F484832

General Info

Members Datasets Scaffolds Average Seq Length
890 442 858 213

Family's Representative Sequence

Representative Sequence 3300047445|Ga0495677_0189437|Ga0495677_0189437_47_769
Length 240
Sequence VAWTGWASSACASSDIASAIQGEYKTMKLYSYFRSSASYRVRIALNLKNLPYEYLPVHLLRDGGEQFKPEYRELNHDAIVPTLVDGDHVITQSLAIIEYLEETHPEPPLLPSKPVDRAYVRSIVQQLACEIHPLNNLRVLKYLKRTVGVNDEVKDAWYRHWISSGFAALEEYLVADGRAGKLCFGDTPTIADICLVPQVFNANRFNVDMSPYPTIRRICEHANTLDAFARAEPGVQPDAE

Samples

Sample ID Description Type Environment
1 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
2 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
5 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
6 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
7 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
8 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
9 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
10 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
11 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
12 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
13 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
14 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
15 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
16 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
17 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
18 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
19 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
20 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
21 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
22 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
23 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
24 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
25 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
26 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
27 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
28 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
29 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
35 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
41 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
42 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
43 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
50 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
63 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
73 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
74 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
75 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
76 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
91 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
147 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
151 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
158 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
233 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
234 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
235 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
236 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
237 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
238 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
241 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
242 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
243 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
247 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
248 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
249 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
250 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
251 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
252 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
255 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
256 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
259 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
264 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
265 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
266 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
277 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
278 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
279 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
280 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
281 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
282 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
283 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
284 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
285 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
286 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
287 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
288 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
289 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
290 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
291 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
292 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
293 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
294 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
295 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
296 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
297 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
298 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
299 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
300 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
301 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
302 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
303 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
308 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
309 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
310 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
311 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
314 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
315 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
316 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
317 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
318 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
319 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
320 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
321 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
322 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
327 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
328 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
329 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
330 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
333 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
334 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
340 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
341 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
344 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
345 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
348 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
349 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
354 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
355 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
356 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
357 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
358 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
359 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
360 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
361 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
362 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
363 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
364 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
365 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
366 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
373 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
374 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
375 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
376 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
377 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
378 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
379 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
380 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
381 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
382 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
383 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
386 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
405 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
406 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
407 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
408 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
409 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
410 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
411 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
412 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
413 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
414 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
415 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
416 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
417 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
418 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
419 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
420 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
422 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
423 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
424 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
425 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
426 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
427 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
428 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
429 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
430 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
431 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
432 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
433 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
434 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
435 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
436 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
439 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
440 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
441 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
442 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.4
Metatranscriptomes 0
Isolates 3.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 1.24
Rhizoplane 4.83
Rhizosphere 82.13
Stem 0
Stem Tuber 0
Unclassified 7.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000889 3300001979 Bacteria 13228
2 JGI24740J21852_10006469 3300001979 Bacteria 4847
3 JGI24739J22299_10005706 3300001989 Bacteria 4716
4 JGI24739J22299_10009956 3300001989 Bacteria 3535
5 JGI24737J22298_10003339 3300001990 Bacteria 5675
6 JGI24737J22298_10055780 3300001990 Bacteria 1194
7 JGI24735J21928_10026752 3300002067 Bacteria 1732
8 JGI24735J21928_10035864 3300002067 Bacteria 1456
9 JGI25156J39149_1003113 3300002705 Bacteria 5597
10 JGI25156J39149_1006429 3300002705 Bacteria 3211
11 JGI25165J46597_1001028 3300003214 Bacteria 18325
12 rootH2_10027978 3300003320 Bacteria 4153
13 rootH2_10164363 3300003320 Bacteria 1416
14 rootH1_10089386 3300003323 Bacteria 1516
15 rootH1_10089401 3300003323 Bacteria 2548
16 JGI25160J50197_1000049 3300003354 Bacteria 135107
17 Ga0055533_1000812 3300003756 Bacteria 9659
18 Ga0055533_1002173 3300003756 Bacteria 4672
19 Ga0055532_1000031 3300003758 Bacteria 231440
20 Ga0055527_1000020 3300003760 Bacteria 231441
21 Ga0055535_1000023 3300003761 Bacteria 231441
22 Ga0055542_1000035 3300003762 Bacteria 231441
23 Ga0055529_1000039 3300003763 Bacteria 231439
24 Ga0055524_1000227 3300003775 Bacteria 59891
25 Ga0055530_10002810 3300003791 Bacteria 10714
26 Ga0055540_1000112 3300003792 Bacteria 88200
27 Ga0055531_10004566 3300003794 Bacteria 8371
28 Ga0065165_1000115 3300005262 Bacteria 135145
29 Ga0065715_10415519 3300005293 Bacteria 864
30 Ga0070658_10012287 3300005327 Bacteria 6875
31 Ga0070658_10337362 3300005327 Bacteria 1289
32 Ga0070658_10530741 3300005327 Bacteria 1018
33 Ga0070676_10021508 3300005328 Bacteria 3611
34 Ga0070676_10048312 3300005328 Bacteria 2487
35 Ga0070676_10136706 3300005328 Bacteria 1556
36 Ga0070683_100026033 3300005329 Bacteria 5262
37 Ga0070683_100039236 3300005329 Bacteria 4346
38 Ga0070683_101199357 3300005329 Unclassified 729
39 Ga0070690_100010655 3300005330 Bacteria 5356
40 Ga0070670_100046023 3300005331 Bacteria 3751
41 Ga0070670_100088711 3300005331 Bacteria 2659
42 Ga0070670_100125628 3300005331 Bacteria 2214
43 Ga0070677_10000399 3300005333 Bacteria 15153
44 Ga0070666_10001754 3300005335 Bacteria 13241
45 Ga0070666_10021840 3300005335 Bacteria 4150
46 Ga0070666_10063686 3300005335 Bacteria 2500
47 Ga0070680_100010998 3300005336 Bacteria 6995
48 Ga0070680_100281712 3300005336 Bacteria 1408
49 Ga0068868_100011862 3300005338 Bacteria 6355
50 Ga0068868_100029926 3300005338 Bacteria 4173
51 Ga0070660_100002929 3300005339 Bacteria 11747
52 Ga0070660_100209189 3300005339 Bacteria 1583
53 Ga0070689_100141774 3300005340 Bacteria 1933
54 Ga0070689_100207343 3300005340 Bacteria 1603
55 Ga0070687_100080577 3300005343 Bacteria 1775
56 Ga0070661_100004617 3300005344 Bacteria 9478
57 Ga0070661_100006773 3300005344 Bacteria 7896
58 Ga0070661_100084021 3300005344 Bacteria 2352
59 Ga0070661_100167367 3300005344 Bacteria 1668
60 Ga0070668_100090767 3300005347 Bacteria 2407
61 Ga0070668_100477890 3300005347 Bacteria 1076
62 Ga0070669_100115617 3300005353 Bacteria 2041
63 Ga0070669_100351508 3300005353 Bacteria 1197
64 Ga0070675_100009122 3300005354 Bacteria 7703
65 Ga0070671_100004778 3300005355 Bacteria 10770
66 Ga0070671_100038311 3300005355 Bacteria 3979
67 Ga0070671_100056534 3300005355 Bacteria 3264
68 Ga0070671_100100596 3300005355 Bacteria 2425
69 Ga0070671_100586845 3300005355 Bacteria 962
70 Ga0070674_100004774 3300005356 Bacteria 7764
71 Ga0070674_100510262 3300005356 Bacteria 1003
72 Ga0070673_100001176 3300005364 Bacteria 15032
73 Ga0070673_100036445 3300005364 Bacteria 3739
74 Ga0070673_100082450 3300005364 Bacteria 2610
75 Ga0070673_100659868 3300005364 Bacteria 958
76 Ga0070659_100000992 3300005366 Bacteria 20821
77 Ga0070659_100002333 3300005366 Bacteria 13501
78 Ga0070659_100247849 3300005366 Bacteria 1476
79 Ga0070659_100329772 3300005366 Bacteria 1277
80 Ga0070667_100001817 3300005367 Bacteria 19009
81 Ga0070667_100053817 3300005367 Bacteria 3397
82 Ga0070667_100097359 3300005367 Bacteria 2538
83 Ga0070667_100100736 3300005367 Bacteria 2495
84 Ga0070667_100425927 3300005367 Bacteria 1210
85 Ga0070709_10026666 3300005434 Bacteria 3427
86 Ga0070709_10055155 3300005434 Bacteria 2508
87 Ga0070714_100208301 3300005435 Bacteria 1791
88 Ga0070710_10000687 3300005437 Bacteria 16064
89 Ga0070711_100048889 3300005439 Bacteria 2894
90 Ga0070708_100088896 3300005445 Bacteria 2810
91 Ga0070663_100010881 3300005455 Bacteria 5684
92 Ga0070663_100089547 3300005455 Bacteria 2278
93 Ga0070663_100221258 3300005455 Bacteria 1486
94 Ga0070663_100501530 3300005455 Bacteria 1008
95 Ga0070678_100016839 3300005456 Bacteria 4687
96 Ga0070678_100031328 3300005456 Bacteria 3667
97 Ga0070662_100022342 3300005457 Bacteria 4330
98 Ga0070662_100115356 3300005457 Bacteria 2052
99 Ga0070662_100133004 3300005457 Bacteria 1920
100 Ga0070662_100209925 3300005457 Bacteria 1549
101 Ga0070681_10029928 3300005458 Bacteria 5465
102 Ga0070681_10031291 3300005458 Bacteria 5342
103 Ga0070681_10082648 3300005458 Bacteria 3167
104 Ga0068867_100002533 3300005459 Bacteria 12859
105 Ga0068867_100132568 3300005459 Bacteria 1938
106 Ga0068867_100165044 3300005459 Bacteria 1749
107 Ga0070685_10280235 3300005466 Bacteria 1116
108 Ga0070685_10395354 3300005466 Bacteria 956
109 Ga0070706_100000081 3300005467 Bacteria 110012
110 Ga0070707_100003563 3300005468 Bacteria 14694
111 Ga0070698_100008005 3300005471 Bacteria 11430
112 Ga0070699_100039227 3300005518 Bacteria 4101
113 Ga0070679_100002835 3300005530 Bacteria 15761
114 Ga0070679_100030058 3300005530 Bacteria 5362
115 Ga0070679_100067751 3300005530 Bacteria 3560
116 Ga0070679_100445439 3300005530 Bacteria 1240
117 Ga0068853_100135144 3300005539 Bacteria 2210
118 Ga0068853_100462008 3300005539 Bacteria 1195
119 Ga0068853_100492388 3300005539 Bacteria 1157
120 Ga0070672_100001353 3300005543 Bacteria 15124
121 Ga0070686_100061340 3300005544 Bacteria 2430
122 Ga0070696_100014222 3300005546 Bacteria 5340
123 Ga0070696_100058271 3300005546 Bacteria 2697
124 Ga0070665_100006949 3300005548 Bacteria 11504
125 Ga0070704_100653068 3300005549 Bacteria 929
126 Ga0068855_100002695 3300005563 Bacteria 21894
127 Ga0068855_100142257 3300005563 Bacteria 2733
128 Ga0068855_100210048 3300005563 Bacteria 2188
129 Ga0070664_100001303 3300005564 Bacteria 19939
130 Ga0070664_100010774 3300005564 Bacteria 7413
131 Ga0070664_100022353 3300005564 Bacteria 5214
132 Ga0070664_100075187 3300005564 Bacteria 2900
133 Ga0068857_100130293 3300005577 Bacteria 2268
134 Ga0068854_100013554 3300005578 Bacteria 5354
135 Ga0068854_100109249 3300005578 Bacteria 2084
136 Ga0068854_100251747 3300005578 Bacteria 1411
137 Ga0068856_100169041 3300005614 Bacteria 2198
138 Ga0068856_100307473 3300005614 Bacteria 1603
139 Ga0068852_100004888 3300005616 Bacteria 9517
140 Ga0068852_100019610 3300005616 Bacteria 5357
141 Ga0068852_100176060 3300005616 Bacteria 2009
142 Ga0068859_100026469 3300005617 Bacteria 5817
143 Ga0068859_100055882 3300005617 Bacteria 3972
144 Ga0068859_100329870 3300005617 Bacteria 1620
145 Ga0068864_100002905 3300005618 Bacteria 14163
146 Ga0068864_100008255 3300005618 Bacteria 8589
147 Ga0068864_100010148 3300005618 Bacteria 7776
148 Ga0068864_100203958 3300005618 Bacteria 1818
149 Ga0068861_100502309 3300005719 Bacteria 1096
150 Ga0068851_10000682 3300005834 Bacteria 14458
151 Ga0068851_10014791 3300005834 Bacteria 3710
152 Ga0068851_10112506 3300005834 Bacteria 1455
153 Ga0068870_10005548 3300005840 Bacteria 5510
154 Ga0068863_100020671 3300005841 Bacteria 6287
155 Ga0068863_100040505 3300005841 Bacteria 4429
156 Ga0068863_100075683 3300005841 Bacteria 3185
157 Ga0068863_100654933 3300005841 Bacteria 1042
158 Ga0068858_100018916 3300005842 Bacteria 6445
159 Ga0068858_100026254 3300005842 Bacteria 5414
160 Ga0068858_100493384 3300005842 Bacteria 1183
161 Ga0068860_100011373 3300005843 Bacteria 8772
162 Ga0068860_100075558 3300005843 Bacteria 3205
163 Ga0068860_100284479 3300005843 Bacteria 1617
164 Ga0068862_100253870 3300005844 Bacteria 1603
165 Ga0068862_100458604 3300005844 Bacteria 1203
166 Ga0070717_10107482 3300006028 Bacteria 2376
167 Ga0070716_100003346 3300006173 Bacteria 7535
168 Ga0070712_100575436 3300006175 Bacteria 951
169 Ga0097621_100055900 3300006237 Bacteria 3223
170 Ga0097621_100093463 3300006237 Bacteria 2520
171 Ga0068871_100009917 3300006358 Bacteria 6916
172 Ga0068871_100036215 3300006358 Bacteria 3927
173 Ga0075428_100006608 3300006844 Bacteria 12900
174 Ga0075434_100013352 3300006871 Bacteria 7811
175 Ga0075429_100189143 3300006880 Bacteria 1804
176 Ga0068865_100148565 3300006881 Bacteria 1775
177 Ga0097620_100026466 3300006931 Bacteria 5817
178 Ga0097620_100055883 3300006931 Bacteria 3972
179 Ga0097620_100329902 3300006931 Bacteria 1620
180 Ga0079104_1000024 3300006946 Bacteria 219543
181 Ga0075435_100003277 3300007076 Bacteria 10966
182 Ga0075435_100212104 3300007076 Unclassified 1643
183 Ga0105251_10000055 3300009011 Bacteria 105044
184 Ga0105251_10074907 3300009011 Bacteria 1572
185 Ga0105251_10119186 3300009011 Bacteria 1199
186 Ga0105240_10018564 3300009093 Bacteria 9335
187 Ga0105240_10018809 3300009093 Bacteria 9255
188 Ga0105240_10213594 3300009093 Bacteria 2253
189 Ga0111539_10003392 3300009094 Bacteria 20991
190 Ga0111539_10676885 3300009094 Bacteria 1201
191 Ga0105245_10713086 3300009098 Bacteria 1037
192 Ga0114129_10030470 3300009147 Bacteria 7634
193 Ga0105241_10128121 3300009174 Bacteria 2051
194 Ga0105248_10014587 3300009177 Bacteria 8648
195 Ga0105248_10038638 3300009177 Bacteria 5343
196 Ga0105248_10072671 3300009177 Bacteria 3866
197 Ga0105248_10395338 3300009177 Bacteria 1556
198 Ga0105248_10434122 3300009177 Bacteria 1479
199 Ga0105248_10510868 3300009177 Bacteria 1355
200 Ga0105248_10604481 3300009177 Bacteria 1237
201 Ga0105237_10928525 3300009545 Bacteria 877
202 Ga0105238_10305285 3300009551 Bacteria 1576
203 Ga0105238_10686404 3300009551 Bacteria 1036
204 Ga0105238_11150796 3300009551 Bacteria 799
205 Ga0105249_10095511 3300009553 Bacteria 2787
206 Ga0099796_10001431 3300010159 Bacteria 4799
207 Ga0105246_10055179 3300011119 Bacteria 2741
208 Ga0157373_10119341 3300013100 Bacteria 1854
209 Ga0157373_10423949 3300013100 Bacteria 955
210 Ga0157371_10181944 3300013102 Bacteria 1503
211 Ga0157370_10272942 3300013104 Bacteria 1562
212 Ga0157370_10362695 3300013104 Bacteria 1335
213 Ga0157370_10370932 3300013104 Bacteria 1319
214 Ga0157370_10656931 3300013104 Bacteria 958
215 Ga0157369_10001611 3300013105 Bacteria 27624
216 Ga0157369_10005258 3300013105 Bacteria 15094
217 Ga0157369_10015435 3300013105 Bacteria 8609
218 Ga0157369_10092640 3300013105 Bacteria 3225
219 Ga0157369_10153297 3300013105 Bacteria 2435
220 Ga0157369_10232541 3300013105 Bacteria 1927
221 Ga0157369_10720790 3300013105 Bacteria 1027
222 Ga0157374_10040250 3300013296 Bacteria 4303
223 Ga0157374_10223996 3300013296 Bacteria 1846
224 Ga0163162_10140431 3300013306 Bacteria 2529
225 Ga0163162_11524306 3300013306 Bacteria 762
226 Ga0157372_10070907 3300013307 Bacteria 3922
227 Ga0157372_10102817 3300013307 Bacteria 3264
228 Ga0157372_10252566 3300013307 Bacteria 2047
229 Ga0157375_10003757 3300013308 Bacteria 13163
230 Ga0157375_10074842 3300013308 Bacteria 3409
231 Ga0157375_10632453 3300013308 Bacteria 1227
232 Ga0163163_10046750 3300014325 Bacteria 4251
233 Ga0163163_10066448 3300014325 Bacteria 3581
234 Ga0163163_10145931 3300014325 Bacteria 2410
235 Ga0163163_10584683 3300014325 Bacteria 1180
236 Ga0157380_10070253 3300014326 Bacteria 2829
237 Ga0157380_10363460 3300014326 Bacteria 1359
238 Ga0157380_10446541 3300014326 Bacteria 1241
239 Ga0182008_10009309 3300014497 Bacteria 5308
240 Ga0182008_10047944 3300014497 Bacteria 2122
241 Ga0182008_10173994 3300014497 Bacteria 1088
242 Ga0182008_10280742 3300014497 Bacteria 867
243 Ga0157379_10034731 3300014968 Bacteria 4497
244 Ga0157379_10089259 3300014968 Bacteria 2765
245 Ga0157376_10235683 3300014969 Bacteria 1702
246 Ga0157376_10258047 3300014969 Bacteria 1631
247 Ga0157376_11455334 3300014969 Bacteria 717
248 Ga0182007_10001200 3300015262 Bacteria 14066
249 Ga0183361_10001 3300016635 Bacteria 908583
250 Ga0163161_10021774 3300017792 Bacteria 4507
251 Ga0163161_10210085 3300017792 Bacteria 1503
252 Ga0213876_10065229 3300021384 Bacteria 1922
253 Ga0209435_112808 3300025206 Bacteria 894
254 Ga0209674_100017 3300025226 Bacteria 689087
255 Ga0209674_100287 3300025226 Bacteria 36895
256 Ga0209672_100001 3300025228 Bacteria 2828210
257 Ga0209147_100001 3300025229 Bacteria 2384371
258 Ga0209563_101394 3300025230 Bacteria 6469
259 Ga0207427_101345 3300025231 Bacteria 9088
260 Ga0209258_100001 3300025242 Bacteria 2384269
261 Ga0209646_1007651 3300025246 Bacteria 1754
262 Ga0209148_1000003 3300025254 Bacteria 2384288
263 Ga0209759_1000037 3300025256 Bacteria 259200
264 Ga0209759_1000649 3300025256 Bacteria 32356
265 Ga0209759_1019104 3300025256 Bacteria 1636
266 Ga0209233_1000123 3300025261 Bacteria 228400
267 Ga0209455_1000001 3300025272 Bacteria 2384278
268 Ga0209130_1011142 3300025284 Bacteria 2423
269 Ga0209675_1010464 3300025291 Bacteria 3164
270 Ga0209050_1001849 3300025298 Bacteria 20458
271 Ga0209050_1066981 3300025298 Bacteria 820
272 Ga0209256_1000011 3300025299 Bacteria 865309
273 Ga0207426_1000007 3300025302 Bacteria 971011
274 Ga0209051_1000016 3300025303 Bacteria 541891
275 Ga0209257_1000510 3300025304 Bacteria 67777
276 Ga0207656_10011120 3300025321 Bacteria 3392
277 Ga0207656_10053425 3300025321 Bacteria 1753
278 Ga0207656_10205865 3300025321 Bacteria 952
279 Ga0207656_10283570 3300025321 Bacteria 817
280 Ga0207713_1000089 3300025735 Bacteria 152927
281 Ga0207713_1000106 3300025735 Bacteria 137911
282 Ga0207682_10000075 3300025893 Bacteria 43404
283 Ga0207682_10024073 3300025893 Bacteria 2408
284 Ga0207682_10117676 3300025893 Bacteria 1176
285 Ga0207680_10001434 3300025903 Bacteria 11296
286 Ga0207680_10005169 3300025903 Bacteria 6226
287 Ga0207647_10000540 3300025904 Bacteria 30173
288 Ga0207647_10007729 3300025904 Bacteria 7740
289 Ga0207647_10007746 3300025904 Bacteria 7732
290 Ga0207647_10351345 3300025904 Bacteria 835
291 Ga0207699_10003665 3300025906 Bacteria 7336
292 Ga0207645_10000152 3300025907 Bacteria 54586
293 Ga0207645_10235406 3300025907 Bacteria 1209
294 Ga0207643_10026800 3300025908 Bacteria 3193
295 Ga0207643_10220595 3300025908 Bacteria 1160
296 Ga0207705_10000942 3300025909 Bacteria 23772
297 Ga0207705_10017299 3300025909 Bacteria 5162
298 Ga0207705_10104005 3300025909 Bacteria 2092
299 Ga0207705_10111230 3300025909 Bacteria 2024
300 Ga0207705_10707150 3300025909 Bacteria 783
301 Ga0207684_10000069 3300025910 Bacteria 189217
302 Ga0207707_10021943 3300025912 Bacteria 5580
303 Ga0207707_10062495 3300025912 Bacteria 3241
304 Ga0207695_10046710 3300025913 Bacteria 4588
305 Ga0207695_10049156 3300025913 Bacteria 4448
306 Ga0207695_10105735 3300025913 Bacteria 2801
307 Ga0207671_10086742 3300025914 Bacteria 2353
308 Ga0207671_10228765 3300025914 Bacteria 1458
309 Ga0207693_10067061 3300025915 Bacteria 2810
310 Ga0207693_10460304 3300025915 Bacteria 994
311 Ga0207660_10107553 3300025917 Bacteria 2093
312 Ga0207660_10428591 3300025917 Bacteria 1068
313 Ga0207660_10623250 3300025917 Bacteria 879
314 Ga0207662_10023331 3300025918 Bacteria 3555
315 Ga0207657_10002608 3300025919 Bacteria 19479
316 Ga0207657_10178669 3300025919 Bacteria 1716
317 Ga0207657_10389313 3300025919 Bacteria 1097
318 Ga0207649_10055418 3300025920 Bacteria 2471
319 Ga0207649_10059731 3300025920 Bacteria 2393
320 Ga0207649_10395062 3300025920 Bacteria 1033
321 Ga0207652_10000875 3300025921 Bacteria 28516
322 Ga0207652_10114033 3300025921 Bacteria 2399
323 Ga0207652_10162990 3300025921 Bacteria 1999
324 Ga0207652_10213684 3300025921 Bacteria 1737
325 Ga0207652_10782013 3300025921 Bacteria 848
326 Ga0207646_10032220 3300025922 Bacteria 4743
327 Ga0207681_10112870 3300025923 Bacteria 1980
328 Ga0207681_10511063 3300025923 Bacteria 985
329 Ga0207694_10815057 3300025924 Bacteria 789
330 Ga0207650_10069709 3300025925 Bacteria 2642
331 Ga0207650_10095222 3300025925 Bacteria 2282
332 Ga0207659_10039835 3300025926 Bacteria 3281
333 Ga0207659_10109538 3300025926 Bacteria 2097
334 Ga0207687_10573601 3300025927 Bacteria 948
335 Ga0207700_10192761 3300025928 Bacteria 1713
336 Ga0207700_10656578 3300025928 Bacteria 935
337 Ga0207664_10021433 3300025929 Bacteria 4805
338 Ga0207644_10008849 3300025931 Bacteria 6593
339 Ga0207644_10009420 3300025931 Bacteria 6411
340 Ga0207644_10130928 3300025931 Bacteria 1920
341 Ga0207644_10164041 3300025931 Bacteria 1729
342 Ga0207644_10240734 3300025931 Bacteria 1440
343 Ga0207690_10002394 3300025932 Bacteria 11356
344 Ga0207690_10034238 3300025932 Bacteria 3272
345 Ga0207706_10036885 3300025933 Bacteria 4342
346 Ga0207706_10086107 3300025933 Bacteria 2762
347 Ga0207706_10166742 3300025933 Bacteria 1936
348 Ga0207706_10398724 3300025933 Bacteria 1193
349 Ga0207686_10133879 3300025934 Bacteria 1704
350 Ga0207709_10199323 3300025935 Bacteria 1428
351 Ga0207670_10167694 3300025936 Bacteria 1644
352 Ga0207669_10001543 3300025937 Bacteria 9822
353 Ga0207704_10146880 3300025938 Bacteria 1658
354 Ga0207691_10000006 3300025940 Bacteria 161922
355 Ga0207691_10039639 3300025940 Bacteria 4358
356 Ga0207711_10037329 3300025941 Bacteria 4126
357 Ga0207711_10049621 3300025941 Bacteria 3593
358 Ga0207711_10057099 3300025941 Bacteria 3356
359 Ga0207661_10087594 3300025944 Bacteria 2586
360 Ga0207679_10007965 3300025945 Bacteria 6738
361 Ga0207679_10008555 3300025945 Bacteria 6520
362 Ga0207679_10049964 3300025945 Bacteria 3053
363 Ga0207679_10282040 3300025945 Bacteria 1425
364 Ga0207667_10002493 3300025949 Bacteria 22937
365 Ga0207667_10151210 3300025949 Bacteria 2389
366 Ga0207667_10166893 3300025949 Bacteria 2263
367 Ga0207651_10003988 3300025960 Bacteria 7337
368 Ga0207651_10015082 3300025960 Bacteria 4480
369 Ga0207651_10047169 3300025960 Bacteria 2903
370 Ga0207712_10094260 3300025961 Bacteria 2211
371 Ga0207668_10007730 3300025972 Bacteria 6396
372 Ga0207668_10092700 3300025972 Bacteria 2224
373 Ga0207668_10167720 3300025972 Bacteria 1719
374 Ga0207640_10009133 3300025981 Bacteria 5537
375 Ga0207640_10062385 3300025981 Bacteria 2473
376 Ga0207640_10159122 3300025981 Bacteria 1669
377 Ga0207640_10882171 3300025981 Bacteria 780
378 Ga0207658_10003664 3300025986 Bacteria 10837
379 Ga0207658_10041926 3300025986 Bacteria 3317
380 Ga0207658_10070544 3300025986 Bacteria 2644
381 Ga0207658_10076087 3300025986 Bacteria 2556
382 Ga0207658_10209577 3300025986 Bacteria 1632
383 Ga0207658_10392337 3300025986 Bacteria 1218
384 Ga0207658_10493470 3300025986 Bacteria 1090
385 Ga0207677_10014400 3300026023 Bacteria 4617
386 Ga0207677_10145959 3300026023 Bacteria 1818
387 Ga0207703_10011799 3300026035 Bacteria 6802
388 Ga0207703_10486578 3300026035 Bacteria 1157
389 Ga0207639_10009225 3300026041 Bacteria 6802
390 Ga0207639_10013414 3300026041 Bacteria 5736
391 Ga0207639_10123248 3300026041 Bacteria 2133
392 Ga0207639_10160529 3300026041 Bacteria 1894
393 Ga0207639_10467091 3300026041 Bacteria 1148
394 Ga0207678_10003179 3300026067 Bacteria 14855
395 Ga0207678_10006058 3300026067 Bacteria 10756
396 Ga0207678_10008744 3300026067 Bacteria 8913
397 Ga0207678_10041652 3300026067 Bacteria 3982
398 Ga0207678_10149684 3300026067 Bacteria 1992
399 Ga0207678_10170178 3300026067 Bacteria 1860
400 Ga0207702_10038338 3300026078 Bacteria 4013
401 Ga0207702_10593330 3300026078 Bacteria 1086
402 Ga0207641_10031582 3300026088 Bacteria 4393
403 Ga0207641_10038663 3300026088 Bacteria 3989
404 Ga0207641_10060392 3300026088 Bacteria 3231
405 Ga0207641_10528273 3300026088 Bacteria 1148
406 Ga0207648_10006993 3300026089 Bacteria 11157
407 Ga0207648_10061894 3300026089 Bacteria 3263
408 Ga0207648_10201635 3300026089 Bacteria 1764
409 Ga0207648_10329465 3300026089 Bacteria 1373
410 Ga0207648_10749895 3300026089 Bacteria 907
411 Ga0207676_10012674 3300026095 Bacteria 6047
412 Ga0207676_10305279 3300026095 Bacteria 1455
413 Ga0207676_10319664 3300026095 Bacteria 1424
414 Ga0207676_10371533 3300026095 Bacteria 1328
415 Ga0207674_10001888 3300026116 Bacteria 26661
416 Ga0207674_10125523 3300026116 Bacteria 2532
417 Ga0207674_10691022 3300026116 Bacteria 985
418 Ga0207675_100045649 3300026118 Bacteria 4094
419 Ga0207675_100070693 3300026118 Bacteria 3262
420 Ga0207675_100113535 3300026118 Bacteria 2558
421 Ga0207675_101364417 3300026118 Bacteria 729
422 Ga0207683_10000056 3300026121 Bacteria 84718
423 Ga0207683_10170817 3300026121 Bacteria 1969
424 Ga0207698_10009478 3300026142 Bacteria 6212
425 Ga0207698_10140275 3300026142 Bacteria 2081
426 Ga0207698_10195752 3300026142 Bacteria 1805
427 Ga0207698_10323449 3300026142 Bacteria 1445
428 Ga0207698_10999551 3300026142 Bacteria 847
429 Ga0209281_1000104 3300027111 Bacteria 221056
430 Ga0268266_10016093 3300028379 Bacteria 6393
431 Ga0268266_10116828 3300028379 Bacteria 2370
432 Ga0268266_10242898 3300028379 Bacteria 1663
433 Ga0268265_10606689 3300028380 Bacteria 1047
434 Ga0268264_10012022 3300028381 Bacteria 7127
435 Ga0268264_10092467 3300028381 Bacteria 2611
436 Ga0268264_10745804 3300028381 Bacteria 975
437 Ga0265318_10004018 3300028577 Bacteria 7224
438 Ga0307515_10002278 3300028794 Bacteria 42025
439 Ga0307515_10002502 3300028794 Bacteria 39826
440 Ga0307515_10011678 3300028794 Bacteria 16633
441 Ga0265338_10000118 3300028800 Bacteria 146710
442 Ga0265338_10016067 3300028800 Bacteria 8172
443 Ga0265338_10018147 3300028800 Bacteria 7548
444 Ga0307512_10028633 3300030522 Bacteria 4881
445 Ga0265330_10005332 3300031235 Bacteria 6409
446 Ga0265332_10000594 3300031238 Bacteria 23783
447 Ga0265328_10028397 3300031239 Bacteria 2092
448 Ga0265325_10000101 3300031241 Bacteria 60537
449 Ga0265329_10004983 3300031242 Bacteria 5432
450 Ga0265340_10114709 3300031247 Bacteria 1243
451 Ga0265339_10001142 3300031249 Bacteria 20029
452 Ga0265331_10000003 3300031250 Bacteria 499358
453 Ga0265331_10016246 3300031250 Bacteria 3912
454 Ga0265331_10022491 3300031250 Bacteria 3216
455 Ga0265327_10000012 3300031251 Bacteria 530403
456 Ga0265327_10028073 3300031251 Bacteria 3226
457 Ga0265316_10009477 3300031344 Bacteria 8970
458 Ga0265316_10014358 3300031344 Bacteria 6975
459 Ga0265316_10353726 3300031344 Bacteria 1063
460 Ga0307513_10049503 3300031456 Bacteria 4551
461 Ga0307513_10161808 3300031456 Bacteria 2130
462 Ga0307513_10247707 3300031456 Bacteria 1581
463 Ga0307513_10421703 3300031456 Bacteria 1064
464 Ga0307408_100098039 3300031548 Bacteria 2227
465 Ga0307408_100262570 3300031548 Bacteria 1430
466 Ga0307408_100275031 3300031548 Bacteria 1400
467 Ga0265313_10008276 3300031595 Bacteria 6936
468 Ga0307508_10000061 3300031616 Bacteria 124749
469 Ga0307514_10003371 3300031649 Bacteria 15418
470 Ga0265314_10009671 3300031711 Bacteria 8117
471 Ga0265314_10011562 3300031711 Bacteria 7272
472 Ga0265342_10006799 3300031712 Bacteria 8466
473 Ga0307516_10009896 3300031730 Bacteria 10571
474 Ga0307516_10462540 3300031730 Bacteria 924
475 Ga0307405_10046904 3300031731 Bacteria 2658
476 Ga0307405_10120894 3300031731 Bacteria 1792
477 Ga0307405_10145811 3300031731 Bacteria 1658
478 Ga0307413_10012332 3300031824 Bacteria 4250
479 Ga0307413_10024980 3300031824 Bacteria 3266
480 Ga0307413_10138235 3300031824 Bacteria 1679
481 Ga0307410_10001663 3300031852 Bacteria 10224
482 Ga0307410_10012652 3300031852 Bacteria 4889
483 Ga0307410_10354745 3300031852 Bacteria 1173
484 Ga0307406_10095006 3300031901 Bacteria 2016
485 Ga0307407_10088037 3300031903 Bacteria 1896
486 Ga0307407_10094699 3300031903 Bacteria 1839
487 Ga0307412_10000014 3300031911 Bacteria 353795
488 Ga0307412_10000107 3300031911 Bacteria 66833
489 Ga0307412_10197917 3300031911 Bacteria 1524
490 Ga0307409_100013592 3300031995 Bacteria 5249
491 Ga0307409_100053047 3300031995 Bacteria 3113
492 Ga0307416_100066514 3300032002 Bacteria 2967
493 Ga0307416_100134263 3300032002 Bacteria 2235
494 Ga0307416_100233750 3300032002 Bacteria 1774
495 Ga0307414_10003535 3300032004 Bacteria 8360
496 Ga0307414_10031322 3300032004 Bacteria 3487
497 Ga0307414_10318725 3300032004 Bacteria 1322
498 Ga0307414_10964554 3300032004 Bacteria 784
499 Ga0307411_10127017 3300032005 Bacteria 1856
500 Ga0307411_10167506 3300032005 Bacteria 1653
501 Ga0307411_10255936 3300032005 Bacteria 1379
502 Ga0307411_10302755 3300032005 Bacteria 1283
503 Ga0307415_100003894 3300032126 Bacteria 7667
504 Ga0307415_100048159 3300032126 Bacteria 2874
505 Ga0307415_100068202 3300032126 Bacteria 2488
506 Ga0307415_100525703 3300032126 Bacteria 1039
507 Ga0307415_100573781 3300032126 Bacteria 999
508 Ga0373930_0067189 3300034816 Bacteria 810
509 Ga0373934_0005617 3300035086 Bacteria 4645
510 Ga0373944_0063867 3300035089 Bacteria 1186
511 Ga0373956_0193661 3300035119 Bacteria 963
512 Ga0373955_0144320 3300035172 Bacteria 1397
513 Ga0373933_0002160 3300035724 Bacteria 11258
514 Ga0373937_0009077 3300036401 Bacteria 8630
515 Ga0373937_1058924 3300036401 Bacteria 760
516 Ga0395899_0039792 3300037312 Bacteria 3518
517 Ga0395899_0041620 3300037312 Bacteria 3432
518 Ga0395899_0054764 3300037312 Bacteria 2951
519 Ga0395899_0057485 3300037312 Bacteria 2871
520 Ga0395899_0202333 3300037312 Bacteria 1384
521 Ga0395900_0000289 3300037418 Bacteria 75525
522 Ga0395900_0005557 3300037418 Bacteria 13198
523 Ga0395900_0017419 3300037418 Bacteria 7333
524 Ga0395900_0030258 3300037418 Bacteria 5558
525 Ga0395900_0041582 3300037418 Bacteria 4738
526 Ga0395900_0064995 3300037418 Bacteria 3747
527 Ga0395900_0081355 3300037418 Bacteria 3327
528 Ga0395900_0119778 3300037418 Bacteria 2701
529 Ga0395900_0136156 3300037418 Bacteria 2516
530 Ga0395900_0159281 3300037418 Bacteria 2303
531 Ga0395900_0427414 3300037418 Bacteria 1284
532 Ga0395900_0518352 3300037418 Bacteria 1140
533 Ga0395898_0017554 3300037466 Bacteria 7304
534 Ga0395898_0017933 3300037466 Bacteria 7223
535 Ga0395898_0035202 3300037466 Bacteria 4983
536 Ga0395898_0127088 3300037466 Bacteria 2442
537 Ga0395898_0163348 3300037466 Bacteria 2130
538 Ga0395898_0383958 3300037466 Bacteria 1339
539 Ga0395898_0511909 3300037466 Bacteria 1141
540 Ga0395905_0000014 3300037471 Bacteria 394209
541 Ga0395905_0000215 3300037471 Bacteria 89274
542 Ga0395905_0014942 3300037471 Bacteria 7405
543 Ga0395905_0025629 3300037471 Bacteria 5560
544 Ga0395905_0039581 3300037471 Bacteria 4423
545 Ga0395905_0058195 3300037471 Bacteria 3614
546 Ga0395905_0079215 3300037471 Bacteria 3079
547 Ga0395905_0144321 3300037471 Bacteria 2240
548 Ga0395905_0158652 3300037471 Bacteria 2127
549 Ga0395905_0183495 3300037471 Bacteria 1964
550 Ga0395905_0215866 3300037471 Bacteria 1796
551 Ga0395905_0298807 3300037471 Bacteria 1497
552 Ga0395905_0503407 3300037471 Bacteria 1111
553 Ga0395905_0567640 3300037471 Bacteria 1036
554 Ga0395905_0790714 3300037471 Bacteria 852
555 Ga0395901_0001244 3300038443 Bacteria 27197
556 Ga0395901_0005184 3300038443 Bacteria 13153
557 Ga0395901_0081384 3300038443 Bacteria 3383
558 Ga0395901_0168234 3300038443 Bacteria 2300
559 Ga0395901_0171658 3300038443 Bacteria 2275
560 Ga0395901_0201713 3300038443 Bacteria 2085
561 Ga0395901_0258911 3300038443 Bacteria 1811
562 Ga0395901_0322603 3300038443 Bacteria 1598
563 Ga0395901_0380814 3300038443 Bacteria 1452
564 Ga0395901_0499111 3300038443 Bacteria 1239
565 Ga0395901_1404494 3300038443 Bacteria 656
566 Ga0436365_1594720 3300039437 Bacteria 3962
567 Ga0439439_0044273 3300041406 Bacteria 1159
568 Ga0451791_0575998 3300041451 Bacteria 1230
569 Ga0451793_0793577 3300041452 Bacteria 947
570 Ga0451797_0999178 3300041453 Bacteria 1129
571 Ga0451800_0643375 3300041459 Bacteria 713
572 Ga0451841_0395393 3300041498 Bacteria 1027
573 Ga0451851_0944863 3300041507 Bacteria 760
574 Ga0451843_0784537 3300041509 Bacteria 926
575 Ga0451853_3344173 3300041512 Bacteria 956
576 Ga0439448_0009747 3300042005 Bacteria 2835
577 Ga0439432_005945 3300042006 Bacteria 4380
578 Ga0439432_022408 3300042006 Bacteria 2086
579 Ga0439449_0107195 3300042007 Bacteria 1034
580 Ga0450912_000085 3300042116 Bacteria 3104
581 Ga0450920_004850 3300042122 Bacteria 2378
582 Ga0450889_031235 3300042144 Bacteria 623
583 Ga0439446_0009840 3300042156 Bacteria 2566
584 Ga0439458_0000200 3300042157 Bacteria 13792
585 Ga0439458_0001759 3300042157 Bacteria 5394
586 Ga0439434_0069678 3300042435 Bacteria 1106
587 Ga0439464_0088987 3300042439 Unclassified 929
588 Ga0450918_001122 3300042531 Bacteria 5499
589 Ga0451577_0708316 3300042876 Bacteria 912
590 Ga0453683_0000640 3300044673 Bacteria 37852
591 Ga0466966_0121667 3300044684 Bacteria 1603
592 Ga0466961_0197442 3300044693 Bacteria 1245
593 Ga0466963_0000326 3300044694 Bacteria 21596
594 Ga0466963_0037475 3300044694 Bacteria 3166
595 Ga0466963_0486500 3300044694 Bacteria 871
596 Ga0466963_0575397 3300044694 Bacteria 795
597 Ga0466964_0057568 3300044706 Bacteria 1609
598 Ga0466971_0092870 3300044719 Bacteria 1383
599 Ga0466957_0000787 3300044842 Bacteria 16194
600 Ga0466957_0373484 3300044842 Bacteria 971
601 Ga0466957_0378015 3300044842 Bacteria 965
602 Ga0466958_0131366 3300045836 Bacteria 1572
603 Ga0466958_0217249 3300045836 Bacteria 1219
604 Ga0466967_0000100 3300045976 Bacteria 31122
605 Ga0466967_0076205 3300045976 Bacteria 3016
606 Ga0466967_0125850 3300045976 Bacteria 2374
607 Ga0466967_0187199 3300045976 Bacteria 1955
608 Ga0466967_0225023 3300045976 Bacteria 1784
609 Ga0466967_0401696 3300045976 Bacteria 1333
610 Ga0466967_0994323 3300045976 Bacteria 835
611 Ga0495592_0040739 3300046454 Bacteria 3484
612 Ga0495592_0185342 3300046454 Bacteria 1414
613 Ga0495603_0016605 3300046455 Bacteria 4454
614 Ga0495603_0301266 3300046455 Bacteria 921
615 Ga0495590_0041346 3300046457 Bacteria 1607
616 Ga0495629_0003125 3300046459 Bacteria 12552
617 Ga0495629_0003148 3300046459 Bacteria 12497
618 Ga0495629_0323467 3300046459 Bacteria 1054
619 Ga0495653_0014931 3300046463 Bacteria 6334
620 Ga0495653_0240220 3300046463 Bacteria 1208
621 Ga0495653_0246511 3300046463 Bacteria 1187
622 Ga0495650_0018718 3300046471 Bacteria 3434
623 Ga0495650_0042657 3300046471 Bacteria 1930
624 Ga0495650_0061671 3300046471 Bacteria 1501
625 Ga0495580_0004970 3300046472 Bacteria 11109
626 Ga0495580_0013759 3300046472 Bacteria 6161
627 Ga0495580_0019504 3300046472 Bacteria 5038
628 Ga0495580_0180777 3300046472 Bacteria 1456
629 Ga0495582_0004146 3300046473 Bacteria 8147
630 Ga0495605_0012407 3300046474 Bacteria 4728
631 Ga0495605_0026161 3300046474 Bacteria 3034
632 Ga0495605_0184036 3300046474 Bacteria 917
633 Ga0495662_0015160 3300046476 Bacteria 3744
634 Ga0495664_0010186 3300046477 Bacteria 5275
635 Ga0495664_0047247 3300046477 Bacteria 2554
636 Ga0495584_0221449 3300046491 Bacteria 962
637 Ga0495583_0009452 3300046506 Bacteria 5822
638 Ga0495606_0011868 3300046507 Bacteria 7050
639 Ga0495608_0030601 3300046511 Bacteria 3643
640 Ga0495610_0008911 3300046512 Bacteria 6426
641 Ga0495610_0024862 3300046512 Bacteria 3226
642 Ga0495616_0032976 3300046513 Bacteria 2702
643 Ga0495618_0008272 3300046514 Bacteria 6299
644 Ga0495620_0105336 3300046515 Bacteria 1121
645 Ga0495628_0060419 3300046516 Bacteria 2973
646 Ga0495628_0338683 3300046516 Bacteria 1107
647 Ga0495632_0011199 3300046519 Bacteria 5251
648 Ga0495643_0063557 3300046522 Bacteria 1952
649 Ga0495643_0092042 3300046522 Bacteria 1563
650 Ga0495648_0067124 3300046524 Bacteria 2099
651 Ga0495666_0003678 3300046526 Bacteria 7750
652 Ga0495642_0019199 3300046528 Bacteria 2679
653 Ga0495642_0126731 3300046528 Bacteria 1098
654 Ga0495652_0016973 3300046529 Bacteria 6504
655 Ga0495640_0011543 3300046533 Bacteria 6793
656 Ga0495645_0105323 3300046543 Bacteria 2001
657 Ga0495622_0066549 3300046557 Bacteria 1665
658 Ga0495625_0003328 3300046660 Bacteria 16189
659 Ga0495635_0004906 3300046663 Bacteria 9303
660 Ga0495599_0000114 3300046678 Bacteria 53722
661 Ga0495623_0070373 3300046679 Bacteria 2179
662 Ga0495646_0004942 3300046680 Bacteria 8419
663 Ga0495646_0018335 3300046680 Bacteria 4432
664 Ga0495658_0245404 3300046683 Bacteria 1125
665 Ga0495669_0000090 3300046684 Bacteria 60222
666 Ga0495669_0063652 3300046684 Bacteria 1673
667 Ga0495613_0094984 3300046689 Bacteria 2157
668 Ga0495624_0054505 3300046690 Bacteria 2520
669 Ga0495649_0006836 3300046694 Bacteria 7061
670 Ga0495649_0018654 3300046694 Bacteria 3900
671 Ga0495649_0243515 3300046694 Bacteria 925
672 Ga0495589_0018927 3300046794 Bacteria 3532
673 Ga0495589_0056398 3300046794 Bacteria 1934
674 Ga0495589_0095974 3300046794 Bacteria 1438
675 Ga0495600_0050291 3300046809 Bacteria 2719
676 Ga0495660_0110930 3300046810 Bacteria 1400
677 Ga0495581_0002005 3300047315 Bacteria 11435
678 Ga0495604_0028444 3300047317 Bacteria 4447
679 Ga0495604_0381199 3300047317 Bacteria 931
680 Ga0495674_0002606 3300047319 Bacteria 17571
681 Ga0495676_0054810 3300047321 Bacteria 3166
682 Ga0495680_0047724 3300047322 Bacteria 3366
683 Ga0495683_0003499 3300047323 Bacteria 9144
684 Ga0495683_0011753 3300047323 Bacteria 4604
685 Ga0495683_0021096 3300047323 Bacteria 3357
686 Ga0495683_0063273 3300047323 Bacteria 1828
687 Ga0495683_0161249 3300047323 Bacteria 1037
688 Ga0495687_023970 3300047443 Bacteria 2908
689 Ga0495687_024023 3300047443 Bacteria 2904
690 Ga0495675_0007254 3300047444 Bacteria 6828
691 Ga0495675_0091118 3300047444 Bacteria 1913
692 Ga0495677_0189437 3300047445 Bacteria 798
693 Ga0495679_040396 3300047446 Bacteria 1450
694 Ga0495673_0019901 3300047469 Bacteria 3353
695 Ga0495681_0136042 3300047470 Bacteria 1042
696 Ga0495686_0000014 3300047472 Bacteria 474014
697 Ga0495686_0076142 3300047472 Bacteria 2056
698 Ga0495593_0012015 3300047673 Bacteria 4962
699 Ga0495593_0012819 3300047673 Bacteria 4788
700 Ga0495593_0101879 3300047673 Bacteria 1472
701 Ga0495602_0027443 3300048088 Bacteria 5470
702 Ga0495602_0050386 3300048088 Bacteria 3720
703 Ga0495614_0003643 3300048089 Bacteria 6905
704 Ga0495626_0027353 3300048091 Bacteria 2774
705 Ga0495626_0088863 3300048091 Bacteria 1361
706 Ga0496100_0060295 3300048903 Bacteria 2496
707 Ga0496100_0082475 3300048903 Bacteria 2174
708 Ga0496101_0023541 3300048904 Bacteria 4256
709 Ga0496101_0103037 3300048904 Bacteria 2138
710 Ga0496101_0143126 3300048904 Bacteria 1824
711 Ga0496102_0060786 3300048905 Bacteria 3456
712 Ga0496102_0672452 3300048905 Bacteria 958
713 Ga0496103_0002910 3300048906 Bacteria 10613
714 Ga0496103_0006948 3300048906 Bacteria 6759
715 Ga0496104_0040840 3300048907 Bacteria 4349
716 Ga0496104_0048947 3300048907 Bacteria 3985
717 Ga0496104_0185297 3300048907 Bacteria 1992
718 Ga0496104_0193490 3300048907 Bacteria 1946
719 Ga0496105_0031288 3300048908 Bacteria 4363
720 Ga0496105_0106472 3300048908 Bacteria 2315
721 Ga0496105_0220412 3300048908 Bacteria 1544
722 Ga0496105_0319422 3300048908 Bacteria 1245
723 Ga0496106_0000071 3300048909 Bacteria 82296
724 Ga0496106_0008281 3300048909 Bacteria 7694
725 Ga0496106_0036863 3300048909 Bacteria 3658
726 Ga0496106_0058895 3300048909 Bacteria 2909
727 Ga0496107_0077530 3300048910 Bacteria 2421
728 Ga0496107_0080296 3300048910 Bacteria 2378
729 Ga0496108_0010388 3300048911 Bacteria 7561
730 Ga0496108_0091858 3300048911 Bacteria 2581
731 Ga0496108_0110184 3300048911 Bacteria 2353
732 Ga0496109_0119657 3300048912 Bacteria 2452
733 Ga0496109_0567090 3300048912 Bacteria 1070
734 Ga0496110_0175252 3300048913 Bacteria 1946
735 Ga0496111_0081657 3300048914 Bacteria 2360
736 Ga0496111_0094589 3300048914 Bacteria 2191
737 Ga0496112_0178770 3300048915 Bacteria 2085
738 Ga0496113_0013566 3300048916 Bacteria 5527
739 Ga0496113_0068126 3300048916 Bacteria 2700
740 Ga0496113_0618617 3300048916 Bacteria 867
741 Ga0496114_0000029 3300048917 Bacteria 175132
742 Ga0496114_0069460 3300048917 Bacteria 2958
743 Ga0496114_0185882 3300048917 Bacteria 1816
744 Ga0496116_0156493 3300048919 Bacteria 1257
745 Ga0496116_0173080 3300048919 Bacteria 1167
746 Ga0496117_0047781 3300048920 Bacteria 3064
747 Ga0496117_0109936 3300048920 Bacteria 1719
748 Ga0496117_0279749 3300048920 Bacteria 894
749 Ga0496118_0002189 3300048921 Bacteria 27169
750 Ga0496118_0010536 3300048921 Bacteria 9143
751 Ga0496118_0032534 3300048921 Bacteria 4293
752 Ga0496118_0107213 3300048921 Bacteria 1866
753 Ga0496119_0023176 3300048922 Bacteria 4416
754 Ga0496119_0154808 3300048922 Bacteria 1225
755 Ga0496121_0000333 3300048924 Bacteria 98583
756 Ga0496121_0032682 3300048924 Bacteria 4724
757 Ga0496121_0056392 3300048924 Bacteria 3263
758 Ga0496122_0044737 3300048925 Bacteria 3451
759 Ga0496124_0141888 3300048927 Bacteria 1895
760 Ga0496126_0001409 3300048929 Bacteria 38034
761 Ga0496126_0002413 3300048929 Bacteria 25289
762 Ga0496126_0007047 3300048929 Bacteria 12397
763 Ga0496126_0062320 3300048929 Bacteria 3347
764 Ga0496126_0298521 3300048929 Bacteria 1330
765 Ga0495682_0040580 3300049460 Bacteria 1706
766 Ga0501031_0155434 3300049568 Bacteria 1495
767 Ga0501032_0098556 3300049569 Bacteria 1937
768 Ga0501033_0224361 3300049570 Bacteria 1336
769 Ga0501034_0000093 3300049571 Bacteria 163663
770 Ga0501034_0038133 3300049571 Bacteria 4867
771 Ga0501034_0203133 3300049571 Bacteria 1939
772 Ga0501036_0078448 3300049572 Bacteria 2793
773 Ga0501036_0104260 3300049572 Bacteria 2398
774 Ga0501036_0918964 3300049572 Bacteria 718
775 Ga0501037_0132205 3300049573 Bacteria 1789
776 Ga0501038_0067408 3300049574 Bacteria 3045
777 Ga0501038_0068470 3300049574 Bacteria 3017
778 Ga0501038_0279060 3300049574 Bacteria 1316
779 Ga0501038_0563764 3300049574 Bacteria 865
780 Ga0501039_0097162 3300049575 Bacteria 2297
781 Ga0501039_0203620 3300049575 Bacteria 1556
782 Ga0501040_0128374 3300049576 Unclassified 1782
783 Ga0501041_0100835 3300049577 Bacteria 1787
784 Ga0501041_0347776 3300049577 Bacteria 937
785 Ga0501042_0495290 3300049578 Bacteria 887
786 Ga0501043_0000397 3300049579 Bacteria 39073
787 Ga0501043_0037136 3300049579 Bacteria 3832
788 Ga0501043_0040221 3300049579 Bacteria 3675
789 Ga0501043_0076965 3300049579 Bacteria 2621
790 Ga0501043_0626494 3300049579 Bacteria 792
791 Ga0501046_0002603 3300049580 Bacteria 16855
792 Ga0501047_0000002 3300049581 Bacteria 553775
793 Ga0501047_0019281 3300049581 Bacteria 6544
794 Ga0501047_0210813 3300049581 Bacteria 1801
795 Ga0501047_0217122 3300049581 Bacteria 1769
796 Ga0501048_0004041 3300049582 Bacteria 11163
797 Ga0501048_0155497 3300049582 Bacteria 1618
798 Ga0501067_0065647 3300049583 Bacteria 2009
799 Ga0501068_0002129 3300049584 Bacteria 10542
800 Ga0501068_0045450 3300049584 Bacteria 2646
801 Ga0501069_0075924 3300049585 Bacteria 1889
802 Ga0501070_0005671 3300049586 Bacteria 10645
803 Ga0501070_0063658 3300049586 Bacteria 3055
804 Ga0501070_0069335 3300049586 Bacteria 2919
805 Ga0501070_0212590 3300049586 Bacteria 1587
806 Ga0501070_0711126 3300049586 Bacteria 794
807 Ga0501071_0275178 3300049587 Bacteria 1273
808 Ga0501071_0393347 3300049587 Bacteria 1058
809 Ga0501072_0000049 3300049588 Bacteria 89925
810 Ga0501072_0053405 3300049588 Bacteria 3182
811 Ga0501073_0006012 3300049589 Bacteria 9055
812 Ga0501073_0129238 3300049589 Bacteria 1751
813 Ga0501073_0189159 3300049589 Bacteria 1424
814 Ga0501074_0046652 3300049590 Bacteria 3132
815 Ga0501074_0124564 3300049590 Bacteria 1843
816 Ga0501074_0585891 3300049590 Bacteria 789
817 Ga0501075_0055463 3300049591 Bacteria 2982
818 Ga0501076_0310638 3300049592 Bacteria 1293
819 Ga0501076_0987915 3300049592 Bacteria 693
820 Ga0501077_0209147 3300049593 Bacteria 1240
821 Ga0501079_0000264 3300049741 Bacteria 32231
822 Ga0501079_0015886 3300049741 Bacteria 5754
823 Ga0501080_0027047 3300049742 Bacteria 5333
824 Ga0501080_0094444 3300049742 Bacteria 2777
825 Ga0501080_0198286 3300049742 Bacteria 1843
826 Ga0501081_0045854 3300049743 Bacteria 3002
827 Ga0501081_0586498 3300049743 Bacteria 834
828 Ga0501083_0001011 3300049744 Bacteria 18739
829 Ga0501083_0011688 3300049744 Bacteria 6155
830 Ga0501083_0125263 3300049744 Bacteria 1684
831 Ga0501083_0850556 3300049744 Bacteria 594
832 Ga0501280_004853 3300049776 Bacteria 1950
833 Ga0501035_0014233 3300049822 Bacteria 7342
834 Ga0501044_0058712 3300049823 Bacteria 3944
835 Ga0501044_0543676 3300049823 Bacteria 1059
836 Ga0501044_0660462 3300049823 Bacteria 934
837 nmdc:mga0k408_330969_c1 3300050493 Bacteria 909
838 nmdc:mga0k408_469504_c1 3300050493 Bacteria 747
839 nmdc:mga07m45_153997_c1 3300050496 Bacteria 1333
840 nmdc:mga05p37_105948_c1 3300050507 Bacteria 3458
841 nmdc:mga09592_131784_c1 3300050508 Bacteria 2151
842 nmdc:mga08y16_313882_c1 3300050511 Bacteria 1614
843 nmdc:mga08y16_9642_c1 3300050511 Bacteria 10138
844 nmdc:mga0n895_23040_c1 3300050512 Bacteria 5848
845 nmdc:mga0rr50_284280_c1 3300050513 Bacteria 1381
846 nmdc:mga0a205_147_c1 3300050515 Bacteria 45502
847 Ga0500641_0007052 3300053096 Bacteria 4003
848 Ga0500658_0000049 3300053134 Bacteria 65535
849 Ga0500590_035333 3300053148 Bacteria 2587
850 Ga0500619_000129 3300053154 Bacteria 19684
851 Ga0500587_001555 3300053739 Bacteria 3265
852 Ga0501084_0000025 3300054114 Bacteria 133611
853 Ga0501084_0068780 3300054114 Bacteria 2964
854 Ga0590075_031682 3300059424 Bacteria 1341
855 Ga0501082_0056108 3300060353 Bacteria 3392
856 Ga0466962_0150105 3300061719 Bacteria 1130
857 Ga0466962_0157408 3300061719 Bacteria 1104
858 Ga0530510_0561834 3300061734 Bacteria 867

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0850556 Ga0501083_0850556_14_565 183
2 3300049581 Ga0501047_0210813 Ga0501047_0210813_311_940 186
3 3300031731 Ga0307405_10120894 Ga0307405_101208942 189
4 3300031824 Ga0307413_10012332 Ga0307413_100123326 189
5 3300031852 Ga0307410_10001663 Ga0307410_100016637 189
6 3300031995 Ga0307409_100013592 Ga0307409_1000135928 189
7 3300032002 Ga0307416_100134263 Ga0307416_1001342632 189
8 3300032004 Ga0307414_10003535 Ga0307414_100035352 189
9 3300032126 Ga0307415_100003894 Ga0307415_1000038941 189
10 3300042144 Ga0450889_031235 Ga0450889_031235_27_599 189
11 3300049741 Ga0501079_0015886 Ga0501079_0015886_3111_3755 194
12 3300049743 Ga0501081_0045854 Ga0501081_0045854_1200_1844 194
13 3300038443 Ga0395901_1404494 Ga0395901_1404494_20_610 195
14 iso_pu_bacteria 2562617112 2563060021 196
15 3300049572 Ga0501036_0918964 Ga0501036_0918964_56_685 197
16 3300049586 Ga0501070_0069335 Ga0501070_0069335_2251_2880 197
17 3300049589 Ga0501073_0189159 Ga0501073_0189159_408_1097 197
18 3300049744 Ga0501083_0011688 Ga0501083_0011688_1176_1805 197
19 3300049744 Ga0501083_0125263 Ga0501083_0125263_805_1434 197
20 3300049823 Ga0501044_0660462 Ga0501044_0660462_31_660 197
21 3300054114 Ga0501084_0068780 Ga0501084_0068780_1203_1832 197
22 3300041507 Ga0451851_0944863 Ga0451851_0944863_20_622 198
23 3300048929 Ga0496126_0298521 Ga0496126_0298521_25_627 200
24 3300049578 Ga0501042_0495290 Ga0501042_0495290_15_620 200
25 3300049590 Ga0501074_0585891 Ga0501074_0585891_164_766 200
26 3300005458 Ga0070681_10082648 Ga0070681_100826483 202
27 3300031824 Ga0307413_10138235 Ga0307413_101382351 202
28 3300031852 Ga0307410_10012652 Ga0307410_100126523 202
29 3300031901 Ga0307406_10095006 Ga0307406_100950062 202
30 3300031903 Ga0307407_10088037 Ga0307407_100880372 202
31 3300032002 Ga0307416_100233750 Ga0307416_1002337502 202
32 3300032126 Ga0307415_100048159 Ga0307415_1000481593 202
33 3300006028 Ga0070717_10107482 Ga0070717_101074824 204
34 3300042439 Ga0439464_0088987 Ga0439464_0088987_140_772 204
35 3300049593 Ga0501077_0209147 Ga0501077_0209147_521_1138 204
36 3300025917 Ga0207660_10623250 Ga0207660_106232501 205
37 3300032004 Ga0307414_10964554 Ga0307414_109645541 205
38 3300044694 Ga0466963_0037475 Ga0466963_0037475_2476_3111 205
39 3300044842 Ga0466957_0000787 Ga0466957_0000787_3423_4058 205
40 3300045836 Ga0466958_0131366 Ga0466958_0131366_86_721 205
41 3300045976 Ga0466967_0076205 Ga0466967_0076205_1679_2314 205
42 3300005293 Ga0065715_10415519 Ga0065715_104155191 206
43 3300028800 Ga0265338_10016067 Ga0265338_100160675 206
44 3300049776 Ga0501280_004853 Ga0501280_004853_137_778 206
45 3300001979 JGI24740J21852_10006469 JGI24740J21852_100064694 207
46 3300001990 JGI24737J22298_10003339 JGI24737J22298_100033393 207
47 3300005327 Ga0070658_10012287 Ga0070658_100122874 207
48 3300005327 Ga0070658_10337362 Ga0070658_103373622 207
49 3300005327 Ga0070658_10530741 Ga0070658_105307412 207
50 3300005328 Ga0070676_10048312 Ga0070676_100483123 207
51 3300005329 Ga0070683_100026033 Ga0070683_1000260334 207
52 3300005329 Ga0070683_100039236 Ga0070683_1000392364 207
53 3300005331 Ga0070670_100046023 Ga0070670_1000460234 207
54 3300005335 Ga0070666_10021840 Ga0070666_100218402 207
55 3300005336 Ga0070680_100010998 Ga0070680_1000109982 207
56 3300005336 Ga0070680_100281712 Ga0070680_1002817122 207
57 3300005339 Ga0070660_100002929 Ga0070660_1000029298 207
58 3300005344 Ga0070661_100006773 Ga0070661_1000067736 207
59 3300005344 Ga0070661_100084021 Ga0070661_1000840211 207
60 3300005344 Ga0070661_100167367 Ga0070661_1001673673 207
61 3300005347 Ga0070668_100477890 Ga0070668_1004778901 207
62 3300005355 Ga0070671_100056534 Ga0070671_1000565343 207
63 3300005355 Ga0070671_100100596 Ga0070671_1001005962 207
64 3300005355 Ga0070671_100586845 Ga0070671_1005868452 207
65 3300005364 Ga0070673_100082450 Ga0070673_1000824503 207
66 3300005364 Ga0070673_100659868 Ga0070673_1006598681 207
67 3300005366 Ga0070659_100000992 Ga0070659_10000099214 207
68 3300005366 Ga0070659_100247849 Ga0070659_1002478493 207
69 3300005366 Ga0070659_100329772 Ga0070659_1003297722 207
70 3300005455 Ga0070663_100010881 Ga0070663_1000108813 207
71 3300005455 Ga0070663_100221258 Ga0070663_1002212582 207
72 3300005457 Ga0070662_100022342 Ga0070662_1000223422 207
73 3300005457 Ga0070662_100209925 Ga0070662_1002099252 207
74 3300005458 Ga0070681_10031291 Ga0070681_100312912 207
75 3300005466 Ga0070685_10395354 Ga0070685_103953541 207
76 3300005530 Ga0070679_100002835 Ga0070679_1000028355 207
77 3300005539 Ga0068853_100135144 Ga0068853_1001351442 207
78 3300005539 Ga0068853_100462008 Ga0068853_1004620082 207
79 3300005539 Ga0068853_100492388 Ga0068853_1004923882 207
80 3300005563 Ga0068855_100002695 Ga0068855_10000269515 207
81 3300005563 Ga0068855_100210048 Ga0068855_1002100483 207
82 3300005564 Ga0070664_100001303 Ga0070664_10000130313 207
83 3300005564 Ga0070664_100010774 Ga0070664_1000107744 207
84 3300005564 Ga0070664_100075187 Ga0070664_1000751873 207
85 3300005577 Ga0068857_100130293 Ga0068857_1001302934 207
86 3300005578 Ga0068854_100013554 Ga0068854_1000135543 207
87 3300005578 Ga0068854_100109249 Ga0068854_1001092492 207
88 3300005578 Ga0068854_100251747 Ga0068854_1002517471 207
89 3300005614 Ga0068856_100169041 Ga0068856_1001690414 207
90 3300005614 Ga0068856_100307473 Ga0068856_1003074732 207
91 3300005616 Ga0068852_100019610 Ga0068852_1000196103 207
92 3300005616 Ga0068852_100176060 Ga0068852_1001760603 207
93 3300005617 Ga0068859_100055882 Ga0068859_1000558822 207
94 3300005617 Ga0068859_100329870 Ga0068859_1003298703 207
95 3300005618 Ga0068864_100008255 Ga0068864_1000082556 207
96 3300005618 Ga0068864_100010148 Ga0068864_1000101483 207
97 3300005834 Ga0068851_10014791 Ga0068851_100147912 207
98 3300005834 Ga0068851_10112506 Ga0068851_101125063 207
99 3300005841 Ga0068863_100020671 Ga0068863_1000206714 207
100 3300005841 Ga0068863_100075683 Ga0068863_1000756834 207
101 3300005841 Ga0068863_100654933 Ga0068863_1006549331 207
102 3300005842 Ga0068858_100018916 Ga0068858_1000189163 207
103 3300005842 Ga0068858_100493384 Ga0068858_1004933842 207
104 3300005844 Ga0068862_100253870 Ga0068862_1002538702 207
105 3300006175 Ga0070712_100575436 Ga0070712_1005754361 207
106 3300006237 Ga0097621_100093463 Ga0097621_1000934634 207
107 3300006358 Ga0068871_100036215 Ga0068871_1000362155 207
108 3300006881 Ga0068865_100148565 Ga0068865_1001485653 207
109 3300006931 Ga0097620_100055883 Ga0097620_1000558832 207
110 3300006931 Ga0097620_100329902 Ga0097620_1003299023 207
111 3300009174 Ga0105241_10128121 Ga0105241_101281213 207
112 3300009177 Ga0105248_10014587 Ga0105248_100145874 207
113 3300009177 Ga0105248_10038638 Ga0105248_100386383 207
114 3300009177 Ga0105248_10604481 Ga0105248_106044812 207
115 3300009545 Ga0105237_10928525 Ga0105237_109285252 207
116 3300009551 Ga0105238_10686404 Ga0105238_106864042 207
117 3300009551 Ga0105238_11150796 Ga0105238_111507961 207
118 3300011119 Ga0105246_10055179 Ga0105246_100551792 207
119 3300013100 Ga0157373_10119341 Ga0157373_101193413 207
120 3300013100 Ga0157373_10423949 Ga0157373_104239492 207
121 3300013102 Ga0157371_10181944 Ga0157371_101819442 207
122 3300013104 Ga0157370_10272942 Ga0157370_102729423 207
123 3300013104 Ga0157370_10370932 Ga0157370_103709322 207
124 3300013105 Ga0157369_10001611 Ga0157369_100016119 207
125 3300013105 Ga0157369_10005258 Ga0157369_100052585 207
126 3300013105 Ga0157369_10092640 Ga0157369_100926404 207
127 3300013105 Ga0157369_10720790 Ga0157369_107207901 207
128 3300013296 Ga0157374_10040250 Ga0157374_100402502 207
129 3300013306 Ga0163162_11524306 Ga0163162_115243061 207
130 3300013307 Ga0157372_10102817 Ga0157372_101028173 207
131 3300013307 Ga0157372_10252566 Ga0157372_102525663 207
132 3300014325 Ga0163163_10145931 Ga0163163_101459314 207
133 3300014497 Ga0182008_10047944 Ga0182008_100479444 207
134 3300014497 Ga0182008_10173994 Ga0182008_101739942 207
135 3300014497 Ga0182008_10280742 Ga0182008_102807422 207
136 3300014968 Ga0157379_10089259 Ga0157379_100892592 207
137 3300025321 Ga0207656_10011120 Ga0207656_100111202 207
138 3300025321 Ga0207656_10205865 Ga0207656_102058652 207
139 3300025321 Ga0207656_10283570 Ga0207656_102835702 207
140 3300025893 Ga0207682_10117676 Ga0207682_101176762 207
141 3300025904 Ga0207647_10007746 Ga0207647_100077465 207
142 3300025904 Ga0207647_10351345 Ga0207647_103513452 207
143 3300025908 Ga0207643_10220595 Ga0207643_102205952 207
144 3300025909 Ga0207705_10000942 Ga0207705_1000094213 207
145 3300025909 Ga0207705_10017299 Ga0207705_100172992 207
146 3300025909 Ga0207705_10104005 Ga0207705_101040053 207
147 3300025909 Ga0207705_10707150 Ga0207705_107071501 207
148 3300025912 Ga0207707_10021943 Ga0207707_100219432 207
149 3300025914 Ga0207671_10086742 Ga0207671_100867424 207
150 3300025917 Ga0207660_10107553 Ga0207660_101075534 207
151 3300025919 Ga0207657_10002608 Ga0207657_1000260822 207
152 3300025920 Ga0207649_10055418 Ga0207649_100554183 207
153 3300025920 Ga0207649_10059731 Ga0207649_100597312 207
154 3300025920 Ga0207649_10395062 Ga0207649_103950622 207
155 3300025921 Ga0207652_10000875 Ga0207652_1000087521 207
156 3300025921 Ga0207652_10114033 Ga0207652_101140333 207
157 3300025921 Ga0207652_10782013 Ga0207652_107820132 207
158 3300025925 Ga0207650_10069709 Ga0207650_100697092 207
159 3300025931 Ga0207644_10009420 Ga0207644_100094204 207
160 3300025931 Ga0207644_10130928 Ga0207644_101309283 207
161 3300025931 Ga0207644_10240734 Ga0207644_102407342 207
162 3300025932 Ga0207690_10034238 Ga0207690_100342384 207
163 3300025933 Ga0207706_10036885 Ga0207706_100368852 207
164 3300025933 Ga0207706_10398724 Ga0207706_103987242 207
165 3300025938 Ga0207704_10146880 Ga0207704_101468803 207
166 3300025944 Ga0207661_10087594 Ga0207661_100875944 207
167 3300025945 Ga0207679_10007965 Ga0207679_100079657 207
168 3300025945 Ga0207679_10049964 Ga0207679_100499644 207
169 3300025945 Ga0207679_10282040 Ga0207679_102820402 207
170 3300025949 Ga0207667_10002493 Ga0207667_1000249318 207
171 3300025960 Ga0207651_10047169 Ga0207651_100471693 207
172 3300025972 Ga0207668_10092700 Ga0207668_100927003 207
173 3300025981 Ga0207640_10009133 Ga0207640_100091331 207
174 3300025981 Ga0207640_10062385 Ga0207640_100623854 207
175 3300025981 Ga0207640_10882171 Ga0207640_108821711 207
176 3300025986 Ga0207658_10209577 Ga0207658_102095772 207
177 3300025986 Ga0207658_10493470 Ga0207658_104934701 207
178 3300026035 Ga0207703_10486578 Ga0207703_104865782 207
179 3300026041 Ga0207639_10013414 Ga0207639_100134144 207
180 3300026041 Ga0207639_10123248 Ga0207639_101232483 207
181 3300026041 Ga0207639_10160529 Ga0207639_101605292 207
182 3300026041 Ga0207639_10467091 Ga0207639_104670912 207
183 3300026067 Ga0207678_10003179 Ga0207678_1000317911 207
184 3300026067 Ga0207678_10006058 Ga0207678_100060585 207
185 3300026067 Ga0207678_10041652 Ga0207678_100416522 207
186 3300026067 Ga0207678_10149684 Ga0207678_101496843 207
187 3300026078 Ga0207702_10038338 Ga0207702_100383382 207
188 3300026078 Ga0207702_10593330 Ga0207702_105933302 207
189 3300026088 Ga0207641_10031582 Ga0207641_100315823 207
190 3300026088 Ga0207641_10060392 Ga0207641_100603923 207
191 3300026088 Ga0207641_10528273 Ga0207641_105282732 207
192 3300026089 Ga0207648_10201635 Ga0207648_102016353 207
193 3300026095 Ga0207676_10371533 Ga0207676_103715332 207
194 3300026116 Ga0207674_10001888 Ga0207674_1000188811 207
195 3300026116 Ga0207674_10691022 Ga0207674_106910222 207
196 3300026118 Ga0207675_100070693 Ga0207675_1000706932 207
197 3300026142 Ga0207698_10009478 Ga0207698_100094785 207
198 3300026142 Ga0207698_10140275 Ga0207698_101402752 207
199 3300026142 Ga0207698_10195752 Ga0207698_101957522 207
200 3300026142 Ga0207698_10323449 Ga0207698_103234492 207
201 3300028379 Ga0268266_10116828 Ga0268266_101168282 207
202 3300031548 Ga0307408_100098039 Ga0307408_1000980394 207
203 3300031548 Ga0307408_100275031 Ga0307408_1002750312 207
204 3300031731 Ga0307405_10046904 Ga0307405_100469044 207
205 3300031731 Ga0307405_10145811 Ga0307405_101458111 207
206 3300031824 Ga0307413_10024980 Ga0307413_100249803 207
207 3300031852 Ga0307410_10354745 Ga0307410_103547452 207
208 3300031903 Ga0307407_10094699 Ga0307407_100946991 207
209 3300031911 Ga0307412_10197917 Ga0307412_101979171 207
210 3300031995 Ga0307409_100053047 Ga0307409_1000530474 207
211 3300032002 Ga0307416_100066514 Ga0307416_1000665142 207
212 3300032004 Ga0307414_10031322 Ga0307414_100313224 207
213 3300032004 Ga0307414_10318725 Ga0307414_103187252 207
214 3300032005 Ga0307411_10127017 Ga0307411_101270171 207
215 3300032005 Ga0307411_10167506 Ga0307411_101675062 207
216 3300032005 Ga0307411_10255936 Ga0307411_102559362 207
217 3300032005 Ga0307411_10302755 Ga0307411_103027552 207
218 3300032126 Ga0307415_100068202 Ga0307415_1000682023 207
219 3300032126 Ga0307415_100525703 Ga0307415_1005257032 207
220 3300032126 Ga0307415_100573781 Ga0307415_1005737811 207
221 3300037312 Ga0395899_0039792 Ga0395899_0039792_1201_1842 207
222 3300037312 Ga0395899_0041620 Ga0395899_0041620_701_1342 207
223 3300037312 Ga0395899_0054764 Ga0395899_0054764_2000_2641 207
224 3300037312 Ga0395899_0057485 Ga0395899_0057485_1772_2413 207
225 3300037312 Ga0395899_0202333 Ga0395899_0202333_192_833 207
226 3300037418 Ga0395900_0000289 Ga0395900_0000289_19893_20534 207
227 3300037418 Ga0395900_0005557 Ga0395900_0005557_6666_7307 207
228 3300037418 Ga0395900_0017419 Ga0395900_0017419_2543_3184 207
229 3300037418 Ga0395900_0030258 Ga0395900_0030258_4541_5182 207
230 3300037418 Ga0395900_0041582 Ga0395900_0041582_44_685 207
231 3300037418 Ga0395900_0064995 Ga0395900_0064995_160_801 207
232 3300037418 Ga0395900_0081355 Ga0395900_0081355_1440_2081 207
233 3300037418 Ga0395900_0119778 Ga0395900_0119778_2032_2673 207
234 3300037418 Ga0395900_0136156 Ga0395900_0136156_330_971 207
235 3300037418 Ga0395900_0159281 Ga0395900_0159281_1091_1732 207
236 3300037418 Ga0395900_0427414 Ga0395900_0427414_50_691 207
237 3300037418 Ga0395900_0518352 Ga0395900_0518352_471_1112 207
238 3300037466 Ga0395898_0017554 Ga0395898_0017554_2831_3472 207
239 3300037466 Ga0395898_0017933 Ga0395898_0017933_5382_6023 207
240 3300037466 Ga0395898_0035202 Ga0395898_0035202_3891_4532 207
241 3300037466 Ga0395898_0127088 Ga0395898_0127088_1309_1950 207
242 3300037466 Ga0395898_0163348 Ga0395898_0163348_662_1303 207
243 3300037466 Ga0395898_0383958 Ga0395898_0383958_678_1319 207
244 3300037466 Ga0395898_0511909 Ga0395898_0511909_487_1128 207
245 3300037471 Ga0395905_0000215 Ga0395905_0000215_85269_85910 207
246 3300037471 Ga0395905_0014942 Ga0395905_0014942_6417_7058 207
247 3300037471 Ga0395905_0025629 Ga0395905_0025629_2520_3161 207
248 3300037471 Ga0395905_0039581 Ga0395905_0039581_3714_4355 207
249 3300037471 Ga0395905_0058195 Ga0395905_0058195_1695_2336 207
250 3300037471 Ga0395905_0079215 Ga0395905_0079215_259_900 207
251 3300037471 Ga0395905_0183495 Ga0395905_0183495_909_1550 207
252 3300037471 Ga0395905_0215866 Ga0395905_0215866_701_1342 207
253 3300037471 Ga0395905_0298807 Ga0395905_0298807_346_987 207
254 3300037471 Ga0395905_0503407 Ga0395905_0503407_257_898 207
255 3300038443 Ga0395901_0001244 Ga0395901_0001244_17601_18242 207
256 3300038443 Ga0395901_0005184 Ga0395901_0005184_10764_11405 207
257 3300038443 Ga0395901_0081384 Ga0395901_0081384_1542_2183 207
258 3300038443 Ga0395901_0168234 Ga0395901_0168234_1312_1953 207
259 3300038443 Ga0395901_0171658 Ga0395901_0171658_1523_2164 207
260 3300038443 Ga0395901_0201713 Ga0395901_0201713_573_1214 207
261 3300038443 Ga0395901_0258911 Ga0395901_0258911_1151_1792 207
262 3300038443 Ga0395901_0322603 Ga0395901_0322603_361_1002 207
263 3300038443 Ga0395901_0380814 Ga0395901_0380814_351_992 207
264 3300041406 Ga0439439_0044273 Ga0439439_0044273_437_1078 207
265 3300042005 Ga0439448_0009747 Ga0439448_0009747_2107_2748 207
266 3300042006 Ga0439432_005945 Ga0439432_005945_3256_3897 207
267 3300042006 Ga0439432_022408 Ga0439432_022408_145_783 207
268 3300042007 Ga0439449_0107195 Ga0439449_0107195_210_851 207
269 3300042116 Ga0450912_000085 Ga0450912_000085_131_772 207
270 3300042157 Ga0439458_0000200 Ga0439458_0000200_10468_11109 207
271 3300042157 Ga0439458_0001759 Ga0439458_0001759_542_1183 207
272 3300044693 Ga0466961_0197442 Ga0466961_0197442_217_858 207
273 3300044694 Ga0466963_0000326 Ga0466963_0000326_19277_19918 207
274 3300044694 Ga0466963_0486500 Ga0466963_0486500_220_861 207
275 3300044694 Ga0466963_0575397 Ga0466963_0575397_135_776 207
276 3300044706 Ga0466964_0057568 Ga0466964_0057568_286_927 207
277 3300044719 Ga0466971_0092870 Ga0466971_0092870_268_909 207
278 3300044842 Ga0466957_0373484 Ga0466957_0373484_67_708 207
279 3300044842 Ga0466957_0378015 Ga0466957_0378015_191_832 207
280 3300045836 Ga0466958_0217249 Ga0466958_0217249_241_882 207
281 3300045976 Ga0466967_0000100 Ga0466967_0000100_28156_28797 207
282 3300045976 Ga0466967_0125850 Ga0466967_0125850_222_863 207
283 3300045976 Ga0466967_0187199 Ga0466967_0187199_461_1102 207
284 3300045976 Ga0466967_0225023 Ga0466967_0225023_746_1387 207
285 3300045976 Ga0466967_0401696 Ga0466967_0401696_106_747 207
286 3300045976 Ga0466967_0994323 Ga0466967_0994323_135_776 207
287 3300046684 Ga0495669_0000090 Ga0495669_0000090_39812_40453 207
288 3300046684 Ga0495669_0063652 Ga0495669_0063652_444_1085 207
289 3300047323 Ga0495683_0161249 Ga0495683_0161249_379_1020 207
290 3300047470 Ga0495681_0136042 Ga0495681_0136042_83_724 207
291 3300048905 Ga0496102_0672452 Ga0496102_0672452_268_909 207
292 3300048906 Ga0496103_0006948 Ga0496103_0006948_5543_6184 207
293 3300048907 Ga0496104_0193490 Ga0496104_0193490_70_711 207
294 3300048908 Ga0496105_0319422 Ga0496105_0319422_579_1220 207
295 3300048909 Ga0496106_0008281 Ga0496106_0008281_2973_3614 207
296 3300048910 Ga0496107_0080296 Ga0496107_0080296_1323_1964 207
297 3300048911 Ga0496108_0010388 Ga0496108_0010388_5320_5961 207
298 3300048911 Ga0496108_0110184 Ga0496108_0110184_1072_1716 207
299 3300048912 Ga0496109_0119657 Ga0496109_0119657_890_1531 207
300 3300048913 Ga0496110_0175252 Ga0496110_0175252_279_920 207
301 3300048914 Ga0496111_0081657 Ga0496111_0081657_67_708 207
302 3300048916 Ga0496113_0068126 Ga0496113_0068126_2044_2685 207
303 3300048916 Ga0496113_0618617 Ga0496113_0618617_153_794 207
304 3300048917 Ga0496114_0000029 Ga0496114_0000029_155019_155660 207
305 3300049583 Ga0501067_0065647 Ga0501067_0065647_632_1273 207
306 3300049584 Ga0501068_0045450 Ga0501068_0045450_896_1537 207
307 3300049585 Ga0501069_0075924 Ga0501069_0075924_765_1406 207
308 3300053134 Ga0500658_0000049 Ga0500658_0000049_26215_26856 207
309 3300059424 Ga0590075_031682 Ga0590075_031682_121_765 207
310 3300061719 Ga0466962_0150105 Ga0466962_0150105_410_1051 207
311 3300061719 Ga0466962_0157408 Ga0466962_0157408_99_740 207
312 3300010159 Ga0099796_10001431 Ga0099796_100014317 208
313 3300035086 Ga0373934_0005617 Ga0373934_0005617_1126_1785 208
314 3300035119 Ga0373956_0193661 Ga0373956_0193661_119_778 208
315 3300035172 Ga0373955_0144320 Ga0373955_0144320_702_1361 208
316 3300035724 Ga0373933_0002160 Ga0373933_0002160_8195_8854 208
317 3300036401 Ga0373937_0009077 Ga0373937_0009077_3947_4606 208
318 3300049571 Ga0501034_0000093 Ga0501034_0000093_38643_39296 208
319 3300049572 Ga0501036_0078448 Ga0501036_0078448_476_1129 208
320 3300049574 Ga0501038_0068470 Ga0501038_0068470_1338_1991 208
321 3300049579 Ga0501043_0000397 Ga0501043_0000397_10447_11100 208
322 3300049580 Ga0501046_0002603 Ga0501046_0002603_13145_13798 208
323 3300049581 Ga0501047_0000002 Ga0501047_0000002_27961_28614 208
324 3300049582 Ga0501048_0004041 Ga0501048_0004041_7038_7691 208
325 3300049584 Ga0501068_0002129 Ga0501068_0002129_1180_1833 208
326 3300049586 Ga0501070_0005671 Ga0501070_0005671_6437_7090 208
327 3300049588 Ga0501072_0000049 Ga0501072_0000049_6451_7104 208
328 3300049589 Ga0501073_0006012 Ga0501073_0006012_8237_8890 208
329 3300049590 Ga0501074_0046652 Ga0501074_0046652_293_946 208
330 3300049741 Ga0501079_0000264 Ga0501079_0000264_25015_25668 208
331 3300049742 Ga0501080_0027047 Ga0501080_0027047_339_992 208
332 3300049744 Ga0501083_0001011 Ga0501083_0001011_166_819 208
333 3300054114 Ga0501084_0000025 Ga0501084_0000025_104998_105651 208
334 3300060353 Ga0501082_0056108 Ga0501082_0056108_339_992 208
335 iso_pu_bacteria 2643221644 2644245577 208
336 3300049569 Ga0501032_0098556 Ga0501032_0098556_146_805 209
337 3300049570 Ga0501033_0224361 Ga0501033_0224361_558_1217 209
338 3300049572 Ga0501036_0104260 Ga0501036_0104260_420_1079 209
339 3300049573 Ga0501037_0132205 Ga0501037_0132205_388_1047 209
340 3300049574 Ga0501038_0563764 Ga0501038_0563764_85_744 209
341 3300049579 Ga0501043_0037136 Ga0501043_0037136_2110_2769 209
342 3300049581 Ga0501047_0019281 Ga0501047_0019281_2775_3434 209
343 3300049822 Ga0501035_0014233 Ga0501035_0014233_3259_3918 209
344 3300049823 Ga0501044_0058712 Ga0501044_0058712_1868_2527 209
345 iso_pu_bacteria 2585428062 2587755804 209
346 3300005367 Ga0070667_100425927 Ga0070667_1004259272 210
347 3300005549 Ga0070704_100653068 Ga0070704_1006530681 210
348 3300025986 Ga0207658_10392337 Ga0207658_103923372 210
349 3300031239 Ga0265328_10028397 Ga0265328_100283972 210
350 3300031250 Ga0265331_10022491 Ga0265331_100224913 210
351 3300031251 Ga0265327_10000012 Ga0265327_10000012426 210
352 3300044673 Ga0453683_0000640 Ga0453683_0000640_12395_13030 210
353 3300049575 Ga0501039_0097162 Ga0501039_0097162_1393_2028 210
354 3300049575 Ga0501039_0203620 Ga0501039_0203620_453_1088 210
355 3300049577 Ga0501041_0100835 Ga0501041_0100835_430_1065 210
356 3300049579 Ga0501043_0626494 Ga0501043_0626494_113_748 210
357 3300049587 Ga0501071_0275178 Ga0501071_0275178_552_1187 210
358 3300049588 Ga0501072_0053405 Ga0501072_0053405_497_1132 210
359 3300049589 Ga0501073_0129238 Ga0501073_0129238_357_992 210
360 3300049590 Ga0501074_0124564 Ga0501074_0124564_667_1302 210
361 3300049592 Ga0501076_0310638 Ga0501076_0310638_264_899 210
362 3300049742 Ga0501080_0198286 Ga0501080_0198286_772_1407 210
363 3300049743 Ga0501081_0586498 Ga0501081_0586498_180_815 210
364 iso_pu_bacteria 2510065045 2510253191 210
365 iso_pu_bacteria 2512047030 2512347364 210
366 iso_pu_bacteria 2513237166 2514048015 210
367 iso_pu_bacteria 2515154122 2515685305 210
368 iso_pu_bacteria 2526164713 2527078829 210
369 iso_pu_bacteria 2711768613 2713479261 210
370 iso_pu_bacteria 2718217991 2719638980 210
371 iso_pu_bacteria 2738541296 2738823792 210
372 iso_pu_bacteria 2738541298 2738836183 210
373 iso_pu_bacteria 2738541306 2738877713 210
374 iso_pu_bacteria 2738543002 2739189419 210
375 iso_pu_bacteria 2738543008 2739224306 210
376 iso_pu_bacteria 2744054900 2746086353 210
377 iso_pu_bacteria 2744054901 2746093353 210
378 iso_pu_bacteria 2791355137 2792834680 210
379 iso_pu_bacteria 2856287931 2856293263 210
380 iso_pu_bacteria 2857357740 2857366618 210
381 iso_pu_bacteria 2885270888 2885276725 210
382 iso_pu_bacteria 2902682994 2902689109 210
383 iso_pu_bacteria 2904483920 2904488531 210
384 iso_pu_bacteria 2904615490 2904620385 210
385 iso_pu_bacteria 2919527303 2919532143 210
386 iso_pu_bacteria 2921643360 2921644150 210
387 iso_pu_bacteria 2945934425 2945935220 210
388 iso_pu_bacteria 2990703756 2990704186 210
389 iso_pu_bacteria 641736151 642422342 210
390 iso_pu_bacteria 642555112 642592070 210
391 iso_pu_bacteria 8055301274 8055304080 210
392 3300005458 Ga0070681_10029928 Ga0070681_100299281 211
393 3300005530 Ga0070679_100067751 Ga0070679_1000677516 211
394 3300025912 Ga0207707_10062495 Ga0207707_100624952 211
395 3300037471 Ga0395905_0144321 Ga0395905_0144321_1506_2144 211
396 3300049571 Ga0501034_0203133 Ga0501034_0203133_726_1361 211
397 3300049574 Ga0501038_0279060 Ga0501038_0279060_58_693 211
398 3300049586 Ga0501070_0212590 Ga0501070_0212590_813_1448 211
399 3300049586 Ga0501070_0711126 Ga0501070_0711126_88_723 211
400 3300003320 rootH2_10164363 rootH2_101643632 212
401 3300003775 Ga0055524_1000227 Ga0055524_10002276 212
402 3300003791 Ga0055530_10002810 Ga0055530_100028106 212
403 3300003792 Ga0055540_1000112 Ga0055540_100011268 212
404 3300003794 Ga0055531_10004566 Ga0055531_100045662 212
405 3300005328 Ga0070676_10021508 Ga0070676_100215084 212
406 3300005328 Ga0070676_10136706 Ga0070676_101367062 212
407 3300005330 Ga0070690_100010655 Ga0070690_1000106554 212
408 3300005331 Ga0070670_100088711 Ga0070670_1000887113 212
409 3300005333 Ga0070677_10000399 Ga0070677_1000039916 212
410 3300005335 Ga0070666_10001754 Ga0070666_100017549 212
411 3300005335 Ga0070666_10063686 Ga0070666_100636863 212
412 3300005338 Ga0068868_100011862 Ga0068868_1000118626 212
413 3300005338 Ga0068868_100029926 Ga0068868_1000299265 212
414 3300005339 Ga0070660_100209189 Ga0070660_1002091892 212
415 3300005340 Ga0070689_100141774 Ga0070689_1001417742 212
416 3300005340 Ga0070689_100207343 Ga0070689_1002073432 212
417 3300005343 Ga0070687_100080577 Ga0070687_1000805772 212
418 3300005344 Ga0070661_100004617 Ga0070661_1000046176 212
419 3300005347 Ga0070668_100090767 Ga0070668_1000907673 212
420 3300005353 Ga0070669_100351508 Ga0070669_1003515082 212
421 3300005354 Ga0070675_100009122 Ga0070675_1000091224 212
422 3300005355 Ga0070671_100004778 Ga0070671_1000047782 212
423 3300005355 Ga0070671_100038311 Ga0070671_1000383115 212
424 3300005356 Ga0070674_100004774 Ga0070674_1000047742 212
425 3300005356 Ga0070674_100510262 Ga0070674_1005102621 212
426 3300005364 Ga0070673_100001176 Ga0070673_1000011768 212
427 3300005364 Ga0070673_100036445 Ga0070673_1000364454 212
428 3300005366 Ga0070659_100002333 Ga0070659_1000023336 212
429 3300005367 Ga0070667_100001817 Ga0070667_1000018172 212
430 3300005367 Ga0070667_100053817 Ga0070667_1000538174 212
431 3300005367 Ga0070667_100100736 Ga0070667_1001007363 212
432 3300005434 Ga0070709_10026666 Ga0070709_100266663 212
433 3300005435 Ga0070714_100208301 Ga0070714_1002083011 212
434 3300005437 Ga0070710_10000687 Ga0070710_1000068711 212
435 3300005439 Ga0070711_100048889 Ga0070711_1000488894 212
436 3300005445 Ga0070708_100088896 Ga0070708_1000888962 212
437 3300005455 Ga0070663_100089547 Ga0070663_1000895472 212
438 3300005456 Ga0070678_100016839 Ga0070678_1000168395 212
439 3300005456 Ga0070678_100031328 Ga0070678_1000313285 212
440 3300005457 Ga0070662_100115356 Ga0070662_1001153563 212
441 3300005457 Ga0070662_100133004 Ga0070662_1001330042 212
442 3300005459 Ga0068867_100002533 Ga0068867_10000253314 212
443 3300005459 Ga0068867_100132568 Ga0068867_1001325682 212
444 3300005459 Ga0068867_100165044 Ga0068867_1001650442 212
445 3300005466 Ga0070685_10280235 Ga0070685_102802352 212
446 3300005467 Ga0070706_100000081 Ga0070706_10000008127 212
447 3300005468 Ga0070707_100003563 Ga0070707_1000035634 212
448 3300005471 Ga0070698_100008005 Ga0070698_10000800514 212
449 3300005518 Ga0070699_100039227 Ga0070699_1000392274 212
450 3300005530 Ga0070679_100030058 Ga0070679_1000300582 212
451 3300005530 Ga0070679_100445439 Ga0070679_1004454392 212
452 3300005543 Ga0070672_100001353 Ga0070672_1000013536 212
453 3300005544 Ga0070686_100061340 Ga0070686_1000613401 212
454 3300005546 Ga0070696_100014222 Ga0070696_1000142226 212
455 3300005548 Ga0070665_100006949 Ga0070665_1000069492 212
456 3300005563 Ga0068855_100142257 Ga0068855_1001422572 212
457 3300005564 Ga0070664_100022353 Ga0070664_1000223532 212
458 3300005616 Ga0068852_100004888 Ga0068852_1000048885 212
459 3300005617 Ga0068859_100026469 Ga0068859_1000264693 212
460 3300005618 Ga0068864_100002905 Ga0068864_1000029055 212
461 3300005618 Ga0068864_100203958 Ga0068864_1002039582 212
462 3300005719 Ga0068861_100502309 Ga0068861_1005023092 212
463 3300005834 Ga0068851_10000682 Ga0068851_1000068215 212
464 3300005840 Ga0068870_10005548 Ga0068870_100055483 212
465 3300005841 Ga0068863_100040505 Ga0068863_1000405053 212
466 3300005842 Ga0068858_100026254 Ga0068858_1000262544 212
467 3300005843 Ga0068860_100011373 Ga0068860_1000113733 212
468 3300005843 Ga0068860_100075558 Ga0068860_1000755582 212
469 3300005843 Ga0068860_100284479 Ga0068860_1002844792 212
470 3300006237 Ga0097621_100055900 Ga0097621_1000559004 212
471 3300006358 Ga0068871_100009917 Ga0068871_1000099178 212
472 3300006931 Ga0097620_100026466 Ga0097620_1000264663 212
473 3300006946 Ga0079104_1000024 Ga0079104_1000024196 212
474 3300009093 Ga0105240_10018809 Ga0105240_100188093 212
475 3300009098 Ga0105245_10713086 Ga0105245_107130862 212
476 3300009177 Ga0105248_10072671 Ga0105248_100726713 212
477 3300009553 Ga0105249_10095511 Ga0105249_100955112 212
478 3300013104 Ga0157370_10362695 Ga0157370_103626952 212
479 3300013104 Ga0157370_10656931 Ga0157370_106569312 212
480 3300013296 Ga0157374_10223996 Ga0157374_102239962 212
481 3300013306 Ga0163162_10140431 Ga0163162_101404312 212
482 3300013307 Ga0157372_10070907 Ga0157372_100709075 212
483 3300013308 Ga0157375_10003757 Ga0157375_1000375714 212
484 3300013308 Ga0157375_10074842 Ga0157375_100748422 212
485 3300013308 Ga0157375_10632453 Ga0157375_106324532 212
486 3300014325 Ga0163163_10046750 Ga0163163_100467502 212
487 3300014325 Ga0163163_10066448 Ga0163163_100664482 212
488 3300014325 Ga0163163_10584683 Ga0163163_105846832 212
489 3300014326 Ga0157380_10446541 Ga0157380_104465412 212
490 3300014968 Ga0157379_10034731 Ga0157379_100347312 212
491 3300014969 Ga0157376_10235683 Ga0157376_102356832 212
492 3300014969 Ga0157376_11455334 Ga0157376_114553341 212
493 3300017792 Ga0163161_10021774 Ga0163161_100217742 212
494 3300017792 Ga0163161_10210085 Ga0163161_102100852 212
495 3300021384 Ga0213876_10065229 Ga0213876_100652291 212
496 3300025291 Ga0209675_1010464 Ga0209675_10104643 212
497 3300025298 Ga0209050_1001849 Ga0209050_10018496 212
498 3300025298 Ga0209050_1066981 Ga0209050_10669812 212
499 3300025299 Ga0209256_1000011 Ga0209256_1000011330 212
500 3300025303 Ga0209051_1000016 Ga0209051_10000166 212
501 3300025304 Ga0209257_1000510 Ga0209257_100051054 212
502 3300025321 Ga0207656_10053425 Ga0207656_100534252 212
503 3300025893 Ga0207682_10000075 Ga0207682_100000759 212
504 3300025893 Ga0207682_10024073 Ga0207682_100240731 212
505 3300025903 Ga0207680_10001434 Ga0207680_100014349 212
506 3300025903 Ga0207680_10005169 Ga0207680_100051695 212
507 3300025906 Ga0207699_10003665 Ga0207699_100036653 212
508 3300025907 Ga0207645_10000152 Ga0207645_1000015246 212
509 3300025908 Ga0207643_10026800 Ga0207643_100268002 212
510 3300025910 Ga0207684_10000069 Ga0207684_1000006978 212
511 3300025913 Ga0207695_10046710 Ga0207695_100467105 212
512 3300025914 Ga0207671_10228765 Ga0207671_102287652 212
513 3300025915 Ga0207693_10067061 Ga0207693_100670611 212
514 3300025917 Ga0207660_10428591 Ga0207660_104285912 212
515 3300025918 Ga0207662_10023331 Ga0207662_100233314 212
516 3300025919 Ga0207657_10389313 Ga0207657_103893131 212
517 3300025921 Ga0207652_10162990 Ga0207652_101629902 212
518 3300025921 Ga0207652_10213684 Ga0207652_102136842 212
519 3300025922 Ga0207646_10032220 Ga0207646_100322202 212
520 3300025923 Ga0207681_10511063 Ga0207681_105110632 212
521 3300025925 Ga0207650_10095222 Ga0207650_100952222 212
522 3300025926 Ga0207659_10039835 Ga0207659_100398354 212
523 3300025926 Ga0207659_10109538 Ga0207659_101095382 212
524 3300025927 Ga0207687_10573601 Ga0207687_105736011 212
525 3300025928 Ga0207700_10192761 Ga0207700_101927612 212
526 3300025929 Ga0207664_10021433 Ga0207664_100214335 212
527 3300025931 Ga0207644_10008849 Ga0207644_100088497 212
528 3300025931 Ga0207644_10164041 Ga0207644_101640412 212
529 3300025932 Ga0207690_10002394 Ga0207690_100023944 212
530 3300025933 Ga0207706_10086107 Ga0207706_100861072 212
531 3300025933 Ga0207706_10166742 Ga0207706_101667423 212
532 3300025934 Ga0207686_10133879 Ga0207686_101338792 212
533 3300025935 Ga0207709_10199323 Ga0207709_101993232 212
534 3300025936 Ga0207670_10167694 Ga0207670_101676942 212
535 3300025937 Ga0207669_10001543 Ga0207669_100015439 212
536 3300025940 Ga0207691_10000006 Ga0207691_10000006118 212
537 3300025940 Ga0207691_10039639 Ga0207691_100396392 212
538 3300025941 Ga0207711_10057099 Ga0207711_100570994 212
539 3300025945 Ga0207679_10008555 Ga0207679_100085552 212
540 3300025949 Ga0207667_10151210 Ga0207667_101512103 212
541 3300025960 Ga0207651_10003988 Ga0207651_100039886 212
542 3300025960 Ga0207651_10015082 Ga0207651_100150824 212
543 3300025961 Ga0207712_10094260 Ga0207712_100942603 212
544 3300025972 Ga0207668_10007730 Ga0207668_100077306 212
545 3300025981 Ga0207640_10159122 Ga0207640_101591222 212
546 3300025986 Ga0207658_10003664 Ga0207658_100036647 212
547 3300025986 Ga0207658_10041926 Ga0207658_100419262 212
548 3300025986 Ga0207658_10076087 Ga0207658_100760872 212
549 3300026023 Ga0207677_10014400 Ga0207677_100144005 212
550 3300026023 Ga0207677_10145959 Ga0207677_101459592 212
551 3300026035 Ga0207703_10011799 Ga0207703_100117994 212
552 3300026041 Ga0207639_10009225 Ga0207639_100092257 212
553 3300026067 Ga0207678_10008744 Ga0207678_100087445 212
554 3300026088 Ga0207641_10038663 Ga0207641_100386632 212
555 3300026089 Ga0207648_10006993 Ga0207648_100069936 212
556 3300026089 Ga0207648_10061894 Ga0207648_100618944 212
557 3300026089 Ga0207648_10329465 Ga0207648_103294652 212
558 3300026095 Ga0207676_10012674 Ga0207676_100126744 212
559 3300026095 Ga0207676_10319664 Ga0207676_103196642 212
560 3300026118 Ga0207675_100045649 Ga0207675_1000456492 212
561 3300026118 Ga0207675_101364417 Ga0207675_1013644171 212
562 3300026121 Ga0207683_10000056 Ga0207683_1000005622 212
563 3300026121 Ga0207683_10170817 Ga0207683_101708172 212
564 3300026142 Ga0207698_10999551 Ga0207698_109995512 212
565 3300027111 Ga0209281_1000104 Ga0209281_10001046 212
566 3300028379 Ga0268266_10016093 Ga0268266_100160936 212
567 3300028379 Ga0268266_10242898 Ga0268266_102428982 212
568 3300028380 Ga0268265_10606689 Ga0268265_106066892 212
569 3300028381 Ga0268264_10012022 Ga0268264_100120222 212
570 3300028381 Ga0268264_10092467 Ga0268264_100924673 212
571 3300028381 Ga0268264_10745804 Ga0268264_107458042 212
572 3300028794 Ga0307515_10002278 Ga0307515_100022786 212
573 3300028794 Ga0307515_10002502 Ga0307515_100025027 212
574 3300028794 Ga0307515_10011678 Ga0307515_1001167812 212
575 3300030522 Ga0307512_10028633 Ga0307512_100286334 212
576 3300031235 Ga0265330_10005332 Ga0265330_100053324 212
577 3300031238 Ga0265332_10000594 Ga0265332_100005942 212
578 3300031242 Ga0265329_10004983 Ga0265329_100049835 212
579 3300031250 Ga0265331_10016246 Ga0265331_100162464 212
580 3300031251 Ga0265327_10028073 Ga0265327_100280733 212
581 3300031344 Ga0265316_10009477 Ga0265316_1000947711 212
582 3300031456 Ga0307513_10049503 Ga0307513_100495033 212
583 3300031456 Ga0307513_10161808 Ga0307513_101618083 212
584 3300031456 Ga0307513_10247707 Ga0307513_102477072 212
585 3300031456 Ga0307513_10421703 Ga0307513_104217032 212
586 3300031616 Ga0307508_10000061 Ga0307508_1000006115 212
587 3300031649 Ga0307514_10003371 Ga0307514_100033714 212
588 3300031711 Ga0265314_10011562 Ga0265314_100115622 212
589 3300031712 Ga0265342_10006799 Ga0265342_1000679912 212
590 3300031730 Ga0307516_10009896 Ga0307516_100098966 212
591 3300031730 Ga0307516_10462540 Ga0307516_104625402 212
592 3300034816 Ga0373930_0067189 Ga0373930_0067189_106_768 212
593 3300035089 Ga0373944_0063867 Ga0373944_0063867_280_927 212
594 3300036401 Ga0373937_1058924 Ga0373937_1058924_25_672 212
595 3300037471 Ga0395905_0790714 Ga0395905_0790714_142_786 212
596 3300039437 Ga0436365_1594720 Ga0436365_1594720_143_793 212
597 3300041451 Ga0451791_0575998 Ga0451791_0575998_368_1015 212
598 3300041452 Ga0451793_0793577 Ga0451793_0793577_225_872 212
599 3300041453 Ga0451797_0999178 Ga0451797_0999178_75_722 212
600 3300041459 Ga0451800_0643375 Ga0451800_0643375_28_675 212
601 3300041498 Ga0451841_0395393 Ga0451841_0395393_99_746 212
602 3300041509 Ga0451843_0784537 Ga0451843_0784537_14_673 212
603 3300041512 Ga0451853_3344173 Ga0451853_3344173_80_727 212
604 3300042122 Ga0450920_004850 Ga0450920_004850_892_1539 212
605 3300042531 Ga0450918_001122 Ga0450918_001122_4820_5467 212
606 3300046454 Ga0495592_0185342 Ga0495592_0185342_277_915 212
607 3300046455 Ga0495603_0301266 Ga0495603_0301266_242_889 212
608 3300046459 Ga0495629_0323467 Ga0495629_0323467_60_707 212
609 3300046512 Ga0495610_0024862 Ga0495610_0024862_2131_2778 212
610 3300046519 Ga0495632_0011199 Ga0495632_0011199_3538_4182 212
611 3300046522 Ga0495643_0092042 Ga0495643_0092042_706_1350 212
612 3300046528 Ga0495642_0126731 Ga0495642_0126731_354_995 212
613 3300046660 Ga0495625_0003328 Ga0495625_0003328_8923_9567 212
614 3300046683 Ga0495658_0245404 Ga0495658_0245404_225_869 212
615 3300047472 Ga0495686_0076142 Ga0495686_0076142_837_1481 212
616 3300048904 Ga0496101_0143126 Ga0496101_0143126_820_1467 212
617 3300048907 Ga0496104_0040840 Ga0496104_0040840_3392_4039 212
618 3300048908 Ga0496105_0106472 Ga0496105_0106472_106_753 212
619 3300048911 Ga0496108_0091858 Ga0496108_0091858_1493_2140 212
620 3300048912 Ga0496109_0567090 Ga0496109_0567090_298_945 212
621 3300048914 Ga0496111_0094589 Ga0496111_0094589_16_663 212
622 3300048917 Ga0496114_0069460 Ga0496114_0069460_1267_1908 212
623 3300048917 Ga0496114_0185882 Ga0496114_0185882_993_1640 212
624 3300048929 Ga0496126_0062320 Ga0496126_0062320_1738_2400 212
625 3300050493 nmdc:mga0k408_330969_c1 nmdc:mga0k408_330969_c1_180_827 212
626 3300050493 nmdc:mga0k408_469504_c1 nmdc:mga0k408_469504_c1_18_665 212
627 3300050496 nmdc:mga07m45_153997_c1 nmdc:mga07m45_153997_c1_40_705 212
628 3300053096 Ga0500641_0007052 Ga0500641_0007052_995_1657 212
629 3300053148 Ga0500590_035333 Ga0500590_035333_1590_2228 212
630 3300053154 Ga0500619_000129 Ga0500619_000129_15818_16639 212
631 3300053739 Ga0500587_001555 Ga0500587_001555_918_1565 212
632 3300028577 Ga0265318_10004018 Ga0265318_100040185 213
633 3300001979 JGI24740J21852_10000889 JGI24740J21852_100008893 214
634 3300001989 JGI24739J22299_10005706 JGI24739J22299_100057066 214
635 3300001989 JGI24739J22299_10009956 JGI24739J22299_100099563 214
636 3300001990 JGI24737J22298_10055780 JGI24737J22298_100557802 214
637 3300002067 JGI24735J21928_10026752 JGI24735J21928_100267522 214
638 3300002067 JGI24735J21928_10035864 JGI24735J21928_100358642 214
639 3300002705 JGI25156J39149_1003113 JGI25156J39149_10031132 214
640 3300002705 JGI25156J39149_1006429 JGI25156J39149_10064292 214
641 3300003214 JGI25165J46597_1001028 JGI25165J46597_10010288 214
642 3300003320 rootH2_10027978 rootH2_100279784 214
643 3300003323 rootH1_10089386 rootH1_100893862 214
644 3300003323 rootH1_10089401 rootH1_100894013 214
645 3300003354 JGI25160J50197_1000049 JGI25160J50197_100004962 214
646 3300003756 Ga0055533_1000812 Ga0055533_10008128 214
647 3300003756 Ga0055533_1002173 Ga0055533_10021736 214
648 3300003758 Ga0055532_1000031 Ga0055532_100003165 214
649 3300003760 Ga0055527_1000020 Ga0055527_100002065 214
650 3300003761 Ga0055535_1000023 Ga0055535_1000023153 214
651 3300003762 Ga0055542_1000035 Ga0055542_100003565 214
652 3300003763 Ga0055529_1000039 Ga0055529_1000039153 214
653 3300005262 Ga0065165_1000115 Ga0065165_100011562 214
654 3300005329 Ga0070683_101199357 Ga0070683_1011993571 214
655 3300005331 Ga0070670_100125628 Ga0070670_1001256281 214
656 3300005353 Ga0070669_100115617 Ga0070669_1001156172 214
657 3300005367 Ga0070667_100097359 Ga0070667_1000973593 214
658 3300005434 Ga0070709_10055155 Ga0070709_100551552 214
659 3300005455 Ga0070663_100501530 Ga0070663_1005015301 214
660 3300005546 Ga0070696_100058271 Ga0070696_1000582713 214
661 3300005844 Ga0068862_100458604 Ga0068862_1004586042 214
662 3300006173 Ga0070716_100003346 Ga0070716_1000033462 214
663 3300006844 Ga0075428_100006608 Ga0075428_1000066088 214
664 3300006871 Ga0075434_100013352 Ga0075434_1000133525 214
665 3300006880 Ga0075429_100189143 Ga0075429_1001891432 214
666 3300007076 Ga0075435_100003277 Ga0075435_10000327712 214
667 3300007076 Ga0075435_100212104 Ga0075435_1002121042 214
668 3300009011 Ga0105251_10000055 Ga0105251_100000559 214
669 3300009011 Ga0105251_10074907 Ga0105251_100749072 214
670 3300009011 Ga0105251_10119186 Ga0105251_101191862 214
671 3300009093 Ga0105240_10018564 Ga0105240_100185648 214
672 3300009093 Ga0105240_10213594 Ga0105240_102135942 214
673 3300009094 Ga0111539_10003392 Ga0111539_1000339212 214
674 3300009094 Ga0111539_10676885 Ga0111539_106768852 214
675 3300009147 Ga0114129_10030470 Ga0114129_100304709 214
676 3300009177 Ga0105248_10395338 Ga0105248_103953382 214
677 3300009177 Ga0105248_10434122 Ga0105248_104341222 214
678 3300009177 Ga0105248_10510868 Ga0105248_105108682 214
679 3300009551 Ga0105238_10305285 Ga0105238_103052852 214
680 3300013105 Ga0157369_10015435 Ga0157369_100154352 214
681 3300013105 Ga0157369_10153297 Ga0157369_101532972 214
682 3300013105 Ga0157369_10232541 Ga0157369_102325411 214
683 3300014326 Ga0157380_10070253 Ga0157380_100702535 214
684 3300014326 Ga0157380_10363460 Ga0157380_103634602 214
685 3300014497 Ga0182008_10009309 Ga0182008_100093093 214
686 3300014969 Ga0157376_10258047 Ga0157376_102580472 214
687 3300015262 Ga0182007_10001200 Ga0182007_100012006 214
688 3300016635 Ga0183361_10001 Ga0183361_10001217 214
689 3300025206 Ga0209435_112808 Ga0209435_1128081 214
690 3300025226 Ga0209674_100017 Ga0209674_1000178 214
691 3300025226 Ga0209674_100287 Ga0209674_1002878 214
692 3300025228 Ga0209672_100001 Ga0209672_1000011946 214
693 3300025229 Ga0209147_100001 Ga0209147_1000011946 214
694 3300025230 Ga0209563_101394 Ga0209563_1013944 214
695 3300025231 Ga0207427_101345 Ga0207427_1013453 214
696 3300025242 Ga0209258_100001 Ga0209258_1000011946 214
697 3300025246 Ga0209646_1007651 Ga0209646_10076512 214
698 3300025254 Ga0209148_1000003 Ga0209148_10000031946 214
699 3300025256 Ga0209759_1000037 Ga0209759_1000037233 214
700 3300025256 Ga0209759_1000649 Ga0209759_100064926 214
701 3300025256 Ga0209759_1019104 Ga0209759_10191041 214
702 3300025261 Ga0209233_1000123 Ga0209233_1000123145 214
703 3300025272 Ga0209455_1000001 Ga0209455_10000011946 214
704 3300025284 Ga0209130_1011142 Ga0209130_10111421 214
705 3300025302 Ga0207426_1000007 Ga0207426_1000007276 214
706 3300025735 Ga0207713_1000089 Ga0207713_1000089116 214
707 3300025735 Ga0207713_1000106 Ga0207713_100010636 214
708 3300025904 Ga0207647_10000540 Ga0207647_100005408 214
709 3300025904 Ga0207647_10007729 Ga0207647_100077293 214
710 3300025907 Ga0207645_10235406 Ga0207645_102354062 214
711 3300025909 Ga0207705_10111230 Ga0207705_101112302 214
712 3300025913 Ga0207695_10049156 Ga0207695_100491562 214
713 3300025913 Ga0207695_10105735 Ga0207695_101057352 214
714 3300025915 Ga0207693_10460304 Ga0207693_104603041 214
715 3300025919 Ga0207657_10178669 Ga0207657_101786692 214
716 3300025923 Ga0207681_10112870 Ga0207681_101128703 214
717 3300025924 Ga0207694_10815057 Ga0207694_108150571 214
718 3300025928 Ga0207700_10656578 Ga0207700_106565782 214
719 3300025941 Ga0207711_10037329 Ga0207711_100373293 214
720 3300025941 Ga0207711_10049621 Ga0207711_100496212 214
721 3300025949 Ga0207667_10166893 Ga0207667_101668932 214
722 3300025972 Ga0207668_10167720 Ga0207668_101677202 214
723 3300025986 Ga0207658_10070544 Ga0207658_100705443 214
724 3300026067 Ga0207678_10170178 Ga0207678_101701783 214
725 3300026089 Ga0207648_10749895 Ga0207648_107498952 214
726 3300026095 Ga0207676_10305279 Ga0207676_103052791 214
727 3300026116 Ga0207674_10125523 Ga0207674_101255232 214
728 3300026118 Ga0207675_100113535 Ga0207675_1001135352 214
729 3300028800 Ga0265338_10000118 Ga0265338_1000011851 214
730 3300028800 Ga0265338_10018147 Ga0265338_100181472 214
731 3300031241 Ga0265325_10000101 Ga0265325_100001018 214
732 3300031247 Ga0265340_10114709 Ga0265340_101147092 214
733 3300031249 Ga0265339_10001142 Ga0265339_1000114213 214
734 3300031250 Ga0265331_10000003 Ga0265331_10000003398 214
735 3300031344 Ga0265316_10014358 Ga0265316_100143583 214
736 3300031344 Ga0265316_10353726 Ga0265316_103537262 214
737 3300031548 Ga0307408_100262570 Ga0307408_1002625702 214
738 3300031595 Ga0265313_10008276 Ga0265313_100082766 214
739 3300031711 Ga0265314_10009671 Ga0265314_100096719 214
740 3300031911 Ga0307412_10000014 Ga0307412_10000014148 214
741 3300031911 Ga0307412_10000107 Ga0307412_1000010753 214
742 3300037471 Ga0395905_0000014 Ga0395905_0000014_194953_195597 214
743 3300037471 Ga0395905_0158652 Ga0395905_0158652_509_1153 214
744 3300037471 Ga0395905_0567640 Ga0395905_0567640_345_989 214
745 3300038443 Ga0395901_0499111 Ga0395901_0499111_168_812 214
746 3300042156 Ga0439446_0009840 Ga0439446_0009840_309_953 214
747 3300042435 Ga0439434_0069678 Ga0439434_0069678_363_1007 214
748 3300042876 Ga0451577_0708316 Ga0451577_0708316_101_748 214
749 3300044684 Ga0466966_0121667 Ga0466966_0121667_768_1430 214
750 3300046454 Ga0495592_0040739 Ga0495592_0040739_1802_2446 214
751 3300046455 Ga0495603_0016605 Ga0495603_0016605_2263_2907 214
752 3300046457 Ga0495590_0041346 Ga0495590_0041346_547_1191 214
753 3300046459 Ga0495629_0003125 Ga0495629_0003125_6788_7432 214
754 3300046459 Ga0495629_0003148 Ga0495629_0003148_6287_6931 214
755 3300046463 Ga0495653_0014931 Ga0495653_0014931_5138_5782 214
756 3300046463 Ga0495653_0240220 Ga0495653_0240220_47_697 214
757 3300046463 Ga0495653_0246511 Ga0495653_0246511_231_875 214
758 3300046471 Ga0495650_0018718 Ga0495650_0018718_2250_2894 214
759 3300046471 Ga0495650_0042657 Ga0495650_0042657_356_1000 214
760 3300046471 Ga0495650_0061671 Ga0495650_0061671_102_746 214
761 3300046472 Ga0495580_0004970 Ga0495580_0004970_5160_5804 214
762 3300046472 Ga0495580_0013759 Ga0495580_0013759_1978_2622 214
763 3300046472 Ga0495580_0019504 Ga0495580_0019504_2133_2777 214
764 3300046472 Ga0495580_0180777 Ga0495580_0180777_169_813 214
765 3300046473 Ga0495582_0004146 Ga0495582_0004146_6371_7015 214
766 3300046474 Ga0495605_0012407 Ga0495605_0012407_348_992 214
767 3300046474 Ga0495605_0026161 Ga0495605_0026161_1884_2528 214
768 3300046474 Ga0495605_0184036 Ga0495605_0184036_159_803 214
769 3300046476 Ga0495662_0015160 Ga0495662_0015160_592_1236 214
770 3300046477 Ga0495664_0010186 Ga0495664_0010186_2591_3235 214
771 3300046477 Ga0495664_0047247 Ga0495664_0047247_324_968 214
772 3300046491 Ga0495584_0221449 Ga0495584_0221449_134_778 214
773 3300046506 Ga0495583_0009452 Ga0495583_0009452_3154_3798 214
774 3300046507 Ga0495606_0011868 Ga0495606_0011868_1163_1807 214
775 3300046511 Ga0495608_0030601 Ga0495608_0030601_1016_1660 214
776 3300046512 Ga0495610_0008911 Ga0495610_0008911_5040_5684 214
777 3300046513 Ga0495616_0032976 Ga0495616_0032976_1227_1871 214
778 3300046514 Ga0495618_0008272 Ga0495618_0008272_4996_5640 214
779 3300046515 Ga0495620_0105336 Ga0495620_0105336_10_666 214
780 3300046516 Ga0495628_0060419 Ga0495628_0060419_231_875 214
781 3300046516 Ga0495628_0338683 Ga0495628_0338683_409_1053 214
782 3300046522 Ga0495643_0063557 Ga0495643_0063557_1112_1756 214
783 3300046524 Ga0495648_0067124 Ga0495648_0067124_588_1262 214
784 3300046526 Ga0495666_0003678 Ga0495666_0003678_2900_3544 214
785 3300046528 Ga0495642_0019199 Ga0495642_0019199_1838_2482 214
786 3300046529 Ga0495652_0016973 Ga0495652_0016973_4207_4851 214
787 3300046533 Ga0495640_0011543 Ga0495640_0011543_3155_3799 214
788 3300046543 Ga0495645_0105323 Ga0495645_0105323_1007_1651 214
789 3300046557 Ga0495622_0066549 Ga0495622_0066549_103_747 214
790 3300046663 Ga0495635_0004906 Ga0495635_0004906_6892_7536 214
791 3300046678 Ga0495599_0000114 Ga0495599_0000114_10315_10962 214
792 3300046679 Ga0495623_0070373 Ga0495623_0070373_103_747 214
793 3300046680 Ga0495646_0004942 Ga0495646_0004942_4794_5438 214
794 3300046680 Ga0495646_0018335 Ga0495646_0018335_2750_3394 214
795 3300046689 Ga0495613_0094984 Ga0495613_0094984_971_1615 214
796 3300046690 Ga0495624_0054505 Ga0495624_0054505_1627_2271 214
797 3300046694 Ga0495649_0006836 Ga0495649_0006836_5732_6388 214
798 3300046694 Ga0495649_0018654 Ga0495649_0018654_615_1259 214
799 3300046694 Ga0495649_0243515 Ga0495649_0243515_223_867 214
800 3300046794 Ga0495589_0018927 Ga0495589_0018927_206_850 214
801 3300046794 Ga0495589_0056398 Ga0495589_0056398_832_1488 214
802 3300046794 Ga0495589_0095974 Ga0495589_0095974_735_1379 214
803 3300046809 Ga0495600_0050291 Ga0495600_0050291_1789_2433 214
804 3300046810 Ga0495660_0110930 Ga0495660_0110930_307_951 214
805 3300047315 Ga0495581_0002005 Ga0495581_0002005_5659_6303 214
806 3300047317 Ga0495604_0028444 Ga0495604_0028444_360_1004 214
807 3300047317 Ga0495604_0381199 Ga0495604_0381199_185_829 214
808 3300047319 Ga0495674_0002606 Ga0495674_0002606_3387_4031 214
809 3300047321 Ga0495676_0054810 Ga0495676_0054810_436_1080 214
810 3300047322 Ga0495680_0047724 Ga0495680_0047724_509_1153 214
811 3300047323 Ga0495683_0003499 Ga0495683_0003499_6128_6772 214
812 3300047323 Ga0495683_0011753 Ga0495683_0011753_2999_3643 214
813 3300047323 Ga0495683_0021096 Ga0495683_0021096_130_774 214
814 3300047323 Ga0495683_0063273 Ga0495683_0063273_1136_1792 214
815 3300047443 Ga0495687_023970 Ga0495687_023970_1286_1930 214
816 3300047443 Ga0495687_024023 Ga0495687_024023_1825_2469 214
817 3300047444 Ga0495675_0007254 Ga0495675_0007254_3866_4510 214
818 3300047444 Ga0495675_0091118 Ga0495675_0091118_231_875 214
819 3300047445 Ga0495677_0189437 Ga0495677_0189437_47_769 214
820 3300047446 Ga0495679_040396 Ga0495679_040396_530_1174 214
821 3300047469 Ga0495673_0019901 Ga0495673_0019901_2053_2697 214
822 3300047472 Ga0495686_0000014 Ga0495686_0000014_149411_150055 214
823 3300047673 Ga0495593_0012015 Ga0495593_0012015_2156_2800 214
824 3300047673 Ga0495593_0012819 Ga0495593_0012819_660_1304 214
825 3300047673 Ga0495593_0101879 Ga0495593_0101879_254_904 214
826 3300048088 Ga0495602_0027443 Ga0495602_0027443_432_1079 214
827 3300048088 Ga0495602_0050386 Ga0495602_0050386_3010_3657 214
828 3300048089 Ga0495614_0003643 Ga0495614_0003643_5625_6269 214
829 3300048091 Ga0495626_0027353 Ga0495626_0027353_195_839 214
830 3300048091 Ga0495626_0088863 Ga0495626_0088863_195_839 214
831 3300048903 Ga0496100_0060295 Ga0496100_0060295_1344_1988 214
832 3300048903 Ga0496100_0082475 Ga0496100_0082475_946_1590 214
833 3300048904 Ga0496101_0023541 Ga0496101_0023541_571_1215 214
834 3300048904 Ga0496101_0103037 Ga0496101_0103037_1434_2078 214
835 3300048905 Ga0496102_0060786 Ga0496102_0060786_454_1098 214
836 3300048906 Ga0496103_0002910 Ga0496103_0002910_4603_5247 214
837 3300048907 Ga0496104_0048947 Ga0496104_0048947_2963_3607 214
838 3300048907 Ga0496104_0185297 Ga0496104_0185297_738_1382 214
839 3300048908 Ga0496105_0031288 Ga0496105_0031288_2622_3266 214
840 3300048908 Ga0496105_0220412 Ga0496105_0220412_844_1488 214
841 3300048909 Ga0496106_0000071 Ga0496106_0000071_44630_45274 214
842 3300048909 Ga0496106_0036863 Ga0496106_0036863_1764_2408 214
843 3300048909 Ga0496106_0058895 Ga0496106_0058895_775_1419 214
844 3300048910 Ga0496107_0077530 Ga0496107_0077530_1257_1901 214
845 3300048915 Ga0496112_0178770 Ga0496112_0178770_1065_1709 214
846 3300048916 Ga0496113_0013566 Ga0496113_0013566_396_1040 214
847 3300048919 Ga0496116_0156493 Ga0496116_0156493_164_808 214
848 3300048919 Ga0496116_0173080 Ga0496116_0173080_440_1084 214
849 3300048920 Ga0496117_0047781 Ga0496117_0047781_61_705 214
850 3300048920 Ga0496117_0109936 Ga0496117_0109936_687_1331 214
851 3300048920 Ga0496117_0279749 Ga0496117_0279749_60_704 214
852 3300048921 Ga0496118_0002189 Ga0496118_0002189_6881_7525 214
853 3300048921 Ga0496118_0010536 Ga0496118_0010536_5553_6197 214
854 3300048921 Ga0496118_0032534 Ga0496118_0032534_1546_2190 214
855 3300048921 Ga0496118_0107213 Ga0496118_0107213_100_744 214
856 3300048922 Ga0496119_0023176 Ga0496119_0023176_1563_2207 214
857 3300048922 Ga0496119_0154808 Ga0496119_0154808_429_1073 214
858 3300048924 Ga0496121_0000333 Ga0496121_0000333_88147_88791 214
859 3300048924 Ga0496121_0032682 Ga0496121_0032682_2997_3641 214
860 3300048924 Ga0496121_0056392 Ga0496121_0056392_1074_1718 214
861 3300048925 Ga0496122_0044737 Ga0496122_0044737_1322_1966 214
862 3300048927 Ga0496124_0141888 Ga0496124_0141888_251_895 214
863 3300048929 Ga0496126_0001409 Ga0496126_0001409_2976_3620 214
864 3300048929 Ga0496126_0002413 Ga0496126_0002413_19651_20295 214
865 3300048929 Ga0496126_0007047 Ga0496126_0007047_6499_7143 214
866 3300049460 Ga0495682_0040580 Ga0495682_0040580_756_1400 214
867 3300049568 Ga0501031_0155434 Ga0501031_0155434_716_1372 214
868 3300049571 Ga0501034_0038133 Ga0501034_0038133_2019_2675 214
869 3300049574 Ga0501038_0067408 Ga0501038_0067408_1831_2487 214
870 3300049576 Ga0501040_0128374 Ga0501040_0128374_778_1422 214
871 3300049577 Ga0501041_0347776 Ga0501041_0347776_242_889 214
872 3300049579 Ga0501043_0040221 Ga0501043_0040221_1578_2234 214
873 3300049579 Ga0501043_0076965 Ga0501043_0076965_335_979 214
874 3300049581 Ga0501047_0217122 Ga0501047_0217122_194_850 214
875 3300049582 Ga0501048_0155497 Ga0501048_0155497_259_906 214
876 3300049586 Ga0501070_0063658 Ga0501070_0063658_2285_2950 214
877 3300049587 Ga0501071_0393347 Ga0501071_0393347_300_947 214
878 3300049591 Ga0501075_0055463 Ga0501075_0055463_1191_1838 214
879 3300049592 Ga0501076_0987915 Ga0501076_0987915_15_659 214
880 3300049742 Ga0501080_0094444 Ga0501080_0094444_2088_2744 214
881 3300049823 Ga0501044_0543676 Ga0501044_0543676_158_814 214
882 3300050507 nmdc:mga05p37_105948_c1 nmdc:mga05p37_105948_c1_108_752 214
883 3300050508 nmdc:mga09592_131784_c1 nmdc:mga09592_131784_c1_545_1189 214
884 3300050511 nmdc:mga08y16_313882_c1 nmdc:mga08y16_313882_c1_888_1541 214
885 3300050511 nmdc:mga08y16_9642_c1 nmdc:mga08y16_9642_c1_9421_10065 214
886 3300050512 nmdc:mga0n895_23040_c1 nmdc:mga0n895_23040_c1_4316_4960 214
887 3300050513 nmdc:mga0rr50_284280_c1 nmdc:mga0rr50_284280_c1_98_742 214
888 3300050515 nmdc:mga0a205_147_c1 nmdc:mga0a205_147_c1_43666_44310 214
889 3300061734 Ga0530510_0561834 Ga0530510_0561834_29_673 214
890 iso_pu_bacteria 2751185846 2753566259 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

29

108

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

34

103

0.91

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

25

102

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9859 1 214
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9813 1 214
2cz2-assembly1.cif.gz_A-2 crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal) 0.9773 2 214
1fw1-assembly1.cif.gz_A-2 glutathione transferase zeta/maleylacetoacetate isomerase 0.9766 2 214
2cz3-assembly1.cif.gz_A crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) 0.9721 2 214
ID Description Score Start End Superfamily
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9881 4 79 3.40.30.10
2v6kB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9796 4 79 3.40.30.10
2v6kB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9766 85 214 1.20.1050.10
af_Q9SRY6_37_122_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9762 2 78 3.40.30.10
2cz2A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9732 4 79 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A382PU28-F1-model_v4 GST N-terminal domain-containing protein 1.005 2 76 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A6P2GFS6-F1-model_v4 Maleylacetoacetate isomerase 0.9976 2 214 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A2VVB5-F1-model_v4 deleted 0.9968 2 214
AF-A0A1F4LEH7-F1-model_v4 Maleylacetoacetate isomerase 0.9957 1 214 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A4R6F2N1-F1-model_v4 Maleylacetoacetate isomerase 0.9952 2 214 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
97.32 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map