F484840

General Info

Members Datasets Scaffolds Average Seq Length
890 592 1780 273

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2724679232|2725950431
Length 324
Sequence ALVVTGRVVQLTRNINPSMDFRVCGSFTFRSRDASLALSDREGAFMDQWAKFERLKALHQGDSAFVIPNPWDAGSARLLASLGFEALATTSAGYAFSKGKLDSFASLGRDEVLGNAAEIVGAADLPVSADLEDGFGASPETCAETIRLACETGLVGGSIEDATGNPAAPIYDLSQAVERIHAAAEAARGLPFLLTARAENYLWERPDLDDTIERLQAFSAAGADVLYAPGLPDIEAIRTVCGAVDKPVNVVMGLKGRKYSVAELSSAGVRRVSVGGSFARAALGALMRAAMEVKTTGTFEYADDALSAAFASQLMSREKRQDRL

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
116 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
117 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
181 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
183 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
209 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
210 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
239 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
240 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
241 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
242 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
243 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
244 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
245 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
246 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
247 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
248 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
249 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
262 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
263 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
307 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
308 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
321 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
345 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
346 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
347 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
348 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
351 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
352 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
355 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
362 2508501050 Microvirga lupini Lut6 Isolate Nodule
363 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
364 2509276019 Ensifer aridi TW10 Isolate Nodule
365 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
366 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
367 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
368 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
369 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
370 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
371 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
372 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
373 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
374 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
375 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
376 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
377 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
378 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
379 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
380 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
381 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
382 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
383 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
384 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
385 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
386 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
387 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
388 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
389 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
390 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
391 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
392 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
393 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
394 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
395 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
396 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
397 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
398 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
399 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
400 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
401 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
402 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
403 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
404 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
405 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
406 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
407 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
408 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
409 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
410 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
411 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
412 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
413 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
414 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
415 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
416 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
417 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
418 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
419 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
420 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
421 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
422 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
423 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
424 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
425 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
426 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
427 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
428 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
429 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
430 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
431 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
432 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
433 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
434 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
435 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
436 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
437 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
438 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
439 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
440 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
441 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
442 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
443 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
444 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
445 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
446 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
447 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
448 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
449 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
450 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
451 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
452 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
453 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
454 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
455 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
456 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
457 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
458 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
459 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
460 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
461 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
462 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
463 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
464 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
465 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
466 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
467 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
468 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
469 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
470 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
471 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
472 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
473 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
474 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
475 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
476 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
477 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
478 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
479 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
480 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
481 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
482 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
483 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
484 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
485 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
486 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
487 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
488 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
489 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
490 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
491 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
492 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
493 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
494 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
495 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
496 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
497 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
498 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
499 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
500 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
501 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
502 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
503 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
504 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
505 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
506 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
507 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
508 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
509 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
510 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
511 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
512 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
513 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
514 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
515 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
516 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
517 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
518 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
519 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
520 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
521 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
522 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
523 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
524 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
525 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
526 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
527 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
528 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
529 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
530 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
531 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
532 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
533 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
534 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
535 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
536 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
537 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
538 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
539 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
540 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
541 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
542 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
543 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
544 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
545 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
546 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
547 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
548 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
549 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
550 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
551 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
552 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
553 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
554 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
555 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
556 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
557 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
558 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
559 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
560 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
561 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
562 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
563 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
564 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
565 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
566 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
567 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
568 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
569 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
570 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
571 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
572 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
573 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
574 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
575 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
576 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
577 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
578 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
579 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
580 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
581 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
582 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
583 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
584 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
585 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
586 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
587 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
588 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
589 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
590 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
591 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
592 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.48
Metatranscriptomes 0.22
Isolates 26.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 4.94
Nodule 25.96
Rhizoplane 3.48
Rhizosphere 61.46
Stem 0
Stem Tuber 0
Unclassified 6.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4814100 2162886011 Unclassified 2044
2 JGI24739J22299_10074399 3300001989 Bacteria 1052
3 JGI25152J39213_1001379 3300002773 Bacteria 10569
4 JGI25159J45721_1002718 3300002987 Bacteria 6567
5 JGI25153J46596_10005213 3300003215 Bacteria 6840
6 JGI25160J50197_1011066 3300003354 Bacteria 3222
7 JGI25161J50226_1000135 3300003374 Bacteria 51243
8 Ga0055526_1011006 3300003771 Bacteria 4133
9 Ga0055526_1015878 3300003771 Bacteria 2991
10 Ga0055524_1003219 3300003775 Bacteria 8006
11 Ga0055524_1013765 3300003775 Bacteria 3034
12 Ga0055528_1000146 3300003790 Bacteria 57915
13 Ga0055540_1001984 3300003792 Bacteria 11439
14 Ga0055543_1000219 3300004625 Bacteria 45978
15 Ga0065712_10070147 3300005290 Bacteria 6288
16 Ga0065715_10150790 3300005293 Bacteria 1731
17 Ga0070658_10059229 3300005327 Bacteria 3118
18 Ga0070658_10127031 3300005327 Bacteria 2123
19 Ga0070683_100002695 3300005329 Bacteria 14195
20 Ga0070683_100004805 3300005329 Bacteria 11185
21 Ga0070683_100157135 3300005329 Bacteria 2157
22 Ga0070683_100217491 3300005329 Unclassified 1816
23 Ga0070690_100075700 3300005330 Bacteria 2194
24 Ga0070670_100004072 3300005331 Bacteria 12208
25 Ga0070670_100005834 3300005331 Bacteria 10409
26 Ga0070670_100151521 3300005331 Bacteria 2007
27 Ga0068869_100080353 3300005334 Bacteria 2432
28 Ga0068869_100168637 3300005334 Bacteria 1709
29 Ga0070666_10032779 3300005335 Bacteria 3433
30 Ga0070666_10092403 3300005335 Bacteria 2080
31 Ga0070666_10113052 3300005335 Bacteria 1879
32 Ga0070680_100015306 3300005336 Bacteria 6011
33 Ga0070680_100196141 3300005336 Unclassified 1702
34 Ga0068868_100007450 3300005338 Bacteria 7793
35 Ga0068868_100058374 3300005338 Bacteria 3050
36 Ga0068868_100215275 3300005338 Bacteria 1607
37 Ga0068868_100338096 3300005338 Bacteria 1287
38 Ga0070689_100238480 3300005340 Bacteria 1497
39 Ga0070661_100001119 3300005344 Bacteria 18814
40 Ga0070661_100006475 3300005344 Bacteria 8076
41 Ga0070661_100013820 3300005344 Bacteria 5673
42 Ga0070668_100016595 3300005347 Bacteria 5504
43 Ga0070669_100090068 3300005353 Bacteria 2299
44 Ga0070669_100169885 3300005353 Bacteria 1699
45 Ga0070669_100242503 3300005353 Bacteria 1432
46 Ga0070669_100375794 3300005353 Bacteria 1158
47 Ga0070675_100054304 3300005354 Bacteria 3296
48 Ga0070675_100067740 3300005354 Bacteria 2954
49 Ga0070675_100166580 3300005354 Bacteria 1898
50 Ga0070671_100000908 3300005355 Bacteria 21598
51 Ga0070671_100059497 3300005355 Bacteria 3180
52 Ga0070671_100102853 3300005355 Unclassified 2397
53 Ga0070671_100573807 3300005355 Bacteria 974
54 Ga0070673_100061478 3300005364 Bacteria 2980
55 Ga0070688_100093000 3300005365 Bacteria 1974
56 Ga0070688_100257552 3300005365 Bacteria 1245
57 Ga0070667_100194085 3300005367 Unclassified 1800
58 Ga0070709_10044943 3300005434 Bacteria 2738
59 Ga0070714_100403819 3300005435 Unclassified 1292
60 Ga0070714_100416739 3300005435 Unclassified 1272
61 Ga0070713_100062186 3300005436 Bacteria 3126
62 Ga0070701_10278130 3300005438 Bacteria 1021
63 Ga0070711_100052725 3300005439 Bacteria 2800
64 Ga0070711_100141298 3300005439 Bacteria 1806
65 Ga0070711_100215393 3300005439 Bacteria 1490
66 Ga0070705_100082341 3300005440 Bacteria 1980
67 Ga0070705_100142997 3300005440 Bacteria 1577
68 Ga0070694_100101955 3300005444 Unclassified 2031
69 Ga0070708_100028821 3300005445 Bacteria 4781
70 Ga0070663_100167437 3300005455 Bacteria 1696
71 Ga0070678_100032190 3300005456 Bacteria 3627
72 Ga0070678_100092963 3300005456 Bacteria 2318
73 Ga0070662_100023428 3300005457 Bacteria 4241
74 Ga0070662_100335992 3300005457 Bacteria 1235
75 Ga0070681_10023869 3300005458 Bacteria 6157
76 Ga0070681_10062901 3300005458 Unclassified 3684
77 Ga0070681_10163020 3300005458 Unclassified 2153
78 Ga0070681_10288030 3300005458 Unclassified 1553
79 Ga0068867_100018888 3300005459 Bacteria 4906
80 Ga0068867_100147545 3300005459 Bacteria 1845
81 Ga0070685_10142325 3300005466 Bacteria 1511
82 Ga0070706_100097355 3300005467 Unclassified 2733
83 Ga0070699_100062623 3300005518 Bacteria 3224
84 Ga0070684_100012173 3300005535 Bacteria 6881
85 Ga0070684_100024603 3300005535 Bacteria 5053
86 Ga0070684_100121768 3300005535 Bacteria 2347
87 Ga0070697_100007343 3300005536 Bacteria 8574
88 Ga0068853_100010208 3300005539 Bacteria 7592
89 Ga0068853_100017461 3300005539 Bacteria 5922
90 Ga0070686_100011132 3300005544 Bacteria 5096
91 Ga0070695_100022081 3300005545 Bacteria 3900
92 Ga0070696_100017498 3300005546 Bacteria 4838
93 Ga0070696_100267545 3300005546 Bacteria 1299
94 Ga0070665_100017875 3300005548 Bacteria 7119
95 Ga0070665_100021730 3300005548 Bacteria 6452
96 Ga0070665_100022430 3300005548 Bacteria 6353
97 Ga0070665_100206764 3300005548 Bacteria 1964
98 Ga0070665_100294832 3300005548 Bacteria 1624
99 Ga0070665_100451389 3300005548 Bacteria 1295
100 Ga0070665_100476542 3300005548 Bacteria 1259
101 Ga0070665_100519333 3300005548 Bacteria 1202
102 Ga0070704_100254864 3300005549 Bacteria 1443
103 Ga0068855_100008914 3300005563 Bacteria 12128
104 Ga0068855_100069122 3300005563 Unclassified 4110
105 Ga0068855_100112392 3300005563 Bacteria 3126
106 Ga0068855_100542874 3300005563 Bacteria 1259
107 Ga0068855_100805843 3300005563 Bacteria 998
108 Ga0070664_100000556 3300005564 Bacteria 28544
109 Ga0070664_100000879 3300005564 Bacteria 23312
110 Ga0070664_100023083 3300005564 Bacteria 5134
111 Ga0068857_100000022 3300005577 Bacteria 87864
112 Ga0068857_100147687 3300005577 Bacteria 2128
113 Ga0068856_100002645 3300005614 Bacteria 18368
114 Ga0068856_100006341 3300005614 Bacteria 11601
115 Ga0070702_100030161 3300005615 Bacteria 2954
116 Ga0068852_100049754 3300005616 Bacteria 3587
117 Ga0068859_100000885 3300005617 Bacteria 30517
118 Ga0068859_100073587 3300005617 Bacteria 3455
119 Ga0068859_101102114 3300005617 Bacteria 873
120 Ga0068864_100001248 3300005618 Bacteria 21136
121 Ga0068864_100006516 3300005618 Bacteria 9568
122 Ga0068864_100253041 3300005618 Bacteria 1636
123 Ga0068866_10000934 3300005718 Bacteria 12833
124 Ga0068866_10038645 3300005718 Bacteria 2351
125 Ga0068861_100018332 3300005719 Bacteria 4986
126 Ga0068851_10012476 3300005834 Bacteria 4008
127 Ga0068863_100020260 3300005841 Bacteria 6361
128 Ga0068863_100049604 3300005841 Bacteria 3980
129 Ga0068863_100834312 3300005841 Bacteria 920
130 Ga0068858_100001352 3300005842 Bacteria 25271
131 Ga0068858_100274041 3300005842 Bacteria 1606
132 Ga0068860_100026095 3300005843 Bacteria 5636
133 Ga0068860_100027246 3300005843 Bacteria 5505
134 Ga0068860_100253170 3300005843 Bacteria 1715
135 Ga0068860_100572971 3300005843 Bacteria 1132
136 Ga0068862_100007797 3300005844 Bacteria 8854
137 Ga0068862_100286293 3300005844 Bacteria 1512
138 Ga0068862_100301000 3300005844 Bacteria 1475
139 Ga0068862_100555690 3300005844 Bacteria 1097
140 Ga0081540_1007236 3300005983 Bacteria 7954
141 Ga0070717_10000011 3300006028 Bacteria 233981
142 Ga0070717_10004825 3300006028 Bacteria 9811
143 Ga0070717_10032461 3300006028 Bacteria 4208
144 Ga0070717_10073474 3300006028 Unclassified 2858
145 Ga0070712_100087692 3300006175 Bacteria 2271
146 Ga0075367_10073184 3300006178 Bacteria 2064
147 Ga0097621_100033399 3300006237 Bacteria 4098
148 Ga0097621_100106027 3300006237 Bacteria 2370
149 Ga0097621_100237606 3300006237 Bacteria 1592
150 Ga0068871_100004926 3300006358 Bacteria 9330
151 Ga0068871_100179612 3300006358 Bacteria 1818
152 Ga0075428_100000826 3300006844 Bacteria 32409
153 Ga0075428_100202338 3300006844 Bacteria 2146
154 Ga0075428_100296398 3300006844 Bacteria 1739
155 Ga0075428_100827600 3300006844 Bacteria 983
156 Ga0075430_100058015 3300006846 Bacteria 3255
157 Ga0075431_100006755 3300006847 Bacteria 11395
158 Ga0075431_100019355 3300006847 Bacteria 6938
159 Ga0075431_100063391 3300006847 Unclassified 3814
160 Ga0075431_100164859 3300006847 Bacteria 2278
161 Ga0075433_10127024 3300006852 Bacteria 2265
162 Ga0075434_100000439 3300006871 Bacteria 30907
163 Ga0075434_100006149 3300006871 Bacteria 10990
164 Ga0075429_100175090 3300006880 Bacteria 1880
165 Ga0075429_100538602 3300006880 Bacteria 1023
166 Ga0068865_100061129 3300006881 Bacteria 2640
167 Ga0068865_100063822 3300006881 Bacteria 2590
168 Ga0097620_100000885 3300006931 Bacteria 30517
169 Ga0097620_100073588 3300006931 Bacteria 3455
170 Ga0097620_101101870 3300006931 Bacteria 873
171 Ga0079104_1005573 3300006946 Bacteria 4989
172 Ga0075435_100050324 3300007076 Bacteria 3352
173 Ga0075435_100094798 3300007076 Bacteria 2468
174 Ga0099795_10111310 3300007788 Bacteria 1085
175 Ga0105240_10395740 3300009093 Bacteria 1557
176 Ga0105240_10939827 3300009093 Unclassified 928
177 Ga0111539_10008178 3300009094 Bacteria 13323
178 Ga0111539_10578871 3300009094 Bacteria 1307
179 Ga0105245_10024451 3300009098 Bacteria 5304
180 Ga0105245_10063118 3300009098 Bacteria 3345
181 Ga0114129_10003465 3300009147 Bacteria 22180
182 Ga0114129_10089264 3300009147 Unclassified 4273
183 Ga0114129_10300751 3300009147 Bacteria 2138
184 Ga0114129_10578536 3300009147 Bacteria 1457
185 Ga0114129_11263266 3300009147 Unclassified 917
186 Ga0105243_10025509 3300009148 Bacteria 4518
187 Ga0105241_10013232 3300009174 Bacteria 6047
188 Ga0105241_10358394 3300009174 Bacteria 1268
189 Ga0105242_10023937 3300009176 Bacteria 4818
190 Ga0105242_10272732 3300009176 Bacteria 1533
191 Ga0105248_10066168 3300009177 Bacteria 4058
192 Ga0105248_10100679 3300009177 Bacteria 3256
193 Ga0105248_10127018 3300009177 Bacteria 2876
194 Ga0105248_10264948 3300009177 Bacteria 1934
195 Ga0105248_10399661 3300009177 Bacteria 1547
196 Ga0105248_10779464 3300009177 Unclassified 1079
197 Ga0105237_10090960 3300009545 Bacteria 3041
198 Ga0105237_10156792 3300009545 Bacteria 2274
199 Ga0105237_10420350 3300009545 Unclassified 1342
200 Ga0105238_10160875 3300009551 Bacteria 2221
201 Ga0105249_10000698 3300009553 Bacteria 30441
202 Ga0105249_10046616 3300009553 Unclassified 3945
203 Ga0123341_1005631 3300009765 Bacteria 11195
204 Ga0105239_10021438 3300010375 Bacteria 7124
205 Ga0105239_10022430 3300010375 Bacteria 6959
206 Ga0105246_10434006 3300011119 Bacteria 1100
207 Ga0157371_10001847 3300013102 Bacteria 21300
208 Ga0157370_10045797 3300013104 Unclassified 4196
209 Ga0157370_10121639 3300013104 Unclassified 2437
210 Ga0157369_10003626 3300013105 Bacteria 18322
211 Ga0157369_10032560 3300013105 Bacteria 5732
212 Ga0157369_10047695 3300013105 Bacteria 4649
213 Ga0157369_10238850 3300013105 Unclassified 1898
214 Ga0157374_10000701 3300013296 Bacteria 29492
215 Ga0157374_10160124 3300013296 Bacteria 2192
216 Ga0157378_10000030 3300013297 Bacteria 124811
217 Ga0157378_10057231 3300013297 Bacteria 3474
218 Ga0157378_10212093 3300013297 Bacteria 1837
219 Ga0163162_10279278 3300013306 Bacteria 1802
220 Ga0163162_10844417 3300013306 Bacteria 1031
221 Ga0157372_10161472 3300013307 Bacteria 2590
222 Ga0157372_10378876 3300013307 Bacteria 1649
223 Ga0157372_11117942 3300013307 Bacteria 911
224 Ga0157375_10083948 3300013308 Bacteria 3232
225 Ga0157375_10589205 3300013308 Bacteria 1272
226 Ga0163163_10017541 3300014325 Bacteria 6679
227 Ga0163163_10022603 3300014325 Bacteria 5960
228 Ga0163163_10148862 3300014325 Bacteria 2385
229 Ga0163163_10243787 3300014325 Bacteria 1847
230 Ga0163163_10517325 3300014325 Bacteria 1256
231 Ga0157379_10044124 3300014968 Bacteria 3980
232 Ga0157379_10069209 3300014968 Bacteria 3156
233 Ga0157379_10086856 3300014968 Bacteria 2804
234 Ga0157376_10014054 3300014969 Bacteria 5994
235 Ga0157376_10023547 3300014969 Bacteria 4821
236 Ga0157376_10124389 3300014969 Bacteria 2291
237 Ga0157376_10254902 3300014969 Unclassified 1641
238 Ga0214543_1000022 3300021327 Bacteria 241930
239 Ga0213872_10000308 3300021361 Bacteria 41753
240 Ga0213872_10125863 3300021361 Bacteria 1131
241 Ga0228711_1000026 3300022739 Bacteria 101497
242 Ga0228710_1000005 3300022740 Bacteria 233531
243 Ga0209436_100059 3300025208 Bacteria 60623
244 Ga0209563_102009 3300025230 Bacteria 4867
245 Ga0209129_1001566 3300025258 Bacteria 12551
246 Ga0209673_1000015 3300025273 Bacteria 530618
247 Ga0209673_1005236 3300025273 Bacteria 6605
248 Ga0209130_1000004 3300025284 Bacteria 633436
249 Ga0209676_1016691 3300025292 Bacteria 2636
250 Ga0209564_1000362 3300025295 Bacteria 84376
251 Ga0209564_1020419 3300025295 Bacteria 2426
252 Ga0209758_1000770 3300025297 Bacteria 46037
253 Ga0209256_1000531 3300025299 Bacteria 55283
254 Ga0209256_1003465 3300025299 Bacteria 11036
255 Ga0207426_1000003 3300025302 Bacteria 1063212
256 Ga0209051_1004215 3300025303 Bacteria 8971
257 Ga0209257_1031412 3300025304 Bacteria 1698
258 Ga0207697_10079247 3300025315 Bacteria 1383
259 Ga0207656_10014601 3300025321 Bacteria 3030
260 Ga0207642_10002317 3300025899 Bacteria 5936
261 Ga0207642_10275216 3300025899 Bacteria 966
262 Ga0207680_10124406 3300025903 Unclassified 1691
263 Ga0207647_10006332 3300025904 Bacteria 8611
264 Ga0207647_10035739 3300025904 Bacteria 3164
265 Ga0207699_10194992 3300025906 Unclassified 1369
266 Ga0207645_10117483 3300025907 Bacteria 1725
267 Ga0207643_10015769 3300025908 Bacteria 4116
268 Ga0207654_10329286 3300025911 Bacteria 1046
269 Ga0207707_10009181 3300025912 Bacteria 8584
270 Ga0207707_10070622 3300025912 Unclassified 3043
271 Ga0207695_10093562 3300025913 Bacteria 3015
272 Ga0207695_10286229 3300025913 Bacteria 1541
273 Ga0207693_10002038 3300025915 Bacteria 17722
274 Ga0207693_10051387 3300025915 Bacteria 3234
275 Ga0207663_10111024 3300025916 Bacteria 1860
276 Ga0207663_10182009 3300025916 Bacteria 1502
277 Ga0207660_10010325 3300025917 Bacteria 6057
278 Ga0207660_10023871 3300025917 Bacteria 4135
279 Ga0207660_10377041 3300025917 Bacteria 1140
280 Ga0207662_10077057 3300025918 Bacteria 2028
281 Ga0207649_10006359 3300025920 Bacteria 6418
282 Ga0207649_10078073 3300025920 Bacteria 2135
283 Ga0207652_10136934 3300025921 Bacteria 2187
284 Ga0207681_10013044 3300025923 Bacteria 5138
285 Ga0207681_10425767 3300025923 Bacteria 1076
286 Ga0207694_10008333 3300025924 Bacteria 7837
287 Ga0207650_10013004 3300025925 Bacteria 5757
288 Ga0207650_10016659 3300025925 Bacteria 5138
289 Ga0207650_10032551 3300025925 Bacteria 3771
290 Ga0207650_10206098 3300025925 Bacteria 1577
291 Ga0207659_10074664 3300025926 Bacteria 2485
292 Ga0207659_10087848 3300025926 Bacteria 2315
293 Ga0207687_10058384 3300025927 Bacteria 2714
294 Ga0207687_10156751 3300025927 Bacteria 1743
295 Ga0207687_10183633 3300025927 Bacteria 1622
296 Ga0207644_10043406 3300025931 Bacteria 3190
297 Ga0207706_10019986 3300025933 Bacteria 6018
298 Ga0207686_10190639 3300025934 Bacteria 1461
299 Ga0207709_10009843 3300025935 Bacteria 5266
300 Ga0207670_10157568 3300025936 Bacteria 1691
301 Ga0207704_10071993 3300025938 Bacteria 2195
302 Ga0207665_10004737 3300025939 Bacteria 9042
303 Ga0207691_10117102 3300025940 Bacteria 2364
304 Ga0207711_10063777 3300025941 Bacteria 3182
305 Ga0207711_10072827 3300025941 Bacteria 2985
306 Ga0207711_10159374 3300025941 Bacteria 2041
307 Ga0207711_10628763 3300025941 Bacteria 1002
308 Ga0207689_10052043 3300025942 Bacteria 3375
309 Ga0207689_10068266 3300025942 Bacteria 2922
310 Ga0207689_10107825 3300025942 Bacteria 2289
311 Ga0207661_10019180 3300025944 Bacteria 5094
312 Ga0207679_10000782 3300025945 Bacteria 20829
313 Ga0207679_10023294 3300025945 Bacteria 4231
314 Ga0207679_10101337 3300025945 Bacteria 2252
315 Ga0207667_10002360 3300025949 Bacteria 23658
316 Ga0207667_10218866 3300025949 Unclassified 1951
317 Ga0207667_10400579 3300025949 Bacteria 1397
318 Ga0207667_10635257 3300025949 Bacteria 1074
319 Ga0207651_10023907 3300025960 Bacteria 3769
320 Ga0207712_10181207 3300025961 Unclassified 1655
321 Ga0207668_10263335 3300025972 Bacteria 1406
322 Ga0207640_10054713 3300025981 Bacteria 2610
323 Ga0207658_10085552 3300025986 Bacteria 2429
324 Ga0207658_10096397 3300025986 Bacteria 2307
325 Ga0207677_10051150 3300026023 Bacteria 2799
326 Ga0207677_10057370 3300026023 Bacteria 2673
327 Ga0207677_10065596 3300026023 Bacteria 2534
328 Ga0207677_10324683 3300026023 Bacteria 1280
329 Ga0207703_10001842 3300026035 Bacteria 18897
330 Ga0207703_10083246 3300026035 Bacteria 2673
331 Ga0207703_10140678 3300026035 Bacteria 2094
332 Ga0207703_10277023 3300026035 Bacteria 1522
333 Ga0207639_10000904 3300026041 Bacteria 20095
334 Ga0207639_10271507 3300026041 Unclassified 1488
335 Ga0207639_10275785 3300026041 Bacteria 1477
336 Ga0207678_10010778 3300026067 Bacteria 8031
337 Ga0207702_10007270 3300026078 Bacteria 9471
338 Ga0207702_10263938 3300026078 Unclassified 1622
339 Ga0207702_10491344 3300026078 Unclassified 1196
340 Ga0207641_10005054 3300026088 Bacteria 11304
341 Ga0207641_10038665 3300026088 Bacteria 3989
342 Ga0207641_10130343 3300026088 Bacteria 2257
343 Ga0207641_10286670 3300026088 Unclassified 1551
344 Ga0207648_10158851 3300026089 Bacteria 1996
345 Ga0207648_10262864 3300026089 Bacteria 1540
346 Ga0207676_10003718 3300026095 Bacteria 10792
347 Ga0207676_10079112 3300026095 Bacteria 2665
348 Ga0207674_10000056 3300026116 Bacteria 113265
349 Ga0207674_10012060 3300026116 Bacteria 9680
350 Ga0207674_10039013 3300026116 Bacteria 4926
351 Ga0207674_10314678 3300026116 Unclassified 1515
352 Ga0207675_100058561 3300026118 Bacteria 3595
353 Ga0207698_10151994 3300026142 Unclassified 2011
354 Ga0209281_1000082 3300027111 Bacteria 257684
355 Ga0209281_1000380 3300027111 Bacteria 70330
356 Ga0209968_1000788 3300027526 Bacteria 4893
357 Ga0209282_1000006 3300027666 Bacteria 276998
358 Ga0209966_1000126 3300027695 Bacteria 33281
359 Ga0207428_10004213 3300027907 Bacteria 13767
360 Ga0207428_10019704 3300027907 Bacteria 5748
361 Ga0268266_10081017 3300028379 Bacteria 2829
362 Ga0268266_10369729 3300028379 Bacteria 1350
363 Ga0268265_10044120 3300028380 Bacteria 3318
364 Ga0268265_10053484 3300028380 Bacteria 3059
365 Ga0268265_10114329 3300028380 Bacteria 2210
366 Ga0268264_10030959 3300028381 Bacteria 4387
367 Ga0268264_10181083 3300028381 Bacteria 1914
368 Ga0268264_10267563 3300028381 Bacteria 1595
369 Ga0265334_10037246 3300028573 Bacteria 1918
370 Ga0307517_10222486 3300028786 Bacteria 1145
371 Ga0265338_10045055 3300028800 Bacteria 4062
372 Ga0265338_10052663 3300028800 Bacteria 3649
373 Ga0265338_10059379 3300028800 Bacteria 3369
374 Ga0265760_10041314 3300031090 Unclassified 1375
375 Ga0265330_10043720 3300031235 Bacteria 1981
376 Ga0265332_10002092 3300031238 Bacteria 10375
377 Ga0265325_10006286 3300031241 Bacteria 7229
378 Ga0265339_10001947 3300031249 Bacteria 15168
379 Ga0265339_10053039 3300031249 Bacteria 2206
380 Ga0265327_10045951 3300031251 Unclassified 2316
381 Ga0307509_10000167 3300031507 Bacteria 103177
382 Ga0307408_100055519 3300031548 Bacteria 2868
383 Ga0307408_100139608 3300031548 Bacteria 1901
384 Ga0265313_10000032 3300031595 Bacteria 128964
385 Ga0265314_10052997 3300031711 Unclassified 2816
386 Ga0265314_10065309 3300031711 Bacteria 2458
387 Ga0307516_10073147 3300031730 Bacteria 3285
388 Ga0307405_10084795 3300031731 Bacteria 2081
389 Ga0307410_10034561 3300031852 Bacteria 3275
390 Ga0307412_10144973 3300031911 Bacteria 1744
391 Ga0315914_1000003 3300031967 Bacteria 314370
392 Ga0307416_100165615 3300032002 Bacteria 2050
393 Ga0307411_10137580 3300032005 Bacteria 1796
394 Ga0315913_1000001 3300033430 Bacteria 284459
395 Ga0315915_1000008 3300033464 Bacteria 258517
396 Ga0373958_0001570 3300034819 Bacteria 3092
397 Ga0373938_0016519 3300034957 Unclassified 1443
398 Ga0373952_0011356 3300035092 Archaea 1737
399 Ga0373923_0017991 3300035111 Bacteria 2712
400 Ga0373939_0017103 3300035114 Bacteria 1922
401 Ga0373941_0051738 3300035115 Bacteria 1308
402 Ga0373954_0216400 3300035118 Bacteria 942
403 Ga0373956_0109895 3300035119 Unclassified 1283
404 Ga0373960_0013782 3300035121 Unclassified 2035
405 Ga0373960_0039365 3300035121 Unclassified 1359
406 Ga0373943_0049734 3300035170 Unclassified 2058
407 Ga0373955_0007434 3300035172 Bacteria 5039
408 Ga0373955_0080410 3300035172 Unclassified 1841
409 Ga0373961_0008058 3300035241 Bacteria 2557
410 Ga0373962_0008332 3300035242 Bacteria 2549
411 Ga0373931_0020650 3300035691 Bacteria 3297
412 Ga0373931_0053366 3300035691 Bacteria 2157
413 Ga0373935_0213751 3300035692 Unclassified 1337
414 Ga0373927_0001321 3300035695 Bacteria 18726
415 Ga0373927_0008143 3300035695 Bacteria 7070
416 Ga0373927_0030817 3300035695 Bacteria 3499
417 Ga0373933_0000757 3300035724 Bacteria 19803
418 Ga0373937_0000170 3300036401 Bacteria 63587
419 Ga0373937_0143365 3300036401 Bacteria 2235
420 Ga0373925_0001239 3300037068 Bacteria 22519
421 Ga0373925_0076717 3300037068 Unclassified 2535
422 Ga0395899_0000114 3300037312 Bacteria 134621
423 Ga0395900_0000154 3300037418 Bacteria 113757
424 Ga0395898_0000308 3300037466 Bacteria 113757
425 Ga0395905_0000153 3300037471 Bacteria 113757
426 Ga0436364_0227810 3300037853 Unclassified 2737
427 Ga0436364_0363407 3300037853 Bacteria 6090
428 Ga0436364_0797891 3300037853 Bacteria 5198
429 Ga0395901_0000107 3300038443 Bacteria 113757
430 Ga0436360_1353299 3300039438 Bacteria 55854
431 Ga0436361_0779674 3300039447 Bacteria 61407
432 Ga0436363_0891872 3300039450 Bacteria 1161
433 Ga0451833_1416838 3300041491 Bacteria 2779
434 Ga0451835_0147460 3300041492 Bacteria 6474
435 Ga0451837_1095128 3300041494 Bacteria 896
436 Ga0451839_1277233 3300041496 Bacteria 1719
437 Ga0451841_0182318 3300041498 Bacteria 2709
438 Ga0451841_0992348 3300041498 Bacteria 3115
439 Ga0451846_31560 3300041502 Bacteria 1092
440 Ga0451847_0679858 3300041503 Bacteria 1741
441 Ga0451849_0143547 3300041505 Bacteria 4822
442 Ga0451849_1092803 3300041505 Bacteria 2202
443 Ga0451851_0368784 3300041507 Bacteria 2326
444 Ga0451843_0425783 3300041509 Bacteria 2187
445 Ga0451855_0035447 3300041511 Bacteria 3441
446 Ga0451853_3048143 3300041512 Bacteria 2895
447 Ga0451577_0742250 3300042876 Bacteria 888
448 Ga0466969_0098723 3300044656 Bacteria 1377
449 Ga0466969_0162337 3300044656 Bacteria 1026
450 Ga0466966_0010031 3300044684 Bacteria 6278
451 Ga0466966_0314260 3300044684 Bacteria 941
452 Ga0466961_0004730 3300044693 Bacteria 8566
453 Ga0466961_0014799 3300044693 Bacteria 5012
454 Ga0466971_0074443 3300044719 Bacteria 1544
455 Ga0466968_0018836 3300044735 Bacteria 2772
456 Ga0466959_0011945 3300045049 Bacteria 6261
457 Ga0466967_0127601 3300045976 Bacteria 2358
458 Ga0495629_0021941 3300046459 Bacteria 4556
459 Ga0495638_0000879 3300046460 Bacteria 30963
460 Ga0495651_0001720 3300046462 Bacteria 16894
461 Ga0495605_0014270 3300046474 Bacteria 4355
462 Ga0495620_0036671 3300046515 Bacteria 2192
463 Ga0495631_0032990 3300046518 Unclassified 2329
464 Ga0495643_0029950 3300046522 Bacteria 3043
465 Ga0495652_0022006 3300046529 Bacteria 5664
466 Ga0495665_0026176 3300046531 Unclassified 3134
467 Ga0495587_0001357 3300046536 Bacteria 16248
468 Ga0495667_0182419 3300046559 Bacteria 1347
469 Ga0495667_0242060 3300046559 Unclassified 1149
470 Ga0495668_0165612 3300046616 Bacteria 1211
471 Ga0495611_0007891 3300046648 Bacteria 4518
472 Ga0495625_0164966 3300046660 Bacteria 1482
473 Ga0495625_0208533 3300046660 Unclassified 1285
474 Ga0495599_0130665 3300046678 Bacteria 1559
475 Ga0495623_0020240 3300046679 Bacteria 4301
476 Ga0495623_0037457 3300046679 Bacteria 3103
477 Ga0495658_0029561 3300046683 Unclassified 2969
478 Ga0495613_0063869 3300046689 Bacteria 2693
479 Ga0495649_0229578 3300046694 Bacteria 958
480 Ga0495660_0136678 3300046810 Unclassified 1224
481 Ga0495604_0042654 3300047317 Bacteria 3554
482 Ga0495636_0012346 3300047318 Bacteria 3382
483 Ga0495680_0118729 3300047322 Bacteria 1954
484 Ga0495687_018769 3300047443 Bacteria 3410
485 Ga0495675_0001588 3300047444 Bacteria 13680
486 Ga0495675_0099040 3300047444 Bacteria 1826
487 Ga0495684_0004935 3300047471 Bacteria 10417
488 Ga0495686_0002349 3300047472 Bacteria 18053
489 Ga0495602_0000454 3300048088 Bacteria 38246
490 Ga0495602_0050592 3300048088 Bacteria 3711
491 Ga0495626_0134360 3300048091 Bacteria 1054
492 Ga0496101_0070587 3300048904 Bacteria 2558
493 Ga0496101_0218432 3300048904 Bacteria 1479
494 Ga0496102_0065260 3300048905 Unclassified 3336
495 Ga0496102_0184606 3300048905 Bacteria 1965
496 Ga0496103_0063601 3300048906 Bacteria 2299
497 Ga0496104_0003039 3300048907 Bacteria 14448
498 Ga0496104_0083256 3300048907 Bacteria 3051
499 Ga0496105_0004740 3300048908 Bacteria 10264
500 Ga0496105_0055801 3300048908 Bacteria 3261
501 Ga0496105_0106563 3300048908 Bacteria 2314
502 Ga0496106_0026698 3300048909 Bacteria 4300
503 Ga0496106_0057038 3300048909 Bacteria 2953
504 Ga0496108_0002286 3300048911 Bacteria 15349
505 Ga0496108_0007401 3300048911 Bacteria 8903
506 Ga0496108_0096737 3300048911 Bacteria 2515
507 Ga0496108_0236380 3300048911 Bacteria 1589
508 Ga0496109_0000608 3300048912 Bacteria 29912
509 Ga0496109_0062805 3300048912 Bacteria 3397
510 Ga0496109_0464587 3300048912 Bacteria 1195
511 Ga0496110_0000743 3300048913 Bacteria 22519
512 Ga0496110_0298350 3300048913 Bacteria 1468
513 Ga0496111_0009935 3300048914 Bacteria 6363
514 Ga0496111_0030809 3300048914 Bacteria 3816
515 Ga0496111_0352744 3300048914 Bacteria 1089
516 Ga0496111_0445422 3300048914 Bacteria 956
517 Ga0496112_0007564 3300048915 Bacteria 9650
518 Ga0496112_0034275 3300048915 Bacteria 4939
519 Ga0496112_0173501 3300048915 Bacteria 2121
520 Ga0496113_0050727 3300048916 Bacteria 3095
521 Ga0496113_0149033 3300048916 Bacteria 1845
522 Ga0496115_0072201 3300048918 Bacteria 2800
523 Ga0496117_0081420 3300048920 Bacteria 2125
524 Ga0496118_0036544 3300048921 Bacteria 3969
525 Ga0496122_0042147 3300048925 Bacteria 3595
526 Ga0496123_0134855 3300048926 Bacteria 1360
527 Ga0496124_0055603 3300048927 Bacteria 3344
528 Ga0496125_0004376 3300048928 Bacteria 16353
529 Ga0495678_028643 3300049459 Unclassified 2348
530 Ga0501299_019699 3300049522 Bacteria 1223
531 Ga0501031_0000002 3300049568 Bacteria 217588
532 Ga0501031_0060593 3300049568 Bacteria 2466
533 Ga0501032_0000004 3300049569 Bacteria 310855
534 Ga0501032_0000339 3300049569 Bacteria 39056
535 Ga0501032_0000663 3300049569 Bacteria 27949
536 Ga0501032_0050471 3300049569 Bacteria 2806
537 Ga0501032_0231981 3300049569 Bacteria 1200
538 Ga0501033_0000016 3300049570 Bacteria 217458
539 Ga0501033_0000461 3300049570 Bacteria 38633
540 Ga0501033_0003180 3300049570 Bacteria 13625
541 Ga0501033_0044672 3300049570 Bacteria 3298
542 Ga0501033_0056276 3300049570 Bacteria 2907
543 Ga0501033_0069595 3300049570 Bacteria 2586
544 Ga0501033_0219713 3300049570 Bacteria 1353
545 Ga0501034_0000011 3300049571 Bacteria 310855
546 Ga0501034_0266456 3300049571 Bacteria 1655
547 Ga0501034_0272307 3300049571 Bacteria 1634
548 Ga0501036_0000001 3300049572 Bacteria 310855
549 Ga0501036_0039135 3300049572 Bacteria 4015
550 Ga0501036_0043569 3300049572 Bacteria 3801
551 Ga0501036_0340208 3300049572 Bacteria 1253
552 Ga0501036_0515109 3300049572 Bacteria 995
553 Ga0501037_0000006 3300049573 Bacteria 217461
554 Ga0501037_0000154 3300049573 Bacteria 64077
555 Ga0501037_0017618 3300049573 Bacteria 5258
556 Ga0501037_0185572 3300049573 Bacteria 1474
557 Ga0501037_0427733 3300049573 Bacteria 906
558 Ga0501038_0000003 3300049574 Bacteria 310855
559 Ga0501038_0206463 3300049574 Bacteria 1574
560 Ga0501038_0257589 3300049574 Bacteria 1380
561 Ga0501039_0000004 3300049575 Bacteria 310855
562 Ga0501040_0003086 3300049576 Bacteria 10804
563 Ga0501043_0000007 3300049579 Bacteria 224595
564 Ga0501043_0000478 3300049579 Bacteria 35744
565 Ga0501043_0023131 3300049579 Bacteria 4875
566 Ga0501043_0069789 3300049579 Bacteria 2760
567 Ga0501043_0200009 3300049579 Bacteria 1551
568 Ga0501046_0019669 3300049580 Bacteria 5595
569 Ga0501046_0076799 3300049580 Bacteria 2587
570 Ga0501047_0002317 3300049581 Bacteria 18214
571 Ga0501047_0005872 3300049581 Bacteria 11554
572 Ga0501047_0011241 3300049581 Bacteria 8472
573 Ga0501047_0013903 3300049581 Bacteria 7644
574 Ga0501047_0058978 3300049581 Bacteria 3707
575 Ga0501047_0289763 3300049581 Bacteria 1481
576 Ga0501068_0084225 3300049584 Bacteria 1955
577 Ga0501069_0000027 3300049585 Bacteria 106217
578 Ga0501069_0002114 3300049585 Bacteria 10005
579 Ga0501070_0000231 3300049586 Bacteria 52768
580 Ga0501070_0002642 3300049586 Bacteria 15642
581 Ga0501070_0011230 3300049586 Bacteria 7563
582 Ga0501070_0015305 3300049586 Bacteria 6453
583 Ga0501070_0049488 3300049586 Bacteria 3490
584 Ga0501070_0140310 3300049586 Bacteria 1995
585 Ga0501070_0324563 3300049586 Bacteria 1252
586 Ga0501071_0106573 3300049587 Bacteria 2069
587 Ga0501073_0194449 3300049589 Bacteria 1403
588 Ga0501074_0000023 3300049590 Bacteria 68925
589 Ga0501074_0048462 3300049590 Bacteria 3069
590 Ga0501074_0301542 3300049590 Bacteria 1138
591 Ga0501257_020605 3300049686 Bacteria 1550
592 Ga0501079_0611770 3300049741 Bacteria 857
593 Ga0501080_0000300 3300049742 Bacteria 37703
594 Ga0501080_0015426 3300049742 Bacteria 7043
595 Ga0501080_0195964 3300049742 Bacteria 1855
596 Ga0501083_0000012 3300049744 Bacteria 178668
597 Ga0501035_0000009 3300049822 Bacteria 310827
598 Ga0501035_0000073 3300049822 Bacteria 122603
599 Ga0501035_0000394 3300049822 Bacteria 49952
600 Ga0501035_0000709 3300049822 Bacteria 36064
601 Ga0501035_0001579 3300049822 Bacteria 23164
602 Ga0501035_0003350 3300049822 Bacteria 15361
603 Ga0501035_0035545 3300049822 Bacteria 4521
604 Ga0501035_0039500 3300049822 Bacteria 4270
605 Ga0501035_0056158 3300049822 Bacteria 3514
606 Ga0501035_0286306 3300049822 Bacteria 1391
607 Ga0501044_0000005 3300049823 Bacteria 310855
608 Ga0501044_0000118 3300049823 Bacteria 95218
609 Ga0501044_0000204 3300049823 Bacteria 75175
610 Ga0501044_0000685 3300049823 Bacteria 40966
611 Ga0501044_0013643 3300049823 Bacteria 8782
612 Ga0501044_0043172 3300049823 Bacteria 4685
613 Ga0501044_0066494 3300049823 Bacteria 3675
614 Ga0501044_0070774 3300049823 Bacteria 3548
615 Ga0501044_0079961 3300049823 Bacteria 3311
616 Ga0501044_0110711 3300049823 Bacteria 2754
617 Ga0501045_0112516 3300049824 Bacteria 2019
618 nmdc:mga06z11_181946_c1 3300050494 Bacteria 1212
619 nmdc:mga07m45_140211_c1 3300050496 Bacteria 1400
620 nmdc:mga05p37_945742_c1 3300050507 Unclassified 923
621 nmdc:mga09592_124326_c1 3300050508 Unclassified 2217
622 nmdc:mga09592_185003_c1 3300050508 Bacteria 1802
623 nmdc:mga09592_84197_c1 3300050508 Bacteria 2711
624 nmdc:mga0qj67_24582_c1 3300050509 Bacteria 4646
625 nmdc:mga06r32_12926_c1 3300050510 Bacteria 7548
626 nmdc:mga06r32_27940_c1 3300050510 Bacteria 5277
627 nmdc:mga08y16_11047_c1 3300050511 Bacteria 9482
628 nmdc:mga08y16_331038_c1 3300050511 Bacteria 1567
629 nmdc:mga08y16_437234_c1 3300050511 Unclassified 1336
630 nmdc:mga08y16_61681_c1 3300050511 Bacteria 3915
631 nmdc:mga0n895_135839_c1 3300050512 Unclassified 2486
632 nmdc:mga0rr50_653_c1 3300050513 Bacteria 18639
633 nmdc:mga0rr50_77683_c1 3300050513 Unclassified 2552
634 nmdc:mga08x19_13418_c2 3300050514 Bacteria 4517
635 nmdc:mga0a205_52691_c1 3300050515 Bacteria 3927
636 Ga0500643_018444 3300053087 Bacteria 2315
637 Ga0500583_0096912 3300053092 Bacteria 1441
638 Ga0500557_004156 3300053105 Bacteria 2993
639 Ga0500594_0002445 3300053118 Bacteria 4045
640 Ga0500597_018590 3300053120 Bacteria 2697
641 Ga0500658_0015256 3300053134 Bacteria 2850
642 Ga0500568_0000339 3300053139 Bacteria 36709
643 Ga0500568_0001733 3300053139 Bacteria 13525
644 Ga0500568_0138416 3300053139 Bacteria 903
645 Ga0500577_0153429 3300053142 Unclassified 978
646 Ga0500588_0008691 3300053146 Bacteria 2384
647 Ga0500616_0001372 3300053153 Bacteria 23606
648 Ga0500622_0000443 3300053156 Bacteria 39403
649 Ga0500633_0001453 3300053160 Bacteria 4466
650 Ga0590071_000366 3300059421 Bacteria 13359
651 Ga0590075_000079 3300059424 Bacteria 24840
652 Ga0590077_000041 3300059426 Bacteria 29107
653 Ga0501082_0074893 3300060353 Bacteria 2916
654 Ga0501082_0077952 3300060353 Bacteria 2858
655 Ga0501082_0348885 3300060353 Bacteria 1290
656 Ga0466962_0026545 3300061719 Bacteria 2780
657 2725950431 2724679232 Bacteria 7646494
658 2508726095 2508501050 Bacteria 9633614
659 2508726139 2508501050 Bacteria 9633614
660 2509108191 2508501122 Bacteria 6292184
661 2509376631 2509276019 Bacteria 6802256
662 2510132844 2510065019 Bacteria 6903379
663 2510305282 2510065057 Bacteria 6649661
664 2511195459 2510917030 Bacteria 7460662
665 2511502420 2511231052 Bacteria 6974333
666 2512533800 2512047086 Bacteria 6850303
667 2512970453 2512875026 Bacteria 6861065
668 2513570067 2513237084 Bacteria 7231967
669 2513585044 2513237086 Bacteria 7265287
670 2513601518 2513237089 Bacteria 6553624
671 2513618111 2513237091 Bacteria 6900273
672 2513710285 2513237103 Bacteria 7647401
673 2513884511 2513237140 Bacteria 7076289
674 2513904447 2513237143 Bacteria 6664116
675 2513983715 2513237156 Bacteria 6402557
676 2514003037 2513237160 Bacteria 6650282
677 2515609219 2515154107 Bacteria 6795637
678 2516893797 2516653046 Bacteria 6989037
679 2517094717 2517093000 Bacteria 7412387
680 2517570509 2517487022 Bacteria 7227575
681 2524448380 2524023207 Bacteria 6813453
682 2551679412 2551306084 Bacteria 8942552
683 2551683562 2551306085 Bacteria 7347181
684 2551688252 2551306085 Bacteria 7347181
685 2551691749 2551306086 Bacteria 6843938
686 2551701729 2551306087 Bacteria 7351905
687 2551713294 2551306089 Bacteria 7162724
688 2551718990 2551306090 Bacteria 7953713
689 2551745724 2551306093 Bacteria 7064773
690 2558864008 2558860100 Bacteria 8458965
691 2616296830 2615840624 Bacteria 6557588
692 2643838049 2643221564 Bacteria 4193379
693 2723568771 2721755685 Bacteria 6704835
694 2724106036 2721755822 Bacteria 6726041
695 2766067955 2765235942 Bacteria 7445910
696 2802716810 2802428858 Bacteria 6636079
697 2802725622 2802428859 Bacteria 6667919
698 2802730288 2802428860 Bacteria 6525526
699 2802737741 2802428861 Bacteria 6534206
700 2802742869 2802428862 Bacteria 6633353
701 2802750293 2802428863 Bacteria 6410669
702 2838043009 2838042994 Bacteria 6046894
703 2842110966 2842110456 Bacteria 7656360
704 2842220545 2842217011 Bacteria 7497767
705 2842396103 2842395702 Bacteria 6780583
706 2850081630 2850079185 Bacteria 6848280
707 2855826522 2855825444 Bacteria 6785811
708 2855841913 2855839649 Bacteria 7135830
709 2857522946 2857516855 Bacteria 7787325
710 2858803712 2858800743 Bacteria 6603254
711 2891050314 2891048133 Bacteria 4447501
712 2915982922 2915980308 Bacteria 6624279
713 2915989523 2915986958 Bacteria 6739310
714 2915998388 2915993759 Bacteria 7016183
715 2916003871 2916000859 Bacteria 6865702
716 2916011795 2916007675 Bacteria 6898660
717 2916019633 2916014648 Bacteria 6946486
718 2916023765 2916021584 Bacteria 6854472
719 2916031913 2916028427 Bacteria 6748433
720 2916037641 2916035215 Bacteria 6755766
721 2916046090 2916041962 Bacteria 6820487
722 2916050337 2916048683 Bacteria 6543552
723 2916058026 2916055098 Bacteria 6758838
724 2916066404 2916061851 Bacteria 6737736
725 2916069120 2916068649 Bacteria 6943657
726 2919106817 2919100787 Bacteria 7710546
727 2919126485 2919125081 Bacteria 5385106
728 2921203907 2921201388 Bacteria 6926299
729 2921211793 2921208531 Bacteria 6745326
730 2921243015 2921237296 Bacteria 6876710
731 2921246036 2921244191 Bacteria 6568419
732 2921253771 2921250672 Bacteria 6677771
733 2921260867 2921257292 Bacteria 6808382
734 2921266887 2921263974 Bacteria 6864552
735 2921286464 2921282425 Bacteria 6826397
736 2921295007 2921289301 Bacteria 7316391
737 2921297944 2921296804 Bacteria 7176999
738 2924147487 2924144063 Bacteria 6883928
739 2924156795 2924150972 Bacteria 7169444
740 2924160894 2924158325 Bacteria 7188855
741 2924166475 2924165586 Bacteria 7260590
742 2924175407 2924172951 Bacteria 6749356
743 2924182584 2924179722 Bacteria 6843264
744 2924189198 2924186466 Bacteria 6876637
745 2924197012 2924193448 Bacteria 6955718
746 2924206927 2924200457 Bacteria 6757188
747 2924208039 2924207177 Bacteria 6917007
748 2924217833 2924214083 Bacteria 7080103
749 2924228461 2924221636 Bacteria 7113495
750 2924232233 2924228884 Bacteria 6633132
751 2933586991 2933586486 Bacteria 7667493
752 2936373201 2936367885 Bacteria 7324495
753 2936381346 2936375103 Bacteria 6652732
754 2937002682 2936996657 Bacteria 6298727
755 2937005695 2937002841 Bacteria 6934057
756 2937012250 2937009748 Bacteria 6746052
757 2937019245 2937016420 Bacteria 6782579
758 2937027546 2937023124 Bacteria 6815156
759 2937030973 2937029754 Bacteria 6424026
760 2937038394 2937036028 Bacteria 6846469
761 2937045332 2937042894 Bacteria 6741576
762 2937054148 2937049772 Bacteria 6757901
763 2937061123 2937056579 Bacteria 7107896
764 2937069013 2937063883 Bacteria 7199456
765 2937074584 2937071275 Bacteria 6984483
766 2937080601 2937078374 Bacteria 6610289
767 2937090774 2937084907 Bacteria 6618516
768 2937098032 2937091812 Bacteria 6979387
769 2937102353 2937098957 Bacteria 7249374
770 2937111972 2937106411 Bacteria 6947143
771 2937117774 2937113482 Bacteria 6505872
772 2937122950 2937119839 Bacteria 6597547
773 2937130690 2937126314 Bacteria 6771275
774 2957380785 2957375807 Bacteria 6425588
775 2957385371 2957382221 Bacteria 6737050
776 2957392049 2957388812 Bacteria 6778072
777 2957397168 2957395598 Bacteria 6822399
778 2957405837 2957402308 Bacteria 6741770
779 2957414396 2957408893 Bacteria 6558585
780 2957420419 2957415311 Bacteria 6991633
781 2957426567 2957422303 Bacteria 7172205
782 2957433447 2957430029 Bacteria 7022557
783 2957440606 2957437181 Bacteria 6568994
784 2957445605 2957443900 Bacteria 6869977
785 2957457169 2957450854 Bacteria 6765715
786 2957460516 2957457609 Bacteria 6967680
787 2957469020 2957464669 Bacteria 6568877
788 2957473016 2957471148 Bacteria 6797643
789 2957481369 2957478035 Bacteria 6756658
790 2957487900 2957484790 Bacteria 6703082
791 2957493049 2957491536 Bacteria 6695180
792 2957500015 2957498199 Bacteria 7126688
793 2957512141 2957505466 Bacteria 7253085
794 2960587018 2960584000 Bacteria 6864594
795 2960594110 2960591022 Bacteria 6622873
796 2960603789 2960597568 Bacteria 6550735
797 2960606357 2960603979 Bacteria 6898737
798 2960615762 2960610863 Bacteria 6691244
799 2960619787 2960617483 Bacteria 6727748
800 2960627339 2960624210 Bacteria 6875384
801 2960635132 2960631154 Bacteria 6732508
802 2960643855 2960637947 Bacteria 7296468
803 2960648924 2960645483 Bacteria 7211087
804 2960658217 2960652885 Bacteria 7083688
805 2960663000 2960660292 Bacteria 7041660
806 2960668092 2960667422 Bacteria 6763020
807 2960677877 2960674078 Bacteria 6609048
808 2960680901 2960680706 Bacteria 6624464
809 2960691002 2960687367 Bacteria 6535474
810 2960698340 2960693952 Bacteria 6749742
811 2964608824 2964607997 Bacteria 7101408
812 2964616062 2964615318 Bacteria 6809089
813 2964625599 2964621998 Bacteria 6834995
814 2964631356 2964628898 Bacteria 7083044
815 2964642870 2964636051 Bacteria 7091832
816 2964643816 2964643177 Bacteria 6820887
817 2964652395 2964649959 Bacteria 6675118
818 2964659915 2964656573 Bacteria 7100150
819 2964665411 2964663802 Bacteria 7019362
820 2964675481 2964670856 Bacteria 6851364
821 2964679661 2964678106 Bacteria 6792020
822 2964685392 2964685014 Bacteria 6839111
823 2964697487 2964691889 Bacteria 6802758
824 2964700927 2964698721 Bacteria 6765331
825 2964707845 2964705432 Bacteria 7114648
826 2964718117 2964712639 Bacteria 6695970
827 2964724194 2964719344 Bacteria 7286602
828 2967669010 2967664464 Bacteria 6948836
829 2967673893 2967671571 Bacteria 7021409
830 2967680399 2967678726 Bacteria 7264382
831 2967689236 2967686174 Bacteria 6678622
832 2967695926 2967693043 Bacteria 6804451
833 2967701729 2967699805 Bacteria 6854538
834 2967711933 2967706974 Bacteria 7186053
835 2967717430 2967714385 Bacteria 7000047
836 2967725486 2967721400 Bacteria 7073753
837 2967729403 2967728569 Bacteria 6641507
838 2967735819 2967735183 Bacteria 6827012
839 2967748025 2967742019 Bacteria 6794534
840 2967750772 2967748971 Bacteria 6733771
841 2967758594 2967755722 Bacteria 6814706
842 2967764931 2967762386 Bacteria 6923502
843 2967774975 2967769361 Bacteria 6587838
844 2967779490 2967775926 Bacteria 6738189
845 2970025573 2970019648 Bacteria 7072033
846 2970028107 2970026789 Bacteria 6785236
847 2970036886 2970033650 Bacteria 7118744
848 2970043782 2970040964 Bacteria 6731123
849 2970053322 2970047711 Bacteria 7088379
850 2970058539 2970054988 Bacteria 6611507
851 2970066780 2970061556 Bacteria 7099761
852 2970073548 2970068827 Bacteria 7123112
853 2970078558 2970076120 Bacteria 6697332
854 2970086541 2970082768 Bacteria 6183754
855 2970090572 2970088815 Bacteria 6933825
856 2970098498 2970095765 Bacteria 6936963
857 2970104057 2970102677 Bacteria 6812532
858 2970111717 2970109326 Bacteria 6863976
859 2970118808 2970116247 Bacteria 6501857
860 2970123364 2970122695 Bacteria 6625855
861 2970132011 2970129317 Bacteria 6806560
862 2970137612 2970136068 Bacteria 7207982
863 2970145774 2970143518 Bacteria 6446480
864 2970152376 2970149975 Bacteria 6779706
865 2970161486 2970156795 Bacteria 7168044
866 2970164457 2970164137 Bacteria 6861252
867 2970175262 2970170962 Bacteria 6876229
868 2970180625 2970177841 Bacteria 6768001
869 2970188848 2970184632 Bacteria 7054431
870 2970194749 2970191845 Bacteria 7032787
871 2977523157 2977516862 Bacteria 6940108
872 2977524788 2977523885 Bacteria 6960446
873 2977541157 2977537788 Bacteria 6929320
874 2977549350 2977544691 Bacteria 6875412
875 2977553733 2977551784 Bacteria 7125765
876 2977562561 2977558990 Bacteria 6863948
877 2977566651 2977565890 Bacteria 6901543
878 2977576021 2977572785 Bacteria 6763888
879 2977584594 2977579622 Bacteria 6772100
880 2984506841 2984504281 Bacteria 5262371
881 2995393060 2995392953 Bacteria 4539380
882 3005447677 3005445848 Bacteria 6906074
883 648738145 648276728 Bacteria 6968865
884 8003994344 8003992118 Bacteria 7266902
885 8004002044 8003999396 Bacteria 7063185
886 8005378719 8005376324 Bacteria 6590079
887 8005569353 8005563573 Bacteria 7153261
888 8016731113 8016728285 Bacteria 5263933
889 8018168038 8018163183 Bacteria 7277977
890 8057875554 8057874678 Bacteria 7494653
891 MRS1b_contig_4814100
892 JGI24739J22299_10074399
893 JGI25152J39213_1001379
894 JGI25159J45721_1002718
895 JGI25153J46596_10005213
896 JGI25160J50197_1011066
897 JGI25161J50226_1000135
898 Ga0055526_1011006
899 Ga0055526_1015878
900 Ga0055524_1003219
901 Ga0055524_1013765
902 Ga0055528_1000146
903 Ga0055540_1001984
904 Ga0055543_1000219
905 Ga0065712_10070147
906 Ga0065715_10150790
907 Ga0070658_10059229
908 Ga0070658_10127031
909 Ga0070683_100002695
910 Ga0070683_100004805
911 Ga0070683_100157135
912 Ga0070683_100217491
913 Ga0070690_100075700
914 Ga0070670_100004072
915 Ga0070670_100005834
916 Ga0070670_100151521
917 Ga0068869_100080353
918 Ga0068869_100168637
919 Ga0070666_10032779
920 Ga0070666_10092403
921 Ga0070666_10113052
922 Ga0070680_100015306
923 Ga0070680_100196141
924 Ga0068868_100007450
925 Ga0068868_100058374
926 Ga0068868_100215275
927 Ga0068868_100338096
928 Ga0070689_100238480
929 Ga0070661_100001119
930 Ga0070661_100006475
931 Ga0070661_100013820
932 Ga0070668_100016595
933 Ga0070669_100090068
934 Ga0070669_100169885
935 Ga0070669_100242503
936 Ga0070669_100375794
937 Ga0070675_100054304
938 Ga0070675_100067740
939 Ga0070675_100166580
940 Ga0070671_100000908
941 Ga0070671_100059497
942 Ga0070671_100102853
943 Ga0070671_100573807
944 Ga0070673_100061478
945 Ga0070688_100093000
946 Ga0070688_100257552
947 Ga0070667_100194085
948 Ga0070709_10044943
949 Ga0070714_100403819
950 Ga0070714_100416739
951 Ga0070713_100062186
952 Ga0070701_10278130
953 Ga0070711_100052725
954 Ga0070711_100141298
955 Ga0070711_100215393
956 Ga0070705_100082341
957 Ga0070705_100142997
958 Ga0070694_100101955
959 Ga0070708_100028821
960 Ga0070663_100167437
961 Ga0070678_100032190
962 Ga0070678_100092963
963 Ga0070662_100023428
964 Ga0070662_100335992
965 Ga0070681_10023869
966 Ga0070681_10062901
967 Ga0070681_10163020
968 Ga0070681_10288030
969 Ga0068867_100018888
970 Ga0068867_100147545
971 Ga0070685_10142325
972 Ga0070706_100097355
973 Ga0070699_100062623
974 Ga0070684_100012173
975 Ga0070684_100024603
976 Ga0070684_100121768
977 Ga0070697_100007343
978 Ga0068853_100010208
979 Ga0068853_100017461
980 Ga0070686_100011132
981 Ga0070695_100022081
982 Ga0070696_100017498
983 Ga0070696_100267545
984 Ga0070665_100017875
985 Ga0070665_100021730
986 Ga0070665_100022430
987 Ga0070665_100206764
988 Ga0070665_100294832
989 Ga0070665_100451389
990 Ga0070665_100476542
991 Ga0070665_100519333
992 Ga0070704_100254864
993 Ga0068855_100008914
994 Ga0068855_100069122
995 Ga0068855_100112392
996 Ga0068855_100542874
997 Ga0068855_100805843
998 Ga0070664_100000556
999 Ga0070664_100000879
1000 Ga0070664_100023083
1001 Ga0068857_100000022
1002 Ga0068857_100147687
1003 Ga0068856_100002645
1004 Ga0068856_100006341
1005 Ga0070702_100030161
1006 Ga0068852_100049754
1007 Ga0068859_100000885
1008 Ga0068859_100073587
1009 Ga0068859_101102114
1010 Ga0068864_100001248
1011 Ga0068864_100006516
1012 Ga0068864_100253041
1013 Ga0068866_10000934
1014 Ga0068866_10038645
1015 Ga0068861_100018332
1016 Ga0068851_10012476
1017 Ga0068863_100020260
1018 Ga0068863_100049604
1019 Ga0068863_100834312
1020 Ga0068858_100001352
1021 Ga0068858_100274041
1022 Ga0068860_100026095
1023 Ga0068860_100027246
1024 Ga0068860_100253170
1025 Ga0068860_100572971
1026 Ga0068862_100007797
1027 Ga0068862_100286293
1028 Ga0068862_100301000
1029 Ga0068862_100555690
1030 Ga0081540_1007236
1031 Ga0070717_10000011
1032 Ga0070717_10004825
1033 Ga0070717_10032461
1034 Ga0070717_10073474
1035 Ga0070712_100087692
1036 Ga0075367_10073184
1037 Ga0097621_100033399
1038 Ga0097621_100106027
1039 Ga0097621_100237606
1040 Ga0068871_100004926
1041 Ga0068871_100179612
1042 Ga0075428_100000826
1043 Ga0075428_100202338
1044 Ga0075428_100296398
1045 Ga0075428_100827600
1046 Ga0075430_100058015
1047 Ga0075431_100006755
1048 Ga0075431_100019355
1049 Ga0075431_100063391
1050 Ga0075431_100164859
1051 Ga0075433_10127024
1052 Ga0075434_100000439
1053 Ga0075434_100006149
1054 Ga0075429_100175090
1055 Ga0075429_100538602
1056 Ga0068865_100061129
1057 Ga0068865_100063822
1058 Ga0097620_100000885
1059 Ga0097620_100073588
1060 Ga0097620_101101870
1061 Ga0079104_1005573
1062 Ga0075435_100050324
1063 Ga0075435_100094798
1064 Ga0099795_10111310
1065 Ga0105240_10395740
1066 Ga0105240_10939827
1067 Ga0111539_10008178
1068 Ga0111539_10578871
1069 Ga0105245_10024451
1070 Ga0105245_10063118
1071 Ga0114129_10003465
1072 Ga0114129_10089264
1073 Ga0114129_10300751
1074 Ga0114129_10578536
1075 Ga0114129_11263266
1076 Ga0105243_10025509
1077 Ga0105241_10013232
1078 Ga0105241_10358394
1079 Ga0105242_10023937
1080 Ga0105242_10272732
1081 Ga0105248_10066168
1082 Ga0105248_10100679
1083 Ga0105248_10127018
1084 Ga0105248_10264948
1085 Ga0105248_10399661
1086 Ga0105248_10779464
1087 Ga0105237_10090960
1088 Ga0105237_10156792
1089 Ga0105237_10420350
1090 Ga0105238_10160875
1091 Ga0105249_10000698
1092 Ga0105249_10046616
1093 Ga0123341_1005631
1094 Ga0105239_10021438
1095 Ga0105239_10022430
1096 Ga0105246_10434006
1097 Ga0157371_10001847
1098 Ga0157370_10045797
1099 Ga0157370_10121639
1100 Ga0157369_10003626
1101 Ga0157369_10032560
1102 Ga0157369_10047695
1103 Ga0157369_10238850
1104 Ga0157374_10000701
1105 Ga0157374_10160124
1106 Ga0157378_10000030
1107 Ga0157378_10057231
1108 Ga0157378_10212093
1109 Ga0163162_10279278
1110 Ga0163162_10844417
1111 Ga0157372_10161472
1112 Ga0157372_10378876
1113 Ga0157372_11117942
1114 Ga0157375_10083948
1115 Ga0157375_10589205
1116 Ga0163163_10017541
1117 Ga0163163_10022603
1118 Ga0163163_10148862
1119 Ga0163163_10243787
1120 Ga0163163_10517325
1121 Ga0157379_10044124
1122 Ga0157379_10069209
1123 Ga0157379_10086856
1124 Ga0157376_10014054
1125 Ga0157376_10023547
1126 Ga0157376_10124389
1127 Ga0157376_10254902
1128 Ga0214543_1000022
1129 Ga0213872_10000308
1130 Ga0213872_10125863
1131 Ga0228711_1000026
1132 Ga0228710_1000005
1133 Ga0209436_100059
1134 Ga0209563_102009
1135 Ga0209129_1001566
1136 Ga0209673_1000015
1137 Ga0209673_1005236
1138 Ga0209130_1000004
1139 Ga0209676_1016691
1140 Ga0209564_1000362
1141 Ga0209564_1020419
1142 Ga0209758_1000770
1143 Ga0209256_1000531
1144 Ga0209256_1003465
1145 Ga0207426_1000003
1146 Ga0209051_1004215
1147 Ga0209257_1031412
1148 Ga0207697_10079247
1149 Ga0207656_10014601
1150 Ga0207642_10002317
1151 Ga0207642_10275216
1152 Ga0207680_10124406
1153 Ga0207647_10006332
1154 Ga0207647_10035739
1155 Ga0207699_10194992
1156 Ga0207645_10117483
1157 Ga0207643_10015769
1158 Ga0207654_10329286
1159 Ga0207707_10009181
1160 Ga0207707_10070622
1161 Ga0207695_10093562
1162 Ga0207695_10286229
1163 Ga0207693_10002038
1164 Ga0207693_10051387
1165 Ga0207663_10111024
1166 Ga0207663_10182009
1167 Ga0207660_10010325
1168 Ga0207660_10023871
1169 Ga0207660_10377041
1170 Ga0207662_10077057
1171 Ga0207649_10006359
1172 Ga0207649_10078073
1173 Ga0207652_10136934
1174 Ga0207681_10013044
1175 Ga0207681_10425767
1176 Ga0207694_10008333
1177 Ga0207650_10013004
1178 Ga0207650_10016659
1179 Ga0207650_10032551
1180 Ga0207650_10206098
1181 Ga0207659_10074664
1182 Ga0207659_10087848
1183 Ga0207687_10058384
1184 Ga0207687_10156751
1185 Ga0207687_10183633
1186 Ga0207644_10043406
1187 Ga0207706_10019986
1188 Ga0207686_10190639
1189 Ga0207709_10009843
1190 Ga0207670_10157568
1191 Ga0207704_10071993
1192 Ga0207665_10004737
1193 Ga0207691_10117102
1194 Ga0207711_10063777
1195 Ga0207711_10072827
1196 Ga0207711_10159374
1197 Ga0207711_10628763
1198 Ga0207689_10052043
1199 Ga0207689_10068266
1200 Ga0207689_10107825
1201 Ga0207661_10019180
1202 Ga0207679_10000782
1203 Ga0207679_10023294
1204 Ga0207679_10101337
1205 Ga0207667_10002360
1206 Ga0207667_10218866
1207 Ga0207667_10400579
1208 Ga0207667_10635257
1209 Ga0207651_10023907
1210 Ga0207712_10181207
1211 Ga0207668_10263335
1212 Ga0207640_10054713
1213 Ga0207658_10085552
1214 Ga0207658_10096397
1215 Ga0207677_10051150
1216 Ga0207677_10057370
1217 Ga0207677_10065596
1218 Ga0207677_10324683
1219 Ga0207703_10001842
1220 Ga0207703_10083246
1221 Ga0207703_10140678
1222 Ga0207703_10277023
1223 Ga0207639_10000904
1224 Ga0207639_10271507
1225 Ga0207639_10275785
1226 Ga0207678_10010778
1227 Ga0207702_10007270
1228 Ga0207702_10263938
1229 Ga0207702_10491344
1230 Ga0207641_10005054
1231 Ga0207641_10038665
1232 Ga0207641_10130343
1233 Ga0207641_10286670
1234 Ga0207648_10158851
1235 Ga0207648_10262864
1236 Ga0207676_10003718
1237 Ga0207676_10079112
1238 Ga0207674_10000056
1239 Ga0207674_10012060
1240 Ga0207674_10039013
1241 Ga0207674_10314678
1242 Ga0207675_100058561
1243 Ga0207698_10151994
1244 Ga0209281_1000082
1245 Ga0209281_1000380
1246 Ga0209968_1000788
1247 Ga0209282_1000006
1248 Ga0209966_1000126
1249 Ga0207428_10004213
1250 Ga0207428_10019704
1251 Ga0268266_10081017
1252 Ga0268266_10369729
1253 Ga0268265_10044120
1254 Ga0268265_10053484
1255 Ga0268265_10114329
1256 Ga0268264_10030959
1257 Ga0268264_10181083
1258 Ga0268264_10267563
1259 Ga0265334_10037246
1260 Ga0307517_10222486
1261 Ga0265338_10045055
1262 Ga0265338_10052663
1263 Ga0265338_10059379
1264 Ga0265760_10041314
1265 Ga0265330_10043720
1266 Ga0265332_10002092
1267 Ga0265325_10006286
1268 Ga0265339_10001947
1269 Ga0265339_10053039
1270 Ga0265327_10045951
1271 Ga0307509_10000167
1272 Ga0307408_100055519
1273 Ga0307408_100139608
1274 Ga0265313_10000032
1275 Ga0265314_10052997
1276 Ga0265314_10065309
1277 Ga0307516_10073147
1278 Ga0307405_10084795
1279 Ga0307410_10034561
1280 Ga0307412_10144973
1281 Ga0315914_1000003
1282 Ga0307416_100165615
1283 Ga0307411_10137580
1284 Ga0315913_1000001
1285 Ga0315915_1000008
1286 Ga0373958_0001570
1287 Ga0373938_0016519
1288 Ga0373952_0011356
1289 Ga0373923_0017991
1290 Ga0373939_0017103
1291 Ga0373941_0051738
1292 Ga0373954_0216400
1293 Ga0373956_0109895
1294 Ga0373960_0013782
1295 Ga0373960_0039365
1296 Ga0373943_0049734
1297 Ga0373955_0007434
1298 Ga0373955_0080410
1299 Ga0373961_0008058
1300 Ga0373962_0008332
1301 Ga0373931_0020650
1302 Ga0373931_0053366
1303 Ga0373935_0213751
1304 Ga0373927_0001321
1305 Ga0373927_0008143
1306 Ga0373927_0030817
1307 Ga0373933_0000757
1308 Ga0373937_0000170
1309 Ga0373937_0143365
1310 Ga0373925_0001239
1311 Ga0373925_0076717
1312 Ga0395899_0000114
1313 Ga0395900_0000154
1314 Ga0395898_0000308
1315 Ga0395905_0000153
1316 Ga0436364_0227810
1317 Ga0436364_0363407
1318 Ga0436364_0797891
1319 Ga0395901_0000107
1320 Ga0436360_1353299
1321 Ga0436361_0779674
1322 Ga0436363_0891872
1323 Ga0451833_1416838
1324 Ga0451835_0147460
1325 Ga0451837_1095128
1326 Ga0451839_1277233
1327 Ga0451841_0182318
1328 Ga0451841_0992348
1329 Ga0451846_31560
1330 Ga0451847_0679858
1331 Ga0451849_0143547
1332 Ga0451849_1092803
1333 Ga0451851_0368784
1334 Ga0451843_0425783
1335 Ga0451855_0035447
1336 Ga0451853_3048143
1337 Ga0451577_0742250
1338 Ga0466969_0098723
1339 Ga0466969_0162337
1340 Ga0466966_0010031
1341 Ga0466966_0314260
1342 Ga0466961_0004730
1343 Ga0466961_0014799
1344 Ga0466971_0074443
1345 Ga0466968_0018836
1346 Ga0466959_0011945
1347 Ga0466967_0127601
1348 Ga0495629_0021941
1349 Ga0495638_0000879
1350 Ga0495651_0001720
1351 Ga0495605_0014270
1352 Ga0495620_0036671
1353 Ga0495631_0032990
1354 Ga0495643_0029950
1355 Ga0495652_0022006
1356 Ga0495665_0026176
1357 Ga0495587_0001357
1358 Ga0495667_0182419
1359 Ga0495667_0242060
1360 Ga0495668_0165612
1361 Ga0495611_0007891
1362 Ga0495625_0164966
1363 Ga0495625_0208533
1364 Ga0495599_0130665
1365 Ga0495623_0020240
1366 Ga0495623_0037457
1367 Ga0495658_0029561
1368 Ga0495613_0063869
1369 Ga0495649_0229578
1370 Ga0495660_0136678
1371 Ga0495604_0042654
1372 Ga0495636_0012346
1373 Ga0495680_0118729
1374 Ga0495687_018769
1375 Ga0495675_0001588
1376 Ga0495675_0099040
1377 Ga0495684_0004935
1378 Ga0495686_0002349
1379 Ga0495602_0000454
1380 Ga0495602_0050592
1381 Ga0495626_0134360
1382 Ga0496101_0070587
1383 Ga0496101_0218432
1384 Ga0496102_0065260
1385 Ga0496102_0184606
1386 Ga0496103_0063601
1387 Ga0496104_0003039
1388 Ga0496104_0083256
1389 Ga0496105_0004740
1390 Ga0496105_0055801
1391 Ga0496105_0106563
1392 Ga0496106_0026698
1393 Ga0496106_0057038
1394 Ga0496108_0002286
1395 Ga0496108_0007401
1396 Ga0496108_0096737
1397 Ga0496108_0236380
1398 Ga0496109_0000608
1399 Ga0496109_0062805
1400 Ga0496109_0464587
1401 Ga0496110_0000743
1402 Ga0496110_0298350
1403 Ga0496111_0009935
1404 Ga0496111_0030809
1405 Ga0496111_0352744
1406 Ga0496111_0445422
1407 Ga0496112_0007564
1408 Ga0496112_0034275
1409 Ga0496112_0173501
1410 Ga0496113_0050727
1411 Ga0496113_0149033
1412 Ga0496115_0072201
1413 Ga0496117_0081420
1414 Ga0496118_0036544
1415 Ga0496122_0042147
1416 Ga0496123_0134855
1417 Ga0496124_0055603
1418 Ga0496125_0004376
1419 Ga0495678_028643
1420 Ga0501299_019699
1421 Ga0501031_0000002
1422 Ga0501031_0060593
1423 Ga0501032_0000004
1424 Ga0501032_0000339
1425 Ga0501032_0000663
1426 Ga0501032_0050471
1427 Ga0501032_0231981
1428 Ga0501033_0000016
1429 Ga0501033_0000461
1430 Ga0501033_0003180
1431 Ga0501033_0044672
1432 Ga0501033_0056276
1433 Ga0501033_0069595
1434 Ga0501033_0219713
1435 Ga0501034_0000011
1436 Ga0501034_0266456
1437 Ga0501034_0272307
1438 Ga0501036_0000001
1439 Ga0501036_0039135
1440 Ga0501036_0043569
1441 Ga0501036_0340208
1442 Ga0501036_0515109
1443 Ga0501037_0000006
1444 Ga0501037_0000154
1445 Ga0501037_0017618
1446 Ga0501037_0185572
1447 Ga0501037_0427733
1448 Ga0501038_0000003
1449 Ga0501038_0206463
1450 Ga0501038_0257589
1451 Ga0501039_0000004
1452 Ga0501040_0003086
1453 Ga0501043_0000007
1454 Ga0501043_0000478
1455 Ga0501043_0023131
1456 Ga0501043_0069789
1457 Ga0501043_0200009
1458 Ga0501046_0019669
1459 Ga0501046_0076799
1460 Ga0501047_0002317
1461 Ga0501047_0005872
1462 Ga0501047_0011241
1463 Ga0501047_0013903
1464 Ga0501047_0058978
1465 Ga0501047_0289763
1466 Ga0501068_0084225
1467 Ga0501069_0000027
1468 Ga0501069_0002114
1469 Ga0501070_0000231
1470 Ga0501070_0002642
1471 Ga0501070_0011230
1472 Ga0501070_0015305
1473 Ga0501070_0049488
1474 Ga0501070_0140310
1475 Ga0501070_0324563
1476 Ga0501071_0106573
1477 Ga0501073_0194449
1478 Ga0501074_0000023
1479 Ga0501074_0048462
1480 Ga0501074_0301542
1481 Ga0501257_020605
1482 Ga0501079_0611770
1483 Ga0501080_0000300
1484 Ga0501080_0015426
1485 Ga0501080_0195964
1486 Ga0501083_0000012
1487 Ga0501035_0000009
1488 Ga0501035_0000073
1489 Ga0501035_0000394
1490 Ga0501035_0000709
1491 Ga0501035_0001579
1492 Ga0501035_0003350
1493 Ga0501035_0035545
1494 Ga0501035_0039500
1495 Ga0501035_0056158
1496 Ga0501035_0286306
1497 Ga0501044_0000005
1498 Ga0501044_0000118
1499 Ga0501044_0000204
1500 Ga0501044_0000685
1501 Ga0501044_0013643
1502 Ga0501044_0043172
1503 Ga0501044_0066494
1504 Ga0501044_0070774
1505 Ga0501044_0079961
1506 Ga0501044_0110711
1507 Ga0501045_0112516
1508 nmdc:mga06z11_181946_c1
1509 nmdc:mga07m45_140211_c1
1510 nmdc:mga05p37_945742_c1
1511 nmdc:mga09592_124326_c1
1512 nmdc:mga09592_185003_c1
1513 nmdc:mga09592_84197_c1
1514 nmdc:mga0qj67_24582_c1
1515 nmdc:mga06r32_12926_c1
1516 nmdc:mga06r32_27940_c1
1517 nmdc:mga08y16_11047_c1
1518 nmdc:mga08y16_331038_c1
1519 nmdc:mga08y16_437234_c1
1520 nmdc:mga08y16_61681_c1
1521 nmdc:mga0n895_135839_c1
1522 nmdc:mga0rr50_653_c1
1523 nmdc:mga0rr50_77683_c1
1524 nmdc:mga08x19_13418_c2
1525 nmdc:mga0a205_52691_c1
1526 Ga0500643_018444
1527 Ga0500583_0096912
1528 Ga0500557_004156
1529 Ga0500594_0002445
1530 Ga0500597_018590
1531 Ga0500658_0015256
1532 Ga0500568_0000339
1533 Ga0500568_0001733
1534 Ga0500568_0138416
1535 Ga0500577_0153429
1536 Ga0500588_0008691
1537 Ga0500616_0001372
1538 Ga0500622_0000443
1539 Ga0500633_0001453
1540 Ga0590071_000366
1541 Ga0590075_000079
1542 Ga0590077_000041
1543 Ga0501082_0074893
1544 Ga0501082_0077952
1545 Ga0501082_0348885
1546 Ga0466962_0026545
1547 2725950431
1548 2508726095
1549 2508726139
1550 2509108191
1551 2509376631
1552 2510132844
1553 2510305282
1554 2511195459
1555 2511502420
1556 2512533800
1557 2512970453
1558 2513570067
1559 2513585044
1560 2513601518
1561 2513618111
1562 2513710285
1563 2513884511
1564 2513904447
1565 2513983715
1566 2514003037
1567 2515609219
1568 2516893797
1569 2517094717
1570 2517570509
1571 2524448380
1572 2551679412
1573 2551683562
1574 2551688252
1575 2551691749
1576 2551701729
1577 2551713294
1578 2551718990
1579 2551745724
1580 2558864008
1581 2616296830
1582 2643838049
1583 2723568771
1584 2724106036
1585 2766067955
1586 2802716810
1587 2802725622
1588 2802730288
1589 2802737741
1590 2802742869
1591 2802750293
1592 2838043009
1593 2842110966
1594 2842220545
1595 2842396103
1596 2850081630
1597 2855826522
1598 2855841913
1599 2857522946
1600 2858803712
1601 2891050314
1602 2915982922
1603 2915989523
1604 2915998388
1605 2916003871
1606 2916011795
1607 2916019633
1608 2916023765
1609 2916031913
1610 2916037641
1611 2916046090
1612 2916050337
1613 2916058026
1614 2916066404
1615 2916069120
1616 2919106817
1617 2919126485
1618 2921203907
1619 2921211793
1620 2921243015
1621 2921246036
1622 2921253771
1623 2921260867
1624 2921266887
1625 2921286464
1626 2921295007
1627 2921297944
1628 2924147487
1629 2924156795
1630 2924160894
1631 2924166475
1632 2924175407
1633 2924182584
1634 2924189198
1635 2924197012
1636 2924206927
1637 2924208039
1638 2924217833
1639 2924228461
1640 2924232233
1641 2933586991
1642 2936373201
1643 2936381346
1644 2937002682
1645 2937005695
1646 2937012250
1647 2937019245
1648 2937027546
1649 2937030973
1650 2937038394
1651 2937045332
1652 2937054148
1653 2937061123
1654 2937069013
1655 2937074584
1656 2937080601
1657 2937090774
1658 2937098032
1659 2937102353
1660 2937111972
1661 2937117774
1662 2937122950
1663 2937130690
1664 2957380785
1665 2957385371
1666 2957392049
1667 2957397168
1668 2957405837
1669 2957414396
1670 2957420419
1671 2957426567
1672 2957433447
1673 2957440606
1674 2957445605
1675 2957457169
1676 2957460516
1677 2957469020
1678 2957473016
1679 2957481369
1680 2957487900
1681 2957493049
1682 2957500015
1683 2957512141
1684 2960587018
1685 2960594110
1686 2960603789
1687 2960606357
1688 2960615762
1689 2960619787
1690 2960627339
1691 2960635132
1692 2960643855
1693 2960648924
1694 2960658217
1695 2960663000
1696 2960668092
1697 2960677877
1698 2960680901
1699 2960691002
1700 2960698340
1701 2964608824
1702 2964616062
1703 2964625599
1704 2964631356
1705 2964642870
1706 2964643816
1707 2964652395
1708 2964659915
1709 2964665411
1710 2964675481
1711 2964679661
1712 2964685392
1713 2964697487
1714 2964700927
1715 2964707845
1716 2964718117
1717 2964724194
1718 2967669010
1719 2967673893
1720 2967680399
1721 2967689236
1722 2967695926
1723 2967701729
1724 2967711933
1725 2967717430
1726 2967725486
1727 2967729403
1728 2967735819
1729 2967748025
1730 2967750772
1731 2967758594
1732 2967764931
1733 2967774975
1734 2967779490
1735 2970025573
1736 2970028107
1737 2970036886
1738 2970043782
1739 2970053322
1740 2970058539
1741 2970066780
1742 2970073548
1743 2970078558
1744 2970086541
1745 2970090572
1746 2970098498
1747 2970104057
1748 2970111717
1749 2970118808
1750 2970123364
1751 2970132011
1752 2970137612
1753 2970145774
1754 2970152376
1755 2970161486
1756 2970164457
1757 2970175262
1758 2970180625
1759 2970188848
1760 2970194749
1761 2977523157
1762 2977524788
1763 2977541157
1764 2977549350
1765 2977553733
1766 2977562561
1767 2977566651
1768 2977576021
1769 2977584594
1770 2984506841
1771 2995393060
1772 3005447677
1773 648738145
1774 8003994344
1775 8004002044
1776 8005378719
1777 8005569353
1778 8016731113
1779 8018168038
1780 8057875554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

55

294

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9814 5 274
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9804 5 274
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9628 5 274
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9602 5 274
4mg4-assembly1.cif.gz_A crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9245 5 249
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9867 5 232 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9697 5 232 3.20.20.60
4mg4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9271 5 249 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9229 5 232 3.20.20.60
af_P9WLN9_1_257_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9061 12 273 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A7Y5GCF5-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9989 1 274 GO:0016829
AF-A0A2V6PFR3-F1-model_v4 2-methylisocitrate lyase 0.9961 24 180 GO:0016829
AF-A0A7Y5GCF5-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9952 1 274 GO:0016829
AF-A0A2V8C7T5-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9951 114 274 GO:0003824
AF-A0A524Q9N9-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.995 4 193 GO:0016829

Map