F484847
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 891 | 609 | 1778 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300002987|JGI25159J45721_1000080|JGI25159J45721_100008014 |
| Length | 340 |
| Sequence | MVMPTTNSSYMLYDEFVPNRLISFEISILKTRRGLKEMTPEQIKAALGSGLLSFPVTHFDKDGRFAPESYKAHVEWLAGYKAPVLFAAGGTGEFFSLKPDEIPGIVAAAKEVAGETAIVSGCGYGTEMAVDIARSVERXGADGILLLPHYLIDAPQEGLYAHVKQICQSVGIGVMVYNRDNSVLQPDTLARLCDECPNLIGFKDGTGDIGLVRQVTAKMGDRLMYLGGMPTAELFAEAYLGAGFTTYSSAVFNFVPGLANEFYAALRSGDRATCERILNDFFYPFMAIRNRAKGYAVSAVKAGVRLQGFNAGPVRSPLKDLTGAEVEMLDALIGSHKRKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 15 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 24 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 25 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 26 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 27 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 28 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 31 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 32 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 33 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 42 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 43 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 44 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 45 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 46 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 48 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 55 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 67 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 69 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 72 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 73 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 74 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 75 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 76 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 77 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 78 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 79 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 80 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 81 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 82 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 83 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 84 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 85 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 86 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 87 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 88 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 89 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 90 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 91 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 92 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 123 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 124 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 125 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 126 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 127 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 128 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 130 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 131 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 132 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 133 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 134 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 135 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 136 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 137 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 138 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 139 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 140 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 141 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 142 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 143 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 144 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 159 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 162 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 163 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 164 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 165 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 166 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 167 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 169 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 170 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 171 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 172 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 173 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 174 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 175 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 176 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 177 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 178 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 179 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 180 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 181 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 182 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 183 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 184 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 185 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 187 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 188 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 189 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 190 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 191 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 192 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 193 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 194 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 195 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 196 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 197 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 198 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 199 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 200 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 201 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 202 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 203 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 204 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 205 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 206 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 207 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 208 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 209 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 210 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 211 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 212 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 213 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 214 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 215 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 216 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 217 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 218 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 219 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 220 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 221 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 222 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 223 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 224 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 225 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 226 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 227 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 228 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 229 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 230 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 231 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 232 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 233 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 234 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 235 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 236 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 237 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 238 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 239 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 240 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 241 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 242 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 243 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 244 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 245 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 246 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 247 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 248 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 249 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 250 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 251 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 252 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 253 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 254 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 255 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 256 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 257 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 258 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 259 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 260 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 261 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 262 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 263 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 264 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 265 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 266 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 267 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 268 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 269 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 270 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 271 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 272 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 273 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 274 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 275 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 276 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 277 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 278 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 279 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 280 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 281 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 282 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 283 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 284 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 285 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 286 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 287 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 288 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 289 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 290 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 291 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 292 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 293 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 294 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 295 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 296 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 297 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 298 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 299 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 300 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 301 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 302 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 303 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 304 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 305 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 306 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 307 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 308 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 309 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 310 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 311 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 312 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 313 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 314 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 315 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 316 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 317 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 318 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 319 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 320 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 321 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 322 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 323 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 324 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 325 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 326 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 327 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 328 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 329 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 330 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 331 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 332 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 333 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 334 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 335 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 336 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 337 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 338 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 339 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 340 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 341 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 342 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 343 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 344 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 345 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 346 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 347 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 348 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 349 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 350 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 351 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 352 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 353 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 354 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 355 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 356 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 357 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 358 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 359 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 360 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 361 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 362 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 363 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 364 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 365 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 366 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 367 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 368 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 369 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 370 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 371 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 372 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 373 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 374 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 375 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 376 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 377 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 378 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 379 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 380 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 381 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 382 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 383 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 384 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 385 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 386 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 387 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 388 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 389 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 390 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 391 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 392 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 393 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 394 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 395 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 396 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 397 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 398 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 399 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 400 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 401 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 402 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 403 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 404 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 405 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 406 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 407 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 408 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 409 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 410 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 411 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 412 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 413 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 414 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 415 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 416 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 417 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 418 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 419 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 420 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 421 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 422 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 423 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 424 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 425 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 426 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 427 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 428 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 429 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 430 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 431 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 432 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 433 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 434 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 435 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 436 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 437 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 438 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 439 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 440 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 441 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 442 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 443 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 444 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 445 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 446 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 447 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 448 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 449 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 450 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 451 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 452 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 453 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 454 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 455 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 456 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 457 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 458 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 459 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 460 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 461 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 462 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 463 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 464 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 465 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 466 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 467 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 468 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 469 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 470 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 471 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 472 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 473 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 474 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 475 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 476 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 477 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 478 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 479 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 480 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 481 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 482 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 483 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 484 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 485 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 486 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 487 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 488 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 489 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 490 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 491 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 492 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 493 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 494 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 495 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 496 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 497 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 498 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 499 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 500 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 501 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 502 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 503 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 504 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 505 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 506 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 507 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 508 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 509 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 510 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 511 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 512 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 513 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 514 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 515 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 516 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 517 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 518 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 519 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 520 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 521 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 522 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 523 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 524 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 525 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 526 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 527 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 528 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 529 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 530 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 531 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 532 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 533 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 534 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 535 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 536 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 537 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 538 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 539 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 540 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 541 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 542 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 543 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 544 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 545 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 546 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 547 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 548 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 549 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 550 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 551 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 552 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 553 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 554 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 555 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 556 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 557 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 558 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 559 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 560 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 561 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 562 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 563 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 564 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 565 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 566 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 567 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 568 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 569 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 570 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 571 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 572 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 573 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 574 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 575 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 576 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 577 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 578 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 579 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 580 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 581 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 582 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 583 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 584 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 585 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 586 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 587 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 588 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 589 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 590 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 591 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 592 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 593 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 594 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 595 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 596 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 597 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 598 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 599 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 600 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 601 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 602 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 603 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 604 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 605 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 606 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 607 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
| 608 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 609 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 38.05 |
| Metatranscriptomes | 0 |
| Isolates | 61.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.45 |
| Bulb | 0 |
| Endosphere | 15.15 |
| Nodule | 48.37 |
| Rhizoplane | 2.81 |
| Rhizosphere | 16.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1000080 | 3300002987 | Bacteria | 46567 |
| 2 | JGI25152J39213_1005341 | 3300002773 | Bacteria | 3776 |
| 3 | JGI25159J45721_1000354 | 3300002987 | Bacteria | 21222 |
| 4 | JGI25159J45721_1000466 | 3300002987 | Bacteria | 18688 |
| 5 | JGI25159J45721_1000514 | 3300002987 | Bacteria | 17677 |
| 6 | JGI25151J46595_10011163 | 3300003187 | Bacteria | 4138 |
| 7 | JGI25151J46595_10026634 | 3300003187 | Bacteria | 2329 |
| 8 | JGI25153J46596_10000302 | 3300003215 | Bacteria | 36803 |
| 9 | rootL2_10092790 | 3300003322 | Bacteria | 1842 |
| 10 | JGI25160J50197_1000005 | 3300003354 | Bacteria | 417280 |
| 11 | JGI25160J50197_1000014 | 3300003354 | Bacteria | 259862 |
| 12 | JGI25160J50197_1000026 | 3300003354 | Bacteria | 184693 |
| 13 | JGI25160J50197_1000160 | 3300003354 | Bacteria | 57733 |
| 14 | JGI25161J50226_1000014 | 3300003374 | Bacteria | 191109 |
| 15 | JGI25161J50226_1000022 | 3300003374 | Bacteria | 158544 |
| 16 | Ga0055526_1004999 | 3300003771 | Bacteria | 7760 |
| 17 | Ga0055526_1006491 | 3300003771 | Bacteria | 6333 |
| 18 | Ga0055524_1000581 | 3300003775 | Bacteria | 26755 |
| 19 | Ga0055524_1002487 | 3300003775 | Bacteria | 9469 |
| 20 | Ga0055524_1006335 | 3300003775 | Bacteria | 5144 |
| 21 | Ga0055524_1028674 | 3300003775 | Bacteria | 1663 |
| 22 | Ga0055524_1035140 | 3300003775 | Bacteria | 1372 |
| 23 | Ga0055536_1001262 | 3300003781 | Bacteria | 15581 |
| 24 | Ga0055536_1006042 | 3300003781 | Bacteria | 5743 |
| 25 | Ga0055536_1011844 | 3300003781 | Bacteria | 3294 |
| 26 | Ga0055536_1019506 | 3300003781 | Bacteria | 2129 |
| 27 | Ga0055528_1016836 | 3300003790 | Bacteria | 2563 |
| 28 | Ga0055540_1006014 | 3300003792 | Bacteria | 4916 |
| 29 | Ga0055540_1008423 | 3300003792 | Bacteria | 3716 |
| 30 | Ga0055531_10001938 | 3300003794 | Bacteria | 14455 |
| 31 | Ga0055531_10002976 | 3300003794 | Bacteria | 11011 |
| 32 | Ga0055531_10003532 | 3300003794 | Bacteria | 9931 |
| 33 | Ga0058692_1001187 | 3300003856 | Bacteria | 9990 |
| 34 | Ga0058692_1005324 | 3300003856 | Bacteria | 3683 |
| 35 | Ga0055543_1000005 | 3300004625 | Bacteria | 223621 |
| 36 | Ga0055543_1000052 | 3300004625 | Bacteria | 104887 |
| 37 | Ga0055543_1000324 | 3300004625 | Bacteria | 33093 |
| 38 | Ga0065165_1000002 | 3300005262 | Bacteria | 444192 |
| 39 | Ga0065165_1000073 | 3300005262 | Bacteria | 164910 |
| 40 | Ga0065165_1000463 | 3300005262 | Bacteria | 63644 |
| 41 | Ga0065165_1000534 | 3300005262 | Bacteria | 57771 |
| 42 | Ga0065704_10079730 | 3300005289 | Bacteria | 4093 |
| 43 | Ga0070683_100315588 | 3300005329 | Bacteria | 1487 |
| 44 | Ga0070670_100000446 | 3300005331 | Bacteria | 33484 |
| 45 | Ga0070668_100095965 | 3300005347 | Bacteria | 2343 |
| 46 | Ga0070662_100140353 | 3300005457 | Bacteria | 1872 |
| 47 | Ga0070665_100008536 | 3300005548 | Bacteria | 10365 |
| 48 | Ga0075365_10011720 | 3300006038 | Bacteria | 5169 |
| 49 | Ga0075365_10033506 | 3300006038 | Bacteria | 3311 |
| 50 | Ga0075365_10093516 | 3300006038 | Bacteria | 2051 |
| 51 | Ga0075368_10024529 | 3300006042 | Bacteria | 2311 |
| 52 | Ga0075363_100135135 | 3300006048 | Bacteria | 1385 |
| 53 | Ga0075364_10000058 | 3300006051 | Bacteria | 41383 |
| 54 | Ga0075364_10022274 | 3300006051 | Bacteria | 3999 |
| 55 | Ga0075367_10056064 | 3300006178 | Bacteria | 2340 |
| 56 | Ga0075369_10063795 | 3300006186 | Bacteria | 1612 |
| 57 | Ga0097621_100014591 | 3300006237 | Bacteria | 5886 |
| 58 | Ga0075430_100172300 | 3300006846 | Bacteria | 1801 |
| 59 | Ga0079104_1000045 | 3300006946 | Bacteria | 183705 |
| 60 | Ga0099826_10000040 | 3300006948 | Bacteria | 98176 |
| 61 | Ga0105251_10028109 | 3300009011 | Bacteria | 2845 |
| 62 | Ga0105250_10036053 | 3300009092 | Bacteria | 1985 |
| 63 | Ga0105243_10030726 | 3300009148 | Bacteria | 4138 |
| 64 | Ga0105248_10391834 | 3300009177 | Bacteria | 1564 |
| 65 | Ga0105246_10078453 | 3300011119 | Bacteria | 2345 |
| 66 | Ga0157373_10061465 | 3300013100 | Bacteria | 2660 |
| 67 | Ga0157371_10000042 | 3300013102 | Bacteria | 198938 |
| 68 | Ga0157370_10000035 | 3300013104 | Bacteria | 137103 |
| 69 | Ga0157370_10392398 | 3300013104 | Bacteria | 1278 |
| 70 | Ga0171463_1013 | 3300013249 | Bacteria | 94945 |
| 71 | Ga0183363_1072 | 3300015690 | Bacteria | 30043 |
| 72 | Ga0214543_1000018 | 3300021327 | Bacteria | 272335 |
| 73 | Ga0228711_1023402 | 3300022739 | Bacteria | 4603 |
| 74 | Ga0228710_1002216 | 3300022740 | Bacteria | 30404 |
| 75 | Ga0228710_1022978 | 3300022740 | Bacteria | 4660 |
| 76 | Ga0209436_100101 | 3300025208 | Bacteria | 42360 |
| 77 | Ga0209436_100162 | 3300025208 | Bacteria | 32237 |
| 78 | Ga0209129_1000690 | 3300025258 | Bacteria | 22130 |
| 79 | Ga0209129_1014727 | 3300025258 | Bacteria | 1650 |
| 80 | Ga0209565_1015948 | 3300025263 | Bacteria | 1681 |
| 81 | Ga0209455_1000196 | 3300025272 | Bacteria | 88682 |
| 82 | Ga0209673_1002427 | 3300025273 | Bacteria | 12963 |
| 83 | Ga0209673_1020551 | 3300025273 | Bacteria | 2335 |
| 84 | Ga0209130_1000010 | 3300025284 | Bacteria | 444920 |
| 85 | Ga0209130_1000013 | 3300025284 | Bacteria | 412810 |
| 86 | Ga0209130_1000121 | 3300025284 | Bacteria | 127462 |
| 87 | Ga0209130_1000309 | 3300025284 | Bacteria | 57785 |
| 88 | Ga0209676_1000498 | 3300025292 | Bacteria | 62906 |
| 89 | Ga0209676_1001837 | 3300025292 | Bacteria | 17566 |
| 90 | Ga0209676_1002471 | 3300025292 | Bacteria | 13041 |
| 91 | Ga0209676_1002760 | 3300025292 | Bacteria | 11746 |
| 92 | Ga0209676_1026246 | 3300025292 | Bacteria | 1853 |
| 93 | Ga0209676_1039150 | 3300025292 | Bacteria | 1350 |
| 94 | Ga0209025_1000374 | 3300025294 | Bacteria | 93607 |
| 95 | Ga0209025_1002206 | 3300025294 | Bacteria | 21532 |
| 96 | Ga0209025_1004162 | 3300025294 | Bacteria | 12812 |
| 97 | Ga0209025_1028032 | 3300025294 | Bacteria | 2772 |
| 98 | Ga0209564_1000341 | 3300025295 | Bacteria | 89262 |
| 99 | Ga0209564_1014365 | 3300025295 | Bacteria | 3300 |
| 100 | Ga0209564_1018741 | 3300025295 | Bacteria | 2622 |
| 101 | Ga0209758_1000237 | 3300025297 | Bacteria | 115867 |
| 102 | Ga0209758_1000504 | 3300025297 | Bacteria | 63308 |
| 103 | Ga0209758_1004696 | 3300025297 | Bacteria | 11158 |
| 104 | Ga0209758_1054380 | 3300025297 | Bacteria | 1368 |
| 105 | Ga0209050_1004289 | 3300025298 | Bacteria | 9752 |
| 106 | Ga0209050_1004459 | 3300025298 | Bacteria | 9445 |
| 107 | Ga0209256_1001577 | 3300025299 | Bacteria | 22383 |
| 108 | Ga0209256_1004219 | 3300025299 | Bacteria | 9219 |
| 109 | Ga0209256_1005600 | 3300025299 | Bacteria | 7134 |
| 110 | Ga0209256_1006490 | 3300025299 | Bacteria | 6158 |
| 111 | Ga0209256_1008108 | 3300025299 | Bacteria | 4956 |
| 112 | Ga0209256_1035422 | 3300025299 | Bacteria | 1319 |
| 113 | Ga0207426_1000022 | 3300025302 | Bacteria | 547377 |
| 114 | Ga0207426_1000036 | 3300025302 | Bacteria | 444920 |
| 115 | Ga0207426_1000075 | 3300025302 | Bacteria | 321337 |
| 116 | Ga0207426_1000503 | 3300025302 | Bacteria | 57785 |
| 117 | Ga0207426_1004564 | 3300025302 | Bacteria | 6692 |
| 118 | Ga0209051_1000751 | 3300025303 | Bacteria | 34884 |
| 119 | Ga0209051_1001177 | 3300025303 | Bacteria | 23706 |
| 120 | Ga0209051_1005962 | 3300025303 | Bacteria | 6975 |
| 121 | Ga0209051_1012132 | 3300025303 | Bacteria | 4188 |
| 122 | Ga0209257_1000599 | 3300025304 | Bacteria | 59865 |
| 123 | Ga0209257_1003754 | 3300025304 | Bacteria | 12550 |
| 124 | Ga0209257_1004578 | 3300025304 | Bacteria | 10575 |
| 125 | Ga0207650_10000377 | 3300025925 | Bacteria | 41945 |
| 126 | Ga0207706_10153279 | 3300025933 | Bacteria | 2027 |
| 127 | Ga0207668_10087555 | 3300025972 | Bacteria | 2278 |
| 128 | Ga0207639_10157689 | 3300026041 | Bacteria | 1909 |
| 129 | Ga0207675_100313109 | 3300026118 | Bacteria | 1531 |
| 130 | Ga0209281_1000034 | 3300027111 | Bacteria | 382562 |
| 131 | Ga0209281_1000329 | 3300027111 | Bacteria | 82668 |
| 132 | Ga0209281_1001431 | 3300027111 | Bacteria | 14142 |
| 133 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 134 | Ga0209371_1000976 | 3300027312 | Bacteria | 22110 |
| 135 | Ga0209282_1000167 | 3300027666 | Bacteria | 37134 |
| 136 | Ga0209813_10018111 | 3300027866 | Bacteria | 1942 |
| 137 | Ga0268266_10026910 | 3300028379 | Bacteria | 4893 |
| 138 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 139 | Ga0307515_10003211 | 3300028794 | Bacteria | 34601 |
| 140 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 141 | Ga0268256_1002843 | 3300030500 | Bacteria | 8345 |
| 142 | Ga0307513_10012532 | 3300031456 | Bacteria | 10453 |
| 143 | Ga0307406_10234063 | 3300031901 | Bacteria | 1374 |
| 144 | Ga0307412_10042257 | 3300031911 | Bacteria | 2961 |
| 145 | Ga0316583_10005162 | 3300032133 | Bacteria | 4681 |
| 146 | Ga0315913_1001354 | 3300033430 | Bacteria | 26738 |
| 147 | Ga0400483_096903 | 3300039062 | Bacteria | 1618 |
| 148 | Ga0439436_0001038 | 3300041404 | Bacteria | 7791 |
| 149 | Ga0439439_0042391 | 3300041406 | Bacteria | 1182 |
| 150 | Ga0439466_0066989 | 3300041411 | Bacteria | 1149 |
| 151 | Ga0439465_0001159 | 3300041413 | Bacteria | 8469 |
| 152 | Ga0451847_0640839 | 3300041503 | Bacteria | 1440 |
| 153 | Ga0451843_0064174 | 3300041509 | Bacteria | 2050 |
| 154 | Ga0451853_1456325 | 3300041512 | Bacteria | 1273 |
| 155 | Ga0439433_0019251 | 3300041999 | Bacteria | 1521 |
| 156 | Ga0439445_0037170 | 3300042004 | Bacteria | 1284 |
| 157 | Ga0439449_0002803 | 3300042007 | Bacteria | 6773 |
| 158 | Ga0439449_0026727 | 3300042007 | Bacteria | 2154 |
| 159 | Ga0450906_025852 | 3300042145 | Bacteria | 1042 |
| 160 | Ga0439434_0012203 | 3300042435 | Bacteria | 2543 |
| 161 | Ga0466970_0223628 | 3300044765 | Bacteria | 1051 |
| 162 | Ga0495592_0187009 | 3300046454 | Bacteria | 1406 |
| 163 | Ga0495629_0080780 | 3300046459 | Bacteria | 2269 |
| 164 | Ga0495638_0087826 | 3300046460 | Bacteria | 1878 |
| 165 | Ga0495651_0013067 | 3300046462 | Bacteria | 6415 |
| 166 | Ga0495650_0029699 | 3300046471 | Bacteria | 2488 |
| 167 | Ga0495605_0061223 | 3300046474 | Bacteria | 1802 |
| 168 | Ga0495662_0037583 | 3300046476 | Bacteria | 2338 |
| 169 | Ga0495585_0066109 | 3300046492 | Bacteria | 1980 |
| 170 | Ga0495607_0012006 | 3300046501 | Bacteria | 5732 |
| 171 | Ga0495583_0007050 | 3300046506 | Bacteria | 7184 |
| 172 | Ga0495606_0001382 | 3300046507 | Bacteria | 32786 |
| 173 | Ga0495606_0011311 | 3300046507 | Bacteria | 7292 |
| 174 | Ga0495606_0101138 | 3300046507 | Bacteria | 1755 |
| 175 | Ga0495608_0209264 | 3300046511 | Bacteria | 1227 |
| 176 | Ga0495620_0021093 | 3300046515 | Bacteria | 3168 |
| 177 | Ga0495630_0091286 | 3300046517 | Bacteria | 2301 |
| 178 | Ga0495643_0025352 | 3300046522 | Bacteria | 3355 |
| 179 | Ga0495643_0032352 | 3300046522 | Bacteria | 2904 |
| 180 | Ga0495648_0016808 | 3300046524 | Bacteria | 5259 |
| 181 | Ga0495652_0142184 | 3300046529 | Bacteria | 1886 |
| 182 | Ga0495654_0000147 | 3300046530 | Bacteria | 72993 |
| 183 | Ga0495654_0000655 | 3300046530 | Bacteria | 27305 |
| 184 | Ga0495587_0067202 | 3300046536 | Bacteria | 2090 |
| 185 | Ga0495597_0003958 | 3300046542 | Bacteria | 8339 |
| 186 | Ga0495633_0012310 | 3300046558 | Bacteria | 4559 |
| 187 | Ga0495633_0062910 | 3300046558 | Bacteria | 1737 |
| 188 | Ga0495633_0081338 | 3300046558 | Bacteria | 1507 |
| 189 | Ga0495668_0146063 | 3300046616 | Bacteria | 1295 |
| 190 | Ga0495635_0164778 | 3300046663 | Bacteria | 1508 |
| 191 | Ga0495588_0075050 | 3300046674 | Bacteria | 1761 |
| 192 | Ga0495624_0024647 | 3300046690 | Bacteria | 3957 |
| 193 | Ga0495670_0040774 | 3300046691 | Bacteria | 2316 |
| 194 | Ga0495670_0052467 | 3300046691 | Bacteria | 2042 |
| 195 | Ga0495686_0000090 | 3300047472 | Bacteria | 193179 |
| 196 | Ga0495686_0027326 | 3300047472 | Bacteria | 3727 |
| 197 | Ga0495686_0039286 | 3300047472 | Bacteria | 3023 |
| 198 | Ga0495686_0047527 | 3300047472 | Bacteria | 2709 |
| 199 | Ga0495686_0162505 | 3300047472 | Bacteria | 1304 |
| 200 | Ga0495626_0022527 | 3300048091 | Bacteria | 3109 |
| 201 | Ga0496100_0267745 | 3300048903 | Bacteria | 1269 |
| 202 | Ga0496101_0021998 | 3300048904 | Bacteria | 4385 |
| 203 | Ga0496102_0019077 | 3300048905 | Bacteria | 6036 |
| 204 | Ga0496103_0009448 | 3300048906 | Bacteria | 5774 |
| 205 | Ga0496104_0000378 | 3300048907 | Bacteria | 39345 |
| 206 | Ga0496105_0001811 | 3300048908 | Bacteria | 15296 |
| 207 | Ga0496106_0000188 | 3300048909 | Bacteria | 43820 |
| 208 | Ga0496107_0307065 | 3300048910 | Bacteria | 1181 |
| 209 | Ga0496109_0195011 | 3300048912 | Bacteria | 1904 |
| 210 | Ga0496110_0007052 | 3300048913 | Bacteria | 8941 |
| 211 | Ga0496110_0073334 | 3300048913 | Bacteria | 3038 |
| 212 | Ga0496110_0244761 | 3300048913 | Bacteria | 1632 |
| 213 | Ga0496111_0000414 | 3300048914 | Bacteria | 21472 |
| 214 | Ga0496111_0000571 | 3300048914 | Bacteria | 19245 |
| 215 | Ga0496113_0025584 | 3300048916 | Bacteria | 4209 |
| 216 | Ga0496114_0010906 | 3300048917 | Bacteria | 7241 |
| 217 | Ga0496116_0005240 | 3300048919 | Bacteria | 12117 |
| 218 | Ga0496116_0027246 | 3300048919 | Bacteria | 4163 |
| 219 | Ga0496116_0078095 | 3300048919 | Bacteria | 2066 |
| 220 | Ga0496117_0000036 | 3300048920 | Bacteria | 325635 |
| 221 | Ga0496118_0009373 | 3300048921 | Bacteria | 9909 |
| 222 | Ga0496118_0048676 | 3300048921 | Bacteria | 3270 |
| 223 | Ga0496118_0078334 | 3300048921 | Bacteria | 2339 |
| 224 | Ga0496118_0092938 | 3300048921 | Bacteria | 2068 |
| 225 | Ga0496119_0001603 | 3300048922 | Bacteria | 26894 |
| 226 | Ga0496119_0010135 | 3300048922 | Bacteria | 7960 |
| 227 | Ga0496119_0014224 | 3300048922 | Bacteria | 6250 |
| 228 | Ga0496119_0032383 | 3300048922 | Bacteria | 3485 |
| 229 | Ga0496119_0065867 | 3300048922 | Bacteria | 2143 |
| 230 | Ga0496120_0000036 | 3300048923 | Bacteria | 206505 |
| 231 | Ga0496120_0002229 | 3300048923 | Bacteria | 20320 |
| 232 | Ga0496120_0015026 | 3300048923 | Bacteria | 5124 |
| 233 | Ga0496121_0000005 | 3300048924 | Bacteria | 1034486 |
| 234 | Ga0496121_0002138 | 3300048924 | Bacteria | 31031 |
| 235 | Ga0496121_0003960 | 3300048924 | Bacteria | 20448 |
| 236 | Ga0496121_0016194 | 3300048924 | Bacteria | 7719 |
| 237 | Ga0496121_0138928 | 3300048924 | Bacteria | 1805 |
| 238 | Ga0496121_0167015 | 3300048924 | Bacteria | 1603 |
| 239 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 240 | Ga0496122_0000215 | 3300048925 | Bacteria | 128810 |
| 241 | Ga0496122_0029881 | 3300048925 | Bacteria | 4582 |
| 242 | Ga0496122_0031051 | 3300048925 | Bacteria | 4457 |
| 243 | Ga0496122_0039878 | 3300048925 | Bacteria | 3739 |
| 244 | Ga0496122_0040195 | 3300048925 | Bacteria | 3721 |
| 245 | Ga0496122_0055260 | 3300048925 | Bacteria | 2972 |
| 246 | Ga0496122_0065842 | 3300048925 | Bacteria | 2623 |
| 247 | Ga0496122_0073963 | 3300048925 | Bacteria | 2413 |
| 248 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 249 | Ga0496123_0000306 | 3300048926 | Bacteria | 95266 |
| 250 | Ga0496123_0008710 | 3300048926 | Bacteria | 9263 |
| 251 | Ga0496124_0000206 | 3300048927 | Bacteria | 116591 |
| 252 | Ga0496124_0000724 | 3300048927 | Bacteria | 54104 |
| 253 | Ga0496124_0004794 | 3300048927 | Bacteria | 15575 |
| 254 | Ga0496124_0010515 | 3300048927 | Bacteria | 9361 |
| 255 | Ga0496124_0018098 | 3300048927 | Bacteria | 6614 |
| 256 | Ga0496124_0024568 | 3300048927 | Bacteria | 5473 |
| 257 | Ga0496124_0032649 | 3300048927 | Bacteria | 4593 |
| 258 | Ga0496124_0044063 | 3300048927 | Bacteria | 3831 |
| 259 | Ga0496124_0126072 | 3300048927 | Bacteria | 2039 |
| 260 | Ga0496125_0000034 | 3300048928 | Bacteria | 348231 |
| 261 | Ga0496125_0000163 | 3300048928 | Bacteria | 148473 |
| 262 | Ga0496125_0000171 | 3300048928 | Bacteria | 145308 |
| 263 | Ga0496125_0014681 | 3300048928 | Bacteria | 7614 |
| 264 | Ga0496125_0018289 | 3300048928 | Bacteria | 6659 |
| 265 | Ga0496125_0093671 | 3300048928 | Bacteria | 2241 |
| 266 | Ga0496125_0134564 | 3300048928 | Bacteria | 1732 |
| 267 | Ga0496125_0147178 | 3300048928 | Bacteria | 1625 |
| 268 | Ga0496126_0005143 | 3300048929 | Bacteria | 15142 |
| 269 | Ga0496126_0034008 | 3300048929 | Bacteria | 4792 |
| 270 | Ga0496126_0193083 | 3300048929 | Bacteria | 1723 |
| 271 | Ga0501032_0006208 | 3300049569 | Bacteria | 8789 |
| 272 | Ga0501032_0120514 | 3300049569 | Bacteria | 1734 |
| 273 | Ga0501033_0011169 | 3300049570 | Bacteria | 6878 |
| 274 | Ga0501033_0239087 | 3300049570 | Bacteria | 1288 |
| 275 | Ga0501034_0418815 | 3300049571 | Bacteria | 1261 |
| 276 | Ga0501036_0135580 | 3300049572 | Bacteria | 2078 |
| 277 | Ga0501036_0279145 | 3300049572 | Bacteria | 1398 |
| 278 | Ga0501037_0000077 | 3300049573 | Bacteria | 91081 |
| 279 | Ga0501037_0187495 | 3300049573 | Bacteria | 1465 |
| 280 | Ga0501043_0000114 | 3300049579 | Bacteria | 75782 |
| 281 | Ga0501043_0007992 | 3300049579 | Bacteria | 8352 |
| 282 | Ga0501043_0185681 | 3300049579 | Bacteria | 1619 |
| 283 | Ga0501067_0028120 | 3300049583 | Bacteria | 3115 |
| 284 | Ga0501068_0034112 | 3300049584 | Bacteria | 3034 |
| 285 | Ga0501069_0000016 | 3300049585 | Bacteria | 142565 |
| 286 | Ga0501070_0000450 | 3300049586 | Bacteria | 37447 |
| 287 | Ga0501073_0018348 | 3300049589 | Bacteria | 5056 |
| 288 | Ga0501073_0313786 | 3300049589 | Bacteria | 1082 |
| 289 | Ga0501074_0000067 | 3300049590 | Bacteria | 49686 |
| 290 | Ga0501080_0002371 | 3300049742 | Bacteria | 16432 |
| 291 | Ga0501080_0106045 | 3300049742 | Bacteria | 2605 |
| 292 | Ga0501083_0000111 | 3300049744 | Bacteria | 55529 |
| 293 | Ga0501280_003248 | 3300049776 | Bacteria | 2532 |
| 294 | Ga0501035_0001093 | 3300049822 | Bacteria | 28434 |
| 295 | Ga0501044_0000003 | 3300049823 | Bacteria | 345647 |
| 296 | Ga0501044_0246499 | 3300049823 | Bacteria | 1729 |
| 297 | Ga0501044_0314354 | 3300049823 | Bacteria | 1492 |
| 298 | nmdc:mga03683_57944_c1 | 3300050489 | Bacteria | 1632 |
| 299 | nmdc:mga00v17_273_c1 | 3300050491 | Bacteria | 30498 |
| 300 | nmdc:mga00v17_42_c1 | 3300050491 | Bacteria | 79984 |
| 301 | nmdc:mga00v17_457_c1 | 3300050491 | Bacteria | 22863 |
| 302 | nmdc:mga00v17_8788_c1 | 3300050491 | Bacteria | 5442 |
| 303 | nmdc:mga0yw44_11102_c1 | 3300050492 | Bacteria | 4631 |
| 304 | nmdc:mga0yw44_18730_c1 | 3300050492 | Bacteria | 3800 |
| 305 | nmdc:mga0yw44_524_c1 | 3300050492 | Bacteria | 13742 |
| 306 | nmdc:mga06z11_40104_c1 | 3300050494 | Bacteria | 2335 |
| 307 | nmdc:mga04h51_4990_c1 | 3300050495 | Bacteria | 3349 |
| 308 | nmdc:mga0sz30_197_c1 | 3300050516 | Bacteria | 22540 |
| 309 | Ga0495619_0106202 | 3300053085 | Bacteria | 1915 |
| 310 | Ga0500578_0036521 | 3300053086 | Bacteria | 3155 |
| 311 | Ga0500581_002510 | 3300053089 | Bacteria | 8048 |
| 312 | Ga0500651_0197915 | 3300053093 | Bacteria | 1187 |
| 313 | Ga0500560_000019 | 3300053107 | Bacteria | 20063 |
| 314 | Ga0500560_000279 | 3300053107 | Bacteria | 6438 |
| 315 | Ga0500572_003810 | 3300053111 | Bacteria | 3426 |
| 316 | Ga0500618_000175 | 3300053125 | Bacteria | 53230 |
| 317 | Ga0500618_000271 | 3300053125 | Bacteria | 39933 |
| 318 | Ga0500618_000356 | 3300053125 | Bacteria | 31771 |
| 319 | Ga0500618_007572 | 3300053125 | Bacteria | 3085 |
| 320 | Ga0500658_0001984 | 3300053134 | Bacteria | 8000 |
| 321 | Ga0500561_0000107 | 3300053137 | Bacteria | 16095 |
| 322 | Ga0500568_0000204 | 3300053139 | Bacteria | 52334 |
| 323 | Ga0500568_0000382 | 3300053139 | Bacteria | 33853 |
| 324 | Ga0500573_0001030 | 3300053140 | Bacteria | 12870 |
| 325 | Ga0500590_000026 | 3300053148 | Bacteria | 36766 |
| 326 | Ga0500616_0000341 | 3300053153 | Bacteria | 66760 |
| 327 | Ga0500616_0022490 | 3300053153 | Bacteria | 3518 |
| 328 | Ga0500622_0000973 | 3300053156 | Bacteria | 24257 |
| 329 | Ga0500624_000700 | 3300053157 | Bacteria | 8417 |
| 330 | Ga0500633_0001859 | 3300053160 | Bacteria | 4151 |
| 331 | Ga0500634_0001772 | 3300053161 | Bacteria | 8672 |
| 332 | Ga0500634_0004085 | 3300053161 | Bacteria | 6670 |
| 333 | Ga0500634_0004915 | 3300053161 | Bacteria | 6271 |
| 334 | Ga0500636_0000001 | 3300053177 | Bacteria | 324086 |
| 335 | Ga0500636_0000044 | 3300053177 | Bacteria | 66762 |
| 336 | Ga0500636_0004690 | 3300053177 | Bacteria | 7760 |
| 337 | Ga0501082_0006930 | 3300060353 | Bacteria | 9794 |
| 338 | 2509073414 | 2508501114 | Bacteria | 7082538 |
| 339 | 2509110810 | 2508501122 | Bacteria | 6292184 |
| 340 | 2509378536 | 2509276019 | Bacteria | 6802256 |
| 341 | 2510136439 | 2510065019 | Bacteria | 6903379 |
| 342 | 2510304637 | 2510065057 | Bacteria | 6649661 |
| 343 | 2510843237 | 2510461069 | Bacteria | 5505000 |
| 344 | 2510892317 | 2510461076 | Bacteria | 8618824 |
| 345 | 2511173275 | 2510917026 | Bacteria | 7046020 |
| 346 | 2511499833 | 2511231052 | Bacteria | 6974333 |
| 347 | 2512530230 | 2512047086 | Bacteria | 6850303 |
| 348 | 2512974800 | 2512875026 | Bacteria | 6861065 |
| 349 | 2513568072 | 2513237084 | Bacteria | 7231967 |
| 350 | 2513578380 | 2513237085 | Bacteria | 7695351 |
| 351 | 2513584847 | 2513237086 | Bacteria | 7265287 |
| 352 | 2513603865 | 2513237089 | Bacteria | 6553624 |
| 353 | 2513617392 | 2513237091 | Bacteria | 6900273 |
| 354 | 2513621143 | 2513237091 | Bacteria | 6900273 |
| 355 | 2513631014 | 2513237093 | Bacteria | 7545552 |
| 356 | 2513883070 | 2513237140 | Bacteria | 7076289 |
| 357 | 2513903125 | 2513237143 | Bacteria | 6664116 |
| 358 | 2513984770 | 2513237156 | Bacteria | 6402557 |
| 359 | 2514001149 | 2513237159 | Bacteria | 6810126 |
| 360 | 2514004179 | 2513237160 | Bacteria | 6650282 |
| 361 | 2514021115 | 2513237162 | Bacteria | 7468464 |
| 362 | 2515108601 | 2515075009 | Bacteria | 7288508 |
| 363 | 2515609892 | 2515154107 | Bacteria | 6795637 |
| 364 | 2515632225 | 2515154113 | Bacteria | 7807172 |
| 365 | 2515658322 | 2515154116 | Bacteria | 7552979 |
| 366 | 2515738110 | 2515154134 | Bacteria | 7220242 |
| 367 | 2516206622 | 2516143018 | Bacteria | 6951533 |
| 368 | 2516897397 | 2516653046 | Bacteria | 6989037 |
| 369 | 2517041210 | 2516653077 | Bacteria | 7555578 |
| 370 | 2517080166 | 2516653085 | Bacteria | 7346596 |
| 371 | 2517098165 | 2517093000 | Bacteria | 7412387 |
| 372 | 2517567447 | 2517487022 | Bacteria | 7227575 |
| 373 | 2524452383 | 2524023207 | Bacteria | 6813453 |
| 374 | 2524457165 | 2524023209 | Bacteria | 6679728 |
| 375 | 2524459746 | 2524023209 | Bacteria | 6679728 |
| 376 | 2530649014 | 2529292951 | Bacteria | 6916614 |
| 377 | 2535520442 | 2534681796 | Bacteria | 7146037 |
| 378 | 2537875925 | 2537561587 | Bacteria | 5425293 |
| 379 | 2551677426 | 2551306084 | Bacteria | 8942552 |
| 380 | 2551687825 | 2551306085 | Bacteria | 7347181 |
| 381 | 2551691469 | 2551306086 | Bacteria | 6843938 |
| 382 | 2551692577 | 2551306086 | Bacteria | 6843938 |
| 383 | 2551700510 | 2551306087 | Bacteria | 7351905 |
| 384 | 2551712948 | 2551306089 | Bacteria | 7162724 |
| 385 | 2551718227 | 2551306090 | Bacteria | 7953713 |
| 386 | 2551725073 | 2551306091 | Bacteria | 7086830 |
| 387 | 2551728044 | 2551306091 | Bacteria | 7086830 |
| 388 | 2551737383 | 2551306092 | Bacteria | 6992595 |
| 389 | 2551738667 | 2551306092 | Bacteria | 6992595 |
| 390 | 2551743994 | 2551306093 | Bacteria | 7064773 |
| 391 | 2554245819 | 2554235003 | Bacteria | 5877155 |
| 392 | 2558861929 | 2558860100 | Bacteria | 8458965 |
| 393 | 2559296414 | 2558860242 | Bacteria | 5568029 |
| 394 | 2561468486 | 2558860983 | Bacteria | 4133860 |
| 395 | 2585168520 | 2582581283 | Bacteria | 6030556 |
| 396 | 2585169527 | 2582581283 | Bacteria | 6030556 |
| 397 | 2585231184 | 2582581299 | Bacteria | 6518058 |
| 398 | 2585257947 | 2582581304 | Bacteria | 5831370 |
| 399 | 2585397739 | 2582581866 | Bacteria | 6859583 |
| 400 | 2585525586 | 2585427526 | Bacteria | 7258840 |
| 401 | 2585996346 | 2585427633 | Bacteria | 6413184 |
| 402 | 2585997544 | 2585427633 | Bacteria | 6413184 |
| 403 | 2586000954 | 2585427634 | Bacteria | 6455027 |
| 404 | 2586002150 | 2585427634 | Bacteria | 6455027 |
| 405 | 2597816253 | 2597489875 | Bacteria | 7010078 |
| 406 | 2599334003 | 2599185156 | Bacteria | 5403036 |
| 407 | 2599605538 | 2599185210 | Bacteria | 5624189 |
| 408 | 2599721867 | 2599185236 | Bacteria | 6875203 |
| 409 | 2600197060 | 2599185352 | Bacteria | 7228948 |
| 410 | 2600197973 | 2599185352 | Bacteria | 7228948 |
| 411 | 2600374311 | 2600254933 | Bacteria | 4750527 |
| 412 | 2601611740 | 2600255279 | Bacteria | 5605316 |
| 413 | 2601749529 | 2600255308 | Bacteria | 5611129 |
| 414 | 2643777630 | 2643221551 | Bacteria | 3750538 |
| 415 | 2643796078 | 2643221555 | Bacteria | 3749717 |
| 416 | 2643806390 | 2643221557 | Bacteria | 7184309 |
| 417 | 2643813877 | 2643221558 | Bacteria | 5460675 |
| 418 | 2643911984 | 2643221580 | Bacteria | 3816678 |
| 419 | 2643917682 | 2643221582 | Bacteria | 5804683 |
| 420 | 2644106104 | 2643221618 | Bacteria | 7717186 |
| 421 | 2644106380 | 2643221618 | Bacteria | 7717186 |
| 422 | 2644106523 | 2643221618 | Bacteria | 7717186 |
| 423 | 2644145986 | 2643221626 | Bacteria | 8069654 |
| 424 | 2644146933 | 2643221626 | Bacteria | 8069654 |
| 425 | 2644149238 | 2643221626 | Bacteria | 8069654 |
| 426 | 2644308405 | 2643221655 | Bacteria | 7722067 |
| 427 | 2644308457 | 2643221655 | Bacteria | 7722067 |
| 428 | 2644310715 | 2643221655 | Bacteria | 7722067 |
| 429 | 2644331822 | 2643221659 | Bacteria | 7890716 |
| 430 | 2644332118 | 2643221659 | Bacteria | 7890716 |
| 431 | 2644334498 | 2643221659 | Bacteria | 7890716 |
| 432 | 2644379336 | 2643221668 | Bacteria | 7306521 |
| 433 | 2644380057 | 2643221668 | Bacteria | 7306521 |
| 434 | 2644412348 | 2643221674 | Bacteria | 3919126 |
| 435 | 2644415178 | 2643221675 | Bacteria | 7473456 |
| 436 | 2644491890 | 2643221688 | Bacteria | 5260751 |
| 437 | 2644497198 | 2643221689 | Bacteria | 6042950 |
| 438 | 2644522783 | 2643221693 | Bacteria | 5513853 |
| 439 | 2644542202 | 2643221698 | Bacteria | 7756764 |
| 440 | 2644544492 | 2643221698 | Bacteria | 7756764 |
| 441 | 2644545303 | 2643221698 | Bacteria | 7756764 |
| 442 | 2644615650 | 2643221712 | Bacteria | 7729434 |
| 443 | 2644615793 | 2643221712 | Bacteria | 7729434 |
| 444 | 2644616549 | 2643221712 | Bacteria | 7729434 |
| 445 | 2644672383 | 2643221723 | Bacteria | 7095460 |
| 446 | 2644674622 | 2643221723 | Bacteria | 7095460 |
| 447 | 2657684285 | 2657244999 | Bacteria | 5946535 |
| 448 | 2692318159 | 2690316117 | Bacteria | 6800650 |
| 449 | 2725947844 | 2724679232 | Bacteria | 7646494 |
| 450 | 2753463928 | 2751185821 | Bacteria | 6189929 |
| 451 | 2757569340 | 2757320392 | Bacteria | 3737298 |
| 452 | 2758638515 | 2758568016 | Bacteria | 5645291 |
| 453 | 2766065125 | 2765235942 | Bacteria | 7445910 |
| 454 | 2774868970 | 2773857925 | Bacteria | 6472445 |
| 455 | 2792621377 | 2791355091 | Bacteria | 6135441 |
| 456 | 2792627935 | 2791355092 | Bacteria | 6248105 |
| 457 | 2792643372 | 2791355094 | Bacteria | 7011481 |
| 458 | 2793280705 | 2791355253 | Bacteria | 5171699 |
| 459 | 2793332011 | 2791355261 | Bacteria | 6661293 |
| 460 | 2802718358 | 2802428858 | Bacteria | 6636079 |
| 461 | 2802724065 | 2802428859 | Bacteria | 6667919 |
| 462 | 2802725848 | 2802428859 | Bacteria | 6667919 |
| 463 | 2802731444 | 2802428860 | Bacteria | 6525526 |
| 464 | 2802736365 | 2802428861 | Bacteria | 6534206 |
| 465 | 2802744339 | 2802428862 | Bacteria | 6633353 |
| 466 | 2802750071 | 2802428863 | Bacteria | 6410669 |
| 467 | 2802752025 | 2802428863 | Bacteria | 6410669 |
| 468 | 2804754247 | 2802429268 | Bacteria | 6094027 |
| 469 | 2808988634 | 2808606387 | Bacteria | 5697198 |
| 470 | 2819557796 | 2818991439 | Bacteria | 6907412 |
| 471 | 2819684975 | 2818991461 | Bacteria | 7026071 |
| 472 | 2821127444 | 2821123053 | Bacteria | 7836056 |
| 473 | 2838069162 | 2838068647 | Bacteria | 6208656 |
| 474 | 2838679807 | 2838675328 | Bacteria | 4909118 |
| 475 | 2838687477 | 2838686498 | Bacteria | 7807632 |
| 476 | 2838717423 | 2838714209 | Bacteria | 5525906 |
| 477 | 2838724376 | 2838719591 | Bacteria | 5523910 |
| 478 | 2838729307 | 2838724970 | Bacteria | 4908691 |
| 479 | 2838734111 | 2838729681 | Bacteria | 7400765 |
| 480 | 2838737969 | 2838736955 | Bacteria | 5760694 |
| 481 | 2838746563 | 2838742623 | Bacteria | 7396178 |
| 482 | 2840880247 | 2840878972 | Bacteria | 5483153 |
| 483 | 2841734662 | 2841734538 | Bacteria | 6784580 |
| 484 | 2841841662 | 2841840854 | Bacteria | 5761912 |
| 485 | 2841850734 | 2841846520 | Bacteria | 5345850 |
| 486 | 2841854027 | 2841851746 | Bacteria | 7532261 |
| 487 | 2841864018 | 2841859092 | Bacteria | 5436171 |
| 488 | 2842116717 | 2842110456 | Bacteria | 7656360 |
| 489 | 2842129539 | 2842124991 | Bacteria | 5346824 |
| 490 | 2842134684 | 2842130223 | Bacteria | 4909145 |
| 491 | 2842141440 | 2842140634 | Bacteria | 5759631 |
| 492 | 2842156798 | 2842152218 | Bacteria | 4908957 |
| 493 | 2842159606 | 2842156927 | Bacteria | 6894975 |
| 494 | 2842164055 | 2842163707 | Bacteria | 6916235 |
| 495 | 2842173056 | 2842170452 | Bacteria | 5525737 |
| 496 | 2842180416 | 2842175837 | Bacteria | 4908771 |
| 497 | 2842182824 | 2842180545 | Bacteria | 6888678 |
| 498 | 2842191925 | 2842187318 | Bacteria | 5524014 |
| 499 | 2842216241 | 2842211629 | Bacteria | 5523832 |
| 500 | 2842221601 | 2842217011 | Bacteria | 7497767 |
| 501 | 2842228961 | 2842224351 | Bacteria | 5524473 |
| 502 | 2842232535 | 2842229732 | Bacteria | 7475766 |
| 503 | 2842247222 | 2842243621 | Bacteria | 7421798 |
| 504 | 2842259091 | 2842257432 | Bacteria | 7401195 |
| 505 | 2842265537 | 2842264693 | Bacteria | 6472963 |
| 506 | 2842272489 | 2842271015 | Bacteria | 7807131 |
| 507 | 2842299281 | 2842298080 | Bacteria | 6123127 |
| 508 | 2842301651 | 2842298080 | Bacteria | 6123127 |
| 509 | 2842309823 | 2842304105 | Bacteria | 7023636 |
| 510 | 2842334371 | 2842333319 | Bacteria | 8899485 |
| 511 | 2842358748 | 2842357229 | Bacteria | 6485165 |
| 512 | 2842361780 | 2842357229 | Bacteria | 6485165 |
| 513 | 2842422352 | 2842422224 | Bacteria | 6239196 |
| 514 | 2842428413 | 2842428310 | Bacteria | 6767288 |
| 515 | 2842435027 | 2842434925 | Bacteria | 6502746 |
| 516 | 2842442111 | 2842441272 | Bacteria | 6769273 |
| 517 | 2842449491 | 2842447887 | Bacteria | 6754142 |
| 518 | 2842466640 | 2842462802 | Bacteria | 6588055 |
| 519 | 2842469359 | 2842469257 | Bacteria | 6752936 |
| 520 | 2842512178 | 2842509118 | Bacteria | 6850950 |
| 521 | 2842513450 | 2842509118 | Bacteria | 6850950 |
| 522 | 2842520800 | 2842515876 | Bacteria | 5436280 |
| 523 | 2842526876 | 2842521101 | Bacteria | 6569494 |
| 524 | 2842925718 | 2842922631 | Bacteria | 5824079 |
| 525 | 2842927033 | 2842922631 | Bacteria | 5824079 |
| 526 | 2844165814 | 2844163670 | Bacteria | 7266046 |
| 527 | 2844166777 | 2844163670 | Bacteria | 7266046 |
| 528 | 2844460473 | 2844454524 | Bacteria | 7952546 |
| 529 | 2847423336 | 2847417321 | Bacteria | 6913799 |
| 530 | 2848997211 | 2848992105 | Bacteria | 6810864 |
| 531 | 2850084033 | 2850079185 | Bacteria | 6848280 |
| 532 | 2852394570 | 2852387548 | Bacteria | 8025568 |
| 533 | 2852395231 | 2852387548 | Bacteria | 8025568 |
| 534 | 2854684840 | 2854681122 | Bacteria | 4548679 |
| 535 | 2854901135 | 2854896431 | Bacteria | 5869725 |
| 536 | 2854918526 | 2854916844 | Bacteria | 5725939 |
| 537 | 2854920244 | 2854916844 | Bacteria | 5725939 |
| 538 | 2855830206 | 2855825444 | Bacteria | 6785811 |
| 539 | 2855830707 | 2855825444 | Bacteria | 6785811 |
| 540 | 2855845520 | 2855839649 | Bacteria | 7135830 |
| 541 | 2855845998 | 2855839649 | Bacteria | 7135830 |
| 542 | 2855874472 | 2855872281 | Bacteria | 6964271 |
| 543 | 2856320232 | 2856314179 | Bacteria | 6477897 |
| 544 | 2856345633 | 2856342000 | Bacteria | 7176905 |
| 545 | 2857357303 | 2857349434 | Bacteria | 7926032 |
| 546 | 2857518044 | 2857516855 | Bacteria | 7787325 |
| 547 | 2857536542 | 2857531043 | Bacteria | 6754041 |
| 548 | 2858804327 | 2858800743 | Bacteria | 6603254 |
| 549 | 2858805387 | 2858800743 | Bacteria | 6603254 |
| 550 | 2871476348 | 2871474448 | Bacteria | 6806570 |
| 551 | 2878042540 | 2878035449 | Bacteria | 6555736 |
| 552 | 2878793525 | 2878788777 | Bacteria | 6567085 |
| 553 | 2882457462 | 2882456835 | Bacteria | 6863978 |
| 554 | 2885346216 | 2885342637 | Bacteria | 7011821 |
| 555 | 2885355118 | 2885350715 | Bacteria | 6787678 |
| 556 | 2889791407 | 2889790730 | Bacteria | 5689708 |
| 557 | 2889920184 | 2889914905 | Bacteria | 5702301 |
| 558 | 2896389297 | 2896384573 | Bacteria | 7700774 |
| 559 | 2899793665 | 2899792073 | Bacteria | 4926588 |
| 560 | 2899848761 | 2899845264 | Bacteria | 5672268 |
| 561 | 2906420989 | 2906414383 | Bacteria | 6580790 |
| 562 | 2913296404 | 2913295892 | Bacteria | 6333755 |
| 563 | 2915980991 | 2915980308 | Bacteria | 6624279 |
| 564 | 2915990897 | 2915986958 | Bacteria | 6739310 |
| 565 | 2915996054 | 2915993759 | Bacteria | 7016183 |
| 566 | 2915998123 | 2915993759 | Bacteria | 7016183 |
| 567 | 2916003037 | 2916000859 | Bacteria | 6865702 |
| 568 | 2916009166 | 2916007675 | Bacteria | 6898660 |
| 569 | 2916009278 | 2916007675 | Bacteria | 6898660 |
| 570 | 2916017178 | 2916014648 | Bacteria | 6946486 |
| 571 | 2916019280 | 2916014648 | Bacteria | 6946486 |
| 572 | 2916025671 | 2916021584 | Bacteria | 6854472 |
| 573 | 2916030672 | 2916028427 | Bacteria | 6748433 |
| 574 | 2916034019 | 2916028427 | Bacteria | 6748433 |
| 575 | 2916037986 | 2916035215 | Bacteria | 6755766 |
| 576 | 2916041027 | 2916035215 | Bacteria | 6755766 |
| 577 | 2916043897 | 2916041962 | Bacteria | 6820487 |
| 578 | 2916048242 | 2916041962 | Bacteria | 6820487 |
| 579 | 2916052018 | 2916048683 | Bacteria | 6543552 |
| 580 | 2916053055 | 2916048683 | Bacteria | 6543552 |
| 581 | 2916060378 | 2916055098 | Bacteria | 6758838 |
| 582 | 2916060571 | 2916055098 | Bacteria | 6758838 |
| 583 | 2916075633 | 2916068649 | Bacteria | 6943657 |
| 584 | 2916077750 | 2916076590 | Bacteria | 6596108 |
| 585 | 2919119176 | 2919114240 | Bacteria | 5700270 |
| 586 | 2919174566 | 2919171160 | Bacteria | 6499771 |
| 587 | 2919177084 | 2919171160 | Bacteria | 6499771 |
| 588 | 2919682390 | 2919679072 | Bacteria | 4629602 |
| 589 | 2920828039 | 2920822456 | Bacteria | 6897201 |
| 590 | 2921207371 | 2921201388 | Bacteria | 6926299 |
| 591 | 2921208296 | 2921201388 | Bacteria | 6926299 |
| 592 | 2921211949 | 2921208531 | Bacteria | 6745326 |
| 593 | 2921215247 | 2921208531 | Bacteria | 6745326 |
| 594 | 2921241830 | 2921237296 | Bacteria | 6876710 |
| 595 | 2921243191 | 2921237296 | Bacteria | 6876710 |
| 596 | 2921248397 | 2921244191 | Bacteria | 6568419 |
| 597 | 2921251331 | 2921250672 | Bacteria | 6677771 |
| 598 | 2921262163 | 2921257292 | Bacteria | 6808382 |
| 599 | 2921263033 | 2921257292 | Bacteria | 6808382 |
| 600 | 2921267850 | 2921263974 | Bacteria | 6864552 |
| 601 | 2921269587 | 2921263974 | Bacteria | 6864552 |
| 602 | 2921285376 | 2921282425 | Bacteria | 6826397 |
| 603 | 2921295418 | 2921289301 | Bacteria | 7316391 |
| 604 | 2921297070 | 2921296804 | Bacteria | 7176999 |
| 605 | 2921302884 | 2921296804 | Bacteria | 7176999 |
| 606 | 2924144629 | 2924144063 | Bacteria | 6883928 |
| 607 | 2924152435 | 2924150972 | Bacteria | 7169444 |
| 608 | 2924152981 | 2924150972 | Bacteria | 7169444 |
| 609 | 2924161175 | 2924158325 | Bacteria | 7188855 |
| 610 | 2924161498 | 2924158325 | Bacteria | 7188855 |
| 611 | 2924167132 | 2924165586 | Bacteria | 7260590 |
| 612 | 2924175991 | 2924172951 | Bacteria | 6749356 |
| 613 | 2924178751 | 2924172951 | Bacteria | 6749356 |
| 614 | 2924184498 | 2924179722 | Bacteria | 6843264 |
| 615 | 2924186603 | 2924186466 | Bacteria | 6876637 |
| 616 | 2924194487 | 2924193448 | Bacteria | 6955718 |
| 617 | 2924197581 | 2924193448 | Bacteria | 6955718 |
| 618 | 2924202038 | 2924200457 | Bacteria | 6757188 |
| 619 | 2924208456 | 2924207177 | Bacteria | 6917007 |
| 620 | 2924209765 | 2924207177 | Bacteria | 6917007 |
| 621 | 2924219053 | 2924214083 | Bacteria | 7080103 |
| 622 | 2924223078 | 2924221636 | Bacteria | 7113495 |
| 623 | 2924223438 | 2924221636 | Bacteria | 7113495 |
| 624 | 2924229261 | 2924228884 | Bacteria | 6633132 |
| 625 | 2924229659 | 2924228884 | Bacteria | 6633132 |
| 626 | 2926759208 | 2926754445 | Bacteria | 5964435 |
| 627 | 2926763362 | 2926760298 | Bacteria | 5505990 |
| 628 | 2928525522 | 2928521798 | Bacteria | 4960112 |
| 629 | 2929142661 | 2929138655 | Bacteria | 5810547 |
| 630 | 2929143234 | 2929138655 | Bacteria | 5810547 |
| 631 | 2933011403 | 2933006813 | Bacteria | 4912075 |
| 632 | 2933016587 | 2933011516 | Bacteria | 5439334 |
| 633 | 2933576265 | 2933570622 | Bacteria | 7023390 |
| 634 | 2933592933 | 2933586486 | Bacteria | 7667493 |
| 635 | 2933596026 | 2933594066 | Bacteria | 5594265 |
| 636 | 2933599827 | 2933599457 | Bacteria | 5858799 |
| 637 | 2935903156 | 2935901341 | Bacteria | 7341747 |
| 638 | 2936374384 | 2936367885 | Bacteria | 7324495 |
| 639 | 2936378774 | 2936375103 | Bacteria | 6652732 |
| 640 | 2937000317 | 2936996657 | Bacteria | 6298727 |
| 641 | 2937006313 | 2937002841 | Bacteria | 6934057 |
| 642 | 2937009168 | 2937002841 | Bacteria | 6934057 |
| 643 | 2937011493 | 2937009748 | Bacteria | 6746052 |
| 644 | 2937017597 | 2937016420 | Bacteria | 6782579 |
| 645 | 2937019917 | 2937016420 | Bacteria | 6782579 |
| 646 | 2937023586 | 2937023124 | Bacteria | 6815156 |
| 647 | 2937026999 | 2937023124 | Bacteria | 6815156 |
| 648 | 2937035921 | 2937029754 | Bacteria | 6424026 |
| 649 | 2937036387 | 2937036028 | Bacteria | 6846469 |
| 650 | 2937043377 | 2937042894 | Bacteria | 6741576 |
| 651 | 2937049185 | 2937042894 | Bacteria | 6741576 |
| 652 | 2937050268 | 2937049772 | Bacteria | 6757901 |
| 653 | 2937056024 | 2937049772 | Bacteria | 6757901 |
| 654 | 2937061061 | 2937056579 | Bacteria | 7107896 |
| 655 | 2937068283 | 2937063883 | Bacteria | 7199456 |
| 656 | 2937074105 | 2937071275 | Bacteria | 6984483 |
| 657 | 2937077075 | 2937071275 | Bacteria | 6984483 |
| 658 | 2937091376 | 2937084907 | Bacteria | 6618516 |
| 659 | 2937092701 | 2937091812 | Bacteria | 6979387 |
| 660 | 2937093484 | 2937091812 | Bacteria | 6979387 |
| 661 | 2937103933 | 2937098957 | Bacteria | 7249374 |
| 662 | 2937104305 | 2937098957 | Bacteria | 7249374 |
| 663 | 2937111693 | 2937106411 | Bacteria | 6947143 |
| 664 | 2937113429 | 2937106411 | Bacteria | 6947143 |
| 665 | 2937116580 | 2937113482 | Bacteria | 6505872 |
| 666 | 2937120457 | 2937119839 | Bacteria | 6597547 |
| 667 | 2937123295 | 2937119839 | Bacteria | 6597547 |
| 668 | 2937128692 | 2937126314 | Bacteria | 6771275 |
| 669 | 2937132881 | 2937126314 | Bacteria | 6771275 |
| 670 | 2937842798 | 2937836603 | Bacteria | 6811263 |
| 671 | 2941505198 | 2941499720 | Bacteria | 7599444 |
| 672 | 2954012436 | 2954011201 | Bacteria | 4762601 |
| 673 | 2957386793 | 2957382221 | Bacteria | 6737050 |
| 674 | 2957394578 | 2957388812 | Bacteria | 6778072 |
| 675 | 2957396283 | 2957395598 | Bacteria | 6822399 |
| 676 | 2957399163 | 2957395598 | Bacteria | 6822399 |
| 677 | 2957407043 | 2957402308 | Bacteria | 6741770 |
| 678 | 2957409288 | 2957408893 | Bacteria | 6558585 |
| 679 | 2957413615 | 2957408893 | Bacteria | 6558585 |
| 680 | 2957415472 | 2957415311 | Bacteria | 6991633 |
| 681 | 2957420899 | 2957415311 | Bacteria | 6991633 |
| 682 | 2957426612 | 2957422303 | Bacteria | 7172205 |
| 683 | 2957430886 | 2957430029 | Bacteria | 7022557 |
| 684 | 2957430914 | 2957430029 | Bacteria | 7022557 |
| 685 | 2957439615 | 2957437181 | Bacteria | 6568994 |
| 686 | 2957444861 | 2957443900 | Bacteria | 6869977 |
| 687 | 2957449628 | 2957443900 | Bacteria | 6869977 |
| 688 | 2957453066 | 2957450854 | Bacteria | 6765715 |
| 689 | 2957463503 | 2957457609 | Bacteria | 6967680 |
| 690 | 2957464598 | 2957457609 | Bacteria | 6967680 |
| 691 | 2957465160 | 2957464669 | Bacteria | 6568877 |
| 692 | 2957473721 | 2957471148 | Bacteria | 6797643 |
| 693 | 2957476949 | 2957471148 | Bacteria | 6797643 |
| 694 | 2957480866 | 2957478035 | Bacteria | 6756658 |
| 695 | 2957483551 | 2957478035 | Bacteria | 6756658 |
| 696 | 2957487432 | 2957484790 | Bacteria | 6703082 |
| 697 | 2957489430 | 2957484790 | Bacteria | 6703082 |
| 698 | 2957491867 | 2957491536 | Bacteria | 6695180 |
| 699 | 2957502881 | 2957498199 | Bacteria | 7126688 |
| 700 | 2957503407 | 2957498199 | Bacteria | 7126688 |
| 701 | 2957505765 | 2957505466 | Bacteria | 7253085 |
| 702 | 2958074898 | 2958071322 | Bacteria | 6815895 |
| 703 | 2960587896 | 2960584000 | Bacteria | 6864594 |
| 704 | 2960592497 | 2960591022 | Bacteria | 6622873 |
| 705 | 2960601134 | 2960597568 | Bacteria | 6550735 |
| 706 | 2960605638 | 2960603979 | Bacteria | 6898737 |
| 707 | 2960606780 | 2960603979 | Bacteria | 6898737 |
| 708 | 2960612737 | 2960610863 | Bacteria | 6691244 |
| 709 | 2960614971 | 2960610863 | Bacteria | 6691244 |
| 710 | 2960621989 | 2960617483 | Bacteria | 6727748 |
| 711 | 2960623831 | 2960617483 | Bacteria | 6727748 |
| 712 | 2960628541 | 2960624210 | Bacteria | 6875384 |
| 713 | 2960628956 | 2960624210 | Bacteria | 6875384 |
| 714 | 2960632236 | 2960631154 | Bacteria | 6732508 |
| 715 | 2960636118 | 2960631154 | Bacteria | 6732508 |
| 716 | 2960643344 | 2960637947 | Bacteria | 7296468 |
| 717 | 2960646955 | 2960645483 | Bacteria | 7211087 |
| 718 | 2960656934 | 2960652885 | Bacteria | 7083688 |
| 719 | 2960661575 | 2960660292 | Bacteria | 7041660 |
| 720 | 2960666301 | 2960660292 | Bacteria | 7041660 |
| 721 | 2960670382 | 2960667422 | Bacteria | 6763020 |
| 722 | 2960676211 | 2960674078 | Bacteria | 6609048 |
| 723 | 2960681134 | 2960680706 | Bacteria | 6624464 |
| 724 | 2960693397 | 2960687367 | Bacteria | 6535474 |
| 725 | 2964614724 | 2964607997 | Bacteria | 7101408 |
| 726 | 2964618856 | 2964615318 | Bacteria | 6809089 |
| 727 | 2964620522 | 2964615318 | Bacteria | 6809089 |
| 728 | 2964625541 | 2964621998 | Bacteria | 6834995 |
| 729 | 2964634850 | 2964628898 | Bacteria | 7083044 |
| 730 | 2964637976 | 2964636051 | Bacteria | 7091832 |
| 731 | 2964638516 | 2964636051 | Bacteria | 7091832 |
| 732 | 2964644283 | 2964643177 | Bacteria | 6820887 |
| 733 | 2964651108 | 2964649959 | Bacteria | 6675118 |
| 734 | 2964653251 | 2964649959 | Bacteria | 6675118 |
| 735 | 2964659871 | 2964656573 | Bacteria | 7100150 |
| 736 | 2964662670 | 2964656573 | Bacteria | 7100150 |
| 737 | 2964664242 | 2964663802 | Bacteria | 7019362 |
| 738 | 2964666392 | 2964663802 | Bacteria | 7019362 |
| 739 | 2964673234 | 2964670856 | Bacteria | 6851364 |
| 740 | 2964678581 | 2964678106 | Bacteria | 6792020 |
| 741 | 2964680308 | 2964678106 | Bacteria | 6792020 |
| 742 | 2964691590 | 2964685014 | Bacteria | 6839111 |
| 743 | 2964695479 | 2964691889 | Bacteria | 6802758 |
| 744 | 2964696707 | 2964691889 | Bacteria | 6802758 |
| 745 | 2964699749 | 2964698721 | Bacteria | 6765331 |
| 746 | 2964708790 | 2964705432 | Bacteria | 7114648 |
| 747 | 2964712528 | 2964705432 | Bacteria | 7114648 |
| 748 | 2964718126 | 2964712639 | Bacteria | 6695970 |
| 749 | 2964723560 | 2964719344 | Bacteria | 7286602 |
| 750 | 2965062944 | 2965062239 | Bacteria | 7412989 |
| 751 | 2967665085 | 2967664464 | Bacteria | 6948836 |
| 752 | 2967665948 | 2967664464 | Bacteria | 6948836 |
| 753 | 2967672763 | 2967671571 | Bacteria | 7021409 |
| 754 | 2967678050 | 2967671571 | Bacteria | 7021409 |
| 755 | 2967679001 | 2967678726 | Bacteria | 7264382 |
| 756 | 2967683729 | 2967678726 | Bacteria | 7264382 |
| 757 | 2967692004 | 2967686174 | Bacteria | 6678622 |
| 758 | 2967694006 | 2967693043 | Bacteria | 6804451 |
| 759 | 2967697593 | 2967693043 | Bacteria | 6804451 |
| 760 | 2967701900 | 2967699805 | Bacteria | 6854538 |
| 761 | 2967703464 | 2967699805 | Bacteria | 6854538 |
| 762 | 2967707836 | 2967706974 | Bacteria | 7186053 |
| 763 | 2967708353 | 2967706974 | Bacteria | 7186053 |
| 764 | 2967718006 | 2967714385 | Bacteria | 7000047 |
| 765 | 2967719354 | 2967714385 | Bacteria | 7000047 |
| 766 | 2967724429 | 2967721400 | Bacteria | 7073753 |
| 767 | 2967725222 | 2967721400 | Bacteria | 7073753 |
| 768 | 2967729126 | 2967728569 | Bacteria | 6641507 |
| 769 | 2967740413 | 2967735183 | Bacteria | 6827012 |
| 770 | 2967747726 | 2967742019 | Bacteria | 6794534 |
| 771 | 2967755251 | 2967748971 | Bacteria | 6733771 |
| 772 | 2967760492 | 2967755722 | Bacteria | 6814706 |
| 773 | 2967760812 | 2967755722 | Bacteria | 6814706 |
| 774 | 2967763462 | 2967762386 | Bacteria | 6923502 |
| 775 | 2967768374 | 2967762386 | Bacteria | 6923502 |
| 776 | 2967770216 | 2967769361 | Bacteria | 6587838 |
| 777 | 2967781886 | 2967775926 | Bacteria | 6738189 |
| 778 | 2967781948 | 2967775926 | Bacteria | 6738189 |
| 779 | 2968092051 | 2968091066 | Bacteria | 6052692 |
| 780 | 2970024605 | 2970019648 | Bacteria | 7072033 |
| 781 | 2970025242 | 2970019648 | Bacteria | 7072033 |
| 782 | 2970029663 | 2970026789 | Bacteria | 6785236 |
| 783 | 2970039883 | 2970033650 | Bacteria | 7118744 |
| 784 | 2970045155 | 2970040964 | Bacteria | 6731123 |
| 785 | 2970047277 | 2970040964 | Bacteria | 6731123 |
| 786 | 2970054713 | 2970047711 | Bacteria | 7088379 |
| 787 | 2970060133 | 2970054988 | Bacteria | 6611507 |
| 788 | 2970063488 | 2970061556 | Bacteria | 7099761 |
| 789 | 2970063669 | 2970061556 | Bacteria | 7099761 |
| 790 | 2970069743 | 2970068827 | Bacteria | 7123112 |
| 791 | 2970082109 | 2970076120 | Bacteria | 6697332 |
| 792 | 2970091420 | 2970088815 | Bacteria | 6933825 |
| 793 | 2970093035 | 2970088815 | Bacteria | 6933825 |
| 794 | 2970099987 | 2970095765 | Bacteria | 6936963 |
| 795 | 2970103109 | 2970102677 | Bacteria | 6812532 |
| 796 | 2970107062 | 2970102677 | Bacteria | 6812532 |
| 797 | 2970110328 | 2970109326 | Bacteria | 6863976 |
| 798 | 2970112559 | 2970109326 | Bacteria | 6863976 |
| 799 | 2970117074 | 2970116247 | Bacteria | 6501857 |
| 800 | 2970124180 | 2970122695 | Bacteria | 6625855 |
| 801 | 2970129884 | 2970129317 | Bacteria | 6806560 |
| 802 | 2970133122 | 2970129317 | Bacteria | 6806560 |
| 803 | 2970138061 | 2970136068 | Bacteria | 7207982 |
| 804 | 2970139195 | 2970136068 | Bacteria | 7207982 |
| 805 | 2970144926 | 2970143518 | Bacteria | 6446480 |
| 806 | 2970152570 | 2970149975 | Bacteria | 6779706 |
| 807 | 2970154694 | 2970149975 | Bacteria | 6779706 |
| 808 | 2970160918 | 2970156795 | Bacteria | 7168044 |
| 809 | 2970166608 | 2970164137 | Bacteria | 6861252 |
| 810 | 2970168758 | 2970164137 | Bacteria | 6861252 |
| 811 | 2970172488 | 2970170962 | Bacteria | 6876229 |
| 812 | 2970175395 | 2970170962 | Bacteria | 6876229 |
| 813 | 2970181342 | 2970177841 | Bacteria | 6768001 |
| 814 | 2970184625 | 2970177841 | Bacteria | 6768001 |
| 815 | 2970188571 | 2970184632 | Bacteria | 7054431 |
| 816 | 2970189886 | 2970184632 | Bacteria | 7054431 |
| 817 | 2970196197 | 2970191845 | Bacteria | 7032787 |
| 818 | 2970529533 | 2970524798 | Bacteria | 6840927 |
| 819 | 2977523583 | 2977516862 | Bacteria | 6940108 |
| 820 | 2977524237 | 2977523885 | Bacteria | 6960446 |
| 821 | 2977527847 | 2977523885 | Bacteria | 6960446 |
| 822 | 2977537278 | 2977530762 | Bacteria | 6951399 |
| 823 | 2977539492 | 2977537788 | Bacteria | 6929320 |
| 824 | 2977543022 | 2977537788 | Bacteria | 6929320 |
| 825 | 2977550106 | 2977544691 | Bacteria | 6875412 |
| 826 | 2977555433 | 2977551784 | Bacteria | 7125765 |
| 827 | 2977556541 | 2977551784 | Bacteria | 7125765 |
| 828 | 2977565299 | 2977558990 | Bacteria | 6863948 |
| 829 | 2977567416 | 2977565890 | Bacteria | 6901543 |
| 830 | 2977572468 | 2977565890 | Bacteria | 6901543 |
| 831 | 2977573435 | 2977572785 | Bacteria | 6763888 |
| 832 | 2977576693 | 2977572785 | Bacteria | 6763888 |
| 833 | 2977583389 | 2977579622 | Bacteria | 6772100 |
| 834 | 2977585339 | 2977579622 | Bacteria | 6772100 |
| 835 | 2977949353 | 2977942078 | Bacteria | 7570577 |
| 836 | 2979091605 | 2979089926 | Bacteria | 5670289 |
| 837 | 2979097126 | 2979095461 | Bacteria | 5669583 |
| 838 | 2979102836 | 2979100975 | Bacteria | 5423623 |
| 839 | 2984509275 | 2984509177 | Bacteria | 5274802 |
| 840 | 2984520025 | 2984518228 | Bacteria | 5277463 |
| 841 | 2984537604 | 2984537506 | Bacteria | 5277481 |
| 842 | 2984604353 | 2984601300 | Bacteria | 5455244 |
| 843 | 2987644693 | 2987636660 | Bacteria | 8088555 |
| 844 | 2989773021 | 2989771324 | Bacteria | 5605128 |
| 845 | 2989781364 | 2989776772 | Bacteria | 4843317 |
| 846 | 2995394612 | 2995392953 | Bacteria | 4539380 |
| 847 | 2996316373 | 2996310559 | Bacteria | 6357320 |
| 848 | 2996887423 | 2996887358 | Bacteria | 5795980 |
| 849 | 3000019256 | 3000017691 | Bacteria | 3772574 |
| 850 | 3000406375 | 3000405567 | Bacteria | 3779330 |
| 851 | 3004210845 | 3004203850 | Bacteria | 7307914 |
| 852 | 3005597260 | 3005594810 | Bacteria | 8716512 |
| 853 | 643822638 | 643692032 | Bacteria | 6891900 |
| 854 | 648737882 | 648276728 | Bacteria | 6968865 |
| 855 | 648739344 | 648276728 | Bacteria | 6968865 |
| 856 | 650842810 | 650716007 | Bacteria | 5573770 |
| 857 | 8003574832 | 8003570095 | Bacteria | 5747666 |
| 858 | 8003997528 | 8003992118 | Bacteria | 7266902 |
| 859 | 8003998214 | 8003992118 | Bacteria | 7266902 |
| 860 | 8004006165 | 8003999396 | Bacteria | 7063185 |
| 861 | 8004637625 | 8004633249 | Bacteria | 6723080 |
| 862 | 8005259884 | 8005258706 | Bacteria | 6184835 |
| 863 | 8005301669 | 8005301065 | Bacteria | 6614431 |
| 864 | 8005307925 | 8005307578 | Bacteria | 7395396 |
| 865 | 8005321950 | 8005321885 | Bacteria | 5795980 |
| 866 | 8005379813 | 8005376324 | Bacteria | 6590079 |
| 867 | 8005399151 | 8005395548 | Bacteria | 6806915 |
| 868 | 8005467225 | 8005460587 | Bacteria | 7157962 |
| 869 | 8005548194 | 8005542996 | Bacteria | 7077758 |
| 870 | 8005562345 | 8005556819 | Bacteria | 6908598 |
| 871 | 8005565507 | 8005563573 | Bacteria | 7153261 |
| 872 | 8018153476 | 8018150411 | Bacteria | 5549903 |
| 873 | 8018165516 | 8018163183 | Bacteria | 7277977 |
| 874 | 8023688077 | 8023680758 | Bacteria | 7729763 |
| 875 | 8024485024 | 8024479707 | Bacteria | 6954785 |
| 876 | 8024487608 | 8024486573 | Bacteria | 6540512 |
| 877 | 8046769100 | 8046767195 | Bacteria | 7547379 |
| 878 | 8046773427 | 8046767195 | Bacteria | 7547379 |
| 879 | 8046774589 | 8046767195 | Bacteria | 7547379 |
| 880 | 8054462142 | 8054460903 | Bacteria | 4872905 |
| 881 | 8054561487 | 8054558443 | Bacteria | 5204801 |
| 882 | 8054563949 | 8054563764 | Bacteria | 5592885 |
| 883 | 8055435285 | 8055431914 | Bacteria | 4551896 |
| 884 | 8055622894 | 8055617313 | Bacteria | 7548464 |
| 885 | 8056876891 | 8056875544 | Bacteria | 4355797 |
| 886 | 8057135757 | 8057132660 | Bacteria | 4061191 |
| 887 | 8057576501 | 8057575449 | Bacteria | 7367519 |
| 888 | 8057581370 | 8057575449 | Bacteria | 7367519 |
| 889 | 8057878005 | 8057874678 | Bacteria | 7494653 |
| 890 | JGI25159J45721_1000080 | |||
| 891 | JGI25152J39213_1005341 | |||
| 892 | JGI25159J45721_1000354 | |||
| 893 | JGI25159J45721_1000466 | |||
| 894 | JGI25159J45721_1000514 | |||
| 895 | JGI25151J46595_10011163 | |||
| 896 | JGI25151J46595_10026634 | |||
| 897 | JGI25153J46596_10000302 | |||
| 898 | rootL2_10092790 | |||
| 899 | JGI25160J50197_1000005 | |||
| 900 | JGI25160J50197_1000014 | |||
| 901 | JGI25160J50197_1000026 | |||
| 902 | JGI25160J50197_1000160 | |||
| 903 | JGI25161J50226_1000014 | |||
| 904 | JGI25161J50226_1000022 | |||
| 905 | Ga0055526_1004999 | |||
| 906 | Ga0055526_1006491 | |||
| 907 | Ga0055524_1000581 | |||
| 908 | Ga0055524_1002487 | |||
| 909 | Ga0055524_1006335 | |||
| 910 | Ga0055524_1028674 | |||
| 911 | Ga0055524_1035140 | |||
| 912 | Ga0055536_1001262 | |||
| 913 | Ga0055536_1006042 | |||
| 914 | Ga0055536_1011844 | |||
| 915 | Ga0055536_1019506 | |||
| 916 | Ga0055528_1016836 | |||
| 917 | Ga0055540_1006014 | |||
| 918 | Ga0055540_1008423 | |||
| 919 | Ga0055531_10001938 | |||
| 920 | Ga0055531_10002976 | |||
| 921 | Ga0055531_10003532 | |||
| 922 | Ga0058692_1001187 | |||
| 923 | Ga0058692_1005324 | |||
| 924 | Ga0055543_1000005 | |||
| 925 | Ga0055543_1000052 | |||
| 926 | Ga0055543_1000324 | |||
| 927 | Ga0065165_1000002 | |||
| 928 | Ga0065165_1000073 | |||
| 929 | Ga0065165_1000463 | |||
| 930 | Ga0065165_1000534 | |||
| 931 | Ga0065704_10079730 | |||
| 932 | Ga0070683_100315588 | |||
| 933 | Ga0070670_100000446 | |||
| 934 | Ga0070668_100095965 | |||
| 935 | Ga0070662_100140353 | |||
| 936 | Ga0070665_100008536 | |||
| 937 | Ga0075365_10011720 | |||
| 938 | Ga0075365_10033506 | |||
| 939 | Ga0075365_10093516 | |||
| 940 | Ga0075368_10024529 | |||
| 941 | Ga0075363_100135135 | |||
| 942 | Ga0075364_10000058 | |||
| 943 | Ga0075364_10022274 | |||
| 944 | Ga0075367_10056064 | |||
| 945 | Ga0075369_10063795 | |||
| 946 | Ga0097621_100014591 | |||
| 947 | Ga0075430_100172300 | |||
| 948 | Ga0079104_1000045 | |||
| 949 | Ga0099826_10000040 | |||
| 950 | Ga0105251_10028109 | |||
| 951 | Ga0105250_10036053 | |||
| 952 | Ga0105243_10030726 | |||
| 953 | Ga0105248_10391834 | |||
| 954 | Ga0105246_10078453 | |||
| 955 | Ga0157373_10061465 | |||
| 956 | Ga0157371_10000042 | |||
| 957 | Ga0157370_10000035 | |||
| 958 | Ga0157370_10392398 | |||
| 959 | Ga0171463_1013 | |||
| 960 | Ga0183363_1072 | |||
| 961 | Ga0214543_1000018 | |||
| 962 | Ga0228711_1023402 | |||
| 963 | Ga0228710_1002216 | |||
| 964 | Ga0228710_1022978 | |||
| 965 | Ga0209436_100101 | |||
| 966 | Ga0209436_100162 | |||
| 967 | Ga0209129_1000690 | |||
| 968 | Ga0209129_1014727 | |||
| 969 | Ga0209565_1015948 | |||
| 970 | Ga0209455_1000196 | |||
| 971 | Ga0209673_1002427 | |||
| 972 | Ga0209673_1020551 | |||
| 973 | Ga0209130_1000010 | |||
| 974 | Ga0209130_1000013 | |||
| 975 | Ga0209130_1000121 | |||
| 976 | Ga0209130_1000309 | |||
| 977 | Ga0209676_1000498 | |||
| 978 | Ga0209676_1001837 | |||
| 979 | Ga0209676_1002471 | |||
| 980 | Ga0209676_1002760 | |||
| 981 | Ga0209676_1026246 | |||
| 982 | Ga0209676_1039150 | |||
| 983 | Ga0209025_1000374 | |||
| 984 | Ga0209025_1002206 | |||
| 985 | Ga0209025_1004162 | |||
| 986 | Ga0209025_1028032 | |||
| 987 | Ga0209564_1000341 | |||
| 988 | Ga0209564_1014365 | |||
| 989 | Ga0209564_1018741 | |||
| 990 | Ga0209758_1000237 | |||
| 991 | Ga0209758_1000504 | |||
| 992 | Ga0209758_1004696 | |||
| 993 | Ga0209758_1054380 | |||
| 994 | Ga0209050_1004289 | |||
| 995 | Ga0209050_1004459 | |||
| 996 | Ga0209256_1001577 | |||
| 997 | Ga0209256_1004219 | |||
| 998 | Ga0209256_1005600 | |||
| 999 | Ga0209256_1006490 | |||
| 1000 | Ga0209256_1008108 | |||
| 1001 | Ga0209256_1035422 | |||
| 1002 | Ga0207426_1000022 | |||
| 1003 | Ga0207426_1000036 | |||
| 1004 | Ga0207426_1000075 | |||
| 1005 | Ga0207426_1000503 | |||
| 1006 | Ga0207426_1004564 | |||
| 1007 | Ga0209051_1000751 | |||
| 1008 | Ga0209051_1001177 | |||
| 1009 | Ga0209051_1005962 | |||
| 1010 | Ga0209051_1012132 | |||
| 1011 | Ga0209257_1000599 | |||
| 1012 | Ga0209257_1003754 | |||
| 1013 | Ga0209257_1004578 | |||
| 1014 | Ga0207650_10000377 | |||
| 1015 | Ga0207706_10153279 | |||
| 1016 | Ga0207668_10087555 | |||
| 1017 | Ga0207639_10157689 | |||
| 1018 | Ga0207675_100313109 | |||
| 1019 | Ga0209281_1000034 | |||
| 1020 | Ga0209281_1000329 | |||
| 1021 | Ga0209281_1001431 | |||
| 1022 | Ga0209371_1000003 | |||
| 1023 | Ga0209371_1000976 | |||
| 1024 | Ga0209282_1000167 | |||
| 1025 | Ga0209813_10018111 | |||
| 1026 | Ga0268266_10026910 | |||
| 1027 | Ga0307515_10000017 | |||
| 1028 | Ga0307515_10003211 | |||
| 1029 | Ga0268256_1000004 | |||
| 1030 | Ga0268256_1002843 | |||
| 1031 | Ga0307513_10012532 | |||
| 1032 | Ga0307406_10234063 | |||
| 1033 | Ga0307412_10042257 | |||
| 1034 | Ga0316583_10005162 | |||
| 1035 | Ga0315913_1001354 | |||
| 1036 | Ga0400483_096903 | |||
| 1037 | Ga0439436_0001038 | |||
| 1038 | Ga0439439_0042391 | |||
| 1039 | Ga0439466_0066989 | |||
| 1040 | Ga0439465_0001159 | |||
| 1041 | Ga0451847_0640839 | |||
| 1042 | Ga0451843_0064174 | |||
| 1043 | Ga0451853_1456325 | |||
| 1044 | Ga0439433_0019251 | |||
| 1045 | Ga0439445_0037170 | |||
| 1046 | Ga0439449_0002803 | |||
| 1047 | Ga0439449_0026727 | |||
| 1048 | Ga0450906_025852 | |||
| 1049 | Ga0439434_0012203 | |||
| 1050 | Ga0466970_0223628 | |||
| 1051 | Ga0495592_0187009 | |||
| 1052 | Ga0495629_0080780 | |||
| 1053 | Ga0495638_0087826 | |||
| 1054 | Ga0495651_0013067 | |||
| 1055 | Ga0495650_0029699 | |||
| 1056 | Ga0495605_0061223 | |||
| 1057 | Ga0495662_0037583 | |||
| 1058 | Ga0495585_0066109 | |||
| 1059 | Ga0495607_0012006 | |||
| 1060 | Ga0495583_0007050 | |||
| 1061 | Ga0495606_0001382 | |||
| 1062 | Ga0495606_0011311 | |||
| 1063 | Ga0495606_0101138 | |||
| 1064 | Ga0495608_0209264 | |||
| 1065 | Ga0495620_0021093 | |||
| 1066 | Ga0495630_0091286 | |||
| 1067 | Ga0495643_0025352 | |||
| 1068 | Ga0495643_0032352 | |||
| 1069 | Ga0495648_0016808 | |||
| 1070 | Ga0495652_0142184 | |||
| 1071 | Ga0495654_0000147 | |||
| 1072 | Ga0495654_0000655 | |||
| 1073 | Ga0495587_0067202 | |||
| 1074 | Ga0495597_0003958 | |||
| 1075 | Ga0495633_0012310 | |||
| 1076 | Ga0495633_0062910 | |||
| 1077 | Ga0495633_0081338 | |||
| 1078 | Ga0495668_0146063 | |||
| 1079 | Ga0495635_0164778 | |||
| 1080 | Ga0495588_0075050 | |||
| 1081 | Ga0495624_0024647 | |||
| 1082 | Ga0495670_0040774 | |||
| 1083 | Ga0495670_0052467 | |||
| 1084 | Ga0495686_0000090 | |||
| 1085 | Ga0495686_0027326 | |||
| 1086 | Ga0495686_0039286 | |||
| 1087 | Ga0495686_0047527 | |||
| 1088 | Ga0495686_0162505 | |||
| 1089 | Ga0495626_0022527 | |||
| 1090 | Ga0496100_0267745 | |||
| 1091 | Ga0496101_0021998 | |||
| 1092 | Ga0496102_0019077 | |||
| 1093 | Ga0496103_0009448 | |||
| 1094 | Ga0496104_0000378 | |||
| 1095 | Ga0496105_0001811 | |||
| 1096 | Ga0496106_0000188 | |||
| 1097 | Ga0496107_0307065 | |||
| 1098 | Ga0496109_0195011 | |||
| 1099 | Ga0496110_0007052 | |||
| 1100 | Ga0496110_0073334 | |||
| 1101 | Ga0496110_0244761 | |||
| 1102 | Ga0496111_0000414 | |||
| 1103 | Ga0496111_0000571 | |||
| 1104 | Ga0496113_0025584 | |||
| 1105 | Ga0496114_0010906 | |||
| 1106 | Ga0496116_0005240 | |||
| 1107 | Ga0496116_0027246 | |||
| 1108 | Ga0496116_0078095 | |||
| 1109 | Ga0496117_0000036 | |||
| 1110 | Ga0496118_0009373 | |||
| 1111 | Ga0496118_0048676 | |||
| 1112 | Ga0496118_0078334 | |||
| 1113 | Ga0496118_0092938 | |||
| 1114 | Ga0496119_0001603 | |||
| 1115 | Ga0496119_0010135 | |||
| 1116 | Ga0496119_0014224 | |||
| 1117 | Ga0496119_0032383 | |||
| 1118 | Ga0496119_0065867 | |||
| 1119 | Ga0496120_0000036 | |||
| 1120 | Ga0496120_0002229 | |||
| 1121 | Ga0496120_0015026 | |||
| 1122 | Ga0496121_0000005 | |||
| 1123 | Ga0496121_0002138 | |||
| 1124 | Ga0496121_0003960 | |||
| 1125 | Ga0496121_0016194 | |||
| 1126 | Ga0496121_0138928 | |||
| 1127 | Ga0496121_0167015 | |||
| 1128 | Ga0496122_0000002 | |||
| 1129 | Ga0496122_0000215 | |||
| 1130 | Ga0496122_0029881 | |||
| 1131 | Ga0496122_0031051 | |||
| 1132 | Ga0496122_0039878 | |||
| 1133 | Ga0496122_0040195 | |||
| 1134 | Ga0496122_0055260 | |||
| 1135 | Ga0496122_0065842 | |||
| 1136 | Ga0496122_0073963 | |||
| 1137 | Ga0496123_0000002 | |||
| 1138 | Ga0496123_0000306 | |||
| 1139 | Ga0496123_0008710 | |||
| 1140 | Ga0496124_0000206 | |||
| 1141 | Ga0496124_0000724 | |||
| 1142 | Ga0496124_0004794 | |||
| 1143 | Ga0496124_0010515 | |||
| 1144 | Ga0496124_0018098 | |||
| 1145 | Ga0496124_0024568 | |||
| 1146 | Ga0496124_0032649 | |||
| 1147 | Ga0496124_0044063 | |||
| 1148 | Ga0496124_0126072 | |||
| 1149 | Ga0496125_0000034 | |||
| 1150 | Ga0496125_0000163 | |||
| 1151 | Ga0496125_0000171 | |||
| 1152 | Ga0496125_0014681 | |||
| 1153 | Ga0496125_0018289 | |||
| 1154 | Ga0496125_0093671 | |||
| 1155 | Ga0496125_0134564 | |||
| 1156 | Ga0496125_0147178 | |||
| 1157 | Ga0496126_0005143 | |||
| 1158 | Ga0496126_0034008 | |||
| 1159 | Ga0496126_0193083 | |||
| 1160 | Ga0501032_0006208 | |||
| 1161 | Ga0501032_0120514 | |||
| 1162 | Ga0501033_0011169 | |||
| 1163 | Ga0501033_0239087 | |||
| 1164 | Ga0501034_0418815 | |||
| 1165 | Ga0501036_0135580 | |||
| 1166 | Ga0501036_0279145 | |||
| 1167 | Ga0501037_0000077 | |||
| 1168 | Ga0501037_0187495 | |||
| 1169 | Ga0501043_0000114 | |||
| 1170 | Ga0501043_0007992 | |||
| 1171 | Ga0501043_0185681 | |||
| 1172 | Ga0501067_0028120 | |||
| 1173 | Ga0501068_0034112 | |||
| 1174 | Ga0501069_0000016 | |||
| 1175 | Ga0501070_0000450 | |||
| 1176 | Ga0501073_0018348 | |||
| 1177 | Ga0501073_0313786 | |||
| 1178 | Ga0501074_0000067 | |||
| 1179 | Ga0501080_0002371 | |||
| 1180 | Ga0501080_0106045 | |||
| 1181 | Ga0501083_0000111 | |||
| 1182 | Ga0501280_003248 | |||
| 1183 | Ga0501035_0001093 | |||
| 1184 | Ga0501044_0000003 | |||
| 1185 | Ga0501044_0246499 | |||
| 1186 | Ga0501044_0314354 | |||
| 1187 | nmdc:mga03683_57944_c1 | |||
| 1188 | nmdc:mga00v17_273_c1 | |||
| 1189 | nmdc:mga00v17_42_c1 | |||
| 1190 | nmdc:mga00v17_457_c1 | |||
| 1191 | nmdc:mga00v17_8788_c1 | |||
| 1192 | nmdc:mga0yw44_11102_c1 | |||
| 1193 | nmdc:mga0yw44_18730_c1 | |||
| 1194 | nmdc:mga0yw44_524_c1 | |||
| 1195 | nmdc:mga06z11_40104_c1 | |||
| 1196 | nmdc:mga04h51_4990_c1 | |||
| 1197 | nmdc:mga0sz30_197_c1 | |||
| 1198 | Ga0495619_0106202 | |||
| 1199 | Ga0500578_0036521 | |||
| 1200 | Ga0500581_002510 | |||
| 1201 | Ga0500651_0197915 | |||
| 1202 | Ga0500560_000019 | |||
| 1203 | Ga0500560_000279 | |||
| 1204 | Ga0500572_003810 | |||
| 1205 | Ga0500618_000175 | |||
| 1206 | Ga0500618_000271 | |||
| 1207 | Ga0500618_000356 | |||
| 1208 | Ga0500618_007572 | |||
| 1209 | Ga0500658_0001984 | |||
| 1210 | Ga0500561_0000107 | |||
| 1211 | Ga0500568_0000204 | |||
| 1212 | Ga0500568_0000382 | |||
| 1213 | Ga0500573_0001030 | |||
| 1214 | Ga0500590_000026 | |||
| 1215 | Ga0500616_0000341 | |||
| 1216 | Ga0500616_0022490 | |||
| 1217 | Ga0500622_0000973 | |||
| 1218 | Ga0500624_000700 | |||
| 1219 | Ga0500633_0001859 | |||
| 1220 | Ga0500634_0001772 | |||
| 1221 | Ga0500634_0004085 | |||
| 1222 | Ga0500634_0004915 | |||
| 1223 | Ga0500636_0000001 | |||
| 1224 | Ga0500636_0000044 | |||
| 1225 | Ga0500636_0004690 | |||
| 1226 | Ga0501082_0006930 | |||
| 1227 | 2509073414 | |||
| 1228 | 2509110810 | |||
| 1229 | 2509378536 | |||
| 1230 | 2510136439 | |||
| 1231 | 2510304637 | |||
| 1232 | 2510843237 | |||
| 1233 | 2510892317 | |||
| 1234 | 2511173275 | |||
| 1235 | 2511499833 | |||
| 1236 | 2512530230 | |||
| 1237 | 2512974800 | |||
| 1238 | 2513568072 | |||
| 1239 | 2513578380 | |||
| 1240 | 2513584847 | |||
| 1241 | 2513603865 | |||
| 1242 | 2513617392 | |||
| 1243 | 2513621143 | |||
| 1244 | 2513631014 | |||
| 1245 | 2513883070 | |||
| 1246 | 2513903125 | |||
| 1247 | 2513984770 | |||
| 1248 | 2514001149 | |||
| 1249 | 2514004179 | |||
| 1250 | 2514021115 | |||
| 1251 | 2515108601 | |||
| 1252 | 2515609892 | |||
| 1253 | 2515632225 | |||
| 1254 | 2515658322 | |||
| 1255 | 2515738110 | |||
| 1256 | 2516206622 | |||
| 1257 | 2516897397 | |||
| 1258 | 2517041210 | |||
| 1259 | 2517080166 | |||
| 1260 | 2517098165 | |||
| 1261 | 2517567447 | |||
| 1262 | 2524452383 | |||
| 1263 | 2524457165 | |||
| 1264 | 2524459746 | |||
| 1265 | 2530649014 | |||
| 1266 | 2535520442 | |||
| 1267 | 2537875925 | |||
| 1268 | 2551677426 | |||
| 1269 | 2551687825 | |||
| 1270 | 2551691469 | |||
| 1271 | 2551692577 | |||
| 1272 | 2551700510 | |||
| 1273 | 2551712948 | |||
| 1274 | 2551718227 | |||
| 1275 | 2551725073 | |||
| 1276 | 2551728044 | |||
| 1277 | 2551737383 | |||
| 1278 | 2551738667 | |||
| 1279 | 2551743994 | |||
| 1280 | 2554245819 | |||
| 1281 | 2558861929 | |||
| 1282 | 2559296414 | |||
| 1283 | 2561468486 | |||
| 1284 | 2585168520 | |||
| 1285 | 2585169527 | |||
| 1286 | 2585231184 | |||
| 1287 | 2585257947 | |||
| 1288 | 2585397739 | |||
| 1289 | 2585525586 | |||
| 1290 | 2585996346 | |||
| 1291 | 2585997544 | |||
| 1292 | 2586000954 | |||
| 1293 | 2586002150 | |||
| 1294 | 2597816253 | |||
| 1295 | 2599334003 | |||
| 1296 | 2599605538 | |||
| 1297 | 2599721867 | |||
| 1298 | 2600197060 | |||
| 1299 | 2600197973 | |||
| 1300 | 2600374311 | |||
| 1301 | 2601611740 | |||
| 1302 | 2601749529 | |||
| 1303 | 2643777630 | |||
| 1304 | 2643796078 | |||
| 1305 | 2643806390 | |||
| 1306 | 2643813877 | |||
| 1307 | 2643911984 | |||
| 1308 | 2643917682 | |||
| 1309 | 2644106104 | |||
| 1310 | 2644106380 | |||
| 1311 | 2644106523 | |||
| 1312 | 2644145986 | |||
| 1313 | 2644146933 | |||
| 1314 | 2644149238 | |||
| 1315 | 2644308405 | |||
| 1316 | 2644308457 | |||
| 1317 | 2644310715 | |||
| 1318 | 2644331822 | |||
| 1319 | 2644332118 | |||
| 1320 | 2644334498 | |||
| 1321 | 2644379336 | |||
| 1322 | 2644380057 | |||
| 1323 | 2644412348 | |||
| 1324 | 2644415178 | |||
| 1325 | 2644491890 | |||
| 1326 | 2644497198 | |||
| 1327 | 2644522783 | |||
| 1328 | 2644542202 | |||
| 1329 | 2644544492 | |||
| 1330 | 2644545303 | |||
| 1331 | 2644615650 | |||
| 1332 | 2644615793 | |||
| 1333 | 2644616549 | |||
| 1334 | 2644672383 | |||
| 1335 | 2644674622 | |||
| 1336 | 2657684285 | |||
| 1337 | 2692318159 | |||
| 1338 | 2725947844 | |||
| 1339 | 2753463928 | |||
| 1340 | 2757569340 | |||
| 1341 | 2758638515 | |||
| 1342 | 2766065125 | |||
| 1343 | 2774868970 | |||
| 1344 | 2792621377 | |||
| 1345 | 2792627935 | |||
| 1346 | 2792643372 | |||
| 1347 | 2793280705 | |||
| 1348 | 2793332011 | |||
| 1349 | 2802718358 | |||
| 1350 | 2802724065 | |||
| 1351 | 2802725848 | |||
| 1352 | 2802731444 | |||
| 1353 | 2802736365 | |||
| 1354 | 2802744339 | |||
| 1355 | 2802750071 | |||
| 1356 | 2802752025 | |||
| 1357 | 2804754247 | |||
| 1358 | 2808988634 | |||
| 1359 | 2819557796 | |||
| 1360 | 2819684975 | |||
| 1361 | 2821127444 | |||
| 1362 | 2838069162 | |||
| 1363 | 2838679807 | |||
| 1364 | 2838687477 | |||
| 1365 | 2838717423 | |||
| 1366 | 2838724376 | |||
| 1367 | 2838729307 | |||
| 1368 | 2838734111 | |||
| 1369 | 2838737969 | |||
| 1370 | 2838746563 | |||
| 1371 | 2840880247 | |||
| 1372 | 2841734662 | |||
| 1373 | 2841841662 | |||
| 1374 | 2841850734 | |||
| 1375 | 2841854027 | |||
| 1376 | 2841864018 | |||
| 1377 | 2842116717 | |||
| 1378 | 2842129539 | |||
| 1379 | 2842134684 | |||
| 1380 | 2842141440 | |||
| 1381 | 2842156798 | |||
| 1382 | 2842159606 | |||
| 1383 | 2842164055 | |||
| 1384 | 2842173056 | |||
| 1385 | 2842180416 | |||
| 1386 | 2842182824 | |||
| 1387 | 2842191925 | |||
| 1388 | 2842216241 | |||
| 1389 | 2842221601 | |||
| 1390 | 2842228961 | |||
| 1391 | 2842232535 | |||
| 1392 | 2842247222 | |||
| 1393 | 2842259091 | |||
| 1394 | 2842265537 | |||
| 1395 | 2842272489 | |||
| 1396 | 2842299281 | |||
| 1397 | 2842301651 | |||
| 1398 | 2842309823 | |||
| 1399 | 2842334371 | |||
| 1400 | 2842358748 | |||
| 1401 | 2842361780 | |||
| 1402 | 2842422352 | |||
| 1403 | 2842428413 | |||
| 1404 | 2842435027 | |||
| 1405 | 2842442111 | |||
| 1406 | 2842449491 | |||
| 1407 | 2842466640 | |||
| 1408 | 2842469359 | |||
| 1409 | 2842512178 | |||
| 1410 | 2842513450 | |||
| 1411 | 2842520800 | |||
| 1412 | 2842526876 | |||
| 1413 | 2842925718 | |||
| 1414 | 2842927033 | |||
| 1415 | 2844165814 | |||
| 1416 | 2844166777 | |||
| 1417 | 2844460473 | |||
| 1418 | 2847423336 | |||
| 1419 | 2848997211 | |||
| 1420 | 2850084033 | |||
| 1421 | 2852394570 | |||
| 1422 | 2852395231 | |||
| 1423 | 2854684840 | |||
| 1424 | 2854901135 | |||
| 1425 | 2854918526 | |||
| 1426 | 2854920244 | |||
| 1427 | 2855830206 | |||
| 1428 | 2855830707 | |||
| 1429 | 2855845520 | |||
| 1430 | 2855845998 | |||
| 1431 | 2855874472 | |||
| 1432 | 2856320232 | |||
| 1433 | 2856345633 | |||
| 1434 | 2857357303 | |||
| 1435 | 2857518044 | |||
| 1436 | 2857536542 | |||
| 1437 | 2858804327 | |||
| 1438 | 2858805387 | |||
| 1439 | 2871476348 | |||
| 1440 | 2878042540 | |||
| 1441 | 2878793525 | |||
| 1442 | 2882457462 | |||
| 1443 | 2885346216 | |||
| 1444 | 2885355118 | |||
| 1445 | 2889791407 | |||
| 1446 | 2889920184 | |||
| 1447 | 2896389297 | |||
| 1448 | 2899793665 | |||
| 1449 | 2899848761 | |||
| 1450 | 2906420989 | |||
| 1451 | 2913296404 | |||
| 1452 | 2915980991 | |||
| 1453 | 2915990897 | |||
| 1454 | 2915996054 | |||
| 1455 | 2915998123 | |||
| 1456 | 2916003037 | |||
| 1457 | 2916009166 | |||
| 1458 | 2916009278 | |||
| 1459 | 2916017178 | |||
| 1460 | 2916019280 | |||
| 1461 | 2916025671 | |||
| 1462 | 2916030672 | |||
| 1463 | 2916034019 | |||
| 1464 | 2916037986 | |||
| 1465 | 2916041027 | |||
| 1466 | 2916043897 | |||
| 1467 | 2916048242 | |||
| 1468 | 2916052018 | |||
| 1469 | 2916053055 | |||
| 1470 | 2916060378 | |||
| 1471 | 2916060571 | |||
| 1472 | 2916075633 | |||
| 1473 | 2916077750 | |||
| 1474 | 2919119176 | |||
| 1475 | 2919174566 | |||
| 1476 | 2919177084 | |||
| 1477 | 2919682390 | |||
| 1478 | 2920828039 | |||
| 1479 | 2921207371 | |||
| 1480 | 2921208296 | |||
| 1481 | 2921211949 | |||
| 1482 | 2921215247 | |||
| 1483 | 2921241830 | |||
| 1484 | 2921243191 | |||
| 1485 | 2921248397 | |||
| 1486 | 2921251331 | |||
| 1487 | 2921262163 | |||
| 1488 | 2921263033 | |||
| 1489 | 2921267850 | |||
| 1490 | 2921269587 | |||
| 1491 | 2921285376 | |||
| 1492 | 2921295418 | |||
| 1493 | 2921297070 | |||
| 1494 | 2921302884 | |||
| 1495 | 2924144629 | |||
| 1496 | 2924152435 | |||
| 1497 | 2924152981 | |||
| 1498 | 2924161175 | |||
| 1499 | 2924161498 | |||
| 1500 | 2924167132 | |||
| 1501 | 2924175991 | |||
| 1502 | 2924178751 | |||
| 1503 | 2924184498 | |||
| 1504 | 2924186603 | |||
| 1505 | 2924194487 | |||
| 1506 | 2924197581 | |||
| 1507 | 2924202038 | |||
| 1508 | 2924208456 | |||
| 1509 | 2924209765 | |||
| 1510 | 2924219053 | |||
| 1511 | 2924223078 | |||
| 1512 | 2924223438 | |||
| 1513 | 2924229261 | |||
| 1514 | 2924229659 | |||
| 1515 | 2926759208 | |||
| 1516 | 2926763362 | |||
| 1517 | 2928525522 | |||
| 1518 | 2929142661 | |||
| 1519 | 2929143234 | |||
| 1520 | 2933011403 | |||
| 1521 | 2933016587 | |||
| 1522 | 2933576265 | |||
| 1523 | 2933592933 | |||
| 1524 | 2933596026 | |||
| 1525 | 2933599827 | |||
| 1526 | 2935903156 | |||
| 1527 | 2936374384 | |||
| 1528 | 2936378774 | |||
| 1529 | 2937000317 | |||
| 1530 | 2937006313 | |||
| 1531 | 2937009168 | |||
| 1532 | 2937011493 | |||
| 1533 | 2937017597 | |||
| 1534 | 2937019917 | |||
| 1535 | 2937023586 | |||
| 1536 | 2937026999 | |||
| 1537 | 2937035921 | |||
| 1538 | 2937036387 | |||
| 1539 | 2937043377 | |||
| 1540 | 2937049185 | |||
| 1541 | 2937050268 | |||
| 1542 | 2937056024 | |||
| 1543 | 2937061061 | |||
| 1544 | 2937068283 | |||
| 1545 | 2937074105 | |||
| 1546 | 2937077075 | |||
| 1547 | 2937091376 | |||
| 1548 | 2937092701 | |||
| 1549 | 2937093484 | |||
| 1550 | 2937103933 | |||
| 1551 | 2937104305 | |||
| 1552 | 2937111693 | |||
| 1553 | 2937113429 | |||
| 1554 | 2937116580 | |||
| 1555 | 2937120457 | |||
| 1556 | 2937123295 | |||
| 1557 | 2937128692 | |||
| 1558 | 2937132881 | |||
| 1559 | 2937842798 | |||
| 1560 | 2941505198 | |||
| 1561 | 2954012436 | |||
| 1562 | 2957386793 | |||
| 1563 | 2957394578 | |||
| 1564 | 2957396283 | |||
| 1565 | 2957399163 | |||
| 1566 | 2957407043 | |||
| 1567 | 2957409288 | |||
| 1568 | 2957413615 | |||
| 1569 | 2957415472 | |||
| 1570 | 2957420899 | |||
| 1571 | 2957426612 | |||
| 1572 | 2957430886 | |||
| 1573 | 2957430914 | |||
| 1574 | 2957439615 | |||
| 1575 | 2957444861 | |||
| 1576 | 2957449628 | |||
| 1577 | 2957453066 | |||
| 1578 | 2957463503 | |||
| 1579 | 2957464598 | |||
| 1580 | 2957465160 | |||
| 1581 | 2957473721 | |||
| 1582 | 2957476949 | |||
| 1583 | 2957480866 | |||
| 1584 | 2957483551 | |||
| 1585 | 2957487432 | |||
| 1586 | 2957489430 | |||
| 1587 | 2957491867 | |||
| 1588 | 2957502881 | |||
| 1589 | 2957503407 | |||
| 1590 | 2957505765 | |||
| 1591 | 2958074898 | |||
| 1592 | 2960587896 | |||
| 1593 | 2960592497 | |||
| 1594 | 2960601134 | |||
| 1595 | 2960605638 | |||
| 1596 | 2960606780 | |||
| 1597 | 2960612737 | |||
| 1598 | 2960614971 | |||
| 1599 | 2960621989 | |||
| 1600 | 2960623831 | |||
| 1601 | 2960628541 | |||
| 1602 | 2960628956 | |||
| 1603 | 2960632236 | |||
| 1604 | 2960636118 | |||
| 1605 | 2960643344 | |||
| 1606 | 2960646955 | |||
| 1607 | 2960656934 | |||
| 1608 | 2960661575 | |||
| 1609 | 2960666301 | |||
| 1610 | 2960670382 | |||
| 1611 | 2960676211 | |||
| 1612 | 2960681134 | |||
| 1613 | 2960693397 | |||
| 1614 | 2964614724 | |||
| 1615 | 2964618856 | |||
| 1616 | 2964620522 | |||
| 1617 | 2964625541 | |||
| 1618 | 2964634850 | |||
| 1619 | 2964637976 | |||
| 1620 | 2964638516 | |||
| 1621 | 2964644283 | |||
| 1622 | 2964651108 | |||
| 1623 | 2964653251 | |||
| 1624 | 2964659871 | |||
| 1625 | 2964662670 | |||
| 1626 | 2964664242 | |||
| 1627 | 2964666392 | |||
| 1628 | 2964673234 | |||
| 1629 | 2964678581 | |||
| 1630 | 2964680308 | |||
| 1631 | 2964691590 | |||
| 1632 | 2964695479 | |||
| 1633 | 2964696707 | |||
| 1634 | 2964699749 | |||
| 1635 | 2964708790 | |||
| 1636 | 2964712528 | |||
| 1637 | 2964718126 | |||
| 1638 | 2964723560 | |||
| 1639 | 2965062944 | |||
| 1640 | 2967665085 | |||
| 1641 | 2967665948 | |||
| 1642 | 2967672763 | |||
| 1643 | 2967678050 | |||
| 1644 | 2967679001 | |||
| 1645 | 2967683729 | |||
| 1646 | 2967692004 | |||
| 1647 | 2967694006 | |||
| 1648 | 2967697593 | |||
| 1649 | 2967701900 | |||
| 1650 | 2967703464 | |||
| 1651 | 2967707836 | |||
| 1652 | 2967708353 | |||
| 1653 | 2967718006 | |||
| 1654 | 2967719354 | |||
| 1655 | 2967724429 | |||
| 1656 | 2967725222 | |||
| 1657 | 2967729126 | |||
| 1658 | 2967740413 | |||
| 1659 | 2967747726 | |||
| 1660 | 2967755251 | |||
| 1661 | 2967760492 | |||
| 1662 | 2967760812 | |||
| 1663 | 2967763462 | |||
| 1664 | 2967768374 | |||
| 1665 | 2967770216 | |||
| 1666 | 2967781886 | |||
| 1667 | 2967781948 | |||
| 1668 | 2968092051 | |||
| 1669 | 2970024605 | |||
| 1670 | 2970025242 | |||
| 1671 | 2970029663 | |||
| 1672 | 2970039883 | |||
| 1673 | 2970045155 | |||
| 1674 | 2970047277 | |||
| 1675 | 2970054713 | |||
| 1676 | 2970060133 | |||
| 1677 | 2970063488 | |||
| 1678 | 2970063669 | |||
| 1679 | 2970069743 | |||
| 1680 | 2970082109 | |||
| 1681 | 2970091420 | |||
| 1682 | 2970093035 | |||
| 1683 | 2970099987 | |||
| 1684 | 2970103109 | |||
| 1685 | 2970107062 | |||
| 1686 | 2970110328 | |||
| 1687 | 2970112559 | |||
| 1688 | 2970117074 | |||
| 1689 | 2970124180 | |||
| 1690 | 2970129884 | |||
| 1691 | 2970133122 | |||
| 1692 | 2970138061 | |||
| 1693 | 2970139195 | |||
| 1694 | 2970144926 | |||
| 1695 | 2970152570 | |||
| 1696 | 2970154694 | |||
| 1697 | 2970160918 | |||
| 1698 | 2970166608 | |||
| 1699 | 2970168758 | |||
| 1700 | 2970172488 | |||
| 1701 | 2970175395 | |||
| 1702 | 2970181342 | |||
| 1703 | 2970184625 | |||
| 1704 | 2970188571 | |||
| 1705 | 2970189886 | |||
| 1706 | 2970196197 | |||
| 1707 | 2970529533 | |||
| 1708 | 2977523583 | |||
| 1709 | 2977524237 | |||
| 1710 | 2977527847 | |||
| 1711 | 2977537278 | |||
| 1712 | 2977539492 | |||
| 1713 | 2977543022 | |||
| 1714 | 2977550106 | |||
| 1715 | 2977555433 | |||
| 1716 | 2977556541 | |||
| 1717 | 2977565299 | |||
| 1718 | 2977567416 | |||
| 1719 | 2977572468 | |||
| 1720 | 2977573435 | |||
| 1721 | 2977576693 | |||
| 1722 | 2977583389 | |||
| 1723 | 2977585339 | |||
| 1724 | 2977949353 | |||
| 1725 | 2979091605 | |||
| 1726 | 2979097126 | |||
| 1727 | 2979102836 | |||
| 1728 | 2984509275 | |||
| 1729 | 2984520025 | |||
| 1730 | 2984537604 | |||
| 1731 | 2984604353 | |||
| 1732 | 2987644693 | |||
| 1733 | 2989773021 | |||
| 1734 | 2989781364 | |||
| 1735 | 2995394612 | |||
| 1736 | 2996316373 | |||
| 1737 | 2996887423 | |||
| 1738 | 3000019256 | |||
| 1739 | 3000406375 | |||
| 1740 | 3004210845 | |||
| 1741 | 3005597260 | |||
| 1742 | 643822638 | |||
| 1743 | 648737882 | |||
| 1744 | 648739344 | |||
| 1745 | 650842810 | |||
| 1746 | 8003574832 | |||
| 1747 | 8003997528 | |||
| 1748 | 8003998214 | |||
| 1749 | 8004006165 | |||
| 1750 | 8004637625 | |||
| 1751 | 8005259884 | |||
| 1752 | 8005301669 | |||
| 1753 | 8005307925 | |||
| 1754 | 8005321950 | |||
| 1755 | 8005379813 | |||
| 1756 | 8005399151 | |||
| 1757 | 8005467225 | |||
| 1758 | 8005548194 | |||
| 1759 | 8005562345 | |||
| 1760 | 8005565507 | |||
| 1761 | 8018153476 | |||
| 1762 | 8018165516 | |||
| 1763 | 8023688077 | |||
| 1764 | 8024485024 | |||
| 1765 | 8024487608 | |||
| 1766 | 8046769100 | |||
| 1767 | 8046773427 | |||
| 1768 | 8046774589 | |||
| 1769 | 8054462142 | |||
| 1770 | 8054561487 | |||
| 1771 | 8054563949 | |||
| 1772 | 8055435285 | |||
| 1773 | 8055622894 | |||
| 1774 | 8056876891 | |||
| 1775 | 8057135757 | |||
| 1776 | 8057576501 | |||
| 1777 | 8057581370 | |||
| 1778 | 8057878005 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ur7-assembly1.cif.gz_D | crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate | 0.9916 | 3 | 303 |
| 5hwm-assembly1.cif.gz_A | crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid | 0.991 | 3 | 303 |
| 4ur7-assembly1.cif.gz_D | crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate | 0.9883 | 3 | 303 |
| 5hwm-assembly1.cif.gz_A | crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid | 0.9812 | 3 | 303 |
| 6rb7-assembly1.cif.gz_E | ruminococcus gnavus sialic acid aldolase catalytic lysine mutant | 0.9079 | 12 | 299 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hwjA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.992 | 3 | 303 | 3.20.20.70 |
| 5hwjA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9822 | 3 | 303 | 3.20.20.70 |
| 3eb2C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9054 | 15 | 299 | 3.20.20.70 |
| 2rfgB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9047 | 15 | 300 | 3.20.20.70 |
| 3e96A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8998 | 8 | 300 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0B5E042-F1-model_v4 | Probable 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (5-keto-4-deoxy-glucarate dehydratase) (KDGDH) | 0.994 | 3 | 303 |
GO:0008840
GO:0042838 GO:0047448 |
| AF-F0G4A0-F1-model_v4 | 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) | 0.9938 | 200 | 300 |
GO:0047448
|
| AF-A0A561QVP7-F1-model_v4 | Probable 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (5-keto-4-deoxy-glucarate dehydratase) (KDGDH) | 0.9931 | 3 | 303 |
GO:0008840
GO:0042838 GO:0047448 |
| AF-A0A358B2K8-F1-model_v4 | Probable 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (5-keto-4-deoxy-glucarate dehydratase) (KDGDH) | 0.9922 | 3 | 303 |
GO:0008840
GO:0042838 GO:0047448 |
| AF-A0A2W7I908-F1-model_v4 | 5-dehydro-4-deoxyglucarate dehydratase | 0.9906 | 123 | 300 |
GO:0008840
|