
| 554 | Ga0207690_10162037 | 3300025932 | Bacteria | 1668 |
| 555 | Ga0207706_10000488 | 3300025933 | Bacteria | 42317 |
| 556 | Ga0207706_10012193 | 3300025933 | Bacteria | 7833 |
| 557 | Ga0207706_10043521 | 3300025933 | Bacteria | 3979 |
| 558 | Ga0207706_10895797 | 3300025933 | Bacteria | 749 |
| 559 | Ga0207686_10000118 | 3300025934 | Bacteria | 64531 |
| 560 | Ga0207686_10177606 | 3300025934 | Bacteria | 1507 |
| 561 | Ga0207670_10003274 | 3300025936 | Bacteria | 8578 |
| 562 | Ga0207670_10006315 | 3300025936 | Bacteria | 6565 |
| 563 | Ga0207670_10022230 | 3300025936 | Bacteria | 3928 |
| 564 | Ga0207669_10000937 | 3300025937 | Bacteria | 12328 |
| 565 | Ga0207669_10004593 | 3300025937 | Bacteria | 6094 |
| 566 | Ga0207669_10006911 | 3300025937 | Bacteria | 5218 |
| 567 | Ga0207669_10012907 | 3300025937 | Bacteria | 4127 |
| 568 | Ga0207669_10024282 | 3300025937 | Bacteria | 3255 |
| 569 | Ga0207669_10079181 | 3300025937 | Bacteria | 2097 |
| 570 | Ga0207669_10175489 | 3300025937 | Bacteria | 1530 |
| 571 | Ga0207669_10210315 | 3300025937 | Bacteria | 1419 |
| 572 | Ga0207704_10008365 | 3300025938 | Bacteria | 4943 |
| 573 | Ga0207704_10155440 | 3300025938 | Bacteria | 1620 |
| 574 | Ga0207704_10280151 | 3300025938 | Bacteria | 1267 |
| 575 | Ga0207665_10031075 | 3300025939 | Bacteria | 3532 |
| 576 | Ga0207665_10045530 | 3300025939 | Bacteria | 2938 |
| 577 | Ga0207665_10161882 | 3300025939 | Bacteria | 1610 |
| 578 | Ga0207665_10639471 | 3300025939 | Bacteria | 833 |
| 579 | Ga0207691_10000458 | 3300025940 | Bacteria | 40362 |
| 580 | Ga0207691_10000572 | 3300025940 | Bacteria | 36827 |
| 581 | Ga0207691_10024787 | 3300025940 | Bacteria | 5638 |
| 582 | Ga0207691_10026691 | 3300025940 | Bacteria | 5419 |
| 583 | Ga0207691_10030643 | 3300025940 | Bacteria | 5025 |
| 584 | Ga0207691_10043789 | 3300025940 | Bacteria | 4123 |
| 585 | Ga0207691_10165429 | 3300025940 | Bacteria | 1939 |
| 586 | Ga0207691_10172875 | 3300025940 | Bacteria | 1891 |
| 587 | Ga0207691_10697946 | 3300025940 | Bacteria | 856 |
| 588 | Ga0207711_10000515 | 3300025941 | Bacteria | 39690 |
| 589 | Ga0207711_10003360 | 3300025941 | Bacteria | 13861 |
| 590 | Ga0207711_10014797 | 3300025941 | Bacteria | 6483 |
| 591 | Ga0207711_10065514 | 3300025941 | Bacteria | 3141 |
| 592 | Ga0207711_10089785 | 3300025941 | Bacteria | 2700 |
| 593 | Ga0207689_10000421 | 3300025942 | Bacteria | 39749 |
| 594 | Ga0207689_10000719 | 3300025942 | Bacteria | 31673 |
| 595 | Ga0207689_10101654 | 3300025942 | Bacteria | 2361 |
| 596 | Ga0207689_10163357 | 3300025942 | Bacteria | 1835 |
| 597 | Ga0207689_10200950 | 3300025942 | Bacteria | 1645 |
| 598 | Ga0207661_10092618 | 3300025944 | Bacteria | 2520 |
| 599 | Ga0207661_10109892 | 3300025944 | Bacteria | 2329 |
| 600 | Ga0207661_10129118 | 3300025944 | Bacteria | 2162 |
| 601 | Ga0207679_10005081 | 3300025945 | Bacteria | 8228 |
| 602 | Ga0207679_10030087 | 3300025945 | Bacteria | 3788 |
| 603 | Ga0207679_10037021 | 3300025945 | Bacteria | 3465 |
| 604 | Ga0207679_10089146 | 3300025945 | Bacteria | 2380 |
| 605 | Ga0207679_10248824 | 3300025945 | Bacteria | 1510 |
| 606 | Ga0207679_10357807 | 3300025945 | Bacteria | 1274 |
| 607 | Ga0207679_10600580 | 3300025945 | Bacteria | 992 |
| 608 | Ga0207667_10030255 | 3300025949 | Bacteria | 5860 |
| 609 | Ga0207667_10091512 | 3300025949 | Bacteria | 3142 |
| 610 | Ga0207667_10246114 | 3300025949 | Bacteria | 1829 |
| 611 | Ga0207667_10346050 | 3300025949 | Bacteria | 1516 |
| 612 | Ga0207651_10001969 | 3300025960 | Bacteria | 9653 |
| 613 | Ga0207651_10002981 | 3300025960 | Bacteria | 8191 |
| 614 | Ga0207651_10009524 | 3300025960 | Bacteria | 5327 |
| 615 | Ga0207651_10067538 | 3300025960 | Bacteria | 2516 |
| 616 | Ga0207651_10187409 | 3300025960 | Bacteria | 1647 |
| 617 | Ga0207651_10289339 | 3300025960 | Bacteria | 1358 |
| 618 | Ga0207651_11210998 | 3300025960 | Bacteria | 678 |
| 619 | Ga0207712_10098595 | 3300025961 | Bacteria | 2168 |
| 620 | Ga0207712_10115059 | 3300025961 | Bacteria | 2024 |
| 621 | Ga0207712_10764334 | 3300025961 | Bacteria | 847 |
| 622 | Ga0207712_11296989 | 3300025961 | Bacteria | 651 |
| 623 | Ga0207668_10003117 | 3300025972 | Bacteria | 9711 |
| 624 | Ga0207668_10003880 | 3300025972 | Bacteria | 8813 |
| 625 | Ga0207668_10005978 | 3300025972 | Bacteria | 7174 |
| 626 | Ga0207668_10021299 | 3300025972 | Bacteria | 4133 |
| 627 | Ga0207668_10024979 | 3300025972 | Bacteria | 3862 |
| 628 | Ga0207668_10052264 | 3300025972 | Bacteria | 2826 |
| 629 | Ga0207668_10063277 | 3300025972 | Bacteria | 2609 |
| 630 | Ga0207668_10088887 | 3300025972 | Bacteria | 2264 |
| 631 | Ga0207668_10091659 | 3300025972 | Bacteria | 2234 |
| 632 | Ga0207668_10170227 | 3300025972 | Bacteria | 1707 |
| 633 | Ga0207668_10317924 | 3300025972 | Bacteria | 1291 |
| 634 | Ga0207640_10008553 | 3300025981 | Bacteria | 5684 |
| 635 | Ga0207640_10494244 | 3300025981 | Bacteria | 1017 |
| 636 | Ga0207640_10817150 | 3300025981 | Bacteria | 809 |
| 637 | Ga0207658_10007690 | 3300025986 | Bacteria | 7338 |
| 638 | Ga0207658_10011693 | 3300025986 | Bacteria | 5976 |
| 639 | Ga0207658_10012660 | 3300025986 | Bacteria | 5761 |
| 640 | Ga0207658_10014000 | 3300025986 | Bacteria | 5490 |
| 641 | Ga0207658_10014476 | 3300025986 | Bacteria | 5401 |
| 642 | Ga0207658_10049696 | 3300025986 | Bacteria | 3082 |
| 643 | Ga0207658_10141366 | 3300025986 | Bacteria | 1948 |
| 644 | Ga0207658_10267733 | 3300025986 | Bacteria | 1459 |
| 645 | Ga0207677_10003500 | 3300026023 | Bacteria | 8322 |
| 646 | Ga0207677_10006248 | 3300026023 | Bacteria | 6515 |
| 647 | Ga0207677_10047725 | 3300026023 | Bacteria | 2877 |
| 648 | Ga0207677_10105985 | 3300026023 | Bacteria | 2081 |
| 649 | Ga0207677_10169989 | 3300026023 | Bacteria | 1703 |
| 650 | Ga0207677_10446257 | 3300026023 | Bacteria | 1107 |
| 651 | Ga0207677_11469471 | 3300026023 | Bacteria | 629 |
| 652 | Ga0207703_10002644 | 3300026035 | Bacteria | 15435 |
| 653 | Ga0207703_10011990 | 3300026035 | Bacteria | 6751 |
| 654 | Ga0207703_10015545 | 3300026035 | Bacteria | 5935 |
| 655 | Ga0207703_10023846 | 3300026035 | Bacteria | 4812 |
| 656 | Ga0207703_10124618 | 3300026035 | Bacteria | 2216 |
| 657 | Ga0207703_10139403 | 3300026035 | Bacteria | 2103 |
| 658 | Ga0207639_10022474 | 3300026041 | Bacteria | 4543 |
| 659 | Ga0207639_10315171 | 3300026041 | Bacteria | 1387 |
| 660 | Ga0207639_10549341 | 3300026041 | Bacteria | 1060 |
| 661 | Ga0207639_10680972 | 3300026041 | Bacteria | 953 |
| 662 | Ga0207639_10992572 | 3300026041 | Bacteria | 786 |
| 663 | Ga0207678_10005480 | 3300026067 | Bacteria | 11348 |
| 664 | Ga0207678_10006243 | 3300026067 | Bacteria | 10586 |
| 665 | Ga0207678_10011514 | 3300026067 | Bacteria | 7770 |
| 666 | Ga0207678_10116000 | 3300026067 | Bacteria | 2285 |
| 667 | Ga0207678_10127320 | 3300026067 | Bacteria | 2172 |
| 668 | Ga0207708_10005086 | 3300026075 | Bacteria | 9702 |
| 669 | Ga0207702_10008839 | 3300026078 | Bacteria | 8491 |
| 670 | Ga0207641_10000588 | 3300026088 | Bacteria | 39984 |
| 671 | Ga0207641_10002776 | 3300026088 | Bacteria | 15957 |
| 672 | Ga0207641_10009170 | 3300026088 | Bacteria | 8170 |
| 673 | Ga0207641_10020806 | 3300026088 | Bacteria | 5392 |
| 674 | Ga0207641_10022296 | 3300026088 | Bacteria | 5212 |
| 675 | Ga0207641_10032620 | 3300026088 | Bacteria | 4324 |
| 676 | Ga0207641_10095043 | 3300026088 | Bacteria | 2615 |
| 677 | Ga0207641_10382301 | 3300026088 | Bacteria | 1348 |
| 678 | Ga0207641_10669220 | 3300026088 | Bacteria | 1021 |
| 679 | Ga0207648_10000364 | 3300026089 | Bacteria | 49697 |
| 680 | Ga0207648_10003329 | 3300026089 | Bacteria | 16878 |
| 681 | Ga0207648_10007103 | 3300026089 | Bacteria | 11049 |
| 682 | Ga0207648_10008038 | 3300026089 | Bacteria | 10277 |
| 683 | Ga0207648_10019354 | 3300026089 | Bacteria | 6145 |
| 684 | Ga0207648_10139771 | 3300026089 | Bacteria | 2134 |
| 685 | Ga0207648_10164325 | 3300026089 | Bacteria | 1961 |
| 686 | Ga0207648_10801163 | 3300026089 | Bacteria | 877 |
| 687 | Ga0207676_10001838 | 3300026095 | Bacteria | 15554 |
| 688 | Ga0207676_10005263 | 3300026095 | Bacteria | 9157 |
| 689 | Ga0207676_10010876 | 3300026095 | Bacteria | 6491 |
| 690 | Ga0207676_10029303 | 3300026095 | Bacteria | 4119 |
| 691 | Ga0207676_10042063 | 3300026095 | Bacteria | 3513 |
| 692 | Ga0207676_10076846 | 3300026095 | Bacteria | 2699 |
| 693 | Ga0207676_10094604 | 3300026095 | Bacteria | 2462 |
| 694 | Ga0207676_10118451 | 3300026095 | Bacteria | 2228 |
| 695 | Ga0207676_10309243 | 3300026095 | Bacteria | 1446 |
| 696 | Ga0207676_10519036 | 3300026095 | Bacteria | 1134 |
| 697 | Ga0207674_10002737 | 3300026116 | Bacteria | 21985 |
| 698 | Ga0207674_10006639 | 3300026116 | Bacteria | 13591 |
| 699 | Ga0207674_10066888 | 3300026116 | Bacteria | 3619 |
| 700 | Ga0207675_100008479 | 3300026118 | Bacteria | 9683 |
| 701 | Ga0207675_100013544 | 3300026118 | Bacteria | 7611 |
| 702 | Ga0207675_100021323 | 3300026118 | Bacteria | 6035 |
| 703 | Ga0207675_100024335 | 3300026118 | Bacteria | 5631 |
| 704 | Ga0207675_100033578 | 3300026118 | Bacteria | 4780 |
| 705 | Ga0207675_100177647 | 3300026118 | Bacteria | 2037 |
| 706 | Ga0207675_100367875 | 3300026118 | Bacteria | 1412 |
| 707 | Ga0207675_100472446 | 3300026118 | Bacteria | 1245 |
| 708 | Ga0207675_100810817 | 3300026118 | Bacteria | 950 |
| 709 | Ga0207675_101721798 | 3300026118 | Bacteria | 647 |
| 710 | Ga0207683_10000076 | 3300026121 | Bacteria | 77762 |
| 711 | Ga0207683_10000218 | 3300026121 | Bacteria | 50151 |
| 712 | Ga0207683_10001799 | 3300026121 | Bacteria | 18984 |
| 713 | Ga0207683_10005087 | 3300026121 | Bacteria | 11285 |
| 714 | Ga0207683_10017518 | 3300026121 | Bacteria | 6106 |
| 715 | Ga0207683_10024809 | 3300026121 | Bacteria | 5166 |
| 716 | Ga0207683_10096864 | 3300026121 | Bacteria | 2631 |
| 717 | Ga0207683_10438216 | 3300026121 | Bacteria | 1204 |
| 718 | Ga0207698_10002381 | 3300026142 | Bacteria | 11142 |
| 719 | Ga0207698_10018570 | 3300026142 | Bacteria | 4741 |
| 720 | Ga0207698_10035981 | 3300026142 | Bacteria | 3629 |
| 721 | Ga0207698_10109945 | 3300026142 | Bacteria | 2307 |
| 722 | Ga0207698_10122160 | 3300026142 | Bacteria | 2206 |
| 723 | Ga0207698_10239913 | 3300026142 | Bacteria | 1651 |
| 724 | Ga0207428_10199808 | 3300027907 | Bacteria | 1504 |
| 725 | Ga0268266_10003578 | 3300028379 | Bacteria | 15404 |
| 726 | Ga0268266_10014526 | 3300028379 | Bacteria | 6769 |
| 727 | Ga0268266_10017452 | 3300028379 | Bacteria | 6121 |
| 728 | Ga0268266_10018819 | 3300028379 | Bacteria | 5885 |
| 729 | Ga0268266_10086443 | 3300028379 | Bacteria | 2742 |
| 730 | Ga0268266_10141465 | 3300028379 | Bacteria | 2159 |
| 731 | Ga0268266_10361952 | 3300028379 | Bacteria | 1365 |
| 732 | Ga0268265_10024064 | 3300028380 | Bacteria | 4303 |
| 733 | Ga0268265_10024477 | 3300028380 | Bacteria | 4272 |
| 734 | Ga0268265_10190097 | 3300028380 | Bacteria | 1772 |
| 735 | Ga0268265_10467838 | 3300028380 | Bacteria | 1181 |
| 736 | Ga0268264_10003660 | 3300028381 | Bacteria | 13217 |
| 737 | Ga0268264_10009693 | 3300028381 | Bacteria | 7977 |
| 738 | Ga0268264_10017111 | 3300028381 | Bacteria | 5936 |
| 739 | Ga0268264_10057016 | 3300028381 | Bacteria | 3266 |
| 740 | Ga0268264_10078712 | 3300028381 | Bacteria | 2811 |
| 741 | Ga0268264_10092446 | 3300028381 | Bacteria | 2612 |
| 742 | Ga0268264_10110620 | 3300028381 | Bacteria | 2406 |
| 743 | Ga0268264_10139271 | 3300028381 | Bacteria | 2161 |
| 744 | Ga0265330_10000546 | 3300031235 | Bacteria | 24652 |
| 745 | Ga0265332_10003000 | 3300031238 | Bacteria | 8280 |
| 746 | Ga0265339_10072728 | 3300031249 | Bacteria | 1829 |
| 747 | Ga0265331_10001620 | 3300031250 | Bacteria | 16437 |
| 748 | Ga0265327_10007592 | 3300031251 | Bacteria | 8325 |
| 749 | Ga0265316_10044839 | 3300031344 | Bacteria | 3514 |
| 750 | Ga0307408_100029133 | 3300031548 | Bacteria | 3821 |
| 751 | Ga0265314_10005632 | 3300031711 | Bacteria | 11251 |
| 752 | Ga0265342_10034247 | 3300031712 | Bacteria | 3117 |
| 753 | Ga0307405_10029979 | 3300031731 | Bacteria | 3185 |
| 754 | Ga0307410_10001615 | 3300031852 | Bacteria | 10350 |
| 755 | Ga0307410_10019419 | 3300031852 | Bacteria | 4134 |
| 756 | Ga0307406_10016654 | 3300031901 | Bacteria | 4277 |
| 757 | Ga0307407_10003364 | 3300031903 | Bacteria | 6544 |
| 758 | Ga0307412_10007245 | 3300031911 | Bacteria | 6288 |
| 759 | Ga0307409_100031116 | 3300031995 | Bacteria | 3846 |
| 760 | Ga0307409_100069496 | 3300031995 | Bacteria | 2791 |
| 761 | Ga0307416_100001805 | 3300032002 | Bacteria | 11892 |
| 762 | Ga0307416_100053428 | 3300032002 | Bacteria | 3241 |
| 763 | Ga0307416_101013295 | 3300032002 | Bacteria | 934 |
| 764 | Ga0307416_101786294 | 3300032002 | Bacteria | 719 |
| 765 | Ga0307414_10015815 | 3300032004 | Bacteria | 4568 |
| 766 | Ga0307411_10029859 | 3300032005 | Bacteria | 3335 |
| 767 | Ga0307411_10106600 | 3300032005 | Bacteria | 1995 |
| 768 | Ga0307411_10466678 | 3300032005 | Bacteria | 1060 |
| 769 | Ga0373934_0040718 | 3300035086 | Bacteria | 1833 |
| 770 | Ga0373944_0037954 | 3300035089 | Bacteria | 1478 |
| 771 | Ga0373953_0093506 | 3300035117 | Bacteria | 1259 |
| 772 | Ga0373954_0195839 | 3300035118 | Bacteria | 992 |
| 773 | Ga0373956_0009855 | 3300035119 | Bacteria | 3892 |
| 774 | Ga0373957_0006995 | 3300035120 | Bacteria | 3586 |
| 775 | Ga0373943_0032494 | 3300035170 | Bacteria | 2481 |
| 776 | Ga0373943_0174358 | 3300035170 | Bacteria | 1178 |
| 777 | Ga0373946_0060219 | 3300035171 | Bacteria | 1613 |
| 778 | Ga0373946_0136708 | 3300035171 | Bacteria | 1132 |
| 779 | Ga0373955_0013907 | 3300035172 | Bacteria | 3904 |
| 780 | Ga0373955_0081354 | 3300035172 | Bacteria | 1831 |
| 781 | Ga0373924_0098616 | 3300035410 | Bacteria | 1255 |
| 782 | Ga0373931_0126129 | 3300035691 | Bacteria | 1468 |
| 783 | Ga0373927_0034038 | 3300035695 | Bacteria | 3315 |
| 784 | Ga0373927_0085289 | 3300035695 | Bacteria | 2049 |
| 785 | Ga0373933_0005379 | 3300035724 | Bacteria | 6973 |
| 786 | Ga0373933_0149262 | 3300035724 | Bacteria | 1480 |
| 787 | Ga0373933_0247253 | 3300035724 | Bacteria | 1148 |
| 788 | Ga0373933_0631218 | 3300035724 | Bacteria | 704 |
| 789 | Ga0373947_0016015 | 3300035725 | Bacteria | 4308 |
| 790 | Ga0373947_0068067 | 3300035725 | Bacteria | 2177 |
| 791 | Ga0373947_0074117 | 3300035725 | Bacteria | 2093 |
| 792 | Ga0373947_0293063 | 3300035725 | Bacteria | 1084 |
| 793 | Ga0373947_0507943 | 3300035725 | Bacteria | 819 |
| 794 | Ga0373937_0002839 | 3300036401 | Bacteria | 14477 |
| 795 | Ga0373937_0010161 | 3300036401 | Bacteria | 8210 |
| 796 | Ga0373937_0137801 | 3300036401 | Bacteria | 2282 |
| 797 | Ga0373937_0228209 | 3300036401 | Bacteria | 1753 |
| 798 | Ga0373937_0518248 | 3300036401 | Bacteria | 1133 |
| 799 | Ga0373937_0531811 | 3300036401 | Bacteria | 1117 |
| 800 | Ga0373925_0027705 | 3300037068 | Bacteria | 4147 |
| 801 | Ga0373925_0363635 | 3300037068 | Bacteria | 1176 |
| 802 | Ga0373925_0764890 | 3300037068 | Bacteria | 796 |
| 803 | Ga0395898_0365052 | 3300037466 | Bacteria | 1377 |
| 804 | Ga0395905_0396226 | 3300037471 | Bacteria | 1275 |
| 805 | Ga0451802_1191024 | 3300041460 | Bacteria | 848 |
| 806 | Ga0451845_0059238 | 3300041501 | Bacteria | 792 |
| 807 | Ga0439448_0062518 | 3300042005 | Bacteria | 1232 |
| 808 | Ga0451577_0258166 | 3300042876 | Bacteria | 1578 |
| 809 | Ga0466957_0603850 | 3300044842 | Bacteria | 768 |
| 810 | Ga0495580_0026036 | 3300046472 | Bacteria | 4268 |
| 811 | Ga0495580_0115264 | 3300046472 | Bacteria | 1866 |
| 812 | Ga0495582_0032219 | 3300046473 | Bacteria | 2883 |
| 813 | Ga0495639_0142314 | 3300046475 | Bacteria | 1153 |
| 814 | Ga0495662_0246951 | 3300046476 | Bacteria | 879 |
| 815 | Ga0495664_0174276 | 3300046477 | Bacteria | 1305 |
| 816 | Ga0495628_0460430 | 3300046516 | Bacteria | 923 |
| 817 | Ga0495665_0149935 | 3300046531 | Bacteria | 1217 |
| 818 | Ga0495586_0118326 | 3300046535 | Bacteria | 1479 |
| 819 | Ga0495621_0004963 | 3300046539 | Bacteria | 3787 |
| 820 | Ga0495645_0020392 | 3300046543 | Bacteria | 4781 |
| 821 | Ga0495647_0013845 | 3300046681 | Bacteria | 2802 |
| 822 | Ga0495658_0009925 | 3300046683 | Bacteria | 4750 |
| 823 | Ga0495658_0365726 | 3300046683 | Bacteria | 917 |
| 824 | Ga0495581_0001804 | 3300047315 | Bacteria | 11968 |
| 825 | Ga0495684_0011314 | 3300047471 | Bacteria | 6888 |
| 826 | Ga0495602_0200549 | 3300048088 | Bacteria | 1523 |
| 827 | Ga0496100_0004262 | 3300048903 | Bacteria | 7564 |
| 828 | Ga0496101_0006151 | 3300048904 | Bacteria | 7707 |
| 829 | Ga0496102_0011726 | 3300048905 | Bacteria | 7565 |
| 830 | Ga0496102_0112457 | 3300048905 | Bacteria | 2540 |
| 831 | Ga0496103_0190656 | 3300048906 | Bacteria | 1318 |
| 832 | Ga0496104_0004333 | 3300048907 | Bacteria | 12345 |
| 833 | Ga0496104_0010541 | 3300048907 | Bacteria | 8254 |
| 834 | Ga0496105_0008136 | 3300048908 | Bacteria | 8155 |
| 835 | Ga0496106_0040063 | 3300048909 | Bacteria | 3507 |
| 836 | Ga0496106_0348158 | 3300048909 | Bacteria | 1190 |
| 837 | Ga0496106_1123322 | 3300048909 | Bacteria | 615 |
| 838 | Ga0496107_0027057 | 3300048910 | Bacteria | 4071 |
| 839 | Ga0496107_0138205 | 3300048910 | Bacteria | 1801 |
| 840 | Ga0496107_0278923 | 3300048910 | Bacteria | 1244 |
| 841 | Ga0496108_0134239 | 3300048911 | Bacteria | 2128 |
| 842 | Ga0496108_0621271 | 3300048911 | Bacteria | 941 |
| 843 | Ga0496108_0629278 | 3300048911 | Bacteria | 934 |
| 844 | Ga0496109_0002292 | 3300048912 | Bacteria | 15916 |
| 845 | Ga0496109_0176900 | 3300048912 | Bacteria | 2003 |
| 846 | Ga0496109_0429556 | 3300048912 | Bacteria | 1248 |
| 847 | Ga0496110_0001542 | 3300048913 | Bacteria | 16768 |
| 848 | Ga0496110_0095256 | 3300048913 | Bacteria | 2666 |
| 849 | Ga0496112_0003810 | 3300048915 | Bacteria | 12602 |
| 850 | Ga0496112_0201440 | 3300048915 | Bacteria | 1950 |
| 851 | Ga0496114_0157771 | 3300048917 | Bacteria | 1971 |
| 852 | Ga0496114_0522999 | 3300048917 | Bacteria | 1049 |
| 853 | Ga0496115_0161289 | 3300048918 | Bacteria | 1853 |
| 854 | Ga0496115_0909124 | 3300048918 | Bacteria | 678 |
| 855 | Ga0501031_0065118 | 3300049568 | Bacteria | 2374 |
| 856 | Ga0501032_0003756 | 3300049569 | Bacteria | 11518 |
| 857 | Ga0501033_0001343 | 3300049570 | Bacteria | 21882 |
| 858 | Ga0501034_0039070 | 3300049571 | Bacteria | 4807 |
| 859 | Ga0501036_0003237 | 3300049572 | Bacteria | 12983 |
| 860 | Ga0501036_0044422 | 3300049572 | Bacteria | 3763 |
| 861 | Ga0501037_0129590 | 3300049573 | Bacteria | 1809 |
| 862 | Ga0501038_0045132 | 3300049574 | Bacteria | 3826 |
| 863 | Ga0501038_0427386 | 3300049574 | Bacteria | 1021 |
| 864 | Ga0501039_0001150 | 3300049575 | Bacteria | 19517 |
| 865 | Ga0501043_0016804 | 3300049579 | Bacteria | 5734 |
| 866 | Ga0501046_0007421 | 3300049580 | Bacteria | 9637 |
| 867 | Ga0501046_0010791 | 3300049580 | Bacteria | 7833 |
| 868 | Ga0501069_0459588 | 3300049585 | Bacteria | 757 |
| 869 | Ga0501035_0000158 | 3300049822 | Bacteria | 82890 |
| 870 | Ga0501044_0041405 | 3300049823 | Bacteria | 4795 |
| 871 | nmdc:mga0k408_324036_c1 | 3300050493 | Bacteria | 919 |
| 872 | nmdc:mga05p37_1110231_c1 | 3300050507 | Bacteria | 827 |
| 873 | nmdc:mga09592_36973_c1 | 3300050508 | Bacteria | 4092 |
| 874 | nmdc:mga08y16_1006394_c1 | 3300050511 | Bacteria | 813 |
| 875 | nmdc:mga08y16_51608_c1 | 3300050511 | Bacteria | 4303 |
| 876 | nmdc:mga0n895_431500_c1 | 3300050512 | Bacteria | 1331 |
| 877 | nmdc:mga0n895_45001_c1 | 3300050512 | Bacteria | 4305 |
| 878 | nmdc:mga0n895_71750_c1 | 3300050512 | Bacteria | 3434 |
| 879 | nmdc:mga0rr50_117377_c1 | 3300050513 | Bacteria | 2113 |
| 880 | nmdc:mga0rr50_45287_c1 | 3300050513 | Bacteria | 3232 |
| 881 | nmdc:mga08x19_106069_c1 | 3300050514 | Bacteria | 1869 |
| 882 | nmdc:mga08x19_392199_c1 | 3300050514 | Bacteria | 973 |
| 883 | nmdc:mga0a205_123229_c1 | 3300050515 | Bacteria | 2492 |
| 884 | nmdc:mga0a205_540523_c1 | 3300050515 | Bacteria | 1021 |
| 885 | Ga0495612_0021443 | 3300053078 | Bacteria | 2592 |
| 886 | Ga0495612_0451942 | 3300053078 | Bacteria | 587 |
| 887 | Ga0495595_0074127 | 3300053084 | Bacteria | 1613 |
| 888 | Ga0495619_0132791 | 3300053085 | Bacteria | 1711 |
| 889 | Ga0495619_0291805 | 3300053085 | Bacteria | 1130 |
| 890 | Ga0501082_0495701 | 3300060353 | Bacteria | 1068 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_10343746 | Ga0157378_103437461 | 176 |
| 2 | 3300026116 | Ga0207674_10066888 | Ga0207674_100668886 | 176 |
| 3 | 3300005347 | Ga0070668_100304243 | Ga0070668_1003042432 | 177 |
| 4 | 3300005719 | Ga0068861_100029852 | Ga0068861_1000298523 | 177 |
| 5 | 3300013306 | Ga0163162_10431019 | Ga0163162_104310192 | 177 |
| 6 | 3300026118 | Ga0207675_100021323 | Ga0207675_1000213233 | 177 |
| 7 | 3300005336 | Ga0070680_100120481 | Ga0070680_1001204812 | 178 |
| 8 | 3300005339 | Ga0070660_100093703 | Ga0070660_1000937032 | 178 |
| 9 | 3300005344 | Ga0070661_100850556 | Ga0070661_1008505562 | 178 |
| 10 | 3300005355 | Ga0070671_100464801 | Ga0070671_1004648012 | 178 |
| 11 | 3300005434 | Ga0070709_10085217 | Ga0070709_100852173 | 178 |
| 12 | 3300005435 | Ga0070714_100179862 | Ga0070714_1001798623 | 178 |
| 13 | 3300005530 | Ga0070679_100053614 | Ga0070679_1000536142 | 178 |
| 14 | 3300005547 | Ga0070693_100428143 | Ga0070693_1004281432 | 178 |
| 15 | 3300005563 | Ga0068855_100062766 | Ga0068855_1000627662 | 178 |
| 16 | 3300005564 | Ga0070664_100113311 | Ga0070664_1001133113 | 178 |
| 17 | 3300005578 | Ga0068854_100353165 | Ga0068854_1003531652 | 178 |
| 18 | 3300005614 | Ga0068856_100002173 | Ga0068856_10000217310 | 178 |
| 19 | 3300005841 | Ga0068863_100693825 | Ga0068863_1006938252 | 178 |
| 20 | 3300009093 | Ga0105240_10482605 | Ga0105240_104826052 | 178 |
| 21 | 3300009174 | Ga0105241_10534313 | Ga0105241_105343132 | 178 |
| 22 | 3300013104 | Ga0157370_10240945 | Ga0157370_102409452 | 178 |
| 23 | 3300013105 | Ga0157369_10049776 | Ga0157369_100497762 | 178 |
| 24 | 3300013307 | Ga0157372_10046075 | Ga0157372_100460752 | 178 |
| 25 | 3300025906 | Ga0207699_10059254 | Ga0207699_100592542 | 178 |
| 26 | 3300025913 | Ga0207695_10184913 | Ga0207695_101849133 | 178 |
| 27 | 3300025917 | Ga0207660_10055842 | Ga0207660_100558422 | 178 |
| 28 | 3300025921 | Ga0207652_10023819 | Ga0207652_100238195 | 178 |
| 29 | 3300025929 | Ga0207664_10040208 | Ga0207664_100402084 | 178 |
| 30 | 3300025931 | Ga0207644_10313396 | Ga0207644_103133962 | 178 |
| 31 | 3300025945 | Ga0207679_10248824 | Ga0207679_102488241 | 178 |
| 32 | 3300025949 | Ga0207667_10091512 | Ga0207667_100915124 | 178 |
| 33 | 3300025981 | Ga0207640_10817150 | Ga0207640_108171502 | 178 |
| 34 | 3300005329 | Ga0070683_100097679 | Ga0070683_1000976791 | 179 |
| 35 | 3300005366 | Ga0070659_100023473 | Ga0070659_1000234733 | 179 |
| 36 | 3300005367 | Ga0070667_100345015 | Ga0070667_1003450152 | 179 |
| 37 | 3300005440 | Ga0070705_100056195 | Ga0070705_1000561953 | 179 |
| 38 | 3300005467 | Ga0070706_100183581 | Ga0070706_1001835813 | 179 |
| 39 | 3300005518 | Ga0070699_100354796 | Ga0070699_1003547962 | 179 |
| 40 | 3300005536 | Ga0070697_100026299 | Ga0070697_1000262994 | 179 |
| 41 | 3300005546 | Ga0070696_100117190 | Ga0070696_1001171903 | 179 |
| 42 | 3300005547 | Ga0070693_101050469 | Ga0070693_1010504691 | 179 |
| 43 | 3300005564 | Ga0070664_100021792 | Ga0070664_1000217925 | 179 |
| 44 | 3300005616 | Ga0068852_100016008 | Ga0068852_1000160085 | 179 |
| 45 | 3300005616 | Ga0068852_100055896 | Ga0068852_1000558962 | 179 |
| 46 | 3300005618 | Ga0068864_100216211 | Ga0068864_1002162113 | 179 |
| 47 | 3300005719 | Ga0068861_100056920 | Ga0068861_1000569203 | 179 |
| 48 | 3300005834 | Ga0068851_10018417 | Ga0068851_100184173 | 179 |
| 49 | 3300007076 | Ga0075435_100748968 | Ga0075435_1007489682 | 179 |
| 50 | 3300009147 | Ga0114129_10097191 | Ga0114129_100971911 | 179 |
| 51 | 3300009147 | Ga0114129_10328673 | Ga0114129_103286732 | 179 |
| 52 | 3300013296 | Ga0157374_10045485 | Ga0157374_100454853 | 179 |
| 53 | 3300013307 | Ga0157372_10194528 | Ga0157372_101945282 | 179 |
| 54 | 3300025910 | Ga0207684_10887322 | Ga0207684_108873222 | 179 |
| 55 | 3300026142 | Ga0207698_10035981 | Ga0207698_100359815 | 179 |
| 56 | 3300031995 | Ga0307409_100069496 | Ga0307409_1000694963 | 179 |
| 57 | 3300032002 | Ga0307416_101013295 | Ga0307416_1010132952 | 179 |
| 58 | 3300032002 | Ga0307416_101786294 | Ga0307416_1017862941 | 179 |
| 59 | 3300032005 | Ga0307411_10106600 | Ga0307411_101066002 | 179 |
| 60 | 3300036401 | Ga0373937_0518248 | Ga0373937_0518248_91_648 | 179 |
| 61 | 3300050507 | nmdc:mga05p37_1110231_c1 | nmdc:mga05p37_1110231_c1_116_664 | 179 |
| 62 | 3300001976 | JGI24752J21851_1008514 | JGI24752J21851_10085142 | 180 |
| 63 | 3300001991 | JGI24743J22301_10001507 | JGI24743J22301_100015072 | 180 |
| 64 | 3300002070 | JGI24750J21931_1047374 | JGI24750J21931_10473741 | 180 |
| 65 | 3300002076 | JGI24749J21850_1003442 | JGI24749J21850_10034422 | 180 |
| 66 | 3300002126 | JGI24035J26624_1019386 | JGI24035J26624_10193861 | 180 |
| 67 | 3300002239 | JGI24034J26672_10002151 | JGI24034J26672_100021513 | 180 |
| 68 | 3300002459 | JGI24751J29686_10013755 | JGI24751J29686_100137552 | 180 |
| 69 | 3300005290 | Ga0065712_10209245 | Ga0065712_102092452 | 180 |
| 70 | 3300005293 | Ga0065715_10034978 | Ga0065715_100349782 | 180 |
| 71 | 3300005293 | Ga0065715_10287265 | Ga0065715_102872651 | 180 |
| 72 | 3300005327 | Ga0070658_10007975 | Ga0070658_100079755 | 180 |
| 73 | 3300005327 | Ga0070658_10678966 | Ga0070658_106789661 | 180 |
| 74 | 3300005328 | Ga0070676_10000214 | Ga0070676_1000021428 | 180 |
| 75 | 3300005328 | Ga0070676_10000744 | Ga0070676_100007443 | 180 |
| 76 | 3300005328 | Ga0070676_10021975 | Ga0070676_100219753 | 180 |
| 77 | 3300005328 | Ga0070676_10045208 | Ga0070676_100452084 | 180 |
| 78 | 3300005328 | Ga0070676_10138379 | Ga0070676_101383792 | 180 |
| 79 | 3300005328 | Ga0070676_10170916 | Ga0070676_101709162 | 180 |
| 80 | 3300005328 | Ga0070676_10184095 | Ga0070676_101840952 | 180 |
| 81 | 3300005328 | Ga0070676_10395994 | Ga0070676_103959942 | 180 |
| 82 | 3300005329 | Ga0070683_100013846 | Ga0070683_10001384610 | 180 |
| 83 | 3300005329 | Ga0070683_100052990 | Ga0070683_1000529905 | 180 |
| 84 | 3300005330 | Ga0070690_100006539 | Ga0070690_1000065398 | 180 |
| 85 | 3300005330 | Ga0070690_100031081 | Ga0070690_1000310813 | 180 |
| 86 | 3300005330 | Ga0070690_100040227 | Ga0070690_1000402274 | 180 |
| 87 | 3300005331 | Ga0070670_100001469 | Ga0070670_10000146916 | 180 |
| 88 | 3300005331 | Ga0070670_100005022 | Ga0070670_1000050228 | 180 |
| 89 | 3300005331 | Ga0070670_100148860 | Ga0070670_1001488601 | 180 |
| 90 | 3300005331 | Ga0070670_100203236 | Ga0070670_1002032362 | 180 |
| 91 | 3300005331 | Ga0070670_100403816 | Ga0070670_1004038162 | 180 |
| 92 | 3300005331 | Ga0070670_100438276 | Ga0070670_1004382762 | 180 |
| 93 | 3300005333 | Ga0070677_10010206 | Ga0070677_100102061 | 180 |
| 94 | 3300005333 | Ga0070677_10023366 | Ga0070677_100233662 | 180 |
| 95 | 3300005334 | Ga0068869_100005557 | Ga0068869_1000055579 | 180 |
| 96 | 3300005334 | Ga0068869_100053049 | Ga0068869_1000530493 | 180 |
| 97 | 3300005334 | Ga0068869_100190880 | Ga0068869_1001908803 | 180 |
| 98 | 3300005334 | Ga0068869_100201317 | Ga0068869_1002013172 | 180 |
| 99 | 3300005334 | Ga0068869_100297666 | Ga0068869_1002976661 | 180 |
| 100 | 3300005334 | Ga0068869_100347343 | Ga0068869_1003473432 | 180 |
| 101 | 3300005335 | Ga0070666_10005903 | Ga0070666_100059034 | 180 |
| 102 | 3300005335 | Ga0070666_10014709 | Ga0070666_100147097 | 180 |
| 103 | 3300005335 | Ga0070666_10019443 | Ga0070666_100194432 | 180 |
| 104 | 3300005335 | Ga0070666_10024618 | Ga0070666_100246186 | 180 |
| 105 | 3300005335 | Ga0070666_10337158 | Ga0070666_103371582 | 180 |
| 106 | 3300005336 | Ga0070680_100571407 | Ga0070680_1005714072 | 180 |
| 107 | 3300005337 | Ga0070682_100023737 | Ga0070682_1000237373 | 180 |
| 108 | 3300005337 | Ga0070682_100693550 | Ga0070682_1006935501 | 180 |
| 109 | 3300005338 | Ga0068868_100004061 | Ga0068868_1000040618 | 180 |
| 110 | 3300005338 | Ga0068868_100017518 | Ga0068868_1000175182 | 180 |
| 111 | 3300005338 | Ga0068868_100022796 | Ga0068868_1000227962 | 180 |
| 112 | 3300005338 | Ga0068868_100052991 | Ga0068868_1000529912 | 180 |
| 113 | 3300005338 | Ga0068868_100106086 | Ga0068868_1001060863 | 180 |
| 114 | 3300005339 | Ga0070660_100065988 | Ga0070660_1000659882 | 180 |
| 115 | 3300005339 | Ga0070660_100076968 | Ga0070660_1000769683 | 180 |
| 116 | 3300005340 | Ga0070689_100000324 | Ga0070689_10000032421 | 180 |
| 117 | 3300005340 | Ga0070689_100000650 | Ga0070689_10000065012 | 180 |
| 118 | 3300005340 | Ga0070689_100032106 | Ga0070689_1000321063 | 180 |
| 119 | 3300005343 | Ga0070687_100010907 | Ga0070687_1000109075 | 180 |
| 120 | 3300005343 | Ga0070687_100016406 | Ga0070687_1000164062 | 180 |
| 121 | 3300005344 | Ga0070661_100008349 | Ga0070661_10000834910 | 180 |
| 122 | 3300005344 | Ga0070661_100157376 | Ga0070661_1001573762 | 180 |
| 123 | 3300005344 | Ga0070661_100393450 | Ga0070661_1003934502 | 180 |
| 124 | 3300005345 | Ga0070692_10046636 | Ga0070692_100466362 | 180 |
| 125 | 3300005345 | Ga0070692_10296993 | Ga0070692_102969932 | 180 |
| 126 | 3300005347 | Ga0070668_100003856 | Ga0070668_10000385610 | 180 |
| 127 | 3300005347 | Ga0070668_100004563 | Ga0070668_1000045638 | 180 |
| 128 | 3300005347 | Ga0070668_100006505 | Ga0070668_1000065059 | 180 |
| 129 | 3300005347 | Ga0070668_100018741 | Ga0070668_1000187416 | 180 |
| 130 | 3300005347 | Ga0070668_100025622 | Ga0070668_1000256222 | 180 |
| 131 | 3300005347 | Ga0070668_100032342 | Ga0070668_1000323426 | 180 |
| 132 | 3300005347 | Ga0070668_100043430 | Ga0070668_1000434302 | 180 |
| 133 | 3300005347 | Ga0070668_100107246 | Ga0070668_1001072462 | 180 |
| 134 | 3300005347 | Ga0070668_101070825 | Ga0070668_1010708251 | 180 |
| 135 | 3300005353 | Ga0070669_100008372 | Ga0070669_1000083723 | 180 |
| 136 | 3300005353 | Ga0070669_100010664 | Ga0070669_1000106642 | 180 |
| 137 | 3300005353 | Ga0070669_100026932 | Ga0070669_1000269322 | 180 |
| 138 | 3300005353 | Ga0070669_100275635 | Ga0070669_1002756351 | 180 |
| 139 | 3300005353 | Ga0070669_100287492 | Ga0070669_1002874921 | 180 |
| 140 | 3300005353 | Ga0070669_100290198 | Ga0070669_1002901981 | 180 |
| 141 | 3300005354 | Ga0070675_100000802 | Ga0070675_1000008028 | 180 |
| 142 | 3300005354 | Ga0070675_100007226 | Ga0070675_1000072263 | 180 |
| 143 | 3300005354 | Ga0070675_100009565 | Ga0070675_1000095655 | 180 |
| 144 | 3300005354 | Ga0070675_100015454 | Ga0070675_1000154547 | 180 |
| 145 | 3300005354 | Ga0070675_100016229 | Ga0070675_1000162296 | 180 |
| 146 | 3300005354 | Ga0070675_100018750 | Ga0070675_1000187503 | 180 |
| 147 | 3300005354 | Ga0070675_100125784 | Ga0070675_1001257843 | 180 |
| 148 | 3300005355 | Ga0070671_100001313 | Ga0070671_1000013132 | 180 |
| 149 | 3300005355 | Ga0070671_100029996 | Ga0070671_1000299962 | 180 |
| 150 | 3300005355 | Ga0070671_100063870 | Ga0070671_1000638704 | 180 |
| 151 | 3300005355 | Ga0070671_100249511 | Ga0070671_1002495112 | 180 |
| 152 | 3300005355 | Ga0070671_100321566 | Ga0070671_1003215662 | 180 |
| 153 | 3300005355 | Ga0070671_100544628 | Ga0070671_1005446282 | 180 |
| 154 | 3300005355 | Ga0070671_100774652 | Ga0070671_1007746522 | 180 |
| 155 | 3300005356 | Ga0070674_100000512 | Ga0070674_10000051221 | 180 |
| 156 | 3300005356 | Ga0070674_100004443 | Ga0070674_1000044436 | 180 |
| 157 | 3300005356 | Ga0070674_100004897 | Ga0070674_1000048975 | 180 |
| 158 | 3300005356 | Ga0070674_100009097 | Ga0070674_1000090974 | 180 |
| 159 | 3300005356 | Ga0070674_100067560 | Ga0070674_1000675602 | 180 |
| 160 | 3300005356 | Ga0070674_100338322 | Ga0070674_1003383222 | 180 |
| 161 | 3300005356 | Ga0070674_100512913 | Ga0070674_1005129131 | 180 |
| 162 | 3300005364 | Ga0070673_100000898 | Ga0070673_10000089811 | 180 |
| 163 | 3300005364 | Ga0070673_100006767 | Ga0070673_1000067673 | 180 |
| 164 | 3300005364 | Ga0070673_100025616 | Ga0070673_1000256165 | 180 |
| 165 | 3300005364 | Ga0070673_100213933 | Ga0070673_1002139332 | 180 |
| 166 | 3300005364 | Ga0070673_100218979 | Ga0070673_1002189792 | 180 |
| 167 | 3300005364 | Ga0070673_101302022 | Ga0070673_1013020221 | 180 |
| 168 | 3300005365 | Ga0070688_100003909 | Ga0070688_1000039098 | 180 |
| 169 | 3300005365 | Ga0070688_100011922 | Ga0070688_1000119226 | 180 |
| 170 | 3300005365 | Ga0070688_100057349 | Ga0070688_1000573492 | 180 |
| 171 | 3300005365 | Ga0070688_100078175 | Ga0070688_1000781753 | 180 |
| 172 | 3300005366 | Ga0070659_100066353 | Ga0070659_1000663532 | 180 |
| 173 | 3300005366 | Ga0070659_100195528 | Ga0070659_1001955282 | 180 |
| 174 | 3300005367 | Ga0070667_100006506 | Ga0070667_1000065068 | 180 |
| 175 | 3300005367 | Ga0070667_100018863 | Ga0070667_1000188638 | 180 |
| 176 | 3300005367 | Ga0070667_100038861 | Ga0070667_1000388616 | 180 |
| 177 | 3300005367 | Ga0070667_100048102 | Ga0070667_1000481025 | 180 |
| 178 | 3300005367 | Ga0070667_100058862 | Ga0070667_1000588624 | 180 |
| 179 | 3300005367 | Ga0070667_100101889 | Ga0070667_1001018894 | 180 |
| 180 | 3300005367 | Ga0070667_100229378 | Ga0070667_1002293782 | 180 |
| 181 | 3300005434 | Ga0070709_10127755 | Ga0070709_101277552 | 180 |
| 182 | 3300005434 | Ga0070709_10474162 | Ga0070709_104741622 | 180 |
| 183 | 3300005435 | Ga0070714_100003295 | Ga0070714_1000032952 | 180 |
| 184 | 3300005435 | Ga0070714_100012558 | Ga0070714_1000125588 | 180 |
| 185 | 3300005435 | Ga0070714_100234866 | Ga0070714_1002348662 | 180 |
| 186 | 3300005436 | Ga0070713_100007196 | Ga0070713_1000071967 | 180 |
| 187 | 3300005436 | Ga0070713_100016403 | Ga0070713_1000164037 | 180 |
| 188 | 3300005436 | Ga0070713_100230985 | Ga0070713_1002309852 | 180 |
| 189 | 3300005437 | Ga0070710_10009218 | Ga0070710_100092182 | 180 |
| 190 | 3300005437 | Ga0070710_10011674 | Ga0070710_100116742 | 180 |
| 191 | 3300005437 | Ga0070710_10036771 | Ga0070710_100367713 | 180 |
| 192 | 3300005438 | Ga0070701_10290377 | Ga0070701_102903772 | 180 |
| 193 | 3300005439 | Ga0070711_100009868 | Ga0070711_1000098687 | 180 |
| 194 | 3300005439 | Ga0070711_100070966 | Ga0070711_1000709662 | 180 |
| 195 | 3300005441 | Ga0070700_100009084 | Ga0070700_1000090845 | 180 |
| 196 | 3300005444 | Ga0070694_100119413 | Ga0070694_1001194132 | 180 |
| 197 | 3300005445 | Ga0070708_100024762 | Ga0070708_1000247626 | 180 |
| 198 | 3300005445 | Ga0070708_100103506 | Ga0070708_1001035063 | 180 |
| 199 | 3300005445 | Ga0070708_100112294 | Ga0070708_1001122942 | 180 |
| 200 | 3300005455 | Ga0070663_100042112 | Ga0070663_1000421123 | 180 |
| 201 | 3300005455 | Ga0070663_100316960 | Ga0070663_1003169602 | 180 |
| 202 | 3300005455 | Ga0070663_100369358 | Ga0070663_1003693582 | 180 |
| 203 | 3300005456 | Ga0070678_100000282 | Ga0070678_10000028210 | 180 |
| 204 | 3300005456 | Ga0070678_100001298 | Ga0070678_1000012987 | 180 |
| 205 | 3300005456 | Ga0070678_100001846 | Ga0070678_1000018465 | 180 |
| 206 | 3300005457 | Ga0070662_100005937 | Ga0070662_1000059379 | 180 |
| 207 | 3300005457 | Ga0070662_100257470 | Ga0070662_1002574702 | 180 |
| 208 | 3300005457 | Ga0070662_100686867 | Ga0070662_1006868671 | 180 |
| 209 | 3300005459 | Ga0068867_100004441 | Ga0068867_10000444111 | 180 |
| 210 | 3300005459 | Ga0068867_100005854 | Ga0068867_10000585410 | 180 |
| 211 | 3300005459 | Ga0068867_100025973 | Ga0068867_1000259734 | 180 |
| 212 | 3300005459 | Ga0068867_100129999 | Ga0068867_1001299993 | 180 |
| 213 | 3300005459 | Ga0068867_100130059 | Ga0068867_1001300592 | 180 |
| 214 | 3300005466 | Ga0070685_10000522 | Ga0070685_100005221 | 180 |
| 215 | 3300005466 | Ga0070685_10012020 | Ga0070685_100120201 | 180 |
| 216 | 3300005467 | Ga0070706_100252372 | Ga0070706_1002523723 | 180 |
| 217 | 3300005468 | Ga0070707_100039853 | Ga0070707_1000398536 | 180 |
| 218 | 3300005468 | Ga0070707_100149935 | Ga0070707_1001499352 | 180 |
| 219 | 3300005468 | Ga0070707_100401546 | Ga0070707_1004015462 | 180 |
| 220 | 3300005471 | Ga0070698_100016152 | Ga0070698_1000161523 | 180 |
| 221 | 3300005518 | Ga0070699_100071083 | Ga0070699_1000710833 | 180 |
| 222 | 3300005518 | Ga0070699_100753511 | Ga0070699_1007535111 | 180 |
| 223 | 3300005530 | Ga0070679_100441316 | Ga0070679_1004413162 | 180 |
| 224 | 3300005530 | Ga0070679_101096423 | Ga0070679_1010964231 | 180 |
| 225 | 3300005535 | Ga0070684_100025324 | Ga0070684_1000253242 | 180 |
| 226 | 3300005535 | Ga0070684_100097224 | Ga0070684_1000972244 | 180 |
| 227 | 3300005535 | Ga0070684_100247198 | Ga0070684_1002471982 | 180 |
| 228 | 3300005536 | Ga0070697_100048014 | Ga0070697_1000480143 | 180 |
| 229 | 3300005536 | Ga0070697_100140130 | Ga0070697_1001401303 | 180 |
| 230 | 3300005539 | Ga0068853_100011343 | Ga0068853_1000113438 | 180 |
| 231 | 3300005539 | Ga0068853_100339975 | Ga0068853_1003399752 | 180 |
| 232 | 3300005539 | Ga0068853_100343594 | Ga0068853_1003435943 | 180 |
| 233 | 3300005539 | Ga0068853_100631304 | Ga0068853_1006313042 | 180 |
| 234 | 3300005539 | Ga0068853_101228963 | Ga0068853_1012289631 | 180 |
| 235 | 3300005543 | Ga0070672_100001800 | Ga0070672_10000180011 | 180 |
| 236 | 3300005543 | Ga0070672_100007333 | Ga0070672_1000073336 | 180 |
| 237 | 3300005543 | Ga0070672_100007488 | Ga0070672_1000074888 | 180 |
| 238 | 3300005543 | Ga0070672_100029001 | Ga0070672_1000290013 | 180 |
| 239 | 3300005543 | Ga0070672_100042454 | Ga0070672_1000424543 | 180 |
| 240 | 3300005543 | Ga0070672_100067015 | Ga0070672_1000670152 | 180 |
| 241 | 3300005543 | Ga0070672_100276883 | Ga0070672_1002768832 | 180 |
| 242 | 3300005543 | Ga0070672_100665361 | Ga0070672_1006653612 | 180 |
| 243 | 3300005544 | Ga0070686_100018280 | Ga0070686_1000182804 | 180 |
| 244 | 3300005544 | Ga0070686_100029097 | Ga0070686_1000290973 | 180 |
| 245 | 3300005545 | Ga0070695_100499207 | Ga0070695_1004992071 | 180 |
| 246 | 3300005546 | Ga0070696_100033653 | Ga0070696_1000336534 | 180 |
| 247 | 3300005546 | Ga0070696_100128568 | Ga0070696_1001285683 | 180 |
| 248 | 3300005547 | Ga0070693_100019866 | Ga0070693_1000198664 | 180 |
| 249 | 3300005548 | Ga0070665_100000755 | Ga0070665_10000075519 | 180 |
| 250 | 3300005548 | Ga0070665_100007656 | Ga0070665_10000765610 | 180 |
| 251 | 3300005548 | Ga0070665_100009807 | Ga0070665_10000980710 | 180 |
| 252 | 3300005548 | Ga0070665_100012260 | Ga0070665_1000122607 | 180 |
| 253 | 3300005548 | Ga0070665_100059749 | Ga0070665_1000597492 | 180 |
| 254 | 3300005548 | Ga0070665_100137403 | Ga0070665_1001374033 | 180 |
| 255 | 3300005548 | Ga0070665_100310380 | Ga0070665_1003103802 | 180 |
| 256 | 3300005548 | Ga0070665_100349784 | Ga0070665_1003497841 | 180 |
| 257 | 3300005549 | Ga0070704_100022083 | Ga0070704_1000220832 | 180 |
| 258 | 3300005549 | Ga0070704_100091877 | Ga0070704_1000918772 | 180 |
| 259 | 3300005563 | Ga0068855_100022600 | Ga0068855_10002260010 | 180 |
| 260 | 3300005563 | Ga0068855_100063552 | Ga0068855_1000635522 | 180 |
| 261 | 3300005563 | Ga0068855_100220290 | Ga0068855_1002202902 | 180 |
| 262 | 3300005563 | Ga0068855_101254028 | Ga0068855_1012540281 | 180 |
| 263 | 3300005564 | Ga0070664_100023145 | Ga0070664_1000231452 | 180 |
| 264 | 3300005564 | Ga0070664_100098547 | Ga0070664_1000985472 | 180 |
| 265 | 3300005564 | Ga0070664_100099412 | Ga0070664_1000994124 | 180 |
| 266 | 3300005564 | Ga0070664_100245891 | Ga0070664_1002458912 | 180 |
| 267 | 3300005564 | Ga0070664_100691049 | Ga0070664_1006910492 | 180 |
| 268 | 3300005577 | Ga0068857_100027579 | Ga0068857_1000275794 | 180 |
| 269 | 3300005577 | Ga0068857_100047088 | Ga0068857_1000470884 | 180 |
| 270 | 3300005578 | Ga0068854_100003556 | Ga0068854_10000355612 | 180 |
| 271 | 3300005578 | Ga0068854_100225093 | Ga0068854_1002250931 | 180 |
| 272 | 3300005578 | Ga0068854_100296237 | Ga0068854_1002962372 | 180 |
| 273 | 3300005614 | Ga0068856_100178286 | Ga0068856_1001782862 | 180 |
| 274 | 3300005614 | Ga0068856_100300789 | Ga0068856_1003007893 | 180 |
| 275 | 3300005614 | Ga0068856_100516198 | Ga0068856_1005161982 | 180 |
| 276 | 3300005615 | Ga0070702_100002946 | Ga0070702_10000294610 | 180 |
| 277 | 3300005615 | Ga0070702_100006577 | Ga0070702_1000065775 | 180 |
| 278 | 3300005616 | Ga0068852_100007283 | Ga0068852_1000072838 | 180 |
| 279 | 3300005616 | Ga0068852_100098686 | Ga0068852_1000986863 | 180 |
| 280 | 3300005616 | Ga0068852_100352976 | Ga0068852_1003529762 | 180 |
| 281 | 3300005616 | Ga0068852_100465588 | Ga0068852_1004655882 | 180 |
| 282 | 3300005616 | Ga0068852_100493197 | Ga0068852_1004931972 | 180 |
| 283 | 3300005617 | Ga0068859_100014387 | Ga0068859_1000143877 | 180 |
| 284 | 3300005617 | Ga0068859_100014902 | Ga0068859_1000149025 | 180 |
| 285 | 3300005617 | Ga0068859_100069675 | Ga0068859_1000696752 | 180 |
| 286 | 3300005618 | Ga0068864_100001000 | Ga0068864_1000010006 | 180 |
| 287 | 3300005618 | Ga0068864_100002501 | Ga0068864_10000250113 | 180 |
| 288 | 3300005618 | Ga0068864_100003431 | Ga0068864_10000343110 | 180 |
| 289 | 3300005618 | Ga0068864_100003931 | Ga0068864_10000393110 | 180 |
| 290 | 3300005618 | Ga0068864_100004467 | Ga0068864_1000044674 | 180 |
| 291 | 3300005618 | Ga0068864_100008156 | Ga0068864_1000081565 | 180 |
| 292 | 3300005618 | Ga0068864_100136358 | Ga0068864_1001363582 | 180 |
| 293 | 3300005618 | Ga0068864_100141381 | Ga0068864_1001413813 | 180 |
| 294 | 3300005618 | Ga0068864_100889976 | Ga0068864_1008899761 | 180 |
| 295 | 3300005718 | Ga0068866_10031772 | Ga0068866_100317723 | 180 |
| 296 | 3300005718 | Ga0068866_10046376 | Ga0068866_100463763 | 180 |
| 297 | 3300005719 | Ga0068861_100009969 | Ga0068861_1000099695 | 180 |
| 298 | 3300005719 | Ga0068861_100017014 | Ga0068861_1000170148 | 180 |
| 299 | 3300005719 | Ga0068861_100041017 | Ga0068861_1000410175 | 180 |
| 300 | 3300005719 | Ga0068861_100189356 | Ga0068861_1001893562 | 180 |
| 301 | 3300005719 | Ga0068861_100304880 | Ga0068861_1003048802 | 180 |
| 302 | 3300005719 | Ga0068861_100334229 | Ga0068861_1003342292 | 180 |
| 303 | 3300005719 | Ga0068861_100612572 | Ga0068861_1006125722 | 180 |
| 304 | 3300005834 | Ga0068851_10000760 | Ga0068851_100007607 | 180 |
| 305 | 3300005834 | Ga0068851_10002900 | Ga0068851_100029003 | 180 |
| 306 | 3300005834 | Ga0068851_10029588 | Ga0068851_100295883 | 180 |
| 307 | 3300005840 | Ga0068870_10010351 | Ga0068870_100103517 | 180 |
| 308 | 3300005840 | Ga0068870_10034223 | Ga0068870_100342232 | 180 |
| 309 | 3300005840 | Ga0068870_10123666 | Ga0068870_101236662 | 180 |
| 310 | 3300005840 | Ga0068870_10329207 | Ga0068870_103292072 | 180 |
| 311 | 3300005841 | Ga0068863_100002509 | Ga0068863_1000025092 | 180 |
| 312 | 3300005841 | Ga0068863_100004438 | Ga0068863_1000044385 | 180 |
| 313 | 3300005841 | Ga0068863_100007482 | Ga0068863_1000074823 | 180 |
| 314 | 3300005841 | Ga0068863_100014344 | Ga0068863_1000143449 | 180 |
| 315 | 3300005841 | Ga0068863_100019177 | Ga0068863_1000191776 | 180 |
| 316 | 3300005841 | Ga0068863_100024468 | Ga0068863_1000244681 | 180 |
| 317 | 3300005841 | Ga0068863_100056261 | Ga0068863_1000562614 | 180 |
| 318 | 3300005841 | Ga0068863_100520796 | Ga0068863_1005207962 | 180 |
| 319 | 3300005842 | Ga0068858_100001616 | Ga0068858_10000161620 | 180 |
| 320 | 3300005842 | Ga0068858_100003832 | Ga0068858_10000383218 | 180 |
| 321 | 3300005842 | Ga0068858_100013427 | Ga0068858_1000134272 | 180 |
| 322 | 3300005842 | Ga0068858_100040010 | Ga0068858_1000400101 | 180 |
| 323 | 3300005842 | Ga0068858_100356369 | Ga0068858_1003563691 | 180 |
| 324 | 3300005843 | Ga0068860_100012240 | Ga0068860_1000122409 | 180 |
| 325 | 3300005843 | Ga0068860_100022453 | Ga0068860_1000224534 | 180 |
| 326 | 3300005843 | Ga0068860_100045549 | Ga0068860_1000455495 | 180 |
| 327 | 3300005843 | Ga0068860_100070846 | Ga0068860_1000708464 | 180 |
| 328 | 3300005843 | Ga0068860_100100895 | Ga0068860_1001008954 | 180 |
| 329 | 3300005843 | Ga0068860_100113608 | Ga0068860_1001136084 | 180 |
| 330 | 3300005843 | Ga0068860_100277201 | Ga0068860_1002772012 | 180 |
| 331 | 3300005843 | Ga0068860_100726973 | Ga0068860_1007269732 | 180 |
| 332 | 3300005844 | Ga0068862_100040093 | Ga0068862_1000400932 | 180 |
| 333 | 3300005844 | Ga0068862_100094281 | Ga0068862_1000942812 | 180 |
| 334 | 3300005844 | Ga0068862_100226873 | Ga0068862_1002268732 | 180 |
| 335 | 3300005985 | Ga0081539_10120190 | Ga0081539_101201902 | 180 |
| 336 | 3300005985 | Ga0081539_10194889 | Ga0081539_101948891 | 180 |
| 337 | 3300006163 | Ga0070715_10005421 | Ga0070715_100054213 | 180 |
| 338 | 3300006173 | Ga0070716_100208729 | Ga0070716_1002087292 | 180 |
| 339 | 3300006175 | Ga0070712_100005685 | Ga0070712_1000056858 | 180 |
| 340 | 3300006175 | Ga0070712_101124297 | Ga0070712_1011242971 | 180 |
| 341 | 3300006237 | Ga0097621_100004791 | Ga0097621_1000047915 | 180 |
| 342 | 3300006237 | Ga0097621_100012757 | Ga0097621_1000127574 | 180 |
| 343 | 3300006237 | Ga0097621_100048808 | Ga0097621_1000488084 | 180 |
| 344 | 3300006237 | Ga0097621_100115684 | Ga0097621_1001156843 | 180 |
| 345 | 3300006237 | Ga0097621_100862876 | Ga0097621_1008628762 | 180 |
| 346 | 3300006358 | Ga0068871_100010378 | Ga0068871_1000103782 | 180 |
| 347 | 3300006358 | Ga0068871_100024045 | Ga0068871_1000240453 | 180 |
| 348 | 3300006358 | Ga0068871_100069668 | Ga0068871_1000696682 | 180 |
| 349 | 3300006358 | Ga0068871_100131550 | Ga0068871_1001315502 | 180 |
| 350 | 3300006358 | Ga0068871_100237936 | Ga0068871_1002379362 | 180 |
| 351 | 3300006358 | Ga0068871_101097707 | Ga0068871_1010977071 | 180 |
| 352 | 3300006358 | Ga0068871_101141649 | Ga0068871_1011416492 | 180 |
| 353 | 3300006844 | Ga0075428_100099878 | Ga0075428_1000998782 | 180 |
| 354 | 3300006847 | Ga0075431_100002144 | Ga0075431_10000214415 | 180 |
| 355 | 3300006852 | Ga0075433_10231821 | Ga0075433_102318213 | 180 |
| 356 | 3300006852 | Ga0075433_10644211 | Ga0075433_106442112 | 180 |
| 357 | 3300006871 | Ga0075434_100019391 | Ga0075434_1000193915 | 180 |
| 358 | 3300006871 | Ga0075434_100056491 | Ga0075434_1000564912 | 180 |
| 359 | 3300006871 | Ga0075434_100725418 | Ga0075434_1007254182 | 180 |
| 360 | 3300006880 | Ga0075429_100034475 | Ga0075429_1000344753 | 180 |
| 361 | 3300006881 | Ga0068865_100010750 | Ga0068865_1000107505 | 180 |
| 362 | 3300006881 | Ga0068865_100025893 | Ga0068865_1000258935 | 180 |
| 363 | 3300006881 | Ga0068865_100029292 | Ga0068865_1000292923 | 180 |
| 364 | 3300006881 | Ga0068865_100077974 | Ga0068865_1000779742 | 180 |
| 365 | 3300006931 | Ga0097620_100014386 | Ga0097620_1000143867 | 180 |
| 366 | 3300006931 | Ga0097620_100014900 | Ga0097620_1000149005 | 180 |
| 367 | 3300006931 | Ga0097620_100069680 | Ga0097620_1000696802 | 180 |
| 368 | 3300007076 | Ga0075435_100041477 | Ga0075435_1000414775 | 180 |
| 369 | 3300007076 | Ga0075435_100195672 | Ga0075435_1001956721 | 180 |
| 370 | 3300007076 | Ga0075435_100828482 | Ga0075435_1008284821 | 180 |
| 371 | 3300009093 | Ga0105240_10051113 | Ga0105240_100511136 | 180 |
| 372 | 3300009093 | Ga0105240_10054022 | Ga0105240_100540224 | 180 |
| 373 | 3300009094 | Ga0111539_10137058 | Ga0111539_101370584 | 180 |
| 374 | 3300009094 | Ga0111539_10243173 | Ga0111539_102431732 | 180 |
| 375 | 3300009098 | Ga0105245_10036008 | Ga0105245_100360083 | 180 |
| 376 | 3300009098 | Ga0105245_10044063 | Ga0105245_100440632 | 180 |
| 377 | 3300009098 | Ga0105245_10469787 | Ga0105245_104697872 | 180 |
| 378 | 3300009101 | Ga0105247_10013579 | Ga0105247_100135794 | 180 |
| 379 | 3300009101 | Ga0105247_10138616 | Ga0105247_101386162 | 180 |
| 380 | 3300009101 | Ga0105247_10336001 | Ga0105247_103360012 | 180 |
| 381 | 3300009148 | Ga0105243_10221975 | Ga0105243_102219752 | 180 |
| 382 | 3300009174 | Ga0105241_10003899 | Ga0105241_100038996 | 180 |
| 383 | 3300009174 | Ga0105241_10042070 | Ga0105241_100420704 | 180 |
| 384 | 3300009174 | Ga0105241_10070821 | Ga0105241_100708211 | 180 |
| 385 | 3300009174 | Ga0105241_10275689 | Ga0105241_102756892 | 180 |
| 386 | 3300009176 | Ga0105242_10176047 | Ga0105242_101760473 | 180 |
| 387 | 3300009177 | Ga0105248_10015655 | Ga0105248_1001565510 | 180 |
| 388 | 3300009177 | Ga0105248_10023395 | Ga0105248_100233957 | 180 |
| 389 | 3300009177 | Ga0105248_10159540 | Ga0105248_101595403 | 180 |
| 390 | 3300009177 | Ga0105248_10303349 | Ga0105248_103033492 | 180 |
| 391 | 3300009177 | Ga0105248_10495674 | Ga0105248_104956742 | 180 |
| 392 | 3300009177 | Ga0105248_10792728 | Ga0105248_107927282 | 180 |
| 393 | 3300009545 | Ga0105237_10026918 | Ga0105237_100269184 | 180 |
| 394 | 3300009551 | Ga0105238_10006515 | Ga0105238_1000651511 | 180 |
| 395 | 3300009551 | Ga0105238_10008114 | Ga0105238_100081143 | 180 |
| 396 | 3300009551 | Ga0105238_10077572 | Ga0105238_100775725 | 180 |
| 397 | 3300009553 | Ga0105249_10038854 | Ga0105249_100388544 | 180 |
| 398 | 3300009553 | Ga0105249_10209728 | Ga0105249_102097282 | 180 |
| 399 | 3300009553 | Ga0105249_10544205 | Ga0105249_105442052 | 180 |
| 400 | 3300009553 | Ga0105249_10841150 | Ga0105249_108411502 | 180 |
| 401 | 3300010375 | Ga0105239_10609064 | Ga0105239_106090642 | 180 |
| 402 | 3300010375 | Ga0105239_10805496 | Ga0105239_108054962 | 180 |
| 403 | 3300011119 | Ga0105246_10176709 | Ga0105246_101767093 | 180 |
| 404 | 3300013100 | Ga0157373_10005591 | Ga0157373_100055918 | 180 |
| 405 | 3300013100 | Ga0157373_10041623 | Ga0157373_100416233 | 180 |
| 406 | 3300013100 | Ga0157373_10055969 | Ga0157373_100559692 | 180 |
| 407 | 3300013100 | Ga0157373_10199852 | Ga0157373_101998521 | 180 |
| 408 | 3300013100 | Ga0157373_10479416 | Ga0157373_104794161 | 180 |
| 409 | 3300013102 | Ga0157371_10019019 | Ga0157371_100190194 | 180 |
| 410 | 3300013102 | Ga0157371_10033685 | Ga0157371_100336854 | 180 |
| 411 | 3300013102 | Ga0157371_10069094 | Ga0157371_100690943 | 180 |
| 412 | 3300013102 | Ga0157371_10254125 | Ga0157371_102541252 | 180 |
| 413 | 3300013104 | Ga0157370_10026926 | Ga0157370_100269267 | 180 |
| 414 | 3300013104 | Ga0157370_10047064 | Ga0157370_100470643 | 180 |
| 415 | 3300013104 | Ga0157370_10066379 | Ga0157370_100663794 | 180 |
| 416 | 3300013104 | Ga0157370_10090956 | Ga0157370_100909564 | 180 |
| 417 | 3300013105 | Ga0157369_10010583 | Ga0157369_100105834 | 180 |
| 418 | 3300013296 | Ga0157374_10002330 | Ga0157374_100023309 | 180 |
| 419 | 3300013296 | Ga0157374_10002543 | Ga0157374_100025435 | 180 |
| 420 | 3300013296 | Ga0157374_10009894 | Ga0157374_100098944 | 180 |
| 421 | 3300013296 | Ga0157374_10134511 | Ga0157374_101345112 | 180 |
| 422 | 3300013296 | Ga0157374_11212014 | Ga0157374_112120142 | 180 |
| 423 | 3300013297 | Ga0157378_10022056 | Ga0157378_100220564 | 180 |
| 424 | 3300013297 | Ga0157378_10273371 | Ga0157378_102733712 | 180 |
| 425 | 3300013297 | Ga0157378_10895463 | Ga0157378_108954632 | 180 |
| 426 | 3300013297 | Ga0157378_11622463 | Ga0157378_116224631 | 180 |
| 427 | 3300013306 | Ga0163162_10003179 | Ga0163162_1000317915 | 180 |
| 428 | 3300013306 | Ga0163162_10035896 | Ga0163162_100358962 | 180 |
| 429 | 3300013306 | Ga0163162_10064452 | Ga0163162_100644524 | 180 |
| 430 | 3300013306 | Ga0163162_10072782 | Ga0163162_100727823 | 180 |
| 431 | 3300013306 | Ga0163162_10160734 | Ga0163162_101607342 | 180 |
| 432 | 3300013306 | Ga0163162_10628880 | Ga0163162_106288802 | 180 |
| 433 | 3300013306 | Ga0163162_11055796 | Ga0163162_110557962 | 180 |
| 434 | 3300013307 | Ga0157372_10004917 | Ga0157372_100049175 | 180 |
| 435 | 3300013307 | Ga0157372_10489255 | Ga0157372_104892552 | 180 |
| 436 | 3300013307 | Ga0157372_11551509 | Ga0157372_115515091 | 180 |
| 437 | 3300013308 | Ga0157375_10003041 | Ga0157375_100030419 | 180 |
| 438 | 3300013308 | Ga0157375_10017959 | Ga0157375_100179595 | 180 |
| 439 | 3300013308 | Ga0157375_10198476 | Ga0157375_101984762 | 180 |
| 440 | 3300013308 | Ga0157375_10205753 | Ga0157375_102057532 | 180 |
| 441 | 3300013308 | Ga0157375_10241910 | Ga0157375_102419103 | 180 |
| 442 | 3300013308 | Ga0157375_10282132 | Ga0157375_102821323 | 180 |
| 443 | 3300013308 | Ga0157375_10416057 | Ga0157375_104160572 | 180 |
| 444 | 3300013308 | Ga0157375_10491502 | Ga0157375_104915022 | 180 |
| 445 | 3300013308 | Ga0157375_10510583 | Ga0157375_105105832 | 180 |
| 446 | 3300013308 | Ga0157375_11387818 | Ga0157375_113878181 | 180 |
| 447 | 3300014325 | Ga0163163_10004410 | Ga0163163_1000441014 | 180 |
| 448 | 3300014325 | Ga0163163_10019921 | Ga0163163_100199214 | 180 |
| 449 | 3300014325 | Ga0163163_10382093 | Ga0163163_103820932 | 180 |
| 450 | 3300014325 | Ga0163163_10900563 | Ga0163163_109005632 | 180 |
| 451 | 3300014325 | Ga0163163_11043633 | Ga0163163_110436331 | 180 |
| 452 | 3300014325 | Ga0163163_12108928 | Ga0163163_121089281 | 180 |
| 453 | 3300014326 | Ga0157380_10015361 | Ga0157380_100153617 | 180 |
| 454 | 3300014326 | Ga0157380_10042701 | Ga0157380_100427013 | 180 |
| 455 | 3300014326 | Ga0157380_10092123 | Ga0157380_100921232 | 180 |
| 456 | 3300014326 | Ga0157380_10317265 | Ga0157380_103172651 | 180 |
| 457 | 3300014326 | Ga0157380_10452150 | Ga0157380_104521502 | 180 |
| 458 | 3300014326 | Ga0157380_11626316 | Ga0157380_116263161 | 180 |
| 459 | 3300014497 | Ga0182008_10183890 | Ga0182008_101838901 | 180 |
| 460 | 3300014745 | Ga0157377_10014844 | Ga0157377_100148443 | 180 |
| 461 | 3300014968 | Ga0157379_10000544 | Ga0157379_100005443 | 180 |
| 462 | 3300014968 | Ga0157379_10013818 | Ga0157379_100138185 | 180 |
| 463 | 3300014968 | Ga0157379_10031598 | Ga0157379_100315984 | 180 |
| 464 | 3300014968 | Ga0157379_10446611 | Ga0157379_104466112 | 180 |
| 465 | 3300014968 | Ga0157379_10563792 | Ga0157379_105637922 | 180 |
| 466 | 3300014969 | Ga0157376_10017692 | Ga0157376_100176922 | 180 |
| 467 | 3300014969 | Ga0157376_10060056 | Ga0157376_100600561 | 180 |
| 468 | 3300014969 | Ga0157376_10076386 | Ga0157376_100763863 | 180 |
| 469 | 3300014969 | Ga0157376_10083894 | Ga0157376_100838944 | 180 |
| 470 | 3300014969 | Ga0157376_10185216 | Ga0157376_101852162 | 180 |
| 471 | 3300014969 | Ga0157376_10442756 | Ga0157376_104427562 | 180 |
| 472 | 3300017792 | Ga0163161_10007139 | Ga0163161_100071399 | 180 |
| 473 | 3300017792 | Ga0163161_10012679 | Ga0163161_100126796 | 180 |
| 474 | 3300017792 | Ga0163161_10054057 | Ga0163161_100540573 | 180 |
| 475 | 3300017792 | Ga0163161_10136415 | Ga0163161_101364152 | 180 |
| 476 | 3300017792 | Ga0163161_10139148 | Ga0163161_101391483 | 180 |
| 477 | 3300025271 | Ga0207666_1002641 | Ga0207666_10026412 | 180 |
| 478 | 3300025290 | Ga0207673_1004095 | Ga0207673_10040952 | 180 |
| 479 | 3300025315 | Ga0207697_10000474 | Ga0207697_100004747 | 180 |
| 480 | 3300025315 | Ga0207697_10014153 | Ga0207697_100141534 | 180 |
| 481 | 3300025321 | Ga0207656_10009549 | Ga0207656_100095493 | 180 |
| 482 | 3300025893 | Ga0207682_10000224 | Ga0207682_1000022425 | 180 |
| 483 | 3300025893 | Ga0207682_10002853 | Ga0207682_100028535 | 180 |
| 484 | 3300025898 | Ga0207692_10035074 | Ga0207692_100350741 | 180 |
| 485 | 3300025898 | Ga0207692_10075173 | Ga0207692_100751732 | 180 |
| 486 | 3300025899 | Ga0207642_10051950 | Ga0207642_100519502 | 180 |
| 487 | 3300025899 | Ga0207642_10076098 | Ga0207642_100760982 | 180 |
| 488 | 3300025900 | Ga0207710_10020412 | Ga0207710_100204123 | 180 |
| 489 | 3300025901 | Ga0207688_10001248 | Ga0207688_1000124814 | 180 |
| 490 | 3300025901 | Ga0207688_10421448 | Ga0207688_104214482 | 180 |
| 491 | 3300025903 | Ga0207680_10017979 | Ga0207680_100179792 | 180 |
| 492 | 3300025903 | Ga0207680_10065128 | Ga0207680_100651283 | 180 |
| 493 | 3300025903 | Ga0207680_10320205 | Ga0207680_103202052 | 180 |
| 494 | 3300025905 | Ga0207685_10022878 | Ga0207685_100228783 | 180 |
| 495 | 3300025906 | Ga0207699_10008850 | Ga0207699_100088504 | 180 |
| 496 | 3300025907 | Ga0207645_10000488 | Ga0207645_100004888 | 180 |
| 497 | 3300025907 | Ga0207645_10001172 | Ga0207645_1000117225 | 180 |
| 498 | 3300025907 | Ga0207645_10003895 | Ga0207645_1000389512 | 180 |
| 499 | 3300025907 | Ga0207645_10020904 | Ga0207645_100209044 | 180 |
| 500 | 3300025907 | Ga0207645_10220063 | Ga0207645_102200632 | 180 |
| 501 | 3300025907 | Ga0207645_10276534 | Ga0207645_102765342 | 180 |
| 502 | 3300025907 | Ga0207645_10471002 | Ga0207645_104710022 | 180 |
| 503 | 3300025908 | Ga0207643_10000241 | Ga0207643_1000024112 | 180 |
| 504 | 3300025908 | Ga0207643_10009328 | Ga0207643_100093282 | 180 |
| 505 | 3300025908 | Ga0207643_10044848 | Ga0207643_100448482 | 180 |
| 506 | 3300025908 | Ga0207643_10155832 | Ga0207643_101558322 | 180 |
| 507 | 3300025909 | Ga0207705_10124679 | Ga0207705_101246793 | 180 |
| 508 | 3300025910 | Ga0207684_10031913 | Ga0207684_100319137 | 180 |
| 509 | 3300025911 | Ga0207654_10188960 | Ga0207654_101889602 | 180 |
| 510 | 3300025912 | Ga0207707_10010933 | Ga0207707_100109338 | 180 |
| 511 | 3300025912 | Ga0207707_10092524 | Ga0207707_100925244 | 180 |
| 512 | 3300025913 | Ga0207695_10042039 | Ga0207695_100420394 | 180 |
| 513 | 3300025915 | Ga0207693_10000069 | Ga0207693_1000006981 | 180 |
| 514 | 3300025915 | Ga0207693_10006208 | Ga0207693_100062088 | 180 |
| 515 | 3300025916 | Ga0207663_10009044 | Ga0207663_100090446 | 180 |
| 516 | 3300025916 | Ga0207663_10171738 | Ga0207663_101717382 | 180 |
| 517 | 3300025916 | Ga0207663_10308783 | Ga0207663_103087832 | 180 |
| 518 | 3300025917 | Ga0207660_10003901 | Ga0207660_1000390112 | 180 |
| 519 | 3300025918 | Ga0207662_10010967 | Ga0207662_100109675 | 180 |
| 520 | 3300025918 | Ga0207662_10036933 | Ga0207662_100369332 | 180 |
| 521 | 3300025919 | Ga0207657_10021040 | Ga0207657_100210407 | 180 |
| 522 | 3300025920 | Ga0207649_10061084 | Ga0207649_100610842 | 180 |
| 523 | 3300025920 | Ga0207649_10583947 | Ga0207649_105839472 | 180 |
| 524 | 3300025921 | Ga0207652_10001143 | Ga0207652_1000114316 | 180 |
| 525 | 3300025921 | Ga0207652_10101505 | Ga0207652_101015054 | 180 |
| 526 | 3300025922 | Ga0207646_10027520 | Ga0207646_100275204 | 180 |
| 527 | 3300025922 | Ga0207646_10242741 | Ga0207646_102427413 | 180 |
| 528 | 3300025922 | Ga0207646_10285750 | Ga0207646_102857502 | 180 |
| 529 | 3300025923 | Ga0207681_10008866 | Ga0207681_100088668 | 180 |
| 530 | 3300025923 | Ga0207681_10016156 | Ga0207681_100161565 | 180 |
| 531 | 3300025923 | Ga0207681_10166400 | Ga0207681_101664002 | 180 |
| 532 | 3300025924 | Ga0207694_10011462 | Ga0207694_100114622 | 180 |
| 533 | 3300025924 | Ga0207694_10141237 | Ga0207694_101412373 | 180 |
| 534 | 3300025924 | Ga0207694_10236969 | Ga0207694_102369692 | 180 |
| 535 | 3300025925 | Ga0207650_10006364 | Ga0207650_100063646 | 180 |
| 536 | 3300025925 | Ga0207650_10007771 | Ga0207650_100077713 | 180 |
| 537 | 3300025925 | Ga0207650_10007867 | Ga0207650_100078679 | 180 |
| 538 | 3300025925 | Ga0207650_10029683 | Ga0207650_100296831 | 180 |
| 539 | 3300025925 | Ga0207650_10076551 | Ga0207650_100765513 | 180 |
| 540 | 3300025925 | Ga0207650_10084892 | Ga0207650_100848923 | 180 |
| 541 | 3300025925 | Ga0207650_10157528 | Ga0207650_101575282 | 180 |
| 542 | 3300025925 | Ga0207650_10506673 | Ga0207650_105066732 | 180 |
| 543 | 3300025925 | Ga0207650_10679555 | Ga0207650_106795552 | 180 |
| 544 | 3300025926 | Ga0207659_10004534 | Ga0207659_100045345 | 180 |
| 545 | 3300025926 | Ga0207659_10005318 | Ga0207659_1000531810 | 180 |
| 546 | 3300025926 | Ga0207659_10007612 | Ga0207659_100076125 | 180 |
| 547 | 3300025926 | Ga0207659_10014481 | Ga0207659_100144817 | 180 |
| 548 | 3300025926 | Ga0207659_10048788 | Ga0207659_100487882 | 180 |
| 549 | 3300025926 | Ga0207659_10070001 | Ga0207659_100700012 | 180 |
| 550 | 3300025927 | Ga0207687_10008061 | Ga0207687_100080615 | 180 |
| 551 | 3300025927 | Ga0207687_10837358 | Ga0207687_108373581 | 180 |
| 552 | 3300025928 | Ga0207700_10001882 | Ga0207700_1000188214 | 180 |
| 553 | 3300025928 | Ga0207700_10010851 | Ga0207700_100108514 | 180 |
| 554 | 3300025928 | Ga0207700_10363638 | Ga0207700_103636382 | 180 |
| 555 | 3300025929 | Ga0207664_10001100 | Ga0207664_100011005 | 180 |
| 556 | 3300025929 | Ga0207664_10015121 | Ga0207664_100151216 | 180 |
| 557 | 3300025929 | Ga0207664_10079989 | Ga0207664_100799892 | 180 |
| 558 | 3300025931 | Ga0207644_10001001 | Ga0207644_1000100119 | 180 |
| 559 | 3300025931 | Ga0207644_10010748 | Ga0207644_100107487 | 180 |
| 560 | 3300025931 | Ga0207644_10016811 | Ga0207644_100168115 | 180 |
| 561 | 3300025931 | Ga0207644_10041280 | Ga0207644_100412804 | 180 |
| 562 | 3300025931 | Ga0207644_10171178 | Ga0207644_101711782 | 180 |
| 563 | 3300025931 | Ga0207644_10359193 | Ga0207644_103591932 | 180 |
| 564 | 3300025931 | Ga0207644_10610095 | Ga0207644_106100952 | 180 |
| 565 | 3300025932 | Ga0207690_10074874 | Ga0207690_100748743 | 180 |
| 566 | 3300025932 | Ga0207690_10162037 | Ga0207690_101620372 | 180 |
| 567 | 3300025933 | Ga0207706_10000488 | Ga0207706_1000048829 | 180 |
| 568 | 3300025933 | Ga0207706_10012193 | Ga0207706_100121932 | 180 |
| 569 | 3300025933 | Ga0207706_10043521 | Ga0207706_100435214 | 180 |
| 570 | 3300025933 | Ga0207706_10895797 | Ga0207706_108957971 | 180 |
| 571 | 3300025934 | Ga0207686_10000118 | Ga0207686_1000011830 | 180 |
| 572 | 3300025934 | Ga0207686_10177606 | Ga0207686_101776062 | 180 |
| 573 | 3300025936 | Ga0207670_10003274 | Ga0207670_1000327410 | 180 |
| 574 | 3300025936 | Ga0207670_10006315 | Ga0207670_100063154 | 180 |
| 575 | 3300025936 | Ga0207670_10022230 | Ga0207670_100222303 | 180 |
| 576 | 3300025937 | Ga0207669_10000937 | Ga0207669_100009375 | 180 |
| 577 | 3300025937 | Ga0207669_10004593 | Ga0207669_100045934 | 180 |
| 578 | 3300025937 | Ga0207669_10006911 | Ga0207669_100069112 | 180 |
| 579 | 3300025937 | Ga0207669_10012907 | Ga0207669_100129075 | 180 |
| 580 | 3300025937 | Ga0207669_10024282 | Ga0207669_100242824 | 180 |
| 581 | 3300025937 | Ga0207669_10079181 | Ga0207669_100791813 | 180 |
| 582 | 3300025937 | Ga0207669_10175489 | Ga0207669_101754892 | 180 |
| 583 | 3300025937 | Ga0207669_10210315 | Ga0207669_102103152 | 180 |
| 584 | 3300025938 | Ga0207704_10008365 | Ga0207704_100083656 | 180 |
| 585 | 3300025938 | Ga0207704_10155440 | Ga0207704_101554402 | 180 |
| 586 | 3300025938 | Ga0207704_10280151 | Ga0207704_102801512 | 180 |
| 587 | 3300025939 | Ga0207665_10031075 | Ga0207665_100310753 | 180 |
| 588 | 3300025939 | Ga0207665_10045530 | Ga0207665_100455302 | 180 |
| 589 | 3300025939 | Ga0207665_10161882 | Ga0207665_101618822 | 180 |
| 590 | 3300025939 | Ga0207665_10639471 | Ga0207665_106394711 | 180 |
| 591 | 3300025940 | Ga0207691_10000458 | Ga0207691_1000045836 | 180 |
| 592 | 3300025940 | Ga0207691_10000572 | Ga0207691_1000057230 | 180 |
| 593 | 3300025940 | Ga0207691_10024787 | Ga0207691_100247878 | 180 |
| 594 | 3300025940 | Ga0207691_10026691 | Ga0207691_100266912 | 180 |
| 595 | 3300025940 | Ga0207691_10030643 | Ga0207691_100306434 | 180 |
| 596 | 3300025940 | Ga0207691_10043789 | Ga0207691_100437893 | 180 |
| 597 | 3300025940 | Ga0207691_10165429 | Ga0207691_101654293 | 180 |
| 598 | 3300025940 | Ga0207691_10172875 | Ga0207691_101728752 | 180 |
| 599 | 3300025940 | Ga0207691_10697946 | Ga0207691_106979462 | 180 |
| 600 | 3300025941 | Ga0207711_10000515 | Ga0207711_1000051528 | 180 |
| 601 | 3300025941 | Ga0207711_10003360 | Ga0207711_1000336018 | 180 |
| 602 | 3300025941 | Ga0207711_10014797 | Ga0207711_100147977 | 180 |
| 603 | 3300025941 | Ga0207711_10065514 | Ga0207711_100655144 | 180 |
| 604 | 3300025941 | Ga0207711_10089785 | Ga0207711_100897853 | 180 |
| 605 | 3300025942 | Ga0207689_10000421 | Ga0207689_100004219 | 180 |
| 606 | 3300025942 | Ga0207689_10000719 | Ga0207689_1000071925 | 180 |
| 607 | 3300025942 | Ga0207689_10101654 | Ga0207689_101016541 | 180 |
| 608 | 3300025942 | Ga0207689_10163357 | Ga0207689_101633572 | 180 |
| 609 | 3300025942 | Ga0207689_10200950 | Ga0207689_102009501 | 180 |
| 610 | 3300025944 | Ga0207661_10092618 | Ga0207661_100926183 | 180 |
| 611 | 3300025944 | Ga0207661_10109892 | Ga0207661_101098922 | 180 |
| 612 | 3300025944 | Ga0207661_10129118 | Ga0207661_101291183 | 180 |
| 613 | 3300025945 | Ga0207679_10005081 | Ga0207679_100050814 | 180 |
| 614 | 3300025945 | Ga0207679_10030087 | Ga0207679_100300872 | 180 |
| 615 | 3300025945 | Ga0207679_10037021 | Ga0207679_100370214 | 180 |
| 616 | 3300025945 | Ga0207679_10089146 | Ga0207679_100891463 | 180 |
| 617 | 3300025945 | Ga0207679_10357807 | Ga0207679_103578072 | 180 |
| 618 | 3300025945 | Ga0207679_10600580 | Ga0207679_106005802 | 180 |
| 619 | 3300025949 | Ga0207667_10030255 | Ga0207667_100302558 | 180 |
| 620 | 3300025949 | Ga0207667_10246114 | Ga0207667_102461142 | 180 |
| 621 | 3300025949 | Ga0207667_10346050 | Ga0207667_103460502 | 180 |
| 622 | 3300025960 | Ga0207651_10001969 | Ga0207651_100019697 | 180 |
| 623 | 3300025960 | Ga0207651_10002981 | Ga0207651_100029816 | 180 |
| 624 | 3300025960 | Ga0207651_10009524 | Ga0207651_100095243 | 180 |
| 625 | 3300025960 | Ga0207651_10067538 | Ga0207651_100675384 | 180 |
| 626 | 3300025960 | Ga0207651_10187409 | Ga0207651_101874092 | 180 |
| 627 | 3300025960 | Ga0207651_10289339 | Ga0207651_102893392 | 180 |
| 628 | 3300025960 | Ga0207651_11210998 | Ga0207651_112109982 | 180 |
| 629 | 3300025961 | Ga0207712_10098595 | Ga0207712_100985953 | 180 |
| 630 | 3300025961 | Ga0207712_10115059 | Ga0207712_101150593 | 180 |
| 631 | 3300025961 | Ga0207712_10764334 | Ga0207712_107643341 | 180 |
| 632 | 3300025961 | Ga0207712_11296989 | Ga0207712_112969891 | 180 |
| 633 | 3300025972 | Ga0207668_10003117 | Ga0207668_100031176 | 180 |
| 634 | 3300025972 | Ga0207668_10003880 | Ga0207668_100038805 | 180 |
| 635 | 3300025972 | Ga0207668_10005978 | Ga0207668_100059788 | 180 |
| 636 | 3300025972 | Ga0207668_10021299 | Ga0207668_100212994 | 180 |
| 637 | 3300025972 | Ga0207668_10024979 | Ga0207668_100249792 | 180 |
| 638 | 3300025972 | Ga0207668_10052264 | Ga0207668_100522644 | 180 |
| 639 | 3300025972 | Ga0207668_10063277 | Ga0207668_100632772 | 180 |
| 640 | 3300025972 | Ga0207668_10088887 | Ga0207668_100888872 | 180 |
| 641 | 3300025972 | Ga0207668_10091659 | Ga0207668_100916592 | 180 |
| 642 | 3300025972 | Ga0207668_10170227 | Ga0207668_101702272 | 180 |
| 643 | 3300025972 | Ga0207668_10317924 | Ga0207668_103179242 | 180 |
| 644 | 3300025981 | Ga0207640_10008553 | Ga0207640_100085532 | 180 |
| 645 | 3300025981 | Ga0207640_10494244 | Ga0207640_104942441 | 180 |
| 646 | 3300025986 | Ga0207658_10007690 | Ga0207658_100076907 | 180 |
| 647 | 3300025986 | Ga0207658_10011693 | Ga0207658_100116933 | 180 |
| 648 | 3300025986 | Ga0207658_10012660 | Ga0207658_100126605 | 180 |
| 649 | 3300025986 | Ga0207658_10014000 | Ga0207658_100140003 | 180 |
| 650 | 3300025986 | Ga0207658_10014476 | Ga0207658_100144765 | 180 |
| 651 | 3300025986 | Ga0207658_10049696 | Ga0207658_100496962 | 180 |
| 652 | 3300025986 | Ga0207658_10141366 | Ga0207658_101413663 | 180 |
| 653 | 3300025986 | Ga0207658_10267733 | Ga0207658_102677333 | 180 |
| 654 | 3300026023 | Ga0207677_10003500 | Ga0207677_100035006 | 180 |
| 655 | 3300026023 | Ga0207677_10006248 | Ga0207677_100062487 | 180 |
| 656 | 3300026023 | Ga0207677_10047725 | Ga0207677_100477254 | 180 |
| 657 | 3300026023 | Ga0207677_10105985 | Ga0207677_101059852 | 180 |
| 658 | 3300026023 | Ga0207677_10169989 | Ga0207677_101699892 | 180 |
| 659 | 3300026023 | Ga0207677_10446257 | Ga0207677_104462572 | 180 |
| 660 | 3300026023 | Ga0207677_11469471 | Ga0207677_114694711 | 180 |
| 661 | 3300026035 | Ga0207703_10002644 | Ga0207703_1000264418 | 180 |
| 662 | 3300026035 | Ga0207703_10011990 | Ga0207703_100119905 | 180 |
| 663 | 3300026035 | Ga0207703_10015545 | Ga0207703_100155454 | 180 |
| 664 | 3300026035 | Ga0207703_10023846 | Ga0207703_100238465 | 180 |
| 665 | 3300026035 | Ga0207703_10124618 | Ga0207703_101246181 | 180 |
| 666 | 3300026035 | Ga0207703_10139403 | Ga0207703_101394032 | 180 |
| 667 | 3300026041 | Ga0207639_10022474 | Ga0207639_100224744 | 180 |
| 668 | 3300026041 | Ga0207639_10315171 | Ga0207639_103151713 | 180 |
| 669 | 3300026041 | Ga0207639_10549341 | Ga0207639_105493412 | 180 |
| 670 | 3300026041 | Ga0207639_10680972 | Ga0207639_106809722 | 180 |
| 671 | 3300026041 | Ga0207639_10992572 | Ga0207639_109925721 | 180 |
| 672 | 3300026067 | Ga0207678_10005480 | Ga0207678_100054808 | 180 |
| 673 | 3300026067 | Ga0207678_10006243 | Ga0207678_100062438 | 180 |
| 674 | 3300026067 | Ga0207678_10011514 | Ga0207678_100115143 | 180 |
| 675 | 3300026067 | Ga0207678_10116000 | Ga0207678_101160002 | 180 |
| 676 | 3300026067 | Ga0207678_10127320 | Ga0207678_101273203 | 180 |
| 677 | 3300026075 | Ga0207708_10005086 | Ga0207708_100050865 | 180 |
| 678 | 3300026078 | Ga0207702_10008839 | Ga0207702_100088394 | 180 |
| 679 | 3300026088 | Ga0207641_10000588 | Ga0207641_1000058836 | 180 |
| 680 | 3300026088 | Ga0207641_10002776 | Ga0207641_100027763 | 180 |
| 681 | 3300026088 | Ga0207641_10009170 | Ga0207641_100091704 | 180 |
| 682 | 3300026088 | Ga0207641_10020806 | Ga0207641_100208067 | 180 |
| 683 | 3300026088 | Ga0207641_10022296 | Ga0207641_100222967 | 180 |
| 684 | 3300026088 | Ga0207641_10032620 | Ga0207641_100326201 | 180 |
| 685 | 3300026088 | Ga0207641_10095043 | Ga0207641_100950432 | 180 |
| 686 | 3300026088 | Ga0207641_10382301 | Ga0207641_103823011 | 180 |
| 687 | 3300026088 | Ga0207641_10669220 | Ga0207641_106692201 | 180 |
| 688 | 3300026089 | Ga0207648_10000364 | Ga0207648_1000036443 | 180 |
| 689 | 3300026089 | Ga0207648_10003329 | Ga0207648_1000332911 | 180 |
| 690 | 3300026089 | Ga0207648_10007103 | Ga0207648_100071037 | 180 |
| 691 | 3300026089 | Ga0207648_10008038 | Ga0207648_100080385 | 180 |
| 692 | 3300026089 | Ga0207648_10019354 | Ga0207648_100193545 | 180 |
| 693 | 3300026089 | Ga0207648_10139771 | Ga0207648_101397713 | 180 |
| 694 | 3300026089 | Ga0207648_10164325 | Ga0207648_101643252 | 180 |
| 695 | 3300026089 | Ga0207648_10801163 | Ga0207648_108011632 | 180 |
| 696 | 3300026095 | Ga0207676_10001838 | Ga0207676_100018384 | 180 |
| 697 | 3300026095 | Ga0207676_10005263 | Ga0207676_100052635 | 180 |
| 698 | 3300026095 | Ga0207676_10010876 | Ga0207676_100108768 | 180 |
| 699 | 3300026095 | Ga0207676_10029303 | Ga0207676_100293034 | 180 |
| 700 | 3300026095 | Ga0207676_10042063 | Ga0207676_100420633 | 180 |
| 701 | 3300026095 | Ga0207676_10076846 | Ga0207676_100768462 | 180 |
| 702 | 3300026095 | Ga0207676_10094604 | Ga0207676_100946044 | 180 |
| 703 | 3300026095 | Ga0207676_10118451 | Ga0207676_101184512 | 180 |
| 704 | 3300026095 | Ga0207676_10309243 | Ga0207676_103092431 | 180 |
| 705 | 3300026095 | Ga0207676_10519036 | Ga0207676_105190362 | 180 |
| 706 | 3300026116 | Ga0207674_10002737 | Ga0207674_1000273715 | 180 |
| 707 | 3300026116 | Ga0207674_10006639 | Ga0207674_100066396 | 180 |
| 708 | 3300026118 | Ga0207675_100008479 | Ga0207675_1000084796 | 180 |
| 709 | 3300026118 | Ga0207675_100013544 | Ga0207675_1000135443 | 180 |
| 710 | 3300026118 | Ga0207675_100024335 | Ga0207675_1000243356 | 180 |
| 711 | 3300026118 | Ga0207675_100033578 | Ga0207675_1000335784 | 180 |
| 712 | 3300026118 | Ga0207675_100177647 | Ga0207675_1001776472 | 180 |
| 713 | 3300026118 | Ga0207675_100367875 | Ga0207675_1003678752 | 180 |
| 714 | 3300026118 | Ga0207675_100472446 | Ga0207675_1004724462 | 180 |
| 715 | 3300026118 | Ga0207675_100810817 | Ga0207675_1008108172 | 180 |
| 716 | 3300026118 | Ga0207675_101721798 | Ga0207675_1017217981 | 180 |
| 717 | 3300026121 | Ga0207683_10000076 | Ga0207683_1000007641 | 180 |
| 718 | 3300026121 | Ga0207683_10000218 | Ga0207683_1000021843 | 180 |
| 719 | 3300026121 | Ga0207683_10001799 | Ga0207683_100017998 | 180 |
| 720 | 3300026121 | Ga0207683_10005087 | Ga0207683_100050872 | 180 |
| 721 | 3300026121 | Ga0207683_10017518 | Ga0207683_100175182 | 180 |
| 722 | 3300026121 | Ga0207683_10024809 | Ga0207683_100248095 | 180 |
| 723 | 3300026121 | Ga0207683_10096864 | Ga0207683_100968644 | 180 |
| 724 | 3300026121 | Ga0207683_10438216 | Ga0207683_104382161 | 180 |
| 725 | 3300026142 | Ga0207698_10002381 | Ga0207698_100023814 | 180 |
| 726 | 3300026142 | Ga0207698_10018570 | Ga0207698_100185705 | 180 |
| 727 | 3300026142 | Ga0207698_10109945 | Ga0207698_101099454 | 180 |
| 728 | 3300026142 | Ga0207698_10122160 | Ga0207698_101221604 | 180 |
| 729 | 3300026142 | Ga0207698_10239913 | Ga0207698_102399132 | 180 |
| 730 | 3300027907 | Ga0207428_10199808 | Ga0207428_101998082 | 180 |
| 731 | 3300028379 | Ga0268266_10003578 | Ga0268266_100035784 | 180 |
| 732 | 3300028379 | Ga0268266_10014526 | Ga0268266_100145264 | 180 |
| 733 | 3300028379 | Ga0268266_10017452 | Ga0268266_100174525 | 180 |
| 734 | 3300028379 | Ga0268266_10018819 | Ga0268266_100188194 | 180 |
| 735 | 3300028379 | Ga0268266_10086443 | Ga0268266_100864433 | 180 |
| 736 | 3300028379 | Ga0268266_10141465 | Ga0268266_101414652 | 180 |
| 737 | 3300028379 | Ga0268266_10361952 | Ga0268266_103619522 | 180 |
| 738 | 3300028380 | Ga0268265_10024064 | Ga0268265_100240646 | 180 |
| 739 | 3300028380 | Ga0268265_10024477 | Ga0268265_100244775 | 180 |
| 740 | 3300028380 | Ga0268265_10190097 | Ga0268265_101900972 | 180 |
| 741 | 3300028380 | Ga0268265_10467838 | Ga0268265_104678382 | 180 |
| 742 | 3300028381 | Ga0268264_10003660 | Ga0268264_1000366011 | 180 |
| 743 | 3300028381 | Ga0268264_10009693 | Ga0268264_100096937 | 180 |
| 744 | 3300028381 | Ga0268264_10017111 | Ga0268264_100171113 | 180 |
| 745 | 3300028381 | Ga0268264_10057016 | Ga0268264_100570163 | 180 |
| 746 | 3300028381 | Ga0268264_10078712 | Ga0268264_100787122 | 180 |
| 747 | 3300028381 | Ga0268264_10092446 | Ga0268264_100924463 | 180 |
| 748 | 3300028381 | Ga0268264_10110620 | Ga0268264_101106204 | 180 |
| 749 | 3300028381 | Ga0268264_10139271 | Ga0268264_101392712 | 180 |
| 750 | 3300031235 | Ga0265330_10000546 | Ga0265330_100005467 | 180 |
| 751 | 3300031238 | Ga0265332_10003000 | Ga0265332_100030005 | 180 |
| 752 | 3300031249 | Ga0265339_10072728 | Ga0265339_100727283 | 180 |
| 753 | 3300031250 | Ga0265331_10001620 | Ga0265331_100016206 | 180 |
| 754 | 3300031251 | Ga0265327_10007592 | Ga0265327_100075927 | 180 |
| 755 | 3300031344 | Ga0265316_10044839 | Ga0265316_100448394 | 180 |
| 756 | 3300031548 | Ga0307408_100029133 | Ga0307408_1000291334 | 180 |
| 757 | 3300031711 | Ga0265314_10005632 | Ga0265314_100056327 | 180 |
| 758 | 3300031712 | Ga0265342_10034247 | Ga0265342_100342472 | 180 |
| 759 | 3300031731 | Ga0307405_10029979 | Ga0307405_100299794 | 180 |
| 760 | 3300031852 | Ga0307410_10001615 | Ga0307410_100016155 | 180 |
| 761 | 3300031852 | Ga0307410_10019419 | Ga0307410_100194194 | 180 |
| 762 | 3300031901 | Ga0307406_10016654 | Ga0307406_100166543 | 180 |
| 763 | 3300031903 | Ga0307407_10003364 | Ga0307407_100033647 | 180 |
| 764 | 3300031911 | Ga0307412_10007245 | Ga0307412_100072455 | 180 |
| 765 | 3300031995 | Ga0307409_100031116 | Ga0307409_1000311163 | 180 |
| 766 | 3300032002 | Ga0307416_100001805 | Ga0307416_1000018053 | 180 |
| 767 | 3300032002 | Ga0307416_100053428 | Ga0307416_1000534282 | 180 |
| 768 | 3300032004 | Ga0307414_10015815 | Ga0307414_100158154 | 180 |
| 769 | 3300032005 | Ga0307411_10029859 | Ga0307411_100298594 | 180 |
| 770 | 3300032005 | Ga0307411_10466678 | Ga0307411_104666782 | 180 |
| 771 | 3300035086 | Ga0373934_0040718 | Ga0373934_0040718_1255_1803 | 180 |
| 772 | 3300035089 | Ga0373944_0037954 | Ga0373944_0037954_339_887 | 180 |
| 773 | 3300035117 | Ga0373953_0093506 | Ga0373953_0093506_301_849 | 180 |
| 774 | 3300035118 | Ga0373954_0195839 | Ga0373954_0195839_78_626 | 180 |
| 775 | 3300035119 | Ga0373956_0009855 | Ga0373956_0009855_1602_2150 | 180 |
| 776 | 3300035120 | Ga0373957_0006995 | Ga0373957_0006995_3011_3559 | 180 |
| 777 | 3300035170 | Ga0373943_0032494 | Ga0373943_0032494_1325_1873 | 180 |
| 778 | 3300035170 | Ga0373943_0174358 | Ga0373943_0174358_40_588 | 180 |
| 779 | 3300035171 | Ga0373946_0060219 | Ga0373946_0060219_140_682 | 180 |
| 780 | 3300035171 | Ga0373946_0136708 | Ga0373946_0136708_498_1046 | 180 |
| 781 | 3300035172 | Ga0373955_0013907 | Ga0373955_0013907_2950_3498 | 180 |
| 782 | 3300035172 | Ga0373955_0081354 | Ga0373955_0081354_271_819 | 180 |
| 783 | 3300035410 | Ga0373924_0098616 | Ga0373924_0098616_288_836 | 180 |
| 784 | 3300035691 | Ga0373931_0126129 | Ga0373931_0126129_395_937 | 180 |
| 785 | 3300035695 | Ga0373927_0034038 | Ga0373927_0034038_1656_2204 | 180 |
| 786 | 3300035695 | Ga0373927_0085289 | Ga0373927_0085289_56_604 | 180 |
| 787 | 3300035724 | Ga0373933_0005379 | Ga0373933_0005379_3534_4082 | 180 |
| 788 | 3300035724 | Ga0373933_0149262 | Ga0373933_0149262_305_853 | 180 |
| 789 | 3300035724 | Ga0373933_0247253 | Ga0373933_0247253_576_1124 | 180 |
| 790 | 3300035724 | Ga0373933_0631218 | Ga0373933_0631218_109_660 | 180 |
| 791 | 3300035725 | Ga0373947_0016015 | Ga0373947_0016015_2197_2745 | 180 |
| 792 | 3300035725 | Ga0373947_0068067 | Ga0373947_0068067_821_1363 | 180 |
| 793 | 3300035725 | Ga0373947_0074117 | Ga0373947_0074117_1389_1937 | 180 |
| 794 | 3300035725 | Ga0373947_0293063 | Ga0373947_0293063_360_908 | 180 |
| 795 | 3300035725 | Ga0373947_0507943 | Ga0373947_0507943_135_683 | 180 |
| 796 | 3300036401 | Ga0373937_0002839 | Ga0373937_0002839_7462_8010 | 180 |
| 797 | 3300036401 | Ga0373937_0010161 | Ga0373937_0010161_4592_5140 | 180 |
| 798 | 3300036401 | Ga0373937_0137801 | Ga0373937_0137801_1143_1691 | 180 |
| 799 | 3300036401 | Ga0373937_0228209 | Ga0373937_0228209_916_1464 | 180 |
| 800 | 3300036401 | Ga0373937_0531811 | Ga0373937_0531811_223_774 | 180 |
| 801 | 3300037068 | Ga0373925_0027705 | Ga0373925_0027705_1394_1942 | 180 |
| 802 | 3300037068 | Ga0373925_0363635 | Ga0373925_0363635_478_1020 | 180 |
| 803 | 3300037068 | Ga0373925_0764890 | Ga0373925_0764890_218_766 | 180 |
| 804 | 3300037466 | Ga0395898_0365052 | Ga0395898_0365052_301_909 | 180 |
| 805 | 3300037471 | Ga0395905_0396226 | Ga0395905_0396226_233_841 | 180 |
| 806 | 3300041460 | Ga0451802_1191024 | Ga0451802_1191024_35_622 | 180 |
| 807 | 3300041501 | Ga0451845_0059238 | Ga0451845_0059238_70_618 | 180 |
| 808 | 3300042005 | Ga0439448_0062518 | Ga0439448_0062518_46_594 | 180 |
| 809 | 3300042876 | Ga0451577_0258166 | Ga0451577_0258166_1007_1555 | 180 |
| 810 | 3300044842 | Ga0466957_0603850 | Ga0466957_0603850_28_693 | 180 |
| 811 | 3300046472 | Ga0495580_0026036 | Ga0495580_0026036_1087_1635 | 180 |
| 812 | 3300046472 | Ga0495580_0115264 | Ga0495580_0115264_334_882 | 180 |
| 813 | 3300046473 | Ga0495582_0032219 | Ga0495582_0032219_1079_1627 | 180 |
| 814 | 3300046475 | Ga0495639_0142314 | Ga0495639_0142314_35_583 | 180 |
| 815 | 3300046476 | Ga0495662_0246951 | Ga0495662_0246951_60_608 | 180 |
| 816 | 3300046477 | Ga0495664_0174276 | Ga0495664_0174276_609_1157 | 180 |
| 817 | 3300046516 | Ga0495628_0460430 | Ga0495628_0460430_258_806 | 180 |
| 818 | 3300046531 | Ga0495665_0149935 | Ga0495665_0149935_35_583 | 180 |
| 819 | 3300046535 | Ga0495586_0118326 | Ga0495586_0118326_796_1344 | 180 |
| 820 | 3300046539 | Ga0495621_0004963 | Ga0495621_0004963_1487_2035 | 180 |
| 821 | 3300046543 | Ga0495645_0020392 | Ga0495645_0020392_2844_3392 | 180 |
| 822 | 3300046681 | Ga0495647_0013845 | Ga0495647_0013845_363_911 | 180 |
| 823 | 3300046683 | Ga0495658_0009925 | Ga0495658_0009925_4167_4715 | 180 |
| 824 | 3300046683 | Ga0495658_0365726 | Ga0495658_0365726_159_836 | 180 |
| 825 | 3300047315 | Ga0495581_0001804 | Ga0495581_0001804_7540_8088 | 180 |
| 826 | 3300047471 | Ga0495684_0011314 | Ga0495684_0011314_5810_6358 | 180 |
| 827 | 3300048088 | Ga0495602_0200549 | Ga0495602_0200549_949_1497 | 180 |
| 828 | 3300048903 | Ga0496100_0004262 | Ga0496100_0004262_928_1470 | 180 |
| 829 | 3300048904 | Ga0496101_0006151 | Ga0496101_0006151_4023_4571 | 180 |
| 830 | 3300048905 | Ga0496102_0011726 | Ga0496102_0011726_4941_5483 | 180 |
| 831 | 3300048905 | Ga0496102_0112457 | Ga0496102_0112457_901_1449 | 180 |
| 832 | 3300048906 | Ga0496103_0190656 | Ga0496103_0190656_680_1228 | 180 |
| 833 | 3300048907 | Ga0496104_0004333 | Ga0496104_0004333_5354_5902 | 180 |
| 834 | 3300048907 | Ga0496104_0010541 | Ga0496104_0010541_706_1248 | 180 |
| 835 | 3300048908 | Ga0496105_0008136 | Ga0496105_0008136_5080_5628 | 180 |
| 836 | 3300048909 | Ga0496106_0040063 | Ga0496106_0040063_1783_2325 | 180 |
| 837 | 3300048909 | Ga0496106_0348158 | Ga0496106_0348158_189_737 | 180 |
| 838 | 3300048909 | Ga0496106_1123322 | Ga0496106_1123322_28_579 | 180 |
| 839 | 3300048910 | Ga0496107_0027057 | Ga0496107_0027057_812_1354 | 180 |
| 840 | 3300048910 | Ga0496107_0138205 | Ga0496107_0138205_1222_1770 | 180 |
| 841 | 3300048910 | Ga0496107_0278923 | Ga0496107_0278923_522_1070 | 180 |
| 842 | 3300048911 | Ga0496108_0134239 | Ga0496108_0134239_1181_1729 | 180 |
| 843 | 3300048911 | Ga0496108_0621271 | Ga0496108_0621271_345_896 | 180 |
| 844 | 3300048911 | Ga0496108_0629278 | Ga0496108_0629278_100_648 | 180 |
| 845 | 3300048912 | Ga0496109_0002292 | Ga0496109_0002292_135_677 | 180 |
| 846 | 3300048912 | Ga0496109_0176900 | Ga0496109_0176900_1431_1979 | 180 |
| 847 | 3300048912 | Ga0496109_0429556 | Ga0496109_0429556_494_1042 | 180 |
| 848 | 3300048913 | Ga0496110_0001542 | Ga0496110_0001542_13754_14296 | 180 |
| 849 | 3300048913 | Ga0496110_0095256 | Ga0496110_0095256_137_685 | 180 |
| 850 | 3300048915 | Ga0496112_0003810 | Ga0496112_0003810_10377_10925 | 180 |
| 851 | 3300048915 | Ga0496112_0201440 | Ga0496112_0201440_769_1311 | 180 |
| 852 | 3300048917 | Ga0496114_0157771 | Ga0496114_0157771_1195_1743 | 180 |
| 853 | 3300048917 | Ga0496114_0522999 | Ga0496114_0522999_458_1009 | 180 |
| 854 | 3300048918 | Ga0496115_0161289 | Ga0496115_0161289_882_1430 | 180 |
| 855 | 3300048918 | Ga0496115_0909124 | Ga0496115_0909124_53_595 | 180 |
| 856 | 3300049568 | Ga0501031_0065118 | Ga0501031_0065118_735_1283 | 180 |
| 857 | 3300049569 | Ga0501032_0003756 | Ga0501032_0003756_10614_11162 | 180 |
| 858 | 3300049570 | Ga0501033_0001343 | Ga0501033_0001343_4199_4747 | 180 |
| 859 | 3300049571 | Ga0501034_0039070 | Ga0501034_0039070_3440_3988 | 180 |
| 860 | 3300049572 | Ga0501036_0003237 | Ga0501036_0003237_662_1210 | 180 |
| 861 | 3300049572 | Ga0501036_0044422 | Ga0501036_0044422_3022_3570 | 180 |
| 862 | 3300049573 | Ga0501037_0129590 | Ga0501037_0129590_166_774 | 180 |
| 863 | 3300049574 | Ga0501038_0045132 | Ga0501038_0045132_2272_2820 | 180 |
| 864 | 3300049574 | Ga0501038_0427386 | Ga0501038_0427386_198_746 | 180 |
| 865 | 3300049575 | Ga0501039_0001150 | Ga0501039_0001150_16891_17439 | 180 |
| 866 | 3300049579 | Ga0501043_0016804 | Ga0501043_0016804_2241_2789 | 180 |
| 867 | 3300049580 | Ga0501046_0007421 | Ga0501046_0007421_8868_9476 | 180 |
| 868 | 3300049580 | Ga0501046_0010791 | Ga0501046_0010791_4665_5213 | 180 |
| 869 | 3300049585 | Ga0501069_0459588 | Ga0501069_0459588_132_680 | 180 |
| 870 | 3300049822 | Ga0501035_0000158 | Ga0501035_0000158_11484_12032 | 180 |
| 871 | 3300049823 | Ga0501044_0041405 | Ga0501044_0041405_2947_3495 | 180 |
| 872 | 3300050493 | nmdc:mga0k408_324036_c1 | nmdc:mga0k408_324036_c1_106_654 | 180 |
| 873 | 3300050508 | nmdc:mga09592_36973_c1 | nmdc:mga09592_36973_c1_2310_2900 | 180 |
| 874 | 3300050511 | nmdc:mga08y16_1006394_c1 | nmdc:mga08y16_1006394_c1_57_608 | 180 |
| 875 | 3300050511 | nmdc:mga08y16_51608_c1 | nmdc:mga08y16_51608_c1_3536_4078 | 180 |
| 876 | 3300050512 | nmdc:mga0n895_431500_c1 | nmdc:mga0n895_431500_c1_493_1041 | 180 |
| 877 | 3300050512 | nmdc:mga0n895_45001_c1 | nmdc:mga0n895_45001_c1_1130_1678 | 180 |
| 878 | 3300050512 | nmdc:mga0n895_71750_c1 | nmdc:mga0n895_71750_c1_2748_3296 | 180 |
| 879 | 3300050513 | nmdc:mga0rr50_117377_c1 | nmdc:mga0rr50_117377_c1_1433_1981 | 180 |
| 880 | 3300050513 | nmdc:mga0rr50_45287_c1 | nmdc:mga0rr50_45287_c1_1929_2477 | 180 |
| 881 | 3300050514 | nmdc:mga08x19_106069_c1 | nmdc:mga08x19_106069_c1_945_1553 | 180 |
| 882 | 3300050514 | nmdc:mga08x19_392199_c1 | nmdc:mga08x19_392199_c1_14_562 | 180 |
| 883 | 3300050515 | nmdc:mga0a205_123229_c1 | nmdc:mga0a205_123229_c1_329_877 | 180 |
| 884 | 3300050515 | nmdc:mga0a205_540523_c1 | nmdc:mga0a205_540523_c1_276_824 | 180 |
| 885 | 3300053078 | Ga0495612_0021443 | Ga0495612_0021443_1012_1560 | 180 |
| 886 | 3300053078 | Ga0495612_0451942 | Ga0495612_0451942_21_569 | 180 |
| 887 | 3300053084 | Ga0495595_0074127 | Ga0495595_0074127_553_1101 | 180 |
| 888 | 3300053085 | Ga0495619_0132791 | Ga0495619_0132791_536_1084 | 180 |
| 889 | 3300053085 | Ga0495619_0291805 | Ga0495619_0291805_501_1049 | 180 |
| 890 | 3300060353 | Ga0501082_0495701 | Ga0501082_0495701_245_796 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4xel-assembly1.cif.gz_A | crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa | 0.9357 | 2 | 174 |
| 4xel-assembly2.cif.gz_B | crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa | 0.9352 | 2 | 174 |
| 4xel-assembly1.cif.gz_A | crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa | 0.9253 | 2 | 174 |
| 4xel-assembly2.cif.gz_B | crystal structure of inorganic pyrophosphatase (ppase) from pseudomonas aeruginosa | 0.9246 | 2 | 174 |
| 3i4q-assembly1.cif.gz_A | structure of a putative inorganic pyrophosphatase from the oil-degrading bacterium oleispira antarctica | 0.9219 | 4 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i40A00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9189 | 2 | 175 | 3.90.80.10 |
| 1i40A00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9088 | 2 | 175 | 3.90.80.10 |
| 3q5vB00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9071 | 3 | 175 | 3.90.80.10 |
| 3emjE00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.8978 | 17 | 172 | 3.90.80.10 |
| af_A0A1D6HHJ7_152_313_3.90.80.10 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.8894 | 15 | 176 | 3.90.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257JFP8-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.991 | 68 | 176 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A3D5Q6T3-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.99 | 50 | 174 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A2M8TYQ3-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9875 | 73 | 175 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A1Y5ETG5-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9829 | 57 | 175 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A3M6FPT4-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9828 | 73 | 174 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar