F484832
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 890 | 442 | 858 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300047445|Ga0495677_0189437|Ga0495677_0189437_47_769 |
| Length | 240 |
| Sequence | VAWTGWASSACASSDIASAIQGEYKTMKLYSYFRSSASYRVRIALNLKNLPYEYLPVHLLRDGGEQFKPEYRELNHDAIVPTLVDGDHVITQSLAIIEYLEETHPEPPLLPSKPVDRAYVRSIVQQLACEIHPLNNLRVLKYLKRTVGVNDEVKDAWYRHWISSGFAALEEYLVADGRAGKLCFGDTPTIADICLVPQVFNANRFNVDMSPYPTIRRICEHANTLDAFARAEPGVQPDAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 2 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 3 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 4 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 5 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 6 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 7 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 8 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 9 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 10 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 11 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 12 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 13 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 14 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 15 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 16 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 17 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 18 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 19 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 20 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 21 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 22 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 23 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 24 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 25 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 26 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 27 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 28 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 29 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 30 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 31 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 32 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 33 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 34 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 35 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 36 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 37 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 38 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 39 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 50 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 60 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 97 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 98 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 150 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 232 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 234 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 237 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 238 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 243 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 245 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 246 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 247 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 248 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 249 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 252 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 254 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 255 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 256 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 259 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 260 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 261 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 262 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 263 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 264 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 271 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 277 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 282 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 283 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 284 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 285 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 286 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 287 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 288 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 289 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 290 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 291 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 292 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 293 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 294 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 295 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 296 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 297 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 298 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 299 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 300 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 301 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 302 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 303 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 304 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 368 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 371 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 372 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 373 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 376 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 377 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 378 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 379 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 380 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 381 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 382 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 383 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 384 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 385 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 386 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 420 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 423 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 433 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 434 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 435 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 437 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 439 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 440 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 441 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 442 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.4 |
| Metatranscriptomes | 0 |
| Isolates | 3.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.49 |
| Nodule | 1.24 |
| Rhizoplane | 4.83 |
| Rhizosphere | 82.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000889 | 3300001979 | Bacteria | 13228 |
| 2 | JGI24740J21852_10006469 | 3300001979 | Bacteria | 4847 |
| 3 | JGI24739J22299_10005706 | 3300001989 | Bacteria | 4716 |
| 4 | JGI24739J22299_10009956 | 3300001989 | Bacteria | 3535 |
| 5 | JGI24737J22298_10003339 | 3300001990 | Bacteria | 5675 |
| 6 | JGI24737J22298_10055780 | 3300001990 | Bacteria | 1194 |
| 7 | JGI24735J21928_10026752 | 3300002067 | Bacteria | 1732 |
| 8 | JGI24735J21928_10035864 | 3300002067 | Bacteria | 1456 |
| 9 | JGI25156J39149_1003113 | 3300002705 | Bacteria | 5597 |
| 10 | JGI25156J39149_1006429 | 3300002705 | Bacteria | 3211 |
| 11 | JGI25165J46597_1001028 | 3300003214 | Bacteria | 18325 |
| 12 | rootH2_10027978 | 3300003320 | Bacteria | 4153 |
| 13 | rootH2_10164363 | 3300003320 | Bacteria | 1416 |
| 14 | rootH1_10089386 | 3300003323 | Bacteria | 1516 |
| 15 | rootH1_10089401 | 3300003323 | Bacteria | 2548 |
| 16 | JGI25160J50197_1000049 | 3300003354 | Bacteria | 135107 |
| 17 | Ga0055533_1000812 | 3300003756 | Bacteria | 9659 |
| 18 | Ga0055533_1002173 | 3300003756 | Bacteria | 4672 |
| 19 | Ga0055532_1000031 | 3300003758 | Bacteria | 231440 |
| 20 | Ga0055527_1000020 | 3300003760 | Bacteria | 231441 |
| 21 | Ga0055535_1000023 | 3300003761 | Bacteria | 231441 |
| 22 | Ga0055542_1000035 | 3300003762 | Bacteria | 231441 |
| 23 | Ga0055529_1000039 | 3300003763 | Bacteria | 231439 |
| 24 | Ga0055524_1000227 | 3300003775 | Bacteria | 59891 |
| 25 | Ga0055530_10002810 | 3300003791 | Bacteria | 10714 |
| 26 | Ga0055540_1000112 | 3300003792 | Bacteria | 88200 |
| 27 | Ga0055531_10004566 | 3300003794 | Bacteria | 8371 |
| 28 | Ga0065165_1000115 | 3300005262 | Bacteria | 135145 |
| 29 | Ga0065715_10415519 | 3300005293 | Bacteria | 864 |
| 30 | Ga0070658_10012287 | 3300005327 | Bacteria | 6875 |
| 31 | Ga0070658_10337362 | 3300005327 | Bacteria | 1289 |
| 32 | Ga0070658_10530741 | 3300005327 | Bacteria | 1018 |
| 33 | Ga0070676_10021508 | 3300005328 | Bacteria | 3611 |
| 34 | Ga0070676_10048312 | 3300005328 | Bacteria | 2487 |
| 35 | Ga0070676_10136706 | 3300005328 | Bacteria | 1556 |
| 36 | Ga0070683_100026033 | 3300005329 | Bacteria | 5262 |
| 37 | Ga0070683_100039236 | 3300005329 | Bacteria | 4346 |
| 38 | Ga0070683_101199357 | 3300005329 | Unclassified | 729 |
| 39 | Ga0070690_100010655 | 3300005330 | Bacteria | 5356 |
| 40 | Ga0070670_100046023 | 3300005331 | Bacteria | 3751 |
| 41 | Ga0070670_100088711 | 3300005331 | Bacteria | 2659 |
| 42 | Ga0070670_100125628 | 3300005331 | Bacteria | 2214 |
| 43 | Ga0070677_10000399 | 3300005333 | Bacteria | 15153 |
| 44 | Ga0070666_10001754 | 3300005335 | Bacteria | 13241 |
| 45 | Ga0070666_10021840 | 3300005335 | Bacteria | 4150 |
| 46 | Ga0070666_10063686 | 3300005335 | Bacteria | 2500 |
| 47 | Ga0070680_100010998 | 3300005336 | Bacteria | 6995 |
| 48 | Ga0070680_100281712 | 3300005336 | Bacteria | 1408 |
| 49 | Ga0068868_100011862 | 3300005338 | Bacteria | 6355 |
| 50 | Ga0068868_100029926 | 3300005338 | Bacteria | 4173 |
| 51 | Ga0070660_100002929 | 3300005339 | Bacteria | 11747 |
| 52 | Ga0070660_100209189 | 3300005339 | Bacteria | 1583 |
| 53 | Ga0070689_100141774 | 3300005340 | Bacteria | 1933 |
| 54 | Ga0070689_100207343 | 3300005340 | Bacteria | 1603 |
| 55 | Ga0070687_100080577 | 3300005343 | Bacteria | 1775 |
| 56 | Ga0070661_100004617 | 3300005344 | Bacteria | 9478 |
| 57 | Ga0070661_100006773 | 3300005344 | Bacteria | 7896 |
| 58 | Ga0070661_100084021 | 3300005344 | Bacteria | 2352 |
| 59 | Ga0070661_100167367 | 3300005344 | Bacteria | 1668 |
| 60 | Ga0070668_100090767 | 3300005347 | Bacteria | 2407 |
| 61 | Ga0070668_100477890 | 3300005347 | Bacteria | 1076 |
| 62 | Ga0070669_100115617 | 3300005353 | Bacteria | 2041 |
| 63 | Ga0070669_100351508 | 3300005353 | Bacteria | 1197 |
| 64 | Ga0070675_100009122 | 3300005354 | Bacteria | 7703 |
| 65 | Ga0070671_100004778 | 3300005355 | Bacteria | 10770 |
| 66 | Ga0070671_100038311 | 3300005355 | Bacteria | 3979 |
| 67 | Ga0070671_100056534 | 3300005355 | Bacteria | 3264 |
| 68 | Ga0070671_100100596 | 3300005355 | Bacteria | 2425 |
| 69 | Ga0070671_100586845 | 3300005355 | Bacteria | 962 |
| 70 | Ga0070674_100004774 | 3300005356 | Bacteria | 7764 |
| 71 | Ga0070674_100510262 | 3300005356 | Bacteria | 1003 |
| 72 | Ga0070673_100001176 | 3300005364 | Bacteria | 15032 |
| 73 | Ga0070673_100036445 | 3300005364 | Bacteria | 3739 |
| 74 | Ga0070673_100082450 | 3300005364 | Bacteria | 2610 |
| 75 | Ga0070673_100659868 | 3300005364 | Bacteria | 958 |
| 76 | Ga0070659_100000992 | 3300005366 | Bacteria | 20821 |
| 77 | Ga0070659_100002333 | 3300005366 | Bacteria | 13501 |
| 78 | Ga0070659_100247849 | 3300005366 | Bacteria | 1476 |
| 79 | Ga0070659_100329772 | 3300005366 | Bacteria | 1277 |
| 80 | Ga0070667_100001817 | 3300005367 | Bacteria | 19009 |
| 81 | Ga0070667_100053817 | 3300005367 | Bacteria | 3397 |
| 82 | Ga0070667_100097359 | 3300005367 | Bacteria | 2538 |
| 83 | Ga0070667_100100736 | 3300005367 | Bacteria | 2495 |
| 84 | Ga0070667_100425927 | 3300005367 | Bacteria | 1210 |
| 85 | Ga0070709_10026666 | 3300005434 | Bacteria | 3427 |
| 86 | Ga0070709_10055155 | 3300005434 | Bacteria | 2508 |
| 87 | Ga0070714_100208301 | 3300005435 | Bacteria | 1791 |
| 88 | Ga0070710_10000687 | 3300005437 | Bacteria | 16064 |
| 89 | Ga0070711_100048889 | 3300005439 | Bacteria | 2894 |
| 90 | Ga0070708_100088896 | 3300005445 | Bacteria | 2810 |
| 91 | Ga0070663_100010881 | 3300005455 | Bacteria | 5684 |
| 92 | Ga0070663_100089547 | 3300005455 | Bacteria | 2278 |
| 93 | Ga0070663_100221258 | 3300005455 | Bacteria | 1486 |
| 94 | Ga0070663_100501530 | 3300005455 | Bacteria | 1008 |
| 95 | Ga0070678_100016839 | 3300005456 | Bacteria | 4687 |
| 96 | Ga0070678_100031328 | 3300005456 | Bacteria | 3667 |
| 97 | Ga0070662_100022342 | 3300005457 | Bacteria | 4330 |
| 98 | Ga0070662_100115356 | 3300005457 | Bacteria | 2052 |
| 99 | Ga0070662_100133004 | 3300005457 | Bacteria | 1920 |
| 100 | Ga0070662_100209925 | 3300005457 | Bacteria | 1549 |
| 101 | Ga0070681_10029928 | 3300005458 | Bacteria | 5465 |
| 102 | Ga0070681_10031291 | 3300005458 | Bacteria | 5342 |
| 103 | Ga0070681_10082648 | 3300005458 | Bacteria | 3167 |
| 104 | Ga0068867_100002533 | 3300005459 | Bacteria | 12859 |
| 105 | Ga0068867_100132568 | 3300005459 | Bacteria | 1938 |
| 106 | Ga0068867_100165044 | 3300005459 | Bacteria | 1749 |
| 107 | Ga0070685_10280235 | 3300005466 | Bacteria | 1116 |
| 108 | Ga0070685_10395354 | 3300005466 | Bacteria | 956 |
| 109 | Ga0070706_100000081 | 3300005467 | Bacteria | 110012 |
| 110 | Ga0070707_100003563 | 3300005468 | Bacteria | 14694 |
| 111 | Ga0070698_100008005 | 3300005471 | Bacteria | 11430 |
| 112 | Ga0070699_100039227 | 3300005518 | Bacteria | 4101 |
| 113 | Ga0070679_100002835 | 3300005530 | Bacteria | 15761 |
| 114 | Ga0070679_100030058 | 3300005530 | Bacteria | 5362 |
| 115 | Ga0070679_100067751 | 3300005530 | Bacteria | 3560 |
| 116 | Ga0070679_100445439 | 3300005530 | Bacteria | 1240 |
| 117 | Ga0068853_100135144 | 3300005539 | Bacteria | 2210 |
| 118 | Ga0068853_100462008 | 3300005539 | Bacteria | 1195 |
| 119 | Ga0068853_100492388 | 3300005539 | Bacteria | 1157 |
| 120 | Ga0070672_100001353 | 3300005543 | Bacteria | 15124 |
| 121 | Ga0070686_100061340 | 3300005544 | Bacteria | 2430 |
| 122 | Ga0070696_100014222 | 3300005546 | Bacteria | 5340 |
| 123 | Ga0070696_100058271 | 3300005546 | Bacteria | 2697 |
| 124 | Ga0070665_100006949 | 3300005548 | Bacteria | 11504 |
| 125 | Ga0070704_100653068 | 3300005549 | Bacteria | 929 |
| 126 | Ga0068855_100002695 | 3300005563 | Bacteria | 21894 |
| 127 | Ga0068855_100142257 | 3300005563 | Bacteria | 2733 |
| 128 | Ga0068855_100210048 | 3300005563 | Bacteria | 2188 |
| 129 | Ga0070664_100001303 | 3300005564 | Bacteria | 19939 |
| 130 | Ga0070664_100010774 | 3300005564 | Bacteria | 7413 |
| 131 | Ga0070664_100022353 | 3300005564 | Bacteria | 5214 |
| 132 | Ga0070664_100075187 | 3300005564 | Bacteria | 2900 |
| 133 | Ga0068857_100130293 | 3300005577 | Bacteria | 2268 |
| 134 | Ga0068854_100013554 | 3300005578 | Bacteria | 5354 |
| 135 | Ga0068854_100109249 | 3300005578 | Bacteria | 2084 |
| 136 | Ga0068854_100251747 | 3300005578 | Bacteria | 1411 |
| 137 | Ga0068856_100169041 | 3300005614 | Bacteria | 2198 |
| 138 | Ga0068856_100307473 | 3300005614 | Bacteria | 1603 |
| 139 | Ga0068852_100004888 | 3300005616 | Bacteria | 9517 |
| 140 | Ga0068852_100019610 | 3300005616 | Bacteria | 5357 |
| 141 | Ga0068852_100176060 | 3300005616 | Bacteria | 2009 |
| 142 | Ga0068859_100026469 | 3300005617 | Bacteria | 5817 |
| 143 | Ga0068859_100055882 | 3300005617 | Bacteria | 3972 |
| 144 | Ga0068859_100329870 | 3300005617 | Bacteria | 1620 |
| 145 | Ga0068864_100002905 | 3300005618 | Bacteria | 14163 |
| 146 | Ga0068864_100008255 | 3300005618 | Bacteria | 8589 |
| 147 | Ga0068864_100010148 | 3300005618 | Bacteria | 7776 |
| 148 | Ga0068864_100203958 | 3300005618 | Bacteria | 1818 |
| 149 | Ga0068861_100502309 | 3300005719 | Bacteria | 1096 |
| 150 | Ga0068851_10000682 | 3300005834 | Bacteria | 14458 |
| 151 | Ga0068851_10014791 | 3300005834 | Bacteria | 3710 |
| 152 | Ga0068851_10112506 | 3300005834 | Bacteria | 1455 |
| 153 | Ga0068870_10005548 | 3300005840 | Bacteria | 5510 |
| 154 | Ga0068863_100020671 | 3300005841 | Bacteria | 6287 |
| 155 | Ga0068863_100040505 | 3300005841 | Bacteria | 4429 |
| 156 | Ga0068863_100075683 | 3300005841 | Bacteria | 3185 |
| 157 | Ga0068863_100654933 | 3300005841 | Bacteria | 1042 |
| 158 | Ga0068858_100018916 | 3300005842 | Bacteria | 6445 |
| 159 | Ga0068858_100026254 | 3300005842 | Bacteria | 5414 |
| 160 | Ga0068858_100493384 | 3300005842 | Bacteria | 1183 |
| 161 | Ga0068860_100011373 | 3300005843 | Bacteria | 8772 |
| 162 | Ga0068860_100075558 | 3300005843 | Bacteria | 3205 |
| 163 | Ga0068860_100284479 | 3300005843 | Bacteria | 1617 |
| 164 | Ga0068862_100253870 | 3300005844 | Bacteria | 1603 |
| 165 | Ga0068862_100458604 | 3300005844 | Bacteria | 1203 |
| 166 | Ga0070717_10107482 | 3300006028 | Bacteria | 2376 |
| 167 | Ga0070716_100003346 | 3300006173 | Bacteria | 7535 |
| 168 | Ga0070712_100575436 | 3300006175 | Bacteria | 951 |
| 169 | Ga0097621_100055900 | 3300006237 | Bacteria | 3223 |
| 170 | Ga0097621_100093463 | 3300006237 | Bacteria | 2520 |
| 171 | Ga0068871_100009917 | 3300006358 | Bacteria | 6916 |
| 172 | Ga0068871_100036215 | 3300006358 | Bacteria | 3927 |
| 173 | Ga0075428_100006608 | 3300006844 | Bacteria | 12900 |
| 174 | Ga0075434_100013352 | 3300006871 | Bacteria | 7811 |
| 175 | Ga0075429_100189143 | 3300006880 | Bacteria | 1804 |
| 176 | Ga0068865_100148565 | 3300006881 | Bacteria | 1775 |
| 177 | Ga0097620_100026466 | 3300006931 | Bacteria | 5817 |
| 178 | Ga0097620_100055883 | 3300006931 | Bacteria | 3972 |
| 179 | Ga0097620_100329902 | 3300006931 | Bacteria | 1620 |
| 180 | Ga0079104_1000024 | 3300006946 | Bacteria | 219543 |
| 181 | Ga0075435_100003277 | 3300007076 | Bacteria | 10966 |
| 182 | Ga0075435_100212104 | 3300007076 | Unclassified | 1643 |
| 183 | Ga0105251_10000055 | 3300009011 | Bacteria | 105044 |
| 184 | Ga0105251_10074907 | 3300009011 | Bacteria | 1572 |
| 185 | Ga0105251_10119186 | 3300009011 | Bacteria | 1199 |
| 186 | Ga0105240_10018564 | 3300009093 | Bacteria | 9335 |
| 187 | Ga0105240_10018809 | 3300009093 | Bacteria | 9255 |
| 188 | Ga0105240_10213594 | 3300009093 | Bacteria | 2253 |
| 189 | Ga0111539_10003392 | 3300009094 | Bacteria | 20991 |
| 190 | Ga0111539_10676885 | 3300009094 | Bacteria | 1201 |
| 191 | Ga0105245_10713086 | 3300009098 | Bacteria | 1037 |
| 192 | Ga0114129_10030470 | 3300009147 | Bacteria | 7634 |
| 193 | Ga0105241_10128121 | 3300009174 | Bacteria | 2051 |
| 194 | Ga0105248_10014587 | 3300009177 | Bacteria | 8648 |
| 195 | Ga0105248_10038638 | 3300009177 | Bacteria | 5343 |
| 196 | Ga0105248_10072671 | 3300009177 | Bacteria | 3866 |
| 197 | Ga0105248_10395338 | 3300009177 | Bacteria | 1556 |
| 198 | Ga0105248_10434122 | 3300009177 | Bacteria | 1479 |
| 199 | Ga0105248_10510868 | 3300009177 | Bacteria | 1355 |
| 200 | Ga0105248_10604481 | 3300009177 | Bacteria | 1237 |
| 201 | Ga0105237_10928525 | 3300009545 | Bacteria | 877 |
| 202 | Ga0105238_10305285 | 3300009551 | Bacteria | 1576 |
| 203 | Ga0105238_10686404 | 3300009551 | Bacteria | 1036 |
| 204 | Ga0105238_11150796 | 3300009551 | Bacteria | 799 |
| 205 | Ga0105249_10095511 | 3300009553 | Bacteria | 2787 |
| 206 | Ga0099796_10001431 | 3300010159 | Bacteria | 4799 |
| 207 | Ga0105246_10055179 | 3300011119 | Bacteria | 2741 |
| 208 | Ga0157373_10119341 | 3300013100 | Bacteria | 1854 |
| 209 | Ga0157373_10423949 | 3300013100 | Bacteria | 955 |
| 210 | Ga0157371_10181944 | 3300013102 | Bacteria | 1503 |
| 211 | Ga0157370_10272942 | 3300013104 | Bacteria | 1562 |
| 212 | Ga0157370_10362695 | 3300013104 | Bacteria | 1335 |
| 213 | Ga0157370_10370932 | 3300013104 | Bacteria | 1319 |
| 214 | Ga0157370_10656931 | 3300013104 | Bacteria | 958 |
| 215 | Ga0157369_10001611 | 3300013105 | Bacteria | 27624 |
| 216 | Ga0157369_10005258 | 3300013105 | Bacteria | 15094 |
| 217 | Ga0157369_10015435 | 3300013105 | Bacteria | 8609 |
| 218 | Ga0157369_10092640 | 3300013105 | Bacteria | 3225 |
| 219 | Ga0157369_10153297 | 3300013105 | Bacteria | 2435 |
| 220 | Ga0157369_10232541 | 3300013105 | Bacteria | 1927 |
| 221 | Ga0157369_10720790 | 3300013105 | Bacteria | 1027 |
| 222 | Ga0157374_10040250 | 3300013296 | Bacteria | 4303 |
| 223 | Ga0157374_10223996 | 3300013296 | Bacteria | 1846 |
| 224 | Ga0163162_10140431 | 3300013306 | Bacteria | 2529 |
| 225 | Ga0163162_11524306 | 3300013306 | Bacteria | 762 |
| 226 | Ga0157372_10070907 | 3300013307 | Bacteria | 3922 |
| 227 | Ga0157372_10102817 | 3300013307 | Bacteria | 3264 |
| 228 | Ga0157372_10252566 | 3300013307 | Bacteria | 2047 |
| 229 | Ga0157375_10003757 | 3300013308 | Bacteria | 13163 |
| 230 | Ga0157375_10074842 | 3300013308 | Bacteria | 3409 |
| 231 | Ga0157375_10632453 | 3300013308 | Bacteria | 1227 |
| 232 | Ga0163163_10046750 | 3300014325 | Bacteria | 4251 |
| 233 | Ga0163163_10066448 | 3300014325 | Bacteria | 3581 |
| 234 | Ga0163163_10145931 | 3300014325 | Bacteria | 2410 |
| 235 | Ga0163163_10584683 | 3300014325 | Bacteria | 1180 |
| 236 | Ga0157380_10070253 | 3300014326 | Bacteria | 2829 |
| 237 | Ga0157380_10363460 | 3300014326 | Bacteria | 1359 |
| 238 | Ga0157380_10446541 | 3300014326 | Bacteria | 1241 |
| 239 | Ga0182008_10009309 | 3300014497 | Bacteria | 5308 |
| 240 | Ga0182008_10047944 | 3300014497 | Bacteria | 2122 |
| 241 | Ga0182008_10173994 | 3300014497 | Bacteria | 1088 |
| 242 | Ga0182008_10280742 | 3300014497 | Bacteria | 867 |
| 243 | Ga0157379_10034731 | 3300014968 | Bacteria | 4497 |
| 244 | Ga0157379_10089259 | 3300014968 | Bacteria | 2765 |
| 245 | Ga0157376_10235683 | 3300014969 | Bacteria | 1702 |
| 246 | Ga0157376_10258047 | 3300014969 | Bacteria | 1631 |
| 247 | Ga0157376_11455334 | 3300014969 | Bacteria | 717 |
| 248 | Ga0182007_10001200 | 3300015262 | Bacteria | 14066 |
| 249 | Ga0183361_10001 | 3300016635 | Bacteria | 908583 |
| 250 | Ga0163161_10021774 | 3300017792 | Bacteria | 4507 |
| 251 | Ga0163161_10210085 | 3300017792 | Bacteria | 1503 |
| 252 | Ga0213876_10065229 | 3300021384 | Bacteria | 1922 |
| 253 | Ga0209435_112808 | 3300025206 | Bacteria | 894 |
| 254 | Ga0209674_100017 | 3300025226 | Bacteria | 689087 |
| 255 | Ga0209674_100287 | 3300025226 | Bacteria | 36895 |
| 256 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 257 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 258 | Ga0209563_101394 | 3300025230 | Bacteria | 6469 |
| 259 | Ga0207427_101345 | 3300025231 | Bacteria | 9088 |
| 260 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 261 | Ga0209646_1007651 | 3300025246 | Bacteria | 1754 |
| 262 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 263 | Ga0209759_1000037 | 3300025256 | Bacteria | 259200 |
| 264 | Ga0209759_1000649 | 3300025256 | Bacteria | 32356 |
| 265 | Ga0209759_1019104 | 3300025256 | Bacteria | 1636 |
| 266 | Ga0209233_1000123 | 3300025261 | Bacteria | 228400 |
| 267 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 268 | Ga0209130_1011142 | 3300025284 | Bacteria | 2423 |
| 269 | Ga0209675_1010464 | 3300025291 | Bacteria | 3164 |
| 270 | Ga0209050_1001849 | 3300025298 | Bacteria | 20458 |
| 271 | Ga0209050_1066981 | 3300025298 | Bacteria | 820 |
| 272 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 273 | Ga0207426_1000007 | 3300025302 | Bacteria | 971011 |
| 274 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 275 | Ga0209257_1000510 | 3300025304 | Bacteria | 67777 |
| 276 | Ga0207656_10011120 | 3300025321 | Bacteria | 3392 |
| 277 | Ga0207656_10053425 | 3300025321 | Bacteria | 1753 |
| 278 | Ga0207656_10205865 | 3300025321 | Bacteria | 952 |
| 279 | Ga0207656_10283570 | 3300025321 | Bacteria | 817 |
| 280 | Ga0207713_1000089 | 3300025735 | Bacteria | 152927 |
| 281 | Ga0207713_1000106 | 3300025735 | Bacteria | 137911 |
| 282 | Ga0207682_10000075 | 3300025893 | Bacteria | 43404 |
| 283 | Ga0207682_10024073 | 3300025893 | Bacteria | 2408 |
| 284 | Ga0207682_10117676 | 3300025893 | Bacteria | 1176 |
| 285 | Ga0207680_10001434 | 3300025903 | Bacteria | 11296 |
| 286 | Ga0207680_10005169 | 3300025903 | Bacteria | 6226 |
| 287 | Ga0207647_10000540 | 3300025904 | Bacteria | 30173 |
| 288 | Ga0207647_10007729 | 3300025904 | Bacteria | 7740 |
| 289 | Ga0207647_10007746 | 3300025904 | Bacteria | 7732 |
| 290 | Ga0207647_10351345 | 3300025904 | Bacteria | 835 |
| 291 | Ga0207699_10003665 | 3300025906 | Bacteria | 7336 |
| 292 | Ga0207645_10000152 | 3300025907 | Bacteria | 54586 |
| 293 | Ga0207645_10235406 | 3300025907 | Bacteria | 1209 |
| 294 | Ga0207643_10026800 | 3300025908 | Bacteria | 3193 |
| 295 | Ga0207643_10220595 | 3300025908 | Bacteria | 1160 |
| 296 | Ga0207705_10000942 | 3300025909 | Bacteria | 23772 |
| 297 | Ga0207705_10017299 | 3300025909 | Bacteria | 5162 |
| 298 | Ga0207705_10104005 | 3300025909 | Bacteria | 2092 |
| 299 | Ga0207705_10111230 | 3300025909 | Bacteria | 2024 |
| 300 | Ga0207705_10707150 | 3300025909 | Bacteria | 783 |
| 301 | Ga0207684_10000069 | 3300025910 | Bacteria | 189217 |
| 302 | Ga0207707_10021943 | 3300025912 | Bacteria | 5580 |
| 303 | Ga0207707_10062495 | 3300025912 | Bacteria | 3241 |
| 304 | Ga0207695_10046710 | 3300025913 | Bacteria | 4588 |
| 305 | Ga0207695_10049156 | 3300025913 | Bacteria | 4448 |
| 306 | Ga0207695_10105735 | 3300025913 | Bacteria | 2801 |
| 307 | Ga0207671_10086742 | 3300025914 | Bacteria | 2353 |
| 308 | Ga0207671_10228765 | 3300025914 | Bacteria | 1458 |
| 309 | Ga0207693_10067061 | 3300025915 | Bacteria | 2810 |
| 310 | Ga0207693_10460304 | 3300025915 | Bacteria | 994 |
| 311 | Ga0207660_10107553 | 3300025917 | Bacteria | 2093 |
| 312 | Ga0207660_10428591 | 3300025917 | Bacteria | 1068 |
| 313 | Ga0207660_10623250 | 3300025917 | Bacteria | 879 |
| 314 | Ga0207662_10023331 | 3300025918 | Bacteria | 3555 |
| 315 | Ga0207657_10002608 | 3300025919 | Bacteria | 19479 |
| 316 | Ga0207657_10178669 | 3300025919 | Bacteria | 1716 |
| 317 | Ga0207657_10389313 | 3300025919 | Bacteria | 1097 |
| 318 | Ga0207649_10055418 | 3300025920 | Bacteria | 2471 |
| 319 | Ga0207649_10059731 | 3300025920 | Bacteria | 2393 |
| 320 | Ga0207649_10395062 | 3300025920 | Bacteria | 1033 |
| 321 | Ga0207652_10000875 | 3300025921 | Bacteria | 28516 |
| 322 | Ga0207652_10114033 | 3300025921 | Bacteria | 2399 |
| 323 | Ga0207652_10162990 | 3300025921 | Bacteria | 1999 |
| 324 | Ga0207652_10213684 | 3300025921 | Bacteria | 1737 |
| 325 | Ga0207652_10782013 | 3300025921 | Bacteria | 848 |
| 326 | Ga0207646_10032220 | 3300025922 | Bacteria | 4743 |
| 327 | Ga0207681_10112870 | 3300025923 | Bacteria | 1980 |
| 328 | Ga0207681_10511063 | 3300025923 | Bacteria | 985 |
| 329 | Ga0207694_10815057 | 3300025924 | Bacteria | 789 |
| 330 | Ga0207650_10069709 | 3300025925 | Bacteria | 2642 |
| 331 | Ga0207650_10095222 | 3300025925 | Bacteria | 2282 |
| 332 | Ga0207659_10039835 | 3300025926 | Bacteria | 3281 |
| 333 | Ga0207659_10109538 | 3300025926 | Bacteria | 2097 |
| 334 | Ga0207687_10573601 | 3300025927 | Bacteria | 948 |
| 335 | Ga0207700_10192761 | 3300025928 | Bacteria | 1713 |
| 336 | Ga0207700_10656578 | 3300025928 | Bacteria | 935 |
| 337 | Ga0207664_10021433 | 3300025929 | Bacteria | 4805 |
| 338 | Ga0207644_10008849 | 3300025931 | Bacteria | 6593 |
| 339 | Ga0207644_10009420 | 3300025931 | Bacteria | 6411 |
| 340 | Ga0207644_10130928 | 3300025931 | Bacteria | 1920 |
| 341 | Ga0207644_10164041 | 3300025931 | Bacteria | 1729 |
| 342 | Ga0207644_10240734 | 3300025931 | Bacteria | 1440 |
| 343 | Ga0207690_10002394 | 3300025932 | Bacteria | 11356 |
| 344 | Ga0207690_10034238 | 3300025932 | Bacteria | 3272 |
| 345 | Ga0207706_10036885 | 3300025933 | Bacteria | 4342 |
| 346 | Ga0207706_10086107 | 3300025933 | Bacteria | 2762 |
| 347 | Ga0207706_10166742 | 3300025933 | Bacteria | 1936 |
| 348 | Ga0207706_10398724 | 3300025933 | Bacteria | 1193 |
| 349 | Ga0207686_10133879 | 3300025934 | Bacteria | 1704 |
| 350 | Ga0207709_10199323 | 3300025935 | Bacteria | 1428 |
| 351 | Ga0207670_10167694 | 3300025936 | Bacteria | 1644 |
| 352 | Ga0207669_10001543 | 3300025937 | Bacteria | 9822 |
| 353 | Ga0207704_10146880 | 3300025938 | Bacteria | 1658 |
| 354 | Ga0207691_10000006 | 3300025940 | Bacteria | 161922 |
| 355 | Ga0207691_10039639 | 3300025940 | Bacteria | 4358 |
| 356 | Ga0207711_10037329 | 3300025941 | Bacteria | 4126 |
| 357 | Ga0207711_10049621 | 3300025941 | Bacteria | 3593 |
| 358 | Ga0207711_10057099 | 3300025941 | Bacteria | 3356 |
| 359 | Ga0207661_10087594 | 3300025944 | Bacteria | 2586 |
| 360 | Ga0207679_10007965 | 3300025945 | Bacteria | 6738 |
| 361 | Ga0207679_10008555 | 3300025945 | Bacteria | 6520 |
| 362 | Ga0207679_10049964 | 3300025945 | Bacteria | 3053 |
| 363 | Ga0207679_10282040 | 3300025945 | Bacteria | 1425 |
| 364 | Ga0207667_10002493 | 3300025949 | Bacteria | 22937 |
| 365 | Ga0207667_10151210 | 3300025949 | Bacteria | 2389 |
| 366 | Ga0207667_10166893 | 3300025949 | Bacteria | 2263 |
| 367 | Ga0207651_10003988 | 3300025960 | Bacteria | 7337 |
| 368 | Ga0207651_10015082 | 3300025960 | Bacteria | 4480 |
| 369 | Ga0207651_10047169 | 3300025960 | Bacteria | 2903 |
| 370 | Ga0207712_10094260 | 3300025961 | Bacteria | 2211 |
| 371 | Ga0207668_10007730 | 3300025972 | Bacteria | 6396 |
| 372 | Ga0207668_10092700 | 3300025972 | Bacteria | 2224 |
| 373 | Ga0207668_10167720 | 3300025972 | Bacteria | 1719 |
| 374 | Ga0207640_10009133 | 3300025981 | Bacteria | 5537 |
| 375 | Ga0207640_10062385 | 3300025981 | Bacteria | 2473 |
| 376 | Ga0207640_10159122 | 3300025981 | Bacteria | 1669 |
| 377 | Ga0207640_10882171 | 3300025981 | Bacteria | 780 |
| 378 | Ga0207658_10003664 | 3300025986 | Bacteria | 10837 |
| 379 | Ga0207658_10041926 | 3300025986 | Bacteria | 3317 |
| 380 | Ga0207658_10070544 | 3300025986 | Bacteria | 2644 |
| 381 | Ga0207658_10076087 | 3300025986 | Bacteria | 2556 |
| 382 | Ga0207658_10209577 | 3300025986 | Bacteria | 1632 |
| 383 | Ga0207658_10392337 | 3300025986 | Bacteria | 1218 |
| 384 | Ga0207658_10493470 | 3300025986 | Bacteria | 1090 |
| 385 | Ga0207677_10014400 | 3300026023 | Bacteria | 4617 |
| 386 | Ga0207677_10145959 | 3300026023 | Bacteria | 1818 |
| 387 | Ga0207703_10011799 | 3300026035 | Bacteria | 6802 |
| 388 | Ga0207703_10486578 | 3300026035 | Bacteria | 1157 |
| 389 | Ga0207639_10009225 | 3300026041 | Bacteria | 6802 |
| 390 | Ga0207639_10013414 | 3300026041 | Bacteria | 5736 |
| 391 | Ga0207639_10123248 | 3300026041 | Bacteria | 2133 |
| 392 | Ga0207639_10160529 | 3300026041 | Bacteria | 1894 |
| 393 | Ga0207639_10467091 | 3300026041 | Bacteria | 1148 |
| 394 | Ga0207678_10003179 | 3300026067 | Bacteria | 14855 |
| 395 | Ga0207678_10006058 | 3300026067 | Bacteria | 10756 |
| 396 | Ga0207678_10008744 | 3300026067 | Bacteria | 8913 |
| 397 | Ga0207678_10041652 | 3300026067 | Bacteria | 3982 |
| 398 | Ga0207678_10149684 | 3300026067 | Bacteria | 1992 |
| 399 | Ga0207678_10170178 | 3300026067 | Bacteria | 1860 |
| 400 | Ga0207702_10038338 | 3300026078 | Bacteria | 4013 |
| 401 | Ga0207702_10593330 | 3300026078 | Bacteria | 1086 |
| 402 | Ga0207641_10031582 | 3300026088 | Bacteria | 4393 |
| 403 | Ga0207641_10038663 | 3300026088 | Bacteria | 3989 |
| 404 | Ga0207641_10060392 | 3300026088 | Bacteria | 3231 |
| 405 | Ga0207641_10528273 | 3300026088 | Bacteria | 1148 |
| 406 | Ga0207648_10006993 | 3300026089 | Bacteria | 11157 |
| 407 | Ga0207648_10061894 | 3300026089 | Bacteria | 3263 |
| 408 | Ga0207648_10201635 | 3300026089 | Bacteria | 1764 |
| 409 | Ga0207648_10329465 | 3300026089 | Bacteria | 1373 |
| 410 | Ga0207648_10749895 | 3300026089 | Bacteria | 907 |
| 411 | Ga0207676_10012674 | 3300026095 | Bacteria | 6047 |
| 412 | Ga0207676_10305279 | 3300026095 | Bacteria | 1455 |
| 413 | Ga0207676_10319664 | 3300026095 | Bacteria | 1424 |
| 414 | Ga0207676_10371533 | 3300026095 | Bacteria | 1328 |
| 415 | Ga0207674_10001888 | 3300026116 | Bacteria | 26661 |
| 416 | Ga0207674_10125523 | 3300026116 | Bacteria | 2532 |
| 417 | Ga0207674_10691022 | 3300026116 | Bacteria | 985 |
| 418 | Ga0207675_100045649 | 3300026118 | Bacteria | 4094 |
| 419 | Ga0207675_100070693 | 3300026118 | Bacteria | 3262 |
| 420 | Ga0207675_100113535 | 3300026118 | Bacteria | 2558 |
| 421 | Ga0207675_101364417 | 3300026118 | Bacteria | 729 |
| 422 | Ga0207683_10000056 | 3300026121 | Bacteria | 84718 |
| 423 | Ga0207683_10170817 | 3300026121 | Bacteria | 1969 |
| 424 | Ga0207698_10009478 | 3300026142 | Bacteria | 6212 |
| 425 | Ga0207698_10140275 | 3300026142 | Bacteria | 2081 |
| 426 | Ga0207698_10195752 | 3300026142 | Bacteria | 1805 |
| 427 | Ga0207698_10323449 | 3300026142 | Bacteria | 1445 |
| 428 | Ga0207698_10999551 | 3300026142 | Bacteria | 847 |
| 429 | Ga0209281_1000104 | 3300027111 | Bacteria | 221056 |
| 430 | Ga0268266_10016093 | 3300028379 | Bacteria | 6393 |
| 431 | Ga0268266_10116828 | 3300028379 | Bacteria | 2370 |
| 432 | Ga0268266_10242898 | 3300028379 | Bacteria | 1663 |
| 433 | Ga0268265_10606689 | 3300028380 | Bacteria | 1047 |
| 434 | Ga0268264_10012022 | 3300028381 | Bacteria | 7127 |
| 435 | Ga0268264_10092467 | 3300028381 | Bacteria | 2611 |
| 436 | Ga0268264_10745804 | 3300028381 | Bacteria | 975 |
| 437 | Ga0265318_10004018 | 3300028577 | Bacteria | 7224 |
| 438 | Ga0307515_10002278 | 3300028794 | Bacteria | 42025 |
| 439 | Ga0307515_10002502 | 3300028794 | Bacteria | 39826 |
| 440 | Ga0307515_10011678 | 3300028794 | Bacteria | 16633 |
| 441 | Ga0265338_10000118 | 3300028800 | Bacteria | 146710 |
| 442 | Ga0265338_10016067 | 3300028800 | Bacteria | 8172 |
| 443 | Ga0265338_10018147 | 3300028800 | Bacteria | 7548 |
| 444 | Ga0307512_10028633 | 3300030522 | Bacteria | 4881 |
| 445 | Ga0265330_10005332 | 3300031235 | Bacteria | 6409 |
| 446 | Ga0265332_10000594 | 3300031238 | Bacteria | 23783 |
| 447 | Ga0265328_10028397 | 3300031239 | Bacteria | 2092 |
| 448 | Ga0265325_10000101 | 3300031241 | Bacteria | 60537 |
| 449 | Ga0265329_10004983 | 3300031242 | Bacteria | 5432 |
| 450 | Ga0265340_10114709 | 3300031247 | Bacteria | 1243 |
| 451 | Ga0265339_10001142 | 3300031249 | Bacteria | 20029 |
| 452 | Ga0265331_10000003 | 3300031250 | Bacteria | 499358 |
| 453 | Ga0265331_10016246 | 3300031250 | Bacteria | 3912 |
| 454 | Ga0265331_10022491 | 3300031250 | Bacteria | 3216 |
| 455 | Ga0265327_10000012 | 3300031251 | Bacteria | 530403 |
| 456 | Ga0265327_10028073 | 3300031251 | Bacteria | 3226 |
| 457 | Ga0265316_10009477 | 3300031344 | Bacteria | 8970 |
| 458 | Ga0265316_10014358 | 3300031344 | Bacteria | 6975 |
| 459 | Ga0265316_10353726 | 3300031344 | Bacteria | 1063 |
| 460 | Ga0307513_10049503 | 3300031456 | Bacteria | 4551 |
| 461 | Ga0307513_10161808 | 3300031456 | Bacteria | 2130 |
| 462 | Ga0307513_10247707 | 3300031456 | Bacteria | 1581 |
| 463 | Ga0307513_10421703 | 3300031456 | Bacteria | 1064 |
| 464 | Ga0307408_100098039 | 3300031548 | Bacteria | 2227 |
| 465 | Ga0307408_100262570 | 3300031548 | Bacteria | 1430 |
| 466 | Ga0307408_100275031 | 3300031548 | Bacteria | 1400 |
| 467 | Ga0265313_10008276 | 3300031595 | Bacteria | 6936 |
| 468 | Ga0307508_10000061 | 3300031616 | Bacteria | 124749 |
| 469 | Ga0307514_10003371 | 3300031649 | Bacteria | 15418 |
| 470 | Ga0265314_10009671 | 3300031711 | Bacteria | 8117 |
| 471 | Ga0265314_10011562 | 3300031711 | Bacteria | 7272 |
| 472 | Ga0265342_10006799 | 3300031712 | Bacteria | 8466 |
| 473 | Ga0307516_10009896 | 3300031730 | Bacteria | 10571 |
| 474 | Ga0307516_10462540 | 3300031730 | Bacteria | 924 |
| 475 | Ga0307405_10046904 | 3300031731 | Bacteria | 2658 |
| 476 | Ga0307405_10120894 | 3300031731 | Bacteria | 1792 |
| 477 | Ga0307405_10145811 | 3300031731 | Bacteria | 1658 |
| 478 | Ga0307413_10012332 | 3300031824 | Bacteria | 4250 |
| 479 | Ga0307413_10024980 | 3300031824 | Bacteria | 3266 |
| 480 | Ga0307413_10138235 | 3300031824 | Bacteria | 1679 |
| 481 | Ga0307410_10001663 | 3300031852 | Bacteria | 10224 |
| 482 | Ga0307410_10012652 | 3300031852 | Bacteria | 4889 |
| 483 | Ga0307410_10354745 | 3300031852 | Bacteria | 1173 |
| 484 | Ga0307406_10095006 | 3300031901 | Bacteria | 2016 |
| 485 | Ga0307407_10088037 | 3300031903 | Bacteria | 1896 |
| 486 | Ga0307407_10094699 | 3300031903 | Bacteria | 1839 |
| 487 | Ga0307412_10000014 | 3300031911 | Bacteria | 353795 |
| 488 | Ga0307412_10000107 | 3300031911 | Bacteria | 66833 |
| 489 | Ga0307412_10197917 | 3300031911 | Bacteria | 1524 |
| 490 | Ga0307409_100013592 | 3300031995 | Bacteria | 5249 |
| 491 | Ga0307409_100053047 | 3300031995 | Bacteria | 3113 |
| 492 | Ga0307416_100066514 | 3300032002 | Bacteria | 2967 |
| 493 | Ga0307416_100134263 | 3300032002 | Bacteria | 2235 |
| 494 | Ga0307416_100233750 | 3300032002 | Bacteria | 1774 |
| 495 | Ga0307414_10003535 | 3300032004 | Bacteria | 8360 |
| 496 | Ga0307414_10031322 | 3300032004 | Bacteria | 3487 |
| 497 | Ga0307414_10318725 | 3300032004 | Bacteria | 1322 |
| 498 | Ga0307414_10964554 | 3300032004 | Bacteria | 784 |
| 499 | Ga0307411_10127017 | 3300032005 | Bacteria | 1856 |
| 500 | Ga0307411_10167506 | 3300032005 | Bacteria | 1653 |
| 501 | Ga0307411_10255936 | 3300032005 | Bacteria | 1379 |
| 502 | Ga0307411_10302755 | 3300032005 | Bacteria | 1283 |
| 503 | Ga0307415_100003894 | 3300032126 | Bacteria | 7667 |
| 504 | Ga0307415_100048159 | 3300032126 | Bacteria | 2874 |
| 505 | Ga0307415_100068202 | 3300032126 | Bacteria | 2488 |
| 506 | Ga0307415_100525703 | 3300032126 | Bacteria | 1039 |
| 507 | Ga0307415_100573781 | 3300032126 | Bacteria | 999 |
| 508 | Ga0373930_0067189 | 3300034816 | Bacteria | 810 |
| 509 | Ga0373934_0005617 | 3300035086 | Bacteria | 4645 |
| 510 | Ga0373944_0063867 | 3300035089 | Bacteria | 1186 |
| 511 | Ga0373956_0193661 | 3300035119 | Bacteria | 963 |
| 512 | Ga0373955_0144320 | 3300035172 | Bacteria | 1397 |
| 513 | Ga0373933_0002160 | 3300035724 | Bacteria | 11258 |
| 514 | Ga0373937_0009077 | 3300036401 | Bacteria | 8630 |
| 515 | Ga0373937_1058924 | 3300036401 | Bacteria | 760 |
| 516 | Ga0395899_0039792 | 3300037312 | Bacteria | 3518 |
| 517 | Ga0395899_0041620 | 3300037312 | Bacteria | 3432 |
| 518 | Ga0395899_0054764 | 3300037312 | Bacteria | 2951 |
| 519 | Ga0395899_0057485 | 3300037312 | Bacteria | 2871 |
| 520 | Ga0395899_0202333 | 3300037312 | Bacteria | 1384 |
| 521 | Ga0395900_0000289 | 3300037418 | Bacteria | 75525 |
| 522 | Ga0395900_0005557 | 3300037418 | Bacteria | 13198 |
| 523 | Ga0395900_0017419 | 3300037418 | Bacteria | 7333 |
| 524 | Ga0395900_0030258 | 3300037418 | Bacteria | 5558 |
| 525 | Ga0395900_0041582 | 3300037418 | Bacteria | 4738 |
| 526 | Ga0395900_0064995 | 3300037418 | Bacteria | 3747 |
| 527 | Ga0395900_0081355 | 3300037418 | Bacteria | 3327 |
| 528 | Ga0395900_0119778 | 3300037418 | Bacteria | 2701 |
| 529 | Ga0395900_0136156 | 3300037418 | Bacteria | 2516 |
| 530 | Ga0395900_0159281 | 3300037418 | Bacteria | 2303 |
| 531 | Ga0395900_0427414 | 3300037418 | Bacteria | 1284 |
| 532 | Ga0395900_0518352 | 3300037418 | Bacteria | 1140 |
| 533 | Ga0395898_0017554 | 3300037466 | Bacteria | 7304 |
| 534 | Ga0395898_0017933 | 3300037466 | Bacteria | 7223 |
| 535 | Ga0395898_0035202 | 3300037466 | Bacteria | 4983 |
| 536 | Ga0395898_0127088 | 3300037466 | Bacteria | 2442 |
| 537 | Ga0395898_0163348 | 3300037466 | Bacteria | 2130 |
| 538 | Ga0395898_0383958 | 3300037466 | Bacteria | 1339 |
| 539 | Ga0395898_0511909 | 3300037466 | Bacteria | 1141 |
| 540 | Ga0395905_0000014 | 3300037471 | Bacteria | 394209 |
| 541 | Ga0395905_0000215 | 3300037471 | Bacteria | 89274 |
| 542 | Ga0395905_0014942 | 3300037471 | Bacteria | 7405 |
| 543 | Ga0395905_0025629 | 3300037471 | Bacteria | 5560 |
| 544 | Ga0395905_0039581 | 3300037471 | Bacteria | 4423 |
| 545 | Ga0395905_0058195 | 3300037471 | Bacteria | 3614 |
| 546 | Ga0395905_0079215 | 3300037471 | Bacteria | 3079 |
| 547 | Ga0395905_0144321 | 3300037471 | Bacteria | 2240 |
| 548 | Ga0395905_0158652 | 3300037471 | Bacteria | 2127 |
| 549 | Ga0395905_0183495 | 3300037471 | Bacteria | 1964 |
| 550 | Ga0395905_0215866 | 3300037471 | Bacteria | 1796 |
| 551 | Ga0395905_0298807 | 3300037471 | Bacteria | 1497 |
| 552 | Ga0395905_0503407 | 3300037471 | Bacteria | 1111 |
| 553 | Ga0395905_0567640 | 3300037471 | Bacteria | 1036 |
| 554 | Ga0395905_0790714 | 3300037471 | Bacteria | 852 |
| 555 | Ga0395901_0001244 | 3300038443 | Bacteria | 27197 |
| 556 | Ga0395901_0005184 | 3300038443 | Bacteria | 13153 |
| 557 | Ga0395901_0081384 | 3300038443 | Bacteria | 3383 |
| 558 | Ga0395901_0168234 | 3300038443 | Bacteria | 2300 |
| 559 | Ga0395901_0171658 | 3300038443 | Bacteria | 2275 |
| 560 | Ga0395901_0201713 | 3300038443 | Bacteria | 2085 |
| 561 | Ga0395901_0258911 | 3300038443 | Bacteria | 1811 |
| 562 | Ga0395901_0322603 | 3300038443 | Bacteria | 1598 |
| 563 | Ga0395901_0380814 | 3300038443 | Bacteria | 1452 |
| 564 | Ga0395901_0499111 | 3300038443 | Bacteria | 1239 |
| 565 | Ga0395901_1404494 | 3300038443 | Bacteria | 656 |
| 566 | Ga0436365_1594720 | 3300039437 | Bacteria | 3962 |
| 567 | Ga0439439_0044273 | 3300041406 | Bacteria | 1159 |
| 568 | Ga0451791_0575998 | 3300041451 | Bacteria | 1230 |
| 569 | Ga0451793_0793577 | 3300041452 | Bacteria | 947 |
| 570 | Ga0451797_0999178 | 3300041453 | Bacteria | 1129 |
| 571 | Ga0451800_0643375 | 3300041459 | Bacteria | 713 |
| 572 | Ga0451841_0395393 | 3300041498 | Bacteria | 1027 |
| 573 | Ga0451851_0944863 | 3300041507 | Bacteria | 760 |
| 574 | Ga0451843_0784537 | 3300041509 | Bacteria | 926 |
| 575 | Ga0451853_3344173 | 3300041512 | Bacteria | 956 |
| 576 | Ga0439448_0009747 | 3300042005 | Bacteria | 2835 |
| 577 | Ga0439432_005945 | 3300042006 | Bacteria | 4380 |
| 578 | Ga0439432_022408 | 3300042006 | Bacteria | 2086 |
| 579 | Ga0439449_0107195 | 3300042007 | Bacteria | 1034 |
| 580 | Ga0450912_000085 | 3300042116 | Bacteria | 3104 |
| 581 | Ga0450920_004850 | 3300042122 | Bacteria | 2378 |
| 582 | Ga0450889_031235 | 3300042144 | Bacteria | 623 |
| 583 | Ga0439446_0009840 | 3300042156 | Bacteria | 2566 |
| 584 | Ga0439458_0000200 | 3300042157 | Bacteria | 13792 |
| 585 | Ga0439458_0001759 | 3300042157 | Bacteria | 5394 |
| 586 | Ga0439434_0069678 | 3300042435 | Bacteria | 1106 |
| 587 | Ga0439464_0088987 | 3300042439 | Unclassified | 929 |
| 588 | Ga0450918_001122 | 3300042531 | Bacteria | 5499 |
| 589 | Ga0451577_0708316 | 3300042876 | Bacteria | 912 |
| 590 | Ga0453683_0000640 | 3300044673 | Bacteria | 37852 |
| 591 | Ga0466966_0121667 | 3300044684 | Bacteria | 1603 |
| 592 | Ga0466961_0197442 | 3300044693 | Bacteria | 1245 |
| 593 | Ga0466963_0000326 | 3300044694 | Bacteria | 21596 |
| 594 | Ga0466963_0037475 | 3300044694 | Bacteria | 3166 |
| 595 | Ga0466963_0486500 | 3300044694 | Bacteria | 871 |
| 596 | Ga0466963_0575397 | 3300044694 | Bacteria | 795 |
| 597 | Ga0466964_0057568 | 3300044706 | Bacteria | 1609 |
| 598 | Ga0466971_0092870 | 3300044719 | Bacteria | 1383 |
| 599 | Ga0466957_0000787 | 3300044842 | Bacteria | 16194 |
| 600 | Ga0466957_0373484 | 3300044842 | Bacteria | 971 |
| 601 | Ga0466957_0378015 | 3300044842 | Bacteria | 965 |
| 602 | Ga0466958_0131366 | 3300045836 | Bacteria | 1572 |
| 603 | Ga0466958_0217249 | 3300045836 | Bacteria | 1219 |
| 604 | Ga0466967_0000100 | 3300045976 | Bacteria | 31122 |
| 605 | Ga0466967_0076205 | 3300045976 | Bacteria | 3016 |
| 606 | Ga0466967_0125850 | 3300045976 | Bacteria | 2374 |
| 607 | Ga0466967_0187199 | 3300045976 | Bacteria | 1955 |
| 608 | Ga0466967_0225023 | 3300045976 | Bacteria | 1784 |
| 609 | Ga0466967_0401696 | 3300045976 | Bacteria | 1333 |
| 610 | Ga0466967_0994323 | 3300045976 | Bacteria | 835 |
| 611 | Ga0495592_0040739 | 3300046454 | Bacteria | 3484 |
| 612 | Ga0495592_0185342 | 3300046454 | Bacteria | 1414 |
| 613 | Ga0495603_0016605 | 3300046455 | Bacteria | 4454 |
| 614 | Ga0495603_0301266 | 3300046455 | Bacteria | 921 |
| 615 | Ga0495590_0041346 | 3300046457 | Bacteria | 1607 |
| 616 | Ga0495629_0003125 | 3300046459 | Bacteria | 12552 |
| 617 | Ga0495629_0003148 | 3300046459 | Bacteria | 12497 |
| 618 | Ga0495629_0323467 | 3300046459 | Bacteria | 1054 |
| 619 | Ga0495653_0014931 | 3300046463 | Bacteria | 6334 |
| 620 | Ga0495653_0240220 | 3300046463 | Bacteria | 1208 |
| 621 | Ga0495653_0246511 | 3300046463 | Bacteria | 1187 |
| 622 | Ga0495650_0018718 | 3300046471 | Bacteria | 3434 |
| 623 | Ga0495650_0042657 | 3300046471 | Bacteria | 1930 |
| 624 | Ga0495650_0061671 | 3300046471 | Bacteria | 1501 |
| 625 | Ga0495580_0004970 | 3300046472 | Bacteria | 11109 |
| 626 | Ga0495580_0013759 | 3300046472 | Bacteria | 6161 |
| 627 | Ga0495580_0019504 | 3300046472 | Bacteria | 5038 |
| 628 | Ga0495580_0180777 | 3300046472 | Bacteria | 1456 |
| 629 | Ga0495582_0004146 | 3300046473 | Bacteria | 8147 |
| 630 | Ga0495605_0012407 | 3300046474 | Bacteria | 4728 |
| 631 | Ga0495605_0026161 | 3300046474 | Bacteria | 3034 |
| 632 | Ga0495605_0184036 | 3300046474 | Bacteria | 917 |
| 633 | Ga0495662_0015160 | 3300046476 | Bacteria | 3744 |
| 634 | Ga0495664_0010186 | 3300046477 | Bacteria | 5275 |
| 635 | Ga0495664_0047247 | 3300046477 | Bacteria | 2554 |
| 636 | Ga0495584_0221449 | 3300046491 | Bacteria | 962 |
| 637 | Ga0495583_0009452 | 3300046506 | Bacteria | 5822 |
| 638 | Ga0495606_0011868 | 3300046507 | Bacteria | 7050 |
| 639 | Ga0495608_0030601 | 3300046511 | Bacteria | 3643 |
| 640 | Ga0495610_0008911 | 3300046512 | Bacteria | 6426 |
| 641 | Ga0495610_0024862 | 3300046512 | Bacteria | 3226 |
| 642 | Ga0495616_0032976 | 3300046513 | Bacteria | 2702 |
| 643 | Ga0495618_0008272 | 3300046514 | Bacteria | 6299 |
| 644 | Ga0495620_0105336 | 3300046515 | Bacteria | 1121 |
| 645 | Ga0495628_0060419 | 3300046516 | Bacteria | 2973 |
| 646 | Ga0495628_0338683 | 3300046516 | Bacteria | 1107 |
| 647 | Ga0495632_0011199 | 3300046519 | Bacteria | 5251 |
| 648 | Ga0495643_0063557 | 3300046522 | Bacteria | 1952 |
| 649 | Ga0495643_0092042 | 3300046522 | Bacteria | 1563 |
| 650 | Ga0495648_0067124 | 3300046524 | Bacteria | 2099 |
| 651 | Ga0495666_0003678 | 3300046526 | Bacteria | 7750 |
| 652 | Ga0495642_0019199 | 3300046528 | Bacteria | 2679 |
| 653 | Ga0495642_0126731 | 3300046528 | Bacteria | 1098 |
| 654 | Ga0495652_0016973 | 3300046529 | Bacteria | 6504 |
| 655 | Ga0495640_0011543 | 3300046533 | Bacteria | 6793 |
| 656 | Ga0495645_0105323 | 3300046543 | Bacteria | 2001 |
| 657 | Ga0495622_0066549 | 3300046557 | Bacteria | 1665 |
| 658 | Ga0495625_0003328 | 3300046660 | Bacteria | 16189 |
| 659 | Ga0495635_0004906 | 3300046663 | Bacteria | 9303 |
| 660 | Ga0495599_0000114 | 3300046678 | Bacteria | 53722 |
| 661 | Ga0495623_0070373 | 3300046679 | Bacteria | 2179 |
| 662 | Ga0495646_0004942 | 3300046680 | Bacteria | 8419 |
| 663 | Ga0495646_0018335 | 3300046680 | Bacteria | 4432 |
| 664 | Ga0495658_0245404 | 3300046683 | Bacteria | 1125 |
| 665 | Ga0495669_0000090 | 3300046684 | Bacteria | 60222 |
| 666 | Ga0495669_0063652 | 3300046684 | Bacteria | 1673 |
| 667 | Ga0495613_0094984 | 3300046689 | Bacteria | 2157 |
| 668 | Ga0495624_0054505 | 3300046690 | Bacteria | 2520 |
| 669 | Ga0495649_0006836 | 3300046694 | Bacteria | 7061 |
| 670 | Ga0495649_0018654 | 3300046694 | Bacteria | 3900 |
| 671 | Ga0495649_0243515 | 3300046694 | Bacteria | 925 |
| 672 | Ga0495589_0018927 | 3300046794 | Bacteria | 3532 |
| 673 | Ga0495589_0056398 | 3300046794 | Bacteria | 1934 |
| 674 | Ga0495589_0095974 | 3300046794 | Bacteria | 1438 |
| 675 | Ga0495600_0050291 | 3300046809 | Bacteria | 2719 |
| 676 | Ga0495660_0110930 | 3300046810 | Bacteria | 1400 |
| 677 | Ga0495581_0002005 | 3300047315 | Bacteria | 11435 |
| 678 | Ga0495604_0028444 | 3300047317 | Bacteria | 4447 |
| 679 | Ga0495604_0381199 | 3300047317 | Bacteria | 931 |
| 680 | Ga0495674_0002606 | 3300047319 | Bacteria | 17571 |
| 681 | Ga0495676_0054810 | 3300047321 | Bacteria | 3166 |
| 682 | Ga0495680_0047724 | 3300047322 | Bacteria | 3366 |
| 683 | Ga0495683_0003499 | 3300047323 | Bacteria | 9144 |
| 684 | Ga0495683_0011753 | 3300047323 | Bacteria | 4604 |
| 685 | Ga0495683_0021096 | 3300047323 | Bacteria | 3357 |
| 686 | Ga0495683_0063273 | 3300047323 | Bacteria | 1828 |
| 687 | Ga0495683_0161249 | 3300047323 | Bacteria | 1037 |
| 688 | Ga0495687_023970 | 3300047443 | Bacteria | 2908 |
| 689 | Ga0495687_024023 | 3300047443 | Bacteria | 2904 |
| 690 | Ga0495675_0007254 | 3300047444 | Bacteria | 6828 |
| 691 | Ga0495675_0091118 | 3300047444 | Bacteria | 1913 |
| 692 | Ga0495677_0189437 | 3300047445 | Bacteria | 798 |
| 693 | Ga0495679_040396 | 3300047446 | Bacteria | 1450 |
| 694 | Ga0495673_0019901 | 3300047469 | Bacteria | 3353 |
| 695 | Ga0495681_0136042 | 3300047470 | Bacteria | 1042 |
| 696 | Ga0495686_0000014 | 3300047472 | Bacteria | 474014 |
| 697 | Ga0495686_0076142 | 3300047472 | Bacteria | 2056 |
| 698 | Ga0495593_0012015 | 3300047673 | Bacteria | 4962 |
| 699 | Ga0495593_0012819 | 3300047673 | Bacteria | 4788 |
| 700 | Ga0495593_0101879 | 3300047673 | Bacteria | 1472 |
| 701 | Ga0495602_0027443 | 3300048088 | Bacteria | 5470 |
| 702 | Ga0495602_0050386 | 3300048088 | Bacteria | 3720 |
| 703 | Ga0495614_0003643 | 3300048089 | Bacteria | 6905 |
| 704 | Ga0495626_0027353 | 3300048091 | Bacteria | 2774 |
| 705 | Ga0495626_0088863 | 3300048091 | Bacteria | 1361 |
| 706 | Ga0496100_0060295 | 3300048903 | Bacteria | 2496 |
| 707 | Ga0496100_0082475 | 3300048903 | Bacteria | 2174 |
| 708 | Ga0496101_0023541 | 3300048904 | Bacteria | 4256 |
| 709 | Ga0496101_0103037 | 3300048904 | Bacteria | 2138 |
| 710 | Ga0496101_0143126 | 3300048904 | Bacteria | 1824 |
| 711 | Ga0496102_0060786 | 3300048905 | Bacteria | 3456 |
| 712 | Ga0496102_0672452 | 3300048905 | Bacteria | 958 |
| 713 | Ga0496103_0002910 | 3300048906 | Bacteria | 10613 |
| 714 | Ga0496103_0006948 | 3300048906 | Bacteria | 6759 |
| 715 | Ga0496104_0040840 | 3300048907 | Bacteria | 4349 |
| 716 | Ga0496104_0048947 | 3300048907 | Bacteria | 3985 |
| 717 | Ga0496104_0185297 | 3300048907 | Bacteria | 1992 |
| 718 | Ga0496104_0193490 | 3300048907 | Bacteria | 1946 |
| 719 | Ga0496105_0031288 | 3300048908 | Bacteria | 4363 |
| 720 | Ga0496105_0106472 | 3300048908 | Bacteria | 2315 |
| 721 | Ga0496105_0220412 | 3300048908 | Bacteria | 1544 |
| 722 | Ga0496105_0319422 | 3300048908 | Bacteria | 1245 |
| 723 | Ga0496106_0000071 | 3300048909 | Bacteria | 82296 |
| 724 | Ga0496106_0008281 | 3300048909 | Bacteria | 7694 |
| 725 | Ga0496106_0036863 | 3300048909 | Bacteria | 3658 |
| 726 | Ga0496106_0058895 | 3300048909 | Bacteria | 2909 |
| 727 | Ga0496107_0077530 | 3300048910 | Bacteria | 2421 |
| 728 | Ga0496107_0080296 | 3300048910 | Bacteria | 2378 |
| 729 | Ga0496108_0010388 | 3300048911 | Bacteria | 7561 |
| 730 | Ga0496108_0091858 | 3300048911 | Bacteria | 2581 |
| 731 | Ga0496108_0110184 | 3300048911 | Bacteria | 2353 |
| 732 | Ga0496109_0119657 | 3300048912 | Bacteria | 2452 |
| 733 | Ga0496109_0567090 | 3300048912 | Bacteria | 1070 |
| 734 | Ga0496110_0175252 | 3300048913 | Bacteria | 1946 |
| 735 | Ga0496111_0081657 | 3300048914 | Bacteria | 2360 |
| 736 | Ga0496111_0094589 | 3300048914 | Bacteria | 2191 |
| 737 | Ga0496112_0178770 | 3300048915 | Bacteria | 2085 |
| 738 | Ga0496113_0013566 | 3300048916 | Bacteria | 5527 |
| 739 | Ga0496113_0068126 | 3300048916 | Bacteria | 2700 |
| 740 | Ga0496113_0618617 | 3300048916 | Bacteria | 867 |
| 741 | Ga0496114_0000029 | 3300048917 | Bacteria | 175132 |
| 742 | Ga0496114_0069460 | 3300048917 | Bacteria | 2958 |
| 743 | Ga0496114_0185882 | 3300048917 | Bacteria | 1816 |
| 744 | Ga0496116_0156493 | 3300048919 | Bacteria | 1257 |
| 745 | Ga0496116_0173080 | 3300048919 | Bacteria | 1167 |
| 746 | Ga0496117_0047781 | 3300048920 | Bacteria | 3064 |
| 747 | Ga0496117_0109936 | 3300048920 | Bacteria | 1719 |
| 748 | Ga0496117_0279749 | 3300048920 | Bacteria | 894 |
| 749 | Ga0496118_0002189 | 3300048921 | Bacteria | 27169 |
| 750 | Ga0496118_0010536 | 3300048921 | Bacteria | 9143 |
| 751 | Ga0496118_0032534 | 3300048921 | Bacteria | 4293 |
| 752 | Ga0496118_0107213 | 3300048921 | Bacteria | 1866 |
| 753 | Ga0496119_0023176 | 3300048922 | Bacteria | 4416 |
| 754 | Ga0496119_0154808 | 3300048922 | Bacteria | 1225 |
| 755 | Ga0496121_0000333 | 3300048924 | Bacteria | 98583 |
| 756 | Ga0496121_0032682 | 3300048924 | Bacteria | 4724 |
| 757 | Ga0496121_0056392 | 3300048924 | Bacteria | 3263 |
| 758 | Ga0496122_0044737 | 3300048925 | Bacteria | 3451 |
| 759 | Ga0496124_0141888 | 3300048927 | Bacteria | 1895 |
| 760 | Ga0496126_0001409 | 3300048929 | Bacteria | 38034 |
| 761 | Ga0496126_0002413 | 3300048929 | Bacteria | 25289 |
| 762 | Ga0496126_0007047 | 3300048929 | Bacteria | 12397 |
| 763 | Ga0496126_0062320 | 3300048929 | Bacteria | 3347 |
| 764 | Ga0496126_0298521 | 3300048929 | Bacteria | 1330 |
| 765 | Ga0495682_0040580 | 3300049460 | Bacteria | 1706 |
| 766 | Ga0501031_0155434 | 3300049568 | Bacteria | 1495 |
| 767 | Ga0501032_0098556 | 3300049569 | Bacteria | 1937 |
| 768 | Ga0501033_0224361 | 3300049570 | Bacteria | 1336 |
| 769 | Ga0501034_0000093 | 3300049571 | Bacteria | 163663 |
| 770 | Ga0501034_0038133 | 3300049571 | Bacteria | 4867 |
| 771 | Ga0501034_0203133 | 3300049571 | Bacteria | 1939 |
| 772 | Ga0501036_0078448 | 3300049572 | Bacteria | 2793 |
| 773 | Ga0501036_0104260 | 3300049572 | Bacteria | 2398 |
| 774 | Ga0501036_0918964 | 3300049572 | Bacteria | 718 |
| 775 | Ga0501037_0132205 | 3300049573 | Bacteria | 1789 |
| 776 | Ga0501038_0067408 | 3300049574 | Bacteria | 3045 |
| 777 | Ga0501038_0068470 | 3300049574 | Bacteria | 3017 |
| 778 | Ga0501038_0279060 | 3300049574 | Bacteria | 1316 |
| 779 | Ga0501038_0563764 | 3300049574 | Bacteria | 865 |
| 780 | Ga0501039_0097162 | 3300049575 | Bacteria | 2297 |
| 781 | Ga0501039_0203620 | 3300049575 | Bacteria | 1556 |
| 782 | Ga0501040_0128374 | 3300049576 | Unclassified | 1782 |
| 783 | Ga0501041_0100835 | 3300049577 | Bacteria | 1787 |
| 784 | Ga0501041_0347776 | 3300049577 | Bacteria | 937 |
| 785 | Ga0501042_0495290 | 3300049578 | Bacteria | 887 |
| 786 | Ga0501043_0000397 | 3300049579 | Bacteria | 39073 |
| 787 | Ga0501043_0037136 | 3300049579 | Bacteria | 3832 |
| 788 | Ga0501043_0040221 | 3300049579 | Bacteria | 3675 |
| 789 | Ga0501043_0076965 | 3300049579 | Bacteria | 2621 |
| 790 | Ga0501043_0626494 | 3300049579 | Bacteria | 792 |
| 791 | Ga0501046_0002603 | 3300049580 | Bacteria | 16855 |
| 792 | Ga0501047_0000002 | 3300049581 | Bacteria | 553775 |
| 793 | Ga0501047_0019281 | 3300049581 | Bacteria | 6544 |
| 794 | Ga0501047_0210813 | 3300049581 | Bacteria | 1801 |
| 795 | Ga0501047_0217122 | 3300049581 | Bacteria | 1769 |
| 796 | Ga0501048_0004041 | 3300049582 | Bacteria | 11163 |
| 797 | Ga0501048_0155497 | 3300049582 | Bacteria | 1618 |
| 798 | Ga0501067_0065647 | 3300049583 | Bacteria | 2009 |
| 799 | Ga0501068_0002129 | 3300049584 | Bacteria | 10542 |
| 800 | Ga0501068_0045450 | 3300049584 | Bacteria | 2646 |
| 801 | Ga0501069_0075924 | 3300049585 | Bacteria | 1889 |
| 802 | Ga0501070_0005671 | 3300049586 | Bacteria | 10645 |
| 803 | Ga0501070_0063658 | 3300049586 | Bacteria | 3055 |
| 804 | Ga0501070_0069335 | 3300049586 | Bacteria | 2919 |
| 805 | Ga0501070_0212590 | 3300049586 | Bacteria | 1587 |
| 806 | Ga0501070_0711126 | 3300049586 | Bacteria | 794 |
| 807 | Ga0501071_0275178 | 3300049587 | Bacteria | 1273 |
| 808 | Ga0501071_0393347 | 3300049587 | Bacteria | 1058 |
| 809 | Ga0501072_0000049 | 3300049588 | Bacteria | 89925 |
| 810 | Ga0501072_0053405 | 3300049588 | Bacteria | 3182 |
| 811 | Ga0501073_0006012 | 3300049589 | Bacteria | 9055 |
| 812 | Ga0501073_0129238 | 3300049589 | Bacteria | 1751 |
| 813 | Ga0501073_0189159 | 3300049589 | Bacteria | 1424 |
| 814 | Ga0501074_0046652 | 3300049590 | Bacteria | 3132 |
| 815 | Ga0501074_0124564 | 3300049590 | Bacteria | 1843 |
| 816 | Ga0501074_0585891 | 3300049590 | Bacteria | 789 |
| 817 | Ga0501075_0055463 | 3300049591 | Bacteria | 2982 |
| 818 | Ga0501076_0310638 | 3300049592 | Bacteria | 1293 |
| 819 | Ga0501076_0987915 | 3300049592 | Bacteria | 693 |
| 820 | Ga0501077_0209147 | 3300049593 | Bacteria | 1240 |
| 821 | Ga0501079_0000264 | 3300049741 | Bacteria | 32231 |
| 822 | Ga0501079_0015886 | 3300049741 | Bacteria | 5754 |
| 823 | Ga0501080_0027047 | 3300049742 | Bacteria | 5333 |
| 824 | Ga0501080_0094444 | 3300049742 | Bacteria | 2777 |
| 825 | Ga0501080_0198286 | 3300049742 | Bacteria | 1843 |
| 826 | Ga0501081_0045854 | 3300049743 | Bacteria | 3002 |
| 827 | Ga0501081_0586498 | 3300049743 | Bacteria | 834 |
| 828 | Ga0501083_0001011 | 3300049744 | Bacteria | 18739 |
| 829 | Ga0501083_0011688 | 3300049744 | Bacteria | 6155 |
| 830 | Ga0501083_0125263 | 3300049744 | Bacteria | 1684 |
| 831 | Ga0501083_0850556 | 3300049744 | Bacteria | 594 |
| 832 | Ga0501280_004853 | 3300049776 | Bacteria | 1950 |
| 833 | Ga0501035_0014233 | 3300049822 | Bacteria | 7342 |
| 834 | Ga0501044_0058712 | 3300049823 | Bacteria | 3944 |
| 835 | Ga0501044_0543676 | 3300049823 | Bacteria | 1059 |
| 836 | Ga0501044_0660462 | 3300049823 | Bacteria | 934 |
| 837 | nmdc:mga0k408_330969_c1 | 3300050493 | Bacteria | 909 |
| 838 | nmdc:mga0k408_469504_c1 | 3300050493 | Bacteria | 747 |
| 839 | nmdc:mga07m45_153997_c1 | 3300050496 | Bacteria | 1333 |
| 840 | nmdc:mga05p37_105948_c1 | 3300050507 | Bacteria | 3458 |
| 841 | nmdc:mga09592_131784_c1 | 3300050508 | Bacteria | 2151 |
| 842 | nmdc:mga08y16_313882_c1 | 3300050511 | Bacteria | 1614 |
| 843 | nmdc:mga08y16_9642_c1 | 3300050511 | Bacteria | 10138 |
| 844 | nmdc:mga0n895_23040_c1 | 3300050512 | Bacteria | 5848 |
| 845 | nmdc:mga0rr50_284280_c1 | 3300050513 | Bacteria | 1381 |
| 846 | nmdc:mga0a205_147_c1 | 3300050515 | Bacteria | 45502 |
| 847 | Ga0500641_0007052 | 3300053096 | Bacteria | 4003 |
| 848 | Ga0500658_0000049 | 3300053134 | Bacteria | 65535 |
| 849 | Ga0500590_035333 | 3300053148 | Bacteria | 2587 |
| 850 | Ga0500619_000129 | 3300053154 | Bacteria | 19684 |
| 851 | Ga0500587_001555 | 3300053739 | Bacteria | 3265 |
| 852 | Ga0501084_0000025 | 3300054114 | Bacteria | 133611 |
| 853 | Ga0501084_0068780 | 3300054114 | Bacteria | 2964 |
| 854 | Ga0590075_031682 | 3300059424 | Bacteria | 1341 |
| 855 | Ga0501082_0056108 | 3300060353 | Bacteria | 3392 |
| 856 | Ga0466962_0150105 | 3300061719 | Bacteria | 1130 |
| 857 | Ga0466962_0157408 | 3300061719 | Bacteria | 1104 |
| 858 | Ga0530510_0561834 | 3300061734 | Bacteria | 867 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049744 | Ga0501083_0850556 | Ga0501083_0850556_14_565 | 183 |
| 2 | 3300049581 | Ga0501047_0210813 | Ga0501047_0210813_311_940 | 186 |
| 3 | 3300031731 | Ga0307405_10120894 | Ga0307405_101208942 | 189 |
| 4 | 3300031824 | Ga0307413_10012332 | Ga0307413_100123326 | 189 |
| 5 | 3300031852 | Ga0307410_10001663 | Ga0307410_100016637 | 189 |
| 6 | 3300031995 | Ga0307409_100013592 | Ga0307409_1000135928 | 189 |
| 7 | 3300032002 | Ga0307416_100134263 | Ga0307416_1001342632 | 189 |
| 8 | 3300032004 | Ga0307414_10003535 | Ga0307414_100035352 | 189 |
| 9 | 3300032126 | Ga0307415_100003894 | Ga0307415_1000038941 | 189 |
| 10 | 3300042144 | Ga0450889_031235 | Ga0450889_031235_27_599 | 189 |
| 11 | 3300049741 | Ga0501079_0015886 | Ga0501079_0015886_3111_3755 | 194 |
| 12 | 3300049743 | Ga0501081_0045854 | Ga0501081_0045854_1200_1844 | 194 |
| 13 | 3300038443 | Ga0395901_1404494 | Ga0395901_1404494_20_610 | 195 |
| 14 | iso_pu_bacteria | 2562617112 | 2563060021 | 196 |
| 15 | 3300049572 | Ga0501036_0918964 | Ga0501036_0918964_56_685 | 197 |
| 16 | 3300049586 | Ga0501070_0069335 | Ga0501070_0069335_2251_2880 | 197 |
| 17 | 3300049589 | Ga0501073_0189159 | Ga0501073_0189159_408_1097 | 197 |
| 18 | 3300049744 | Ga0501083_0011688 | Ga0501083_0011688_1176_1805 | 197 |
| 19 | 3300049744 | Ga0501083_0125263 | Ga0501083_0125263_805_1434 | 197 |
| 20 | 3300049823 | Ga0501044_0660462 | Ga0501044_0660462_31_660 | 197 |
| 21 | 3300054114 | Ga0501084_0068780 | Ga0501084_0068780_1203_1832 | 197 |
| 22 | 3300041507 | Ga0451851_0944863 | Ga0451851_0944863_20_622 | 198 |
| 23 | 3300048929 | Ga0496126_0298521 | Ga0496126_0298521_25_627 | 200 |
| 24 | 3300049578 | Ga0501042_0495290 | Ga0501042_0495290_15_620 | 200 |
| 25 | 3300049590 | Ga0501074_0585891 | Ga0501074_0585891_164_766 | 200 |
| 26 | 3300005458 | Ga0070681_10082648 | Ga0070681_100826483 | 202 |
| 27 | 3300031824 | Ga0307413_10138235 | Ga0307413_101382351 | 202 |
| 28 | 3300031852 | Ga0307410_10012652 | Ga0307410_100126523 | 202 |
| 29 | 3300031901 | Ga0307406_10095006 | Ga0307406_100950062 | 202 |
| 30 | 3300031903 | Ga0307407_10088037 | Ga0307407_100880372 | 202 |
| 31 | 3300032002 | Ga0307416_100233750 | Ga0307416_1002337502 | 202 |
| 32 | 3300032126 | Ga0307415_100048159 | Ga0307415_1000481593 | 202 |
| 33 | 3300006028 | Ga0070717_10107482 | Ga0070717_101074824 | 204 |
| 34 | 3300042439 | Ga0439464_0088987 | Ga0439464_0088987_140_772 | 204 |
| 35 | 3300049593 | Ga0501077_0209147 | Ga0501077_0209147_521_1138 | 204 |
| 36 | 3300025917 | Ga0207660_10623250 | Ga0207660_106232501 | 205 |
| 37 | 3300032004 | Ga0307414_10964554 | Ga0307414_109645541 | 205 |
| 38 | 3300044694 | Ga0466963_0037475 | Ga0466963_0037475_2476_3111 | 205 |
| 39 | 3300044842 | Ga0466957_0000787 | Ga0466957_0000787_3423_4058 | 205 |
| 40 | 3300045836 | Ga0466958_0131366 | Ga0466958_0131366_86_721 | 205 |
| 41 | 3300045976 | Ga0466967_0076205 | Ga0466967_0076205_1679_2314 | 205 |
| 42 | 3300005293 | Ga0065715_10415519 | Ga0065715_104155191 | 206 |
| 43 | 3300028800 | Ga0265338_10016067 | Ga0265338_100160675 | 206 |
| 44 | 3300049776 | Ga0501280_004853 | Ga0501280_004853_137_778 | 206 |
| 45 | 3300001979 | JGI24740J21852_10006469 | JGI24740J21852_100064694 | 207 |
| 46 | 3300001990 | JGI24737J22298_10003339 | JGI24737J22298_100033393 | 207 |
| 47 | 3300005327 | Ga0070658_10012287 | Ga0070658_100122874 | 207 |
| 48 | 3300005327 | Ga0070658_10337362 | Ga0070658_103373622 | 207 |
| 49 | 3300005327 | Ga0070658_10530741 | Ga0070658_105307412 | 207 |
| 50 | 3300005328 | Ga0070676_10048312 | Ga0070676_100483123 | 207 |
| 51 | 3300005329 | Ga0070683_100026033 | Ga0070683_1000260334 | 207 |
| 52 | 3300005329 | Ga0070683_100039236 | Ga0070683_1000392364 | 207 |
| 53 | 3300005331 | Ga0070670_100046023 | Ga0070670_1000460234 | 207 |
| 54 | 3300005335 | Ga0070666_10021840 | Ga0070666_100218402 | 207 |
| 55 | 3300005336 | Ga0070680_100010998 | Ga0070680_1000109982 | 207 |
| 56 | 3300005336 | Ga0070680_100281712 | Ga0070680_1002817122 | 207 |
| 57 | 3300005339 | Ga0070660_100002929 | Ga0070660_1000029298 | 207 |
| 58 | 3300005344 | Ga0070661_100006773 | Ga0070661_1000067736 | 207 |
| 59 | 3300005344 | Ga0070661_100084021 | Ga0070661_1000840211 | 207 |
| 60 | 3300005344 | Ga0070661_100167367 | Ga0070661_1001673673 | 207 |
| 61 | 3300005347 | Ga0070668_100477890 | Ga0070668_1004778901 | 207 |
| 62 | 3300005355 | Ga0070671_100056534 | Ga0070671_1000565343 | 207 |
| 63 | 3300005355 | Ga0070671_100100596 | Ga0070671_1001005962 | 207 |
| 64 | 3300005355 | Ga0070671_100586845 | Ga0070671_1005868452 | 207 |
| 65 | 3300005364 | Ga0070673_100082450 | Ga0070673_1000824503 | 207 |
| 66 | 3300005364 | Ga0070673_100659868 | Ga0070673_1006598681 | 207 |
| 67 | 3300005366 | Ga0070659_100000992 | Ga0070659_10000099214 | 207 |
| 68 | 3300005366 | Ga0070659_100247849 | Ga0070659_1002478493 | 207 |
| 69 | 3300005366 | Ga0070659_100329772 | Ga0070659_1003297722 | 207 |
| 70 | 3300005455 | Ga0070663_100010881 | Ga0070663_1000108813 | 207 |
| 71 | 3300005455 | Ga0070663_100221258 | Ga0070663_1002212582 | 207 |
| 72 | 3300005457 | Ga0070662_100022342 | Ga0070662_1000223422 | 207 |
| 73 | 3300005457 | Ga0070662_100209925 | Ga0070662_1002099252 | 207 |
| 74 | 3300005458 | Ga0070681_10031291 | Ga0070681_100312912 | 207 |
| 75 | 3300005466 | Ga0070685_10395354 | Ga0070685_103953541 | 207 |
| 76 | 3300005530 | Ga0070679_100002835 | Ga0070679_1000028355 | 207 |
| 77 | 3300005539 | Ga0068853_100135144 | Ga0068853_1001351442 | 207 |
| 78 | 3300005539 | Ga0068853_100462008 | Ga0068853_1004620082 | 207 |
| 79 | 3300005539 | Ga0068853_100492388 | Ga0068853_1004923882 | 207 |
| 80 | 3300005563 | Ga0068855_100002695 | Ga0068855_10000269515 | 207 |
| 81 | 3300005563 | Ga0068855_100210048 | Ga0068855_1002100483 | 207 |
| 82 | 3300005564 | Ga0070664_100001303 | Ga0070664_10000130313 | 207 |
| 83 | 3300005564 | Ga0070664_100010774 | Ga0070664_1000107744 | 207 |
| 84 | 3300005564 | Ga0070664_100075187 | Ga0070664_1000751873 | 207 |
| 85 | 3300005577 | Ga0068857_100130293 | Ga0068857_1001302934 | 207 |
| 86 | 3300005578 | Ga0068854_100013554 | Ga0068854_1000135543 | 207 |
| 87 | 3300005578 | Ga0068854_100109249 | Ga0068854_1001092492 | 207 |
| 88 | 3300005578 | Ga0068854_100251747 | Ga0068854_1002517471 | 207 |
| 89 | 3300005614 | Ga0068856_100169041 | Ga0068856_1001690414 | 207 |
| 90 | 3300005614 | Ga0068856_100307473 | Ga0068856_1003074732 | 207 |
| 91 | 3300005616 | Ga0068852_100019610 | Ga0068852_1000196103 | 207 |
| 92 | 3300005616 | Ga0068852_100176060 | Ga0068852_1001760603 | 207 |
| 93 | 3300005617 | Ga0068859_100055882 | Ga0068859_1000558822 | 207 |
| 94 | 3300005617 | Ga0068859_100329870 | Ga0068859_1003298703 | 207 |
| 95 | 3300005618 | Ga0068864_100008255 | Ga0068864_1000082556 | 207 |
| 96 | 3300005618 | Ga0068864_100010148 | Ga0068864_1000101483 | 207 |
| 97 | 3300005834 | Ga0068851_10014791 | Ga0068851_100147912 | 207 |
| 98 | 3300005834 | Ga0068851_10112506 | Ga0068851_101125063 | 207 |
| 99 | 3300005841 | Ga0068863_100020671 | Ga0068863_1000206714 | 207 |
| 100 | 3300005841 | Ga0068863_100075683 | Ga0068863_1000756834 | 207 |
| 101 | 3300005841 | Ga0068863_100654933 | Ga0068863_1006549331 | 207 |
| 102 | 3300005842 | Ga0068858_100018916 | Ga0068858_1000189163 | 207 |
| 103 | 3300005842 | Ga0068858_100493384 | Ga0068858_1004933842 | 207 |
| 104 | 3300005844 | Ga0068862_100253870 | Ga0068862_1002538702 | 207 |
| 105 | 3300006175 | Ga0070712_100575436 | Ga0070712_1005754361 | 207 |
| 106 | 3300006237 | Ga0097621_100093463 | Ga0097621_1000934634 | 207 |
| 107 | 3300006358 | Ga0068871_100036215 | Ga0068871_1000362155 | 207 |
| 108 | 3300006881 | Ga0068865_100148565 | Ga0068865_1001485653 | 207 |
| 109 | 3300006931 | Ga0097620_100055883 | Ga0097620_1000558832 | 207 |
| 110 | 3300006931 | Ga0097620_100329902 | Ga0097620_1003299023 | 207 |
| 111 | 3300009174 | Ga0105241_10128121 | Ga0105241_101281213 | 207 |
| 112 | 3300009177 | Ga0105248_10014587 | Ga0105248_100145874 | 207 |
| 113 | 3300009177 | Ga0105248_10038638 | Ga0105248_100386383 | 207 |
| 114 | 3300009177 | Ga0105248_10604481 | Ga0105248_106044812 | 207 |
| 115 | 3300009545 | Ga0105237_10928525 | Ga0105237_109285252 | 207 |
| 116 | 3300009551 | Ga0105238_10686404 | Ga0105238_106864042 | 207 |
| 117 | 3300009551 | Ga0105238_11150796 | Ga0105238_111507961 | 207 |
| 118 | 3300011119 | Ga0105246_10055179 | Ga0105246_100551792 | 207 |
| 119 | 3300013100 | Ga0157373_10119341 | Ga0157373_101193413 | 207 |
| 120 | 3300013100 | Ga0157373_10423949 | Ga0157373_104239492 | 207 |
| 121 | 3300013102 | Ga0157371_10181944 | Ga0157371_101819442 | 207 |
| 122 | 3300013104 | Ga0157370_10272942 | Ga0157370_102729423 | 207 |
| 123 | 3300013104 | Ga0157370_10370932 | Ga0157370_103709322 | 207 |
| 124 | 3300013105 | Ga0157369_10001611 | Ga0157369_100016119 | 207 |
| 125 | 3300013105 | Ga0157369_10005258 | Ga0157369_100052585 | 207 |
| 126 | 3300013105 | Ga0157369_10092640 | Ga0157369_100926404 | 207 |
| 127 | 3300013105 | Ga0157369_10720790 | Ga0157369_107207901 | 207 |
| 128 | 3300013296 | Ga0157374_10040250 | Ga0157374_100402502 | 207 |
| 129 | 3300013306 | Ga0163162_11524306 | Ga0163162_115243061 | 207 |
| 130 | 3300013307 | Ga0157372_10102817 | Ga0157372_101028173 | 207 |
| 131 | 3300013307 | Ga0157372_10252566 | Ga0157372_102525663 | 207 |
| 132 | 3300014325 | Ga0163163_10145931 | Ga0163163_101459314 | 207 |
| 133 | 3300014497 | Ga0182008_10047944 | Ga0182008_100479444 | 207 |
| 134 | 3300014497 | Ga0182008_10173994 | Ga0182008_101739942 | 207 |
| 135 | 3300014497 | Ga0182008_10280742 | Ga0182008_102807422 | 207 |
| 136 | 3300014968 | Ga0157379_10089259 | Ga0157379_100892592 | 207 |
| 137 | 3300025321 | Ga0207656_10011120 | Ga0207656_100111202 | 207 |
| 138 | 3300025321 | Ga0207656_10205865 | Ga0207656_102058652 | 207 |
| 139 | 3300025321 | Ga0207656_10283570 | Ga0207656_102835702 | 207 |
| 140 | 3300025893 | Ga0207682_10117676 | Ga0207682_101176762 | 207 |
| 141 | 3300025904 | Ga0207647_10007746 | Ga0207647_100077465 | 207 |
| 142 | 3300025904 | Ga0207647_10351345 | Ga0207647_103513452 | 207 |
| 143 | 3300025908 | Ga0207643_10220595 | Ga0207643_102205952 | 207 |
| 144 | 3300025909 | Ga0207705_10000942 | Ga0207705_1000094213 | 207 |
| 145 | 3300025909 | Ga0207705_10017299 | Ga0207705_100172992 | 207 |
| 146 | 3300025909 | Ga0207705_10104005 | Ga0207705_101040053 | 207 |
| 147 | 3300025909 | Ga0207705_10707150 | Ga0207705_107071501 | 207 |
| 148 | 3300025912 | Ga0207707_10021943 | Ga0207707_100219432 | 207 |
| 149 | 3300025914 | Ga0207671_10086742 | Ga0207671_100867424 | 207 |
| 150 | 3300025917 | Ga0207660_10107553 | Ga0207660_101075534 | 207 |
| 151 | 3300025919 | Ga0207657_10002608 | Ga0207657_1000260822 | 207 |
| 152 | 3300025920 | Ga0207649_10055418 | Ga0207649_100554183 | 207 |
| 153 | 3300025920 | Ga0207649_10059731 | Ga0207649_100597312 | 207 |
| 154 | 3300025920 | Ga0207649_10395062 | Ga0207649_103950622 | 207 |
| 155 | 3300025921 | Ga0207652_10000875 | Ga0207652_1000087521 | 207 |
| 156 | 3300025921 | Ga0207652_10114033 | Ga0207652_101140333 | 207 |
| 157 | 3300025921 | Ga0207652_10782013 | Ga0207652_107820132 | 207 |
| 158 | 3300025925 | Ga0207650_10069709 | Ga0207650_100697092 | 207 |
| 159 | 3300025931 | Ga0207644_10009420 | Ga0207644_100094204 | 207 |
| 160 | 3300025931 | Ga0207644_10130928 | Ga0207644_101309283 | 207 |
| 161 | 3300025931 | Ga0207644_10240734 | Ga0207644_102407342 | 207 |
| 162 | 3300025932 | Ga0207690_10034238 | Ga0207690_100342384 | 207 |
| 163 | 3300025933 | Ga0207706_10036885 | Ga0207706_100368852 | 207 |
| 164 | 3300025933 | Ga0207706_10398724 | Ga0207706_103987242 | 207 |
| 165 | 3300025938 | Ga0207704_10146880 | Ga0207704_101468803 | 207 |
| 166 | 3300025944 | Ga0207661_10087594 | Ga0207661_100875944 | 207 |
| 167 | 3300025945 | Ga0207679_10007965 | Ga0207679_100079657 | 207 |
| 168 | 3300025945 | Ga0207679_10049964 | Ga0207679_100499644 | 207 |
| 169 | 3300025945 | Ga0207679_10282040 | Ga0207679_102820402 | 207 |
| 170 | 3300025949 | Ga0207667_10002493 | Ga0207667_1000249318 | 207 |
| 171 | 3300025960 | Ga0207651_10047169 | Ga0207651_100471693 | 207 |
| 172 | 3300025972 | Ga0207668_10092700 | Ga0207668_100927003 | 207 |
| 173 | 3300025981 | Ga0207640_10009133 | Ga0207640_100091331 | 207 |
| 174 | 3300025981 | Ga0207640_10062385 | Ga0207640_100623854 | 207 |
| 175 | 3300025981 | Ga0207640_10882171 | Ga0207640_108821711 | 207 |
| 176 | 3300025986 | Ga0207658_10209577 | Ga0207658_102095772 | 207 |
| 177 | 3300025986 | Ga0207658_10493470 | Ga0207658_104934701 | 207 |
| 178 | 3300026035 | Ga0207703_10486578 | Ga0207703_104865782 | 207 |
| 179 | 3300026041 | Ga0207639_10013414 | Ga0207639_100134144 | 207 |
| 180 | 3300026041 | Ga0207639_10123248 | Ga0207639_101232483 | 207 |
| 181 | 3300026041 | Ga0207639_10160529 | Ga0207639_101605292 | 207 |
| 182 | 3300026041 | Ga0207639_10467091 | Ga0207639_104670912 | 207 |
| 183 | 3300026067 | Ga0207678_10003179 | Ga0207678_1000317911 | 207 |
| 184 | 3300026067 | Ga0207678_10006058 | Ga0207678_100060585 | 207 |
| 185 | 3300026067 | Ga0207678_10041652 | Ga0207678_100416522 | 207 |
| 186 | 3300026067 | Ga0207678_10149684 | Ga0207678_101496843 | 207 |
| 187 | 3300026078 | Ga0207702_10038338 | Ga0207702_100383382 | 207 |
| 188 | 3300026078 | Ga0207702_10593330 | Ga0207702_105933302 | 207 |
| 189 | 3300026088 | Ga0207641_10031582 | Ga0207641_100315823 | 207 |
| 190 | 3300026088 | Ga0207641_10060392 | Ga0207641_100603923 | 207 |
| 191 | 3300026088 | Ga0207641_10528273 | Ga0207641_105282732 | 207 |
| 192 | 3300026089 | Ga0207648_10201635 | Ga0207648_102016353 | 207 |
| 193 | 3300026095 | Ga0207676_10371533 | Ga0207676_103715332 | 207 |
| 194 | 3300026116 | Ga0207674_10001888 | Ga0207674_1000188811 | 207 |
| 195 | 3300026116 | Ga0207674_10691022 | Ga0207674_106910222 | 207 |
| 196 | 3300026118 | Ga0207675_100070693 | Ga0207675_1000706932 | 207 |
| 197 | 3300026142 | Ga0207698_10009478 | Ga0207698_100094785 | 207 |
| 198 | 3300026142 | Ga0207698_10140275 | Ga0207698_101402752 | 207 |
| 199 | 3300026142 | Ga0207698_10195752 | Ga0207698_101957522 | 207 |
| 200 | 3300026142 | Ga0207698_10323449 | Ga0207698_103234492 | 207 |
| 201 | 3300028379 | Ga0268266_10116828 | Ga0268266_101168282 | 207 |
| 202 | 3300031548 | Ga0307408_100098039 | Ga0307408_1000980394 | 207 |
| 203 | 3300031548 | Ga0307408_100275031 | Ga0307408_1002750312 | 207 |
| 204 | 3300031731 | Ga0307405_10046904 | Ga0307405_100469044 | 207 |
| 205 | 3300031731 | Ga0307405_10145811 | Ga0307405_101458111 | 207 |
| 206 | 3300031824 | Ga0307413_10024980 | Ga0307413_100249803 | 207 |
| 207 | 3300031852 | Ga0307410_10354745 | Ga0307410_103547452 | 207 |
| 208 | 3300031903 | Ga0307407_10094699 | Ga0307407_100946991 | 207 |
| 209 | 3300031911 | Ga0307412_10197917 | Ga0307412_101979171 | 207 |
| 210 | 3300031995 | Ga0307409_100053047 | Ga0307409_1000530474 | 207 |
| 211 | 3300032002 | Ga0307416_100066514 | Ga0307416_1000665142 | 207 |
| 212 | 3300032004 | Ga0307414_10031322 | Ga0307414_100313224 | 207 |
| 213 | 3300032004 | Ga0307414_10318725 | Ga0307414_103187252 | 207 |
| 214 | 3300032005 | Ga0307411_10127017 | Ga0307411_101270171 | 207 |
| 215 | 3300032005 | Ga0307411_10167506 | Ga0307411_101675062 | 207 |
| 216 | 3300032005 | Ga0307411_10255936 | Ga0307411_102559362 | 207 |
| 217 | 3300032005 | Ga0307411_10302755 | Ga0307411_103027552 | 207 |
| 218 | 3300032126 | Ga0307415_100068202 | Ga0307415_1000682023 | 207 |
| 219 | 3300032126 | Ga0307415_100525703 | Ga0307415_1005257032 | 207 |
| 220 | 3300032126 | Ga0307415_100573781 | Ga0307415_1005737811 | 207 |
| 221 | 3300037312 | Ga0395899_0039792 | Ga0395899_0039792_1201_1842 | 207 |
| 222 | 3300037312 | Ga0395899_0041620 | Ga0395899_0041620_701_1342 | 207 |
| 223 | 3300037312 | Ga0395899_0054764 | Ga0395899_0054764_2000_2641 | 207 |
| 224 | 3300037312 | Ga0395899_0057485 | Ga0395899_0057485_1772_2413 | 207 |
| 225 | 3300037312 | Ga0395899_0202333 | Ga0395899_0202333_192_833 | 207 |
| 226 | 3300037418 | Ga0395900_0000289 | Ga0395900_0000289_19893_20534 | 207 |
| 227 | 3300037418 | Ga0395900_0005557 | Ga0395900_0005557_6666_7307 | 207 |
| 228 | 3300037418 | Ga0395900_0017419 | Ga0395900_0017419_2543_3184 | 207 |
| 229 | 3300037418 | Ga0395900_0030258 | Ga0395900_0030258_4541_5182 | 207 |
| 230 | 3300037418 | Ga0395900_0041582 | Ga0395900_0041582_44_685 | 207 |
| 231 | 3300037418 | Ga0395900_0064995 | Ga0395900_0064995_160_801 | 207 |
| 232 | 3300037418 | Ga0395900_0081355 | Ga0395900_0081355_1440_2081 | 207 |
| 233 | 3300037418 | Ga0395900_0119778 | Ga0395900_0119778_2032_2673 | 207 |
| 234 | 3300037418 | Ga0395900_0136156 | Ga0395900_0136156_330_971 | 207 |
| 235 | 3300037418 | Ga0395900_0159281 | Ga0395900_0159281_1091_1732 | 207 |
| 236 | 3300037418 | Ga0395900_0427414 | Ga0395900_0427414_50_691 | 207 |
| 237 | 3300037418 | Ga0395900_0518352 | Ga0395900_0518352_471_1112 | 207 |
| 238 | 3300037466 | Ga0395898_0017554 | Ga0395898_0017554_2831_3472 | 207 |
| 239 | 3300037466 | Ga0395898_0017933 | Ga0395898_0017933_5382_6023 | 207 |
| 240 | 3300037466 | Ga0395898_0035202 | Ga0395898_0035202_3891_4532 | 207 |
| 241 | 3300037466 | Ga0395898_0127088 | Ga0395898_0127088_1309_1950 | 207 |
| 242 | 3300037466 | Ga0395898_0163348 | Ga0395898_0163348_662_1303 | 207 |
| 243 | 3300037466 | Ga0395898_0383958 | Ga0395898_0383958_678_1319 | 207 |
| 244 | 3300037466 | Ga0395898_0511909 | Ga0395898_0511909_487_1128 | 207 |
| 245 | 3300037471 | Ga0395905_0000215 | Ga0395905_0000215_85269_85910 | 207 |
| 246 | 3300037471 | Ga0395905_0014942 | Ga0395905_0014942_6417_7058 | 207 |
| 247 | 3300037471 | Ga0395905_0025629 | Ga0395905_0025629_2520_3161 | 207 |
| 248 | 3300037471 | Ga0395905_0039581 | Ga0395905_0039581_3714_4355 | 207 |
| 249 | 3300037471 | Ga0395905_0058195 | Ga0395905_0058195_1695_2336 | 207 |
| 250 | 3300037471 | Ga0395905_0079215 | Ga0395905_0079215_259_900 | 207 |
| 251 | 3300037471 | Ga0395905_0183495 | Ga0395905_0183495_909_1550 | 207 |
| 252 | 3300037471 | Ga0395905_0215866 | Ga0395905_0215866_701_1342 | 207 |
| 253 | 3300037471 | Ga0395905_0298807 | Ga0395905_0298807_346_987 | 207 |
| 254 | 3300037471 | Ga0395905_0503407 | Ga0395905_0503407_257_898 | 207 |
| 255 | 3300038443 | Ga0395901_0001244 | Ga0395901_0001244_17601_18242 | 207 |
| 256 | 3300038443 | Ga0395901_0005184 | Ga0395901_0005184_10764_11405 | 207 |
| 257 | 3300038443 | Ga0395901_0081384 | Ga0395901_0081384_1542_2183 | 207 |
| 258 | 3300038443 | Ga0395901_0168234 | Ga0395901_0168234_1312_1953 | 207 |
| 259 | 3300038443 | Ga0395901_0171658 | Ga0395901_0171658_1523_2164 | 207 |
| 260 | 3300038443 | Ga0395901_0201713 | Ga0395901_0201713_573_1214 | 207 |
| 261 | 3300038443 | Ga0395901_0258911 | Ga0395901_0258911_1151_1792 | 207 |
| 262 | 3300038443 | Ga0395901_0322603 | Ga0395901_0322603_361_1002 | 207 |
| 263 | 3300038443 | Ga0395901_0380814 | Ga0395901_0380814_351_992 | 207 |
| 264 | 3300041406 | Ga0439439_0044273 | Ga0439439_0044273_437_1078 | 207 |
| 265 | 3300042005 | Ga0439448_0009747 | Ga0439448_0009747_2107_2748 | 207 |
| 266 | 3300042006 | Ga0439432_005945 | Ga0439432_005945_3256_3897 | 207 |
| 267 | 3300042006 | Ga0439432_022408 | Ga0439432_022408_145_783 | 207 |
| 268 | 3300042007 | Ga0439449_0107195 | Ga0439449_0107195_210_851 | 207 |
| 269 | 3300042116 | Ga0450912_000085 | Ga0450912_000085_131_772 | 207 |
| 270 | 3300042157 | Ga0439458_0000200 | Ga0439458_0000200_10468_11109 | 207 |
| 271 | 3300042157 | Ga0439458_0001759 | Ga0439458_0001759_542_1183 | 207 |
| 272 | 3300044693 | Ga0466961_0197442 | Ga0466961_0197442_217_858 | 207 |
| 273 | 3300044694 | Ga0466963_0000326 | Ga0466963_0000326_19277_19918 | 207 |
| 274 | 3300044694 | Ga0466963_0486500 | Ga0466963_0486500_220_861 | 207 |
| 275 | 3300044694 | Ga0466963_0575397 | Ga0466963_0575397_135_776 | 207 |
| 276 | 3300044706 | Ga0466964_0057568 | Ga0466964_0057568_286_927 | 207 |
| 277 | 3300044719 | Ga0466971_0092870 | Ga0466971_0092870_268_909 | 207 |
| 278 | 3300044842 | Ga0466957_0373484 | Ga0466957_0373484_67_708 | 207 |
| 279 | 3300044842 | Ga0466957_0378015 | Ga0466957_0378015_191_832 | 207 |
| 280 | 3300045836 | Ga0466958_0217249 | Ga0466958_0217249_241_882 | 207 |
| 281 | 3300045976 | Ga0466967_0000100 | Ga0466967_0000100_28156_28797 | 207 |
| 282 | 3300045976 | Ga0466967_0125850 | Ga0466967_0125850_222_863 | 207 |
| 283 | 3300045976 | Ga0466967_0187199 | Ga0466967_0187199_461_1102 | 207 |
| 284 | 3300045976 | Ga0466967_0225023 | Ga0466967_0225023_746_1387 | 207 |
| 285 | 3300045976 | Ga0466967_0401696 | Ga0466967_0401696_106_747 | 207 |
| 286 | 3300045976 | Ga0466967_0994323 | Ga0466967_0994323_135_776 | 207 |
| 287 | 3300046684 | Ga0495669_0000090 | Ga0495669_0000090_39812_40453 | 207 |
| 288 | 3300046684 | Ga0495669_0063652 | Ga0495669_0063652_444_1085 | 207 |
| 289 | 3300047323 | Ga0495683_0161249 | Ga0495683_0161249_379_1020 | 207 |
| 290 | 3300047470 | Ga0495681_0136042 | Ga0495681_0136042_83_724 | 207 |
| 291 | 3300048905 | Ga0496102_0672452 | Ga0496102_0672452_268_909 | 207 |
| 292 | 3300048906 | Ga0496103_0006948 | Ga0496103_0006948_5543_6184 | 207 |
| 293 | 3300048907 | Ga0496104_0193490 | Ga0496104_0193490_70_711 | 207 |
| 294 | 3300048908 | Ga0496105_0319422 | Ga0496105_0319422_579_1220 | 207 |
| 295 | 3300048909 | Ga0496106_0008281 | Ga0496106_0008281_2973_3614 | 207 |
| 296 | 3300048910 | Ga0496107_0080296 | Ga0496107_0080296_1323_1964 | 207 |
| 297 | 3300048911 | Ga0496108_0010388 | Ga0496108_0010388_5320_5961 | 207 |
| 298 | 3300048911 | Ga0496108_0110184 | Ga0496108_0110184_1072_1716 | 207 |
| 299 | 3300048912 | Ga0496109_0119657 | Ga0496109_0119657_890_1531 | 207 |
| 300 | 3300048913 | Ga0496110_0175252 | Ga0496110_0175252_279_920 | 207 |
| 301 | 3300048914 | Ga0496111_0081657 | Ga0496111_0081657_67_708 | 207 |
| 302 | 3300048916 | Ga0496113_0068126 | Ga0496113_0068126_2044_2685 | 207 |
| 303 | 3300048916 | Ga0496113_0618617 | Ga0496113_0618617_153_794 | 207 |
| 304 | 3300048917 | Ga0496114_0000029 | Ga0496114_0000029_155019_155660 | 207 |
| 305 | 3300049583 | Ga0501067_0065647 | Ga0501067_0065647_632_1273 | 207 |
| 306 | 3300049584 | Ga0501068_0045450 | Ga0501068_0045450_896_1537 | 207 |
| 307 | 3300049585 | Ga0501069_0075924 | Ga0501069_0075924_765_1406 | 207 |
| 308 | 3300053134 | Ga0500658_0000049 | Ga0500658_0000049_26215_26856 | 207 |
| 309 | 3300059424 | Ga0590075_031682 | Ga0590075_031682_121_765 | 207 |
| 310 | 3300061719 | Ga0466962_0150105 | Ga0466962_0150105_410_1051 | 207 |
| 311 | 3300061719 | Ga0466962_0157408 | Ga0466962_0157408_99_740 | 207 |
| 312 | 3300010159 | Ga0099796_10001431 | Ga0099796_100014317 | 208 |
| 313 | 3300035086 | Ga0373934_0005617 | Ga0373934_0005617_1126_1785 | 208 |
| 314 | 3300035119 | Ga0373956_0193661 | Ga0373956_0193661_119_778 | 208 |
| 315 | 3300035172 | Ga0373955_0144320 | Ga0373955_0144320_702_1361 | 208 |
| 316 | 3300035724 | Ga0373933_0002160 | Ga0373933_0002160_8195_8854 | 208 |
| 317 | 3300036401 | Ga0373937_0009077 | Ga0373937_0009077_3947_4606 | 208 |
| 318 | 3300049571 | Ga0501034_0000093 | Ga0501034_0000093_38643_39296 | 208 |
| 319 | 3300049572 | Ga0501036_0078448 | Ga0501036_0078448_476_1129 | 208 |
| 320 | 3300049574 | Ga0501038_0068470 | Ga0501038_0068470_1338_1991 | 208 |
| 321 | 3300049579 | Ga0501043_0000397 | Ga0501043_0000397_10447_11100 | 208 |
| 322 | 3300049580 | Ga0501046_0002603 | Ga0501046_0002603_13145_13798 | 208 |
| 323 | 3300049581 | Ga0501047_0000002 | Ga0501047_0000002_27961_28614 | 208 |
| 324 | 3300049582 | Ga0501048_0004041 | Ga0501048_0004041_7038_7691 | 208 |
| 325 | 3300049584 | Ga0501068_0002129 | Ga0501068_0002129_1180_1833 | 208 |
| 326 | 3300049586 | Ga0501070_0005671 | Ga0501070_0005671_6437_7090 | 208 |
| 327 | 3300049588 | Ga0501072_0000049 | Ga0501072_0000049_6451_7104 | 208 |
| 328 | 3300049589 | Ga0501073_0006012 | Ga0501073_0006012_8237_8890 | 208 |
| 329 | 3300049590 | Ga0501074_0046652 | Ga0501074_0046652_293_946 | 208 |
| 330 | 3300049741 | Ga0501079_0000264 | Ga0501079_0000264_25015_25668 | 208 |
| 331 | 3300049742 | Ga0501080_0027047 | Ga0501080_0027047_339_992 | 208 |
| 332 | 3300049744 | Ga0501083_0001011 | Ga0501083_0001011_166_819 | 208 |
| 333 | 3300054114 | Ga0501084_0000025 | Ga0501084_0000025_104998_105651 | 208 |
| 334 | 3300060353 | Ga0501082_0056108 | Ga0501082_0056108_339_992 | 208 |
| 335 | iso_pu_bacteria | 2643221644 | 2644245577 | 208 |
| 336 | 3300049569 | Ga0501032_0098556 | Ga0501032_0098556_146_805 | 209 |
| 337 | 3300049570 | Ga0501033_0224361 | Ga0501033_0224361_558_1217 | 209 |
| 338 | 3300049572 | Ga0501036_0104260 | Ga0501036_0104260_420_1079 | 209 |
| 339 | 3300049573 | Ga0501037_0132205 | Ga0501037_0132205_388_1047 | 209 |
| 340 | 3300049574 | Ga0501038_0563764 | Ga0501038_0563764_85_744 | 209 |
| 341 | 3300049579 | Ga0501043_0037136 | Ga0501043_0037136_2110_2769 | 209 |
| 342 | 3300049581 | Ga0501047_0019281 | Ga0501047_0019281_2775_3434 | 209 |
| 343 | 3300049822 | Ga0501035_0014233 | Ga0501035_0014233_3259_3918 | 209 |
| 344 | 3300049823 | Ga0501044_0058712 | Ga0501044_0058712_1868_2527 | 209 |
| 345 | iso_pu_bacteria | 2585428062 | 2587755804 | 209 |
| 346 | 3300005367 | Ga0070667_100425927 | Ga0070667_1004259272 | 210 |
| 347 | 3300005549 | Ga0070704_100653068 | Ga0070704_1006530681 | 210 |
| 348 | 3300025986 | Ga0207658_10392337 | Ga0207658_103923372 | 210 |
| 349 | 3300031239 | Ga0265328_10028397 | Ga0265328_100283972 | 210 |
| 350 | 3300031250 | Ga0265331_10022491 | Ga0265331_100224913 | 210 |
| 351 | 3300031251 | Ga0265327_10000012 | Ga0265327_10000012426 | 210 |
| 352 | 3300044673 | Ga0453683_0000640 | Ga0453683_0000640_12395_13030 | 210 |
| 353 | 3300049575 | Ga0501039_0097162 | Ga0501039_0097162_1393_2028 | 210 |
| 354 | 3300049575 | Ga0501039_0203620 | Ga0501039_0203620_453_1088 | 210 |
| 355 | 3300049577 | Ga0501041_0100835 | Ga0501041_0100835_430_1065 | 210 |
| 356 | 3300049579 | Ga0501043_0626494 | Ga0501043_0626494_113_748 | 210 |
| 357 | 3300049587 | Ga0501071_0275178 | Ga0501071_0275178_552_1187 | 210 |
| 358 | 3300049588 | Ga0501072_0053405 | Ga0501072_0053405_497_1132 | 210 |
| 359 | 3300049589 | Ga0501073_0129238 | Ga0501073_0129238_357_992 | 210 |
| 360 | 3300049590 | Ga0501074_0124564 | Ga0501074_0124564_667_1302 | 210 |
| 361 | 3300049592 | Ga0501076_0310638 | Ga0501076_0310638_264_899 | 210 |
| 362 | 3300049742 | Ga0501080_0198286 | Ga0501080_0198286_772_1407 | 210 |
| 363 | 3300049743 | Ga0501081_0586498 | Ga0501081_0586498_180_815 | 210 |
| 364 | iso_pu_bacteria | 2510065045 | 2510253191 | 210 |
| 365 | iso_pu_bacteria | 2512047030 | 2512347364 | 210 |
| 366 | iso_pu_bacteria | 2513237166 | 2514048015 | 210 |
| 367 | iso_pu_bacteria | 2515154122 | 2515685305 | 210 |
| 368 | iso_pu_bacteria | 2526164713 | 2527078829 | 210 |
| 369 | iso_pu_bacteria | 2711768613 | 2713479261 | 210 |
| 370 | iso_pu_bacteria | 2718217991 | 2719638980 | 210 |
| 371 | iso_pu_bacteria | 2738541296 | 2738823792 | 210 |
| 372 | iso_pu_bacteria | 2738541298 | 2738836183 | 210 |
| 373 | iso_pu_bacteria | 2738541306 | 2738877713 | 210 |
| 374 | iso_pu_bacteria | 2738543002 | 2739189419 | 210 |
| 375 | iso_pu_bacteria | 2738543008 | 2739224306 | 210 |
| 376 | iso_pu_bacteria | 2744054900 | 2746086353 | 210 |
| 377 | iso_pu_bacteria | 2744054901 | 2746093353 | 210 |
| 378 | iso_pu_bacteria | 2791355137 | 2792834680 | 210 |
| 379 | iso_pu_bacteria | 2856287931 | 2856293263 | 210 |
| 380 | iso_pu_bacteria | 2857357740 | 2857366618 | 210 |
| 381 | iso_pu_bacteria | 2885270888 | 2885276725 | 210 |
| 382 | iso_pu_bacteria | 2902682994 | 2902689109 | 210 |
| 383 | iso_pu_bacteria | 2904483920 | 2904488531 | 210 |
| 384 | iso_pu_bacteria | 2904615490 | 2904620385 | 210 |
| 385 | iso_pu_bacteria | 2919527303 | 2919532143 | 210 |
| 386 | iso_pu_bacteria | 2921643360 | 2921644150 | 210 |
| 387 | iso_pu_bacteria | 2945934425 | 2945935220 | 210 |
| 388 | iso_pu_bacteria | 2990703756 | 2990704186 | 210 |
| 389 | iso_pu_bacteria | 641736151 | 642422342 | 210 |
| 390 | iso_pu_bacteria | 642555112 | 642592070 | 210 |
| 391 | iso_pu_bacteria | 8055301274 | 8055304080 | 210 |
| 392 | 3300005458 | Ga0070681_10029928 | Ga0070681_100299281 | 211 |
| 393 | 3300005530 | Ga0070679_100067751 | Ga0070679_1000677516 | 211 |
| 394 | 3300025912 | Ga0207707_10062495 | Ga0207707_100624952 | 211 |
| 395 | 3300037471 | Ga0395905_0144321 | Ga0395905_0144321_1506_2144 | 211 |
| 396 | 3300049571 | Ga0501034_0203133 | Ga0501034_0203133_726_1361 | 211 |
| 397 | 3300049574 | Ga0501038_0279060 | Ga0501038_0279060_58_693 | 211 |
| 398 | 3300049586 | Ga0501070_0212590 | Ga0501070_0212590_813_1448 | 211 |
| 399 | 3300049586 | Ga0501070_0711126 | Ga0501070_0711126_88_723 | 211 |
| 400 | 3300003320 | rootH2_10164363 | rootH2_101643632 | 212 |
| 401 | 3300003775 | Ga0055524_1000227 | Ga0055524_10002276 | 212 |
| 402 | 3300003791 | Ga0055530_10002810 | Ga0055530_100028106 | 212 |
| 403 | 3300003792 | Ga0055540_1000112 | Ga0055540_100011268 | 212 |
| 404 | 3300003794 | Ga0055531_10004566 | Ga0055531_100045662 | 212 |
| 405 | 3300005328 | Ga0070676_10021508 | Ga0070676_100215084 | 212 |
| 406 | 3300005328 | Ga0070676_10136706 | Ga0070676_101367062 | 212 |
| 407 | 3300005330 | Ga0070690_100010655 | Ga0070690_1000106554 | 212 |
| 408 | 3300005331 | Ga0070670_100088711 | Ga0070670_1000887113 | 212 |
| 409 | 3300005333 | Ga0070677_10000399 | Ga0070677_1000039916 | 212 |
| 410 | 3300005335 | Ga0070666_10001754 | Ga0070666_100017549 | 212 |
| 411 | 3300005335 | Ga0070666_10063686 | Ga0070666_100636863 | 212 |
| 412 | 3300005338 | Ga0068868_100011862 | Ga0068868_1000118626 | 212 |
| 413 | 3300005338 | Ga0068868_100029926 | Ga0068868_1000299265 | 212 |
| 414 | 3300005339 | Ga0070660_100209189 | Ga0070660_1002091892 | 212 |
| 415 | 3300005340 | Ga0070689_100141774 | Ga0070689_1001417742 | 212 |
| 416 | 3300005340 | Ga0070689_100207343 | Ga0070689_1002073432 | 212 |
| 417 | 3300005343 | Ga0070687_100080577 | Ga0070687_1000805772 | 212 |
| 418 | 3300005344 | Ga0070661_100004617 | Ga0070661_1000046176 | 212 |
| 419 | 3300005347 | Ga0070668_100090767 | Ga0070668_1000907673 | 212 |
| 420 | 3300005353 | Ga0070669_100351508 | Ga0070669_1003515082 | 212 |
| 421 | 3300005354 | Ga0070675_100009122 | Ga0070675_1000091224 | 212 |
| 422 | 3300005355 | Ga0070671_100004778 | Ga0070671_1000047782 | 212 |
| 423 | 3300005355 | Ga0070671_100038311 | Ga0070671_1000383115 | 212 |
| 424 | 3300005356 | Ga0070674_100004774 | Ga0070674_1000047742 | 212 |
| 425 | 3300005356 | Ga0070674_100510262 | Ga0070674_1005102621 | 212 |
| 426 | 3300005364 | Ga0070673_100001176 | Ga0070673_1000011768 | 212 |
| 427 | 3300005364 | Ga0070673_100036445 | Ga0070673_1000364454 | 212 |
| 428 | 3300005366 | Ga0070659_100002333 | Ga0070659_1000023336 | 212 |
| 429 | 3300005367 | Ga0070667_100001817 | Ga0070667_1000018172 | 212 |
| 430 | 3300005367 | Ga0070667_100053817 | Ga0070667_1000538174 | 212 |
| 431 | 3300005367 | Ga0070667_100100736 | Ga0070667_1001007363 | 212 |
| 432 | 3300005434 | Ga0070709_10026666 | Ga0070709_100266663 | 212 |
| 433 | 3300005435 | Ga0070714_100208301 | Ga0070714_1002083011 | 212 |
| 434 | 3300005437 | Ga0070710_10000687 | Ga0070710_1000068711 | 212 |
| 435 | 3300005439 | Ga0070711_100048889 | Ga0070711_1000488894 | 212 |
| 436 | 3300005445 | Ga0070708_100088896 | Ga0070708_1000888962 | 212 |
| 437 | 3300005455 | Ga0070663_100089547 | Ga0070663_1000895472 | 212 |
| 438 | 3300005456 | Ga0070678_100016839 | Ga0070678_1000168395 | 212 |
| 439 | 3300005456 | Ga0070678_100031328 | Ga0070678_1000313285 | 212 |
| 440 | 3300005457 | Ga0070662_100115356 | Ga0070662_1001153563 | 212 |
| 441 | 3300005457 | Ga0070662_100133004 | Ga0070662_1001330042 | 212 |
| 442 | 3300005459 | Ga0068867_100002533 | Ga0068867_10000253314 | 212 |
| 443 | 3300005459 | Ga0068867_100132568 | Ga0068867_1001325682 | 212 |
| 444 | 3300005459 | Ga0068867_100165044 | Ga0068867_1001650442 | 212 |
| 445 | 3300005466 | Ga0070685_10280235 | Ga0070685_102802352 | 212 |
| 446 | 3300005467 | Ga0070706_100000081 | Ga0070706_10000008127 | 212 |
| 447 | 3300005468 | Ga0070707_100003563 | Ga0070707_1000035634 | 212 |
| 448 | 3300005471 | Ga0070698_100008005 | Ga0070698_10000800514 | 212 |
| 449 | 3300005518 | Ga0070699_100039227 | Ga0070699_1000392274 | 212 |
| 450 | 3300005530 | Ga0070679_100030058 | Ga0070679_1000300582 | 212 |
| 451 | 3300005530 | Ga0070679_100445439 | Ga0070679_1004454392 | 212 |
| 452 | 3300005543 | Ga0070672_100001353 | Ga0070672_1000013536 | 212 |
| 453 | 3300005544 | Ga0070686_100061340 | Ga0070686_1000613401 | 212 |
| 454 | 3300005546 | Ga0070696_100014222 | Ga0070696_1000142226 | 212 |
| 455 | 3300005548 | Ga0070665_100006949 | Ga0070665_1000069492 | 212 |
| 456 | 3300005563 | Ga0068855_100142257 | Ga0068855_1001422572 | 212 |
| 457 | 3300005564 | Ga0070664_100022353 | Ga0070664_1000223532 | 212 |
| 458 | 3300005616 | Ga0068852_100004888 | Ga0068852_1000048885 | 212 |
| 459 | 3300005617 | Ga0068859_100026469 | Ga0068859_1000264693 | 212 |
| 460 | 3300005618 | Ga0068864_100002905 | Ga0068864_1000029055 | 212 |
| 461 | 3300005618 | Ga0068864_100203958 | Ga0068864_1002039582 | 212 |
| 462 | 3300005719 | Ga0068861_100502309 | Ga0068861_1005023092 | 212 |
| 463 | 3300005834 | Ga0068851_10000682 | Ga0068851_1000068215 | 212 |
| 464 | 3300005840 | Ga0068870_10005548 | Ga0068870_100055483 | 212 |
| 465 | 3300005841 | Ga0068863_100040505 | Ga0068863_1000405053 | 212 |
| 466 | 3300005842 | Ga0068858_100026254 | Ga0068858_1000262544 | 212 |
| 467 | 3300005843 | Ga0068860_100011373 | Ga0068860_1000113733 | 212 |
| 468 | 3300005843 | Ga0068860_100075558 | Ga0068860_1000755582 | 212 |
| 469 | 3300005843 | Ga0068860_100284479 | Ga0068860_1002844792 | 212 |
| 470 | 3300006237 | Ga0097621_100055900 | Ga0097621_1000559004 | 212 |
| 471 | 3300006358 | Ga0068871_100009917 | Ga0068871_1000099178 | 212 |
| 472 | 3300006931 | Ga0097620_100026466 | Ga0097620_1000264663 | 212 |
| 473 | 3300006946 | Ga0079104_1000024 | Ga0079104_1000024196 | 212 |
| 474 | 3300009093 | Ga0105240_10018809 | Ga0105240_100188093 | 212 |
| 475 | 3300009098 | Ga0105245_10713086 | Ga0105245_107130862 | 212 |
| 476 | 3300009177 | Ga0105248_10072671 | Ga0105248_100726713 | 212 |
| 477 | 3300009553 | Ga0105249_10095511 | Ga0105249_100955112 | 212 |
| 478 | 3300013104 | Ga0157370_10362695 | Ga0157370_103626952 | 212 |
| 479 | 3300013104 | Ga0157370_10656931 | Ga0157370_106569312 | 212 |
| 480 | 3300013296 | Ga0157374_10223996 | Ga0157374_102239962 | 212 |
| 481 | 3300013306 | Ga0163162_10140431 | Ga0163162_101404312 | 212 |
| 482 | 3300013307 | Ga0157372_10070907 | Ga0157372_100709075 | 212 |
| 483 | 3300013308 | Ga0157375_10003757 | Ga0157375_1000375714 | 212 |
| 484 | 3300013308 | Ga0157375_10074842 | Ga0157375_100748422 | 212 |
| 485 | 3300013308 | Ga0157375_10632453 | Ga0157375_106324532 | 212 |
| 486 | 3300014325 | Ga0163163_10046750 | Ga0163163_100467502 | 212 |
| 487 | 3300014325 | Ga0163163_10066448 | Ga0163163_100664482 | 212 |
| 488 | 3300014325 | Ga0163163_10584683 | Ga0163163_105846832 | 212 |
| 489 | 3300014326 | Ga0157380_10446541 | Ga0157380_104465412 | 212 |
| 490 | 3300014968 | Ga0157379_10034731 | Ga0157379_100347312 | 212 |
| 491 | 3300014969 | Ga0157376_10235683 | Ga0157376_102356832 | 212 |
| 492 | 3300014969 | Ga0157376_11455334 | Ga0157376_114553341 | 212 |
| 493 | 3300017792 | Ga0163161_10021774 | Ga0163161_100217742 | 212 |
| 494 | 3300017792 | Ga0163161_10210085 | Ga0163161_102100852 | 212 |
| 495 | 3300021384 | Ga0213876_10065229 | Ga0213876_100652291 | 212 |
| 496 | 3300025291 | Ga0209675_1010464 | Ga0209675_10104643 | 212 |
| 497 | 3300025298 | Ga0209050_1001849 | Ga0209050_10018496 | 212 |
| 498 | 3300025298 | Ga0209050_1066981 | Ga0209050_10669812 | 212 |
| 499 | 3300025299 | Ga0209256_1000011 | Ga0209256_1000011330 | 212 |
| 500 | 3300025303 | Ga0209051_1000016 | Ga0209051_10000166 | 212 |
| 501 | 3300025304 | Ga0209257_1000510 | Ga0209257_100051054 | 212 |
| 502 | 3300025321 | Ga0207656_10053425 | Ga0207656_100534252 | 212 |
| 503 | 3300025893 | Ga0207682_10000075 | Ga0207682_100000759 | 212 |
| 504 | 3300025893 | Ga0207682_10024073 | Ga0207682_100240731 | 212 |
| 505 | 3300025903 | Ga0207680_10001434 | Ga0207680_100014349 | 212 |
| 506 | 3300025903 | Ga0207680_10005169 | Ga0207680_100051695 | 212 |
| 507 | 3300025906 | Ga0207699_10003665 | Ga0207699_100036653 | 212 |
| 508 | 3300025907 | Ga0207645_10000152 | Ga0207645_1000015246 | 212 |
| 509 | 3300025908 | Ga0207643_10026800 | Ga0207643_100268002 | 212 |
| 510 | 3300025910 | Ga0207684_10000069 | Ga0207684_1000006978 | 212 |
| 511 | 3300025913 | Ga0207695_10046710 | Ga0207695_100467105 | 212 |
| 512 | 3300025914 | Ga0207671_10228765 | Ga0207671_102287652 | 212 |
| 513 | 3300025915 | Ga0207693_10067061 | Ga0207693_100670611 | 212 |
| 514 | 3300025917 | Ga0207660_10428591 | Ga0207660_104285912 | 212 |
| 515 | 3300025918 | Ga0207662_10023331 | Ga0207662_100233314 | 212 |
| 516 | 3300025919 | Ga0207657_10389313 | Ga0207657_103893131 | 212 |
| 517 | 3300025921 | Ga0207652_10162990 | Ga0207652_101629902 | 212 |
| 518 | 3300025921 | Ga0207652_10213684 | Ga0207652_102136842 | 212 |
| 519 | 3300025922 | Ga0207646_10032220 | Ga0207646_100322202 | 212 |
| 520 | 3300025923 | Ga0207681_10511063 | Ga0207681_105110632 | 212 |
| 521 | 3300025925 | Ga0207650_10095222 | Ga0207650_100952222 | 212 |
| 522 | 3300025926 | Ga0207659_10039835 | Ga0207659_100398354 | 212 |
| 523 | 3300025926 | Ga0207659_10109538 | Ga0207659_101095382 | 212 |
| 524 | 3300025927 | Ga0207687_10573601 | Ga0207687_105736011 | 212 |
| 525 | 3300025928 | Ga0207700_10192761 | Ga0207700_101927612 | 212 |
| 526 | 3300025929 | Ga0207664_10021433 | Ga0207664_100214335 | 212 |
| 527 | 3300025931 | Ga0207644_10008849 | Ga0207644_100088497 | 212 |
| 528 | 3300025931 | Ga0207644_10164041 | Ga0207644_101640412 | 212 |
| 529 | 3300025932 | Ga0207690_10002394 | Ga0207690_100023944 | 212 |
| 530 | 3300025933 | Ga0207706_10086107 | Ga0207706_100861072 | 212 |
| 531 | 3300025933 | Ga0207706_10166742 | Ga0207706_101667423 | 212 |
| 532 | 3300025934 | Ga0207686_10133879 | Ga0207686_101338792 | 212 |
| 533 | 3300025935 | Ga0207709_10199323 | Ga0207709_101993232 | 212 |
| 534 | 3300025936 | Ga0207670_10167694 | Ga0207670_101676942 | 212 |
| 535 | 3300025937 | Ga0207669_10001543 | Ga0207669_100015439 | 212 |
| 536 | 3300025940 | Ga0207691_10000006 | Ga0207691_10000006118 | 212 |
| 537 | 3300025940 | Ga0207691_10039639 | Ga0207691_100396392 | 212 |
| 538 | 3300025941 | Ga0207711_10057099 | Ga0207711_100570994 | 212 |
| 539 | 3300025945 | Ga0207679_10008555 | Ga0207679_100085552 | 212 |
| 540 | 3300025949 | Ga0207667_10151210 | Ga0207667_101512103 | 212 |
| 541 | 3300025960 | Ga0207651_10003988 | Ga0207651_100039886 | 212 |
| 542 | 3300025960 | Ga0207651_10015082 | Ga0207651_100150824 | 212 |
| 543 | 3300025961 | Ga0207712_10094260 | Ga0207712_100942603 | 212 |
| 544 | 3300025972 | Ga0207668_10007730 | Ga0207668_100077306 | 212 |
| 545 | 3300025981 | Ga0207640_10159122 | Ga0207640_101591222 | 212 |
| 546 | 3300025986 | Ga0207658_10003664 | Ga0207658_100036647 | 212 |
| 547 | 3300025986 | Ga0207658_10041926 | Ga0207658_100419262 | 212 |
| 548 | 3300025986 | Ga0207658_10076087 | Ga0207658_100760872 | 212 |
| 549 | 3300026023 | Ga0207677_10014400 | Ga0207677_100144005 | 212 |
| 550 | 3300026023 | Ga0207677_10145959 | Ga0207677_101459592 | 212 |
| 551 | 3300026035 | Ga0207703_10011799 | Ga0207703_100117994 | 212 |
| 552 | 3300026041 | Ga0207639_10009225 | Ga0207639_100092257 | 212 |
| 553 | 3300026067 | Ga0207678_10008744 | Ga0207678_100087445 | 212 |
| 554 | 3300026088 | Ga0207641_10038663 | Ga0207641_100386632 | 212 |
| 555 | 3300026089 | Ga0207648_10006993 | Ga0207648_100069936 | 212 |
| 556 | 3300026089 | Ga0207648_10061894 | Ga0207648_100618944 | 212 |
| 557 | 3300026089 | Ga0207648_10329465 | Ga0207648_103294652 | 212 |
| 558 | 3300026095 | Ga0207676_10012674 | Ga0207676_100126744 | 212 |
| 559 | 3300026095 | Ga0207676_10319664 | Ga0207676_103196642 | 212 |
| 560 | 3300026118 | Ga0207675_100045649 | Ga0207675_1000456492 | 212 |
| 561 | 3300026118 | Ga0207675_101364417 | Ga0207675_1013644171 | 212 |
| 562 | 3300026121 | Ga0207683_10000056 | Ga0207683_1000005622 | 212 |
| 563 | 3300026121 | Ga0207683_10170817 | Ga0207683_101708172 | 212 |
| 564 | 3300026142 | Ga0207698_10999551 | Ga0207698_109995512 | 212 |
| 565 | 3300027111 | Ga0209281_1000104 | Ga0209281_10001046 | 212 |
| 566 | 3300028379 | Ga0268266_10016093 | Ga0268266_100160936 | 212 |
| 567 | 3300028379 | Ga0268266_10242898 | Ga0268266_102428982 | 212 |
| 568 | 3300028380 | Ga0268265_10606689 | Ga0268265_106066892 | 212 |
| 569 | 3300028381 | Ga0268264_10012022 | Ga0268264_100120222 | 212 |
| 570 | 3300028381 | Ga0268264_10092467 | Ga0268264_100924673 | 212 |
| 571 | 3300028381 | Ga0268264_10745804 | Ga0268264_107458042 | 212 |
| 572 | 3300028794 | Ga0307515_10002278 | Ga0307515_100022786 | 212 |
| 573 | 3300028794 | Ga0307515_10002502 | Ga0307515_100025027 | 212 |
| 574 | 3300028794 | Ga0307515_10011678 | Ga0307515_1001167812 | 212 |
| 575 | 3300030522 | Ga0307512_10028633 | Ga0307512_100286334 | 212 |
| 576 | 3300031235 | Ga0265330_10005332 | Ga0265330_100053324 | 212 |
| 577 | 3300031238 | Ga0265332_10000594 | Ga0265332_100005942 | 212 |
| 578 | 3300031242 | Ga0265329_10004983 | Ga0265329_100049835 | 212 |
| 579 | 3300031250 | Ga0265331_10016246 | Ga0265331_100162464 | 212 |
| 580 | 3300031251 | Ga0265327_10028073 | Ga0265327_100280733 | 212 |
| 581 | 3300031344 | Ga0265316_10009477 | Ga0265316_1000947711 | 212 |
| 582 | 3300031456 | Ga0307513_10049503 | Ga0307513_100495033 | 212 |
| 583 | 3300031456 | Ga0307513_10161808 | Ga0307513_101618083 | 212 |
| 584 | 3300031456 | Ga0307513_10247707 | Ga0307513_102477072 | 212 |
| 585 | 3300031456 | Ga0307513_10421703 | Ga0307513_104217032 | 212 |
| 586 | 3300031616 | Ga0307508_10000061 | Ga0307508_1000006115 | 212 |
| 587 | 3300031649 | Ga0307514_10003371 | Ga0307514_100033714 | 212 |
| 588 | 3300031711 | Ga0265314_10011562 | Ga0265314_100115622 | 212 |
| 589 | 3300031712 | Ga0265342_10006799 | Ga0265342_1000679912 | 212 |
| 590 | 3300031730 | Ga0307516_10009896 | Ga0307516_100098966 | 212 |
| 591 | 3300031730 | Ga0307516_10462540 | Ga0307516_104625402 | 212 |
| 592 | 3300034816 | Ga0373930_0067189 | Ga0373930_0067189_106_768 | 212 |
| 593 | 3300035089 | Ga0373944_0063867 | Ga0373944_0063867_280_927 | 212 |
| 594 | 3300036401 | Ga0373937_1058924 | Ga0373937_1058924_25_672 | 212 |
| 595 | 3300037471 | Ga0395905_0790714 | Ga0395905_0790714_142_786 | 212 |
| 596 | 3300039437 | Ga0436365_1594720 | Ga0436365_1594720_143_793 | 212 |
| 597 | 3300041451 | Ga0451791_0575998 | Ga0451791_0575998_368_1015 | 212 |
| 598 | 3300041452 | Ga0451793_0793577 | Ga0451793_0793577_225_872 | 212 |
| 599 | 3300041453 | Ga0451797_0999178 | Ga0451797_0999178_75_722 | 212 |
| 600 | 3300041459 | Ga0451800_0643375 | Ga0451800_0643375_28_675 | 212 |
| 601 | 3300041498 | Ga0451841_0395393 | Ga0451841_0395393_99_746 | 212 |
| 602 | 3300041509 | Ga0451843_0784537 | Ga0451843_0784537_14_673 | 212 |
| 603 | 3300041512 | Ga0451853_3344173 | Ga0451853_3344173_80_727 | 212 |
| 604 | 3300042122 | Ga0450920_004850 | Ga0450920_004850_892_1539 | 212 |
| 605 | 3300042531 | Ga0450918_001122 | Ga0450918_001122_4820_5467 | 212 |
| 606 | 3300046454 | Ga0495592_0185342 | Ga0495592_0185342_277_915 | 212 |
| 607 | 3300046455 | Ga0495603_0301266 | Ga0495603_0301266_242_889 | 212 |
| 608 | 3300046459 | Ga0495629_0323467 | Ga0495629_0323467_60_707 | 212 |
| 609 | 3300046512 | Ga0495610_0024862 | Ga0495610_0024862_2131_2778 | 212 |
| 610 | 3300046519 | Ga0495632_0011199 | Ga0495632_0011199_3538_4182 | 212 |
| 611 | 3300046522 | Ga0495643_0092042 | Ga0495643_0092042_706_1350 | 212 |
| 612 | 3300046528 | Ga0495642_0126731 | Ga0495642_0126731_354_995 | 212 |
| 613 | 3300046660 | Ga0495625_0003328 | Ga0495625_0003328_8923_9567 | 212 |
| 614 | 3300046683 | Ga0495658_0245404 | Ga0495658_0245404_225_869 | 212 |
| 615 | 3300047472 | Ga0495686_0076142 | Ga0495686_0076142_837_1481 | 212 |
| 616 | 3300048904 | Ga0496101_0143126 | Ga0496101_0143126_820_1467 | 212 |
| 617 | 3300048907 | Ga0496104_0040840 | Ga0496104_0040840_3392_4039 | 212 |
| 618 | 3300048908 | Ga0496105_0106472 | Ga0496105_0106472_106_753 | 212 |
| 619 | 3300048911 | Ga0496108_0091858 | Ga0496108_0091858_1493_2140 | 212 |
| 620 | 3300048912 | Ga0496109_0567090 | Ga0496109_0567090_298_945 | 212 |
| 621 | 3300048914 | Ga0496111_0094589 | Ga0496111_0094589_16_663 | 212 |
| 622 | 3300048917 | Ga0496114_0069460 | Ga0496114_0069460_1267_1908 | 212 |
| 623 | 3300048917 | Ga0496114_0185882 | Ga0496114_0185882_993_1640 | 212 |
| 624 | 3300048929 | Ga0496126_0062320 | Ga0496126_0062320_1738_2400 | 212 |
| 625 | 3300050493 | nmdc:mga0k408_330969_c1 | nmdc:mga0k408_330969_c1_180_827 | 212 |
| 626 | 3300050493 | nmdc:mga0k408_469504_c1 | nmdc:mga0k408_469504_c1_18_665 | 212 |
| 627 | 3300050496 | nmdc:mga07m45_153997_c1 | nmdc:mga07m45_153997_c1_40_705 | 212 |
| 628 | 3300053096 | Ga0500641_0007052 | Ga0500641_0007052_995_1657 | 212 |
| 629 | 3300053148 | Ga0500590_035333 | Ga0500590_035333_1590_2228 | 212 |
| 630 | 3300053154 | Ga0500619_000129 | Ga0500619_000129_15818_16639 | 212 |
| 631 | 3300053739 | Ga0500587_001555 | Ga0500587_001555_918_1565 | 212 |
| 632 | 3300028577 | Ga0265318_10004018 | Ga0265318_100040185 | 213 |
| 633 | 3300001979 | JGI24740J21852_10000889 | JGI24740J21852_100008893 | 214 |
| 634 | 3300001989 | JGI24739J22299_10005706 | JGI24739J22299_100057066 | 214 |
| 635 | 3300001989 | JGI24739J22299_10009956 | JGI24739J22299_100099563 | 214 |
| 636 | 3300001990 | JGI24737J22298_10055780 | JGI24737J22298_100557802 | 214 |
| 637 | 3300002067 | JGI24735J21928_10026752 | JGI24735J21928_100267522 | 214 |
| 638 | 3300002067 | JGI24735J21928_10035864 | JGI24735J21928_100358642 | 214 |
| 639 | 3300002705 | JGI25156J39149_1003113 | JGI25156J39149_10031132 | 214 |
| 640 | 3300002705 | JGI25156J39149_1006429 | JGI25156J39149_10064292 | 214 |
| 641 | 3300003214 | JGI25165J46597_1001028 | JGI25165J46597_10010288 | 214 |
| 642 | 3300003320 | rootH2_10027978 | rootH2_100279784 | 214 |
| 643 | 3300003323 | rootH1_10089386 | rootH1_100893862 | 214 |
| 644 | 3300003323 | rootH1_10089401 | rootH1_100894013 | 214 |
| 645 | 3300003354 | JGI25160J50197_1000049 | JGI25160J50197_100004962 | 214 |
| 646 | 3300003756 | Ga0055533_1000812 | Ga0055533_10008128 | 214 |
| 647 | 3300003756 | Ga0055533_1002173 | Ga0055533_10021736 | 214 |
| 648 | 3300003758 | Ga0055532_1000031 | Ga0055532_100003165 | 214 |
| 649 | 3300003760 | Ga0055527_1000020 | Ga0055527_100002065 | 214 |
| 650 | 3300003761 | Ga0055535_1000023 | Ga0055535_1000023153 | 214 |
| 651 | 3300003762 | Ga0055542_1000035 | Ga0055542_100003565 | 214 |
| 652 | 3300003763 | Ga0055529_1000039 | Ga0055529_1000039153 | 214 |
| 653 | 3300005262 | Ga0065165_1000115 | Ga0065165_100011562 | 214 |
| 654 | 3300005329 | Ga0070683_101199357 | Ga0070683_1011993571 | 214 |
| 655 | 3300005331 | Ga0070670_100125628 | Ga0070670_1001256281 | 214 |
| 656 | 3300005353 | Ga0070669_100115617 | Ga0070669_1001156172 | 214 |
| 657 | 3300005367 | Ga0070667_100097359 | Ga0070667_1000973593 | 214 |
| 658 | 3300005434 | Ga0070709_10055155 | Ga0070709_100551552 | 214 |
| 659 | 3300005455 | Ga0070663_100501530 | Ga0070663_1005015301 | 214 |
| 660 | 3300005546 | Ga0070696_100058271 | Ga0070696_1000582713 | 214 |
| 661 | 3300005844 | Ga0068862_100458604 | Ga0068862_1004586042 | 214 |
| 662 | 3300006173 | Ga0070716_100003346 | Ga0070716_1000033462 | 214 |
| 663 | 3300006844 | Ga0075428_100006608 | Ga0075428_1000066088 | 214 |
| 664 | 3300006871 | Ga0075434_100013352 | Ga0075434_1000133525 | 214 |
| 665 | 3300006880 | Ga0075429_100189143 | Ga0075429_1001891432 | 214 |
| 666 | 3300007076 | Ga0075435_100003277 | Ga0075435_10000327712 | 214 |
| 667 | 3300007076 | Ga0075435_100212104 | Ga0075435_1002121042 | 214 |
| 668 | 3300009011 | Ga0105251_10000055 | Ga0105251_100000559 | 214 |
| 669 | 3300009011 | Ga0105251_10074907 | Ga0105251_100749072 | 214 |
| 670 | 3300009011 | Ga0105251_10119186 | Ga0105251_101191862 | 214 |
| 671 | 3300009093 | Ga0105240_10018564 | Ga0105240_100185648 | 214 |
| 672 | 3300009093 | Ga0105240_10213594 | Ga0105240_102135942 | 214 |
| 673 | 3300009094 | Ga0111539_10003392 | Ga0111539_1000339212 | 214 |
| 674 | 3300009094 | Ga0111539_10676885 | Ga0111539_106768852 | 214 |
| 675 | 3300009147 | Ga0114129_10030470 | Ga0114129_100304709 | 214 |
| 676 | 3300009177 | Ga0105248_10395338 | Ga0105248_103953382 | 214 |
| 677 | 3300009177 | Ga0105248_10434122 | Ga0105248_104341222 | 214 |
| 678 | 3300009177 | Ga0105248_10510868 | Ga0105248_105108682 | 214 |
| 679 | 3300009551 | Ga0105238_10305285 | Ga0105238_103052852 | 214 |
| 680 | 3300013105 | Ga0157369_10015435 | Ga0157369_100154352 | 214 |
| 681 | 3300013105 | Ga0157369_10153297 | Ga0157369_101532972 | 214 |
| 682 | 3300013105 | Ga0157369_10232541 | Ga0157369_102325411 | 214 |
| 683 | 3300014326 | Ga0157380_10070253 | Ga0157380_100702535 | 214 |
| 684 | 3300014326 | Ga0157380_10363460 | Ga0157380_103634602 | 214 |
| 685 | 3300014497 | Ga0182008_10009309 | Ga0182008_100093093 | 214 |
| 686 | 3300014969 | Ga0157376_10258047 | Ga0157376_102580472 | 214 |
| 687 | 3300015262 | Ga0182007_10001200 | Ga0182007_100012006 | 214 |
| 688 | 3300016635 | Ga0183361_10001 | Ga0183361_10001217 | 214 |
| 689 | 3300025206 | Ga0209435_112808 | Ga0209435_1128081 | 214 |
| 690 | 3300025226 | Ga0209674_100017 | Ga0209674_1000178 | 214 |
| 691 | 3300025226 | Ga0209674_100287 | Ga0209674_1002878 | 214 |
| 692 | 3300025228 | Ga0209672_100001 | Ga0209672_1000011946 | 214 |
| 693 | 3300025229 | Ga0209147_100001 | Ga0209147_1000011946 | 214 |
| 694 | 3300025230 | Ga0209563_101394 | Ga0209563_1013944 | 214 |
| 695 | 3300025231 | Ga0207427_101345 | Ga0207427_1013453 | 214 |
| 696 | 3300025242 | Ga0209258_100001 | Ga0209258_1000011946 | 214 |
| 697 | 3300025246 | Ga0209646_1007651 | Ga0209646_10076512 | 214 |
| 698 | 3300025254 | Ga0209148_1000003 | Ga0209148_10000031946 | 214 |
| 699 | 3300025256 | Ga0209759_1000037 | Ga0209759_1000037233 | 214 |
| 700 | 3300025256 | Ga0209759_1000649 | Ga0209759_100064926 | 214 |
| 701 | 3300025256 | Ga0209759_1019104 | Ga0209759_10191041 | 214 |
| 702 | 3300025261 | Ga0209233_1000123 | Ga0209233_1000123145 | 214 |
| 703 | 3300025272 | Ga0209455_1000001 | Ga0209455_10000011946 | 214 |
| 704 | 3300025284 | Ga0209130_1011142 | Ga0209130_10111421 | 214 |
| 705 | 3300025302 | Ga0207426_1000007 | Ga0207426_1000007276 | 214 |
| 706 | 3300025735 | Ga0207713_1000089 | Ga0207713_1000089116 | 214 |
| 707 | 3300025735 | Ga0207713_1000106 | Ga0207713_100010636 | 214 |
| 708 | 3300025904 | Ga0207647_10000540 | Ga0207647_100005408 | 214 |
| 709 | 3300025904 | Ga0207647_10007729 | Ga0207647_100077293 | 214 |
| 710 | 3300025907 | Ga0207645_10235406 | Ga0207645_102354062 | 214 |
| 711 | 3300025909 | Ga0207705_10111230 | Ga0207705_101112302 | 214 |
| 712 | 3300025913 | Ga0207695_10049156 | Ga0207695_100491562 | 214 |
| 713 | 3300025913 | Ga0207695_10105735 | Ga0207695_101057352 | 214 |
| 714 | 3300025915 | Ga0207693_10460304 | Ga0207693_104603041 | 214 |
| 715 | 3300025919 | Ga0207657_10178669 | Ga0207657_101786692 | 214 |
| 716 | 3300025923 | Ga0207681_10112870 | Ga0207681_101128703 | 214 |
| 717 | 3300025924 | Ga0207694_10815057 | Ga0207694_108150571 | 214 |
| 718 | 3300025928 | Ga0207700_10656578 | Ga0207700_106565782 | 214 |
| 719 | 3300025941 | Ga0207711_10037329 | Ga0207711_100373293 | 214 |
| 720 | 3300025941 | Ga0207711_10049621 | Ga0207711_100496212 | 214 |
| 721 | 3300025949 | Ga0207667_10166893 | Ga0207667_101668932 | 214 |
| 722 | 3300025972 | Ga0207668_10167720 | Ga0207668_101677202 | 214 |
| 723 | 3300025986 | Ga0207658_10070544 | Ga0207658_100705443 | 214 |
| 724 | 3300026067 | Ga0207678_10170178 | Ga0207678_101701783 | 214 |
| 725 | 3300026089 | Ga0207648_10749895 | Ga0207648_107498952 | 214 |
| 726 | 3300026095 | Ga0207676_10305279 | Ga0207676_103052791 | 214 |
| 727 | 3300026116 | Ga0207674_10125523 | Ga0207674_101255232 | 214 |
| 728 | 3300026118 | Ga0207675_100113535 | Ga0207675_1001135352 | 214 |
| 729 | 3300028800 | Ga0265338_10000118 | Ga0265338_1000011851 | 214 |
| 730 | 3300028800 | Ga0265338_10018147 | Ga0265338_100181472 | 214 |
| 731 | 3300031241 | Ga0265325_10000101 | Ga0265325_100001018 | 214 |
| 732 | 3300031247 | Ga0265340_10114709 | Ga0265340_101147092 | 214 |
| 733 | 3300031249 | Ga0265339_10001142 | Ga0265339_1000114213 | 214 |
| 734 | 3300031250 | Ga0265331_10000003 | Ga0265331_10000003398 | 214 |
| 735 | 3300031344 | Ga0265316_10014358 | Ga0265316_100143583 | 214 |
| 736 | 3300031344 | Ga0265316_10353726 | Ga0265316_103537262 | 214 |
| 737 | 3300031548 | Ga0307408_100262570 | Ga0307408_1002625702 | 214 |
| 738 | 3300031595 | Ga0265313_10008276 | Ga0265313_100082766 | 214 |
| 739 | 3300031711 | Ga0265314_10009671 | Ga0265314_100096719 | 214 |
| 740 | 3300031911 | Ga0307412_10000014 | Ga0307412_10000014148 | 214 |
| 741 | 3300031911 | Ga0307412_10000107 | Ga0307412_1000010753 | 214 |
| 742 | 3300037471 | Ga0395905_0000014 | Ga0395905_0000014_194953_195597 | 214 |
| 743 | 3300037471 | Ga0395905_0158652 | Ga0395905_0158652_509_1153 | 214 |
| 744 | 3300037471 | Ga0395905_0567640 | Ga0395905_0567640_345_989 | 214 |
| 745 | 3300038443 | Ga0395901_0499111 | Ga0395901_0499111_168_812 | 214 |
| 746 | 3300042156 | Ga0439446_0009840 | Ga0439446_0009840_309_953 | 214 |
| 747 | 3300042435 | Ga0439434_0069678 | Ga0439434_0069678_363_1007 | 214 |
| 748 | 3300042876 | Ga0451577_0708316 | Ga0451577_0708316_101_748 | 214 |
| 749 | 3300044684 | Ga0466966_0121667 | Ga0466966_0121667_768_1430 | 214 |
| 750 | 3300046454 | Ga0495592_0040739 | Ga0495592_0040739_1802_2446 | 214 |
| 751 | 3300046455 | Ga0495603_0016605 | Ga0495603_0016605_2263_2907 | 214 |
| 752 | 3300046457 | Ga0495590_0041346 | Ga0495590_0041346_547_1191 | 214 |
| 753 | 3300046459 | Ga0495629_0003125 | Ga0495629_0003125_6788_7432 | 214 |
| 754 | 3300046459 | Ga0495629_0003148 | Ga0495629_0003148_6287_6931 | 214 |
| 755 | 3300046463 | Ga0495653_0014931 | Ga0495653_0014931_5138_5782 | 214 |
| 756 | 3300046463 | Ga0495653_0240220 | Ga0495653_0240220_47_697 | 214 |
| 757 | 3300046463 | Ga0495653_0246511 | Ga0495653_0246511_231_875 | 214 |
| 758 | 3300046471 | Ga0495650_0018718 | Ga0495650_0018718_2250_2894 | 214 |
| 759 | 3300046471 | Ga0495650_0042657 | Ga0495650_0042657_356_1000 | 214 |
| 760 | 3300046471 | Ga0495650_0061671 | Ga0495650_0061671_102_746 | 214 |
| 761 | 3300046472 | Ga0495580_0004970 | Ga0495580_0004970_5160_5804 | 214 |
| 762 | 3300046472 | Ga0495580_0013759 | Ga0495580_0013759_1978_2622 | 214 |
| 763 | 3300046472 | Ga0495580_0019504 | Ga0495580_0019504_2133_2777 | 214 |
| 764 | 3300046472 | Ga0495580_0180777 | Ga0495580_0180777_169_813 | 214 |
| 765 | 3300046473 | Ga0495582_0004146 | Ga0495582_0004146_6371_7015 | 214 |
| 766 | 3300046474 | Ga0495605_0012407 | Ga0495605_0012407_348_992 | 214 |
| 767 | 3300046474 | Ga0495605_0026161 | Ga0495605_0026161_1884_2528 | 214 |
| 768 | 3300046474 | Ga0495605_0184036 | Ga0495605_0184036_159_803 | 214 |
| 769 | 3300046476 | Ga0495662_0015160 | Ga0495662_0015160_592_1236 | 214 |
| 770 | 3300046477 | Ga0495664_0010186 | Ga0495664_0010186_2591_3235 | 214 |
| 771 | 3300046477 | Ga0495664_0047247 | Ga0495664_0047247_324_968 | 214 |
| 772 | 3300046491 | Ga0495584_0221449 | Ga0495584_0221449_134_778 | 214 |
| 773 | 3300046506 | Ga0495583_0009452 | Ga0495583_0009452_3154_3798 | 214 |
| 774 | 3300046507 | Ga0495606_0011868 | Ga0495606_0011868_1163_1807 | 214 |
| 775 | 3300046511 | Ga0495608_0030601 | Ga0495608_0030601_1016_1660 | 214 |
| 776 | 3300046512 | Ga0495610_0008911 | Ga0495610_0008911_5040_5684 | 214 |
| 777 | 3300046513 | Ga0495616_0032976 | Ga0495616_0032976_1227_1871 | 214 |
| 778 | 3300046514 | Ga0495618_0008272 | Ga0495618_0008272_4996_5640 | 214 |
| 779 | 3300046515 | Ga0495620_0105336 | Ga0495620_0105336_10_666 | 214 |
| 780 | 3300046516 | Ga0495628_0060419 | Ga0495628_0060419_231_875 | 214 |
| 781 | 3300046516 | Ga0495628_0338683 | Ga0495628_0338683_409_1053 | 214 |
| 782 | 3300046522 | Ga0495643_0063557 | Ga0495643_0063557_1112_1756 | 214 |
| 783 | 3300046524 | Ga0495648_0067124 | Ga0495648_0067124_588_1262 | 214 |
| 784 | 3300046526 | Ga0495666_0003678 | Ga0495666_0003678_2900_3544 | 214 |
| 785 | 3300046528 | Ga0495642_0019199 | Ga0495642_0019199_1838_2482 | 214 |
| 786 | 3300046529 | Ga0495652_0016973 | Ga0495652_0016973_4207_4851 | 214 |
| 787 | 3300046533 | Ga0495640_0011543 | Ga0495640_0011543_3155_3799 | 214 |
| 788 | 3300046543 | Ga0495645_0105323 | Ga0495645_0105323_1007_1651 | 214 |
| 789 | 3300046557 | Ga0495622_0066549 | Ga0495622_0066549_103_747 | 214 |
| 790 | 3300046663 | Ga0495635_0004906 | Ga0495635_0004906_6892_7536 | 214 |
| 791 | 3300046678 | Ga0495599_0000114 | Ga0495599_0000114_10315_10962 | 214 |
| 792 | 3300046679 | Ga0495623_0070373 | Ga0495623_0070373_103_747 | 214 |
| 793 | 3300046680 | Ga0495646_0004942 | Ga0495646_0004942_4794_5438 | 214 |
| 794 | 3300046680 | Ga0495646_0018335 | Ga0495646_0018335_2750_3394 | 214 |
| 795 | 3300046689 | Ga0495613_0094984 | Ga0495613_0094984_971_1615 | 214 |
| 796 | 3300046690 | Ga0495624_0054505 | Ga0495624_0054505_1627_2271 | 214 |
| 797 | 3300046694 | Ga0495649_0006836 | Ga0495649_0006836_5732_6388 | 214 |
| 798 | 3300046694 | Ga0495649_0018654 | Ga0495649_0018654_615_1259 | 214 |
| 799 | 3300046694 | Ga0495649_0243515 | Ga0495649_0243515_223_867 | 214 |
| 800 | 3300046794 | Ga0495589_0018927 | Ga0495589_0018927_206_850 | 214 |
| 801 | 3300046794 | Ga0495589_0056398 | Ga0495589_0056398_832_1488 | 214 |
| 802 | 3300046794 | Ga0495589_0095974 | Ga0495589_0095974_735_1379 | 214 |
| 803 | 3300046809 | Ga0495600_0050291 | Ga0495600_0050291_1789_2433 | 214 |
| 804 | 3300046810 | Ga0495660_0110930 | Ga0495660_0110930_307_951 | 214 |
| 805 | 3300047315 | Ga0495581_0002005 | Ga0495581_0002005_5659_6303 | 214 |
| 806 | 3300047317 | Ga0495604_0028444 | Ga0495604_0028444_360_1004 | 214 |
| 807 | 3300047317 | Ga0495604_0381199 | Ga0495604_0381199_185_829 | 214 |
| 808 | 3300047319 | Ga0495674_0002606 | Ga0495674_0002606_3387_4031 | 214 |
| 809 | 3300047321 | Ga0495676_0054810 | Ga0495676_0054810_436_1080 | 214 |
| 810 | 3300047322 | Ga0495680_0047724 | Ga0495680_0047724_509_1153 | 214 |
| 811 | 3300047323 | Ga0495683_0003499 | Ga0495683_0003499_6128_6772 | 214 |
| 812 | 3300047323 | Ga0495683_0011753 | Ga0495683_0011753_2999_3643 | 214 |
| 813 | 3300047323 | Ga0495683_0021096 | Ga0495683_0021096_130_774 | 214 |
| 814 | 3300047323 | Ga0495683_0063273 | Ga0495683_0063273_1136_1792 | 214 |
| 815 | 3300047443 | Ga0495687_023970 | Ga0495687_023970_1286_1930 | 214 |
| 816 | 3300047443 | Ga0495687_024023 | Ga0495687_024023_1825_2469 | 214 |
| 817 | 3300047444 | Ga0495675_0007254 | Ga0495675_0007254_3866_4510 | 214 |
| 818 | 3300047444 | Ga0495675_0091118 | Ga0495675_0091118_231_875 | 214 |
| 819 | 3300047445 | Ga0495677_0189437 | Ga0495677_0189437_47_769 | 214 |
| 820 | 3300047446 | Ga0495679_040396 | Ga0495679_040396_530_1174 | 214 |
| 821 | 3300047469 | Ga0495673_0019901 | Ga0495673_0019901_2053_2697 | 214 |
| 822 | 3300047472 | Ga0495686_0000014 | Ga0495686_0000014_149411_150055 | 214 |
| 823 | 3300047673 | Ga0495593_0012015 | Ga0495593_0012015_2156_2800 | 214 |
| 824 | 3300047673 | Ga0495593_0012819 | Ga0495593_0012819_660_1304 | 214 |
| 825 | 3300047673 | Ga0495593_0101879 | Ga0495593_0101879_254_904 | 214 |
| 826 | 3300048088 | Ga0495602_0027443 | Ga0495602_0027443_432_1079 | 214 |
| 827 | 3300048088 | Ga0495602_0050386 | Ga0495602_0050386_3010_3657 | 214 |
| 828 | 3300048089 | Ga0495614_0003643 | Ga0495614_0003643_5625_6269 | 214 |
| 829 | 3300048091 | Ga0495626_0027353 | Ga0495626_0027353_195_839 | 214 |
| 830 | 3300048091 | Ga0495626_0088863 | Ga0495626_0088863_195_839 | 214 |
| 831 | 3300048903 | Ga0496100_0060295 | Ga0496100_0060295_1344_1988 | 214 |
| 832 | 3300048903 | Ga0496100_0082475 | Ga0496100_0082475_946_1590 | 214 |
| 833 | 3300048904 | Ga0496101_0023541 | Ga0496101_0023541_571_1215 | 214 |
| 834 | 3300048904 | Ga0496101_0103037 | Ga0496101_0103037_1434_2078 | 214 |
| 835 | 3300048905 | Ga0496102_0060786 | Ga0496102_0060786_454_1098 | 214 |
| 836 | 3300048906 | Ga0496103_0002910 | Ga0496103_0002910_4603_5247 | 214 |
| 837 | 3300048907 | Ga0496104_0048947 | Ga0496104_0048947_2963_3607 | 214 |
| 838 | 3300048907 | Ga0496104_0185297 | Ga0496104_0185297_738_1382 | 214 |
| 839 | 3300048908 | Ga0496105_0031288 | Ga0496105_0031288_2622_3266 | 214 |
| 840 | 3300048908 | Ga0496105_0220412 | Ga0496105_0220412_844_1488 | 214 |
| 841 | 3300048909 | Ga0496106_0000071 | Ga0496106_0000071_44630_45274 | 214 |
| 842 | 3300048909 | Ga0496106_0036863 | Ga0496106_0036863_1764_2408 | 214 |
| 843 | 3300048909 | Ga0496106_0058895 | Ga0496106_0058895_775_1419 | 214 |
| 844 | 3300048910 | Ga0496107_0077530 | Ga0496107_0077530_1257_1901 | 214 |
| 845 | 3300048915 | Ga0496112_0178770 | Ga0496112_0178770_1065_1709 | 214 |
| 846 | 3300048916 | Ga0496113_0013566 | Ga0496113_0013566_396_1040 | 214 |
| 847 | 3300048919 | Ga0496116_0156493 | Ga0496116_0156493_164_808 | 214 |
| 848 | 3300048919 | Ga0496116_0173080 | Ga0496116_0173080_440_1084 | 214 |
| 849 | 3300048920 | Ga0496117_0047781 | Ga0496117_0047781_61_705 | 214 |
| 850 | 3300048920 | Ga0496117_0109936 | Ga0496117_0109936_687_1331 | 214 |
| 851 | 3300048920 | Ga0496117_0279749 | Ga0496117_0279749_60_704 | 214 |
| 852 | 3300048921 | Ga0496118_0002189 | Ga0496118_0002189_6881_7525 | 214 |
| 853 | 3300048921 | Ga0496118_0010536 | Ga0496118_0010536_5553_6197 | 214 |
| 854 | 3300048921 | Ga0496118_0032534 | Ga0496118_0032534_1546_2190 | 214 |
| 855 | 3300048921 | Ga0496118_0107213 | Ga0496118_0107213_100_744 | 214 |
| 856 | 3300048922 | Ga0496119_0023176 | Ga0496119_0023176_1563_2207 | 214 |
| 857 | 3300048922 | Ga0496119_0154808 | Ga0496119_0154808_429_1073 | 214 |
| 858 | 3300048924 | Ga0496121_0000333 | Ga0496121_0000333_88147_88791 | 214 |
| 859 | 3300048924 | Ga0496121_0032682 | Ga0496121_0032682_2997_3641 | 214 |
| 860 | 3300048924 | Ga0496121_0056392 | Ga0496121_0056392_1074_1718 | 214 |
| 861 | 3300048925 | Ga0496122_0044737 | Ga0496122_0044737_1322_1966 | 214 |
| 862 | 3300048927 | Ga0496124_0141888 | Ga0496124_0141888_251_895 | 214 |
| 863 | 3300048929 | Ga0496126_0001409 | Ga0496126_0001409_2976_3620 | 214 |
| 864 | 3300048929 | Ga0496126_0002413 | Ga0496126_0002413_19651_20295 | 214 |
| 865 | 3300048929 | Ga0496126_0007047 | Ga0496126_0007047_6499_7143 | 214 |
| 866 | 3300049460 | Ga0495682_0040580 | Ga0495682_0040580_756_1400 | 214 |
| 867 | 3300049568 | Ga0501031_0155434 | Ga0501031_0155434_716_1372 | 214 |
| 868 | 3300049571 | Ga0501034_0038133 | Ga0501034_0038133_2019_2675 | 214 |
| 869 | 3300049574 | Ga0501038_0067408 | Ga0501038_0067408_1831_2487 | 214 |
| 870 | 3300049576 | Ga0501040_0128374 | Ga0501040_0128374_778_1422 | 214 |
| 871 | 3300049577 | Ga0501041_0347776 | Ga0501041_0347776_242_889 | 214 |
| 872 | 3300049579 | Ga0501043_0040221 | Ga0501043_0040221_1578_2234 | 214 |
| 873 | 3300049579 | Ga0501043_0076965 | Ga0501043_0076965_335_979 | 214 |
| 874 | 3300049581 | Ga0501047_0217122 | Ga0501047_0217122_194_850 | 214 |
| 875 | 3300049582 | Ga0501048_0155497 | Ga0501048_0155497_259_906 | 214 |
| 876 | 3300049586 | Ga0501070_0063658 | Ga0501070_0063658_2285_2950 | 214 |
| 877 | 3300049587 | Ga0501071_0393347 | Ga0501071_0393347_300_947 | 214 |
| 878 | 3300049591 | Ga0501075_0055463 | Ga0501075_0055463_1191_1838 | 214 |
| 879 | 3300049592 | Ga0501076_0987915 | Ga0501076_0987915_15_659 | 214 |
| 880 | 3300049742 | Ga0501080_0094444 | Ga0501080_0094444_2088_2744 | 214 |
| 881 | 3300049823 | Ga0501044_0543676 | Ga0501044_0543676_158_814 | 214 |
| 882 | 3300050507 | nmdc:mga05p37_105948_c1 | nmdc:mga05p37_105948_c1_108_752 | 214 |
| 883 | 3300050508 | nmdc:mga09592_131784_c1 | nmdc:mga09592_131784_c1_545_1189 | 214 |
| 884 | 3300050511 | nmdc:mga08y16_313882_c1 | nmdc:mga08y16_313882_c1_888_1541 | 214 |
| 885 | 3300050511 | nmdc:mga08y16_9642_c1 | nmdc:mga08y16_9642_c1_9421_10065 | 214 |
| 886 | 3300050512 | nmdc:mga0n895_23040_c1 | nmdc:mga0n895_23040_c1_4316_4960 | 214 |
| 887 | 3300050513 | nmdc:mga0rr50_284280_c1 | nmdc:mga0rr50_284280_c1_98_742 | 214 |
| 888 | 3300050515 | nmdc:mga0a205_147_c1 | nmdc:mga0a205_147_c1_43666_44310 | 214 |
| 889 | 3300061734 | Ga0530510_0561834 | Ga0530510_0561834_29_673 | 214 |
| 890 | iso_pu_bacteria | 2751185846 | 2753566259 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jl4-assembly1.cif.gz_B | holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class | 0.9859 | 1 | 214 |
| 2jl4-assembly1.cif.gz_B | holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class | 0.9813 | 1 | 214 |
| 2cz2-assembly1.cif.gz_A-2 | crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal) | 0.9773 | 2 | 214 |
| 1fw1-assembly1.cif.gz_A-2 | glutathione transferase zeta/maleylacetoacetate isomerase | 0.9766 | 2 | 214 |
| 2cz3-assembly1.cif.gz_A | crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) | 0.9721 | 2 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VHD2_18_96_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9881 | 4 | 79 | 3.40.30.10 |
| 2v6kB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9796 | 4 | 79 | 3.40.30.10 |
| 2v6kB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9766 | 85 | 214 | 1.20.1050.10 |
| af_Q9SRY6_37_122_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9762 | 2 | 78 | 3.40.30.10 |
| 2cz2A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9732 | 4 | 79 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382PU28-F1-model_v4 | GST N-terminal domain-containing protein | 1.005 | 2 | 76 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A6P2GFS6-F1-model_v4 | Maleylacetoacetate isomerase | 0.9976 | 2 | 214 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A2VVB5-F1-model_v4 | deleted | 0.9968 | 2 | 214 |
|
| AF-A0A1F4LEH7-F1-model_v4 | Maleylacetoacetate isomerase | 0.9957 | 1 | 214 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A4R6F2N1-F1-model_v4 | Maleylacetoacetate isomerase | 0.9952 | 2 | 214 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar