F484847

General Info

Members Datasets Scaffolds Average Seq Length
891 609 1778 300

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1000080|JGI25159J45721_100008014
Length 340
Sequence MVMPTTNSSYMLYDEFVPNRLISFEISILKTRRGLKEMTPEQIKAALGSGLLSFPVTHFDKDGRFAPESYKAHVEWLAGYKAPVLFAAGGTGEFFSLKPDEIPGIVAAAKEVAGETAIVSGCGYGTEMAVDIARSVERXGADGILLLPHYLIDAPQEGLYAHVKQICQSVGIGVMVYNRDNSVLQPDTLARLCDECPNLIGFKDGTGDIGLVRQVTAKMGDRLMYLGGMPTAELFAEAYLGAGFTTYSSAVFNFVPGLANEFYAALRSGDRATCERILNDFFYPFMAIRNRAKGYAVSAVKAGVRLQGFNAGPVRSPLKDLTGAEVEMLDALIGSHKRKA

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
42 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
43 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
44 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
45 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
46 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
67 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
77 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
78 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
79 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
80 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
81 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
82 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
83 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
84 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
87 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
90 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
169 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
172 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
173 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
178 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
182 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
183 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
184 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
187 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
188 2509276019 Ensifer aridi TW10 Isolate Nodule
189 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
190 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
191 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
192 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
193 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
194 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
195 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
196 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
197 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
198 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
199 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
200 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
201 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
202 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
203 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
204 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
205 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
206 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
207 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
208 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
209 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
210 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
211 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
212 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
213 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
214 2516143018 Ensifer sp. BR816 Isolate Nodule
215 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
216 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
217 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
218 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
219 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
220 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
221 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
222 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
223 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
224 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
225 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
226 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
227 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
228 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
229 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
230 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
231 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
232 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
233 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
234 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
235 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
236 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
237 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
238 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
239 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
240 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
241 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
242 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
243 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
244 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
245 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
246 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
247 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
248 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
249 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
250 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
251 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
252 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
253 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
254 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
255 2643221557 Ensifer sp. Root558 Isolate Unclassified
256 2643221558 Rhizobium sp. Root149 Isolate Unclassified
257 2643221580 Devosia sp. Root635 Isolate Unclassified
258 2643221582 Rhizobium sp. Root651 Isolate Unclassified
259 2643221618 Ensifer sp. Root231 Isolate Unclassified
260 2643221626 Ensifer sp. Root31 Isolate Unclassified
261 2643221655 Ensifer sp. Root1252 Isolate Unclassified
262 2643221659 Ensifer sp. Root127 Isolate Unclassified
263 2643221668 Ensifer sp. Root423 Isolate Unclassified
264 2643221674 Devosia sp. Root436 Isolate Unclassified
265 2643221675 Ensifer sp. Root1298 Isolate Unclassified
266 2643221688 Rhizobium sp. Root482 Isolate Unclassified
267 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
268 2643221693 Rhizobium sp. Root491 Isolate Unclassified
269 2643221698 Ensifer sp. Root142 Isolate Unclassified
270 2643221712 Ensifer sp. Root258 Isolate Unclassified
271 2643221723 Ensifer sp. Root278 Isolate Unclassified
272 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
273 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
274 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
275 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
276 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
277 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
278 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
279 2773857925 Microvirga vignae BR3299 Isolate Unclassified
280 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
281 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
282 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
283 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
284 2791355261 Rhizobium sp. J15 Isolate Nodule
285 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
286 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
287 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
288 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
289 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
290 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
291 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
292 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
293 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
294 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
295 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
296 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
297 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
298 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
299 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
300 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
301 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
302 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
303 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
304 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
305 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
306 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
307 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
308 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
309 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
310 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
311 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
312 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
313 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
314 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
315 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
316 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
317 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
318 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
319 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
320 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
321 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
322 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
323 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
324 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
325 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
326 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
327 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
328 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
329 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
330 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
331 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
332 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
333 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
334 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
335 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
336 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
337 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
338 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
339 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
340 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
341 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
342 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
343 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
344 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
345 2844163670 Ensifer sp. 1H6 Isolate Unclassified
346 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
347 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
348 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
349 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
350 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
351 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
352 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
353 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
354 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
355 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
356 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
357 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
358 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
359 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
360 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
361 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
362 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
363 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
364 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
365 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
366 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
367 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
368 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
369 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
370 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
371 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
372 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
373 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
374 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
375 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
376 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
377 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
378 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
379 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
380 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
381 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
382 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
383 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
384 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
385 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
386 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
387 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
388 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
389 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
390 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
391 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
392 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
393 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
394 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
395 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
396 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
397 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
398 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
399 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
400 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
401 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
402 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
403 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
404 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
405 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
406 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
407 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
408 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
409 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
410 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
411 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
412 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
413 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
414 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
415 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
416 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
417 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
418 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
419 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
420 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
421 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
422 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
423 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
424 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
425 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
426 2933599457 Rhizobium phaseoli M3 Isolate Nodule
427 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
428 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
429 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
430 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
431 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
432 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
433 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
434 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
435 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
436 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
437 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
438 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
439 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
440 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
441 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
442 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
443 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
444 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
445 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
446 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
447 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
448 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
449 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
450 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
451 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
452 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
453 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
454 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
455 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
456 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
457 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
458 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
459 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
460 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
461 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
462 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
463 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
464 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
465 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
466 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
467 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
468 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
469 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
470 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
471 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
472 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
473 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
474 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
475 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
476 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
477 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
478 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
479 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
480 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
481 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
482 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
483 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
484 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
485 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
486 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
487 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
488 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
489 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
490 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
491 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
492 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
493 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
494 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
495 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
496 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
497 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
498 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
499 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
500 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
501 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
502 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
503 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
504 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
505 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
506 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
507 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
508 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
509 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
510 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
511 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
512 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
513 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
514 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
515 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
516 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
517 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
518 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
519 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
520 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
521 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
522 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
523 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
524 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
525 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
526 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
527 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
528 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
529 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
530 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
531 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
532 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
533 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
534 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
535 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
536 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
537 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
538 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
539 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
540 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
541 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
542 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
543 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
544 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
545 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
546 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
547 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
548 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
549 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
550 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
551 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
552 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
553 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
554 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
555 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
556 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
557 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
558 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
559 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
560 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
561 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
562 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
563 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
564 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
565 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
566 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
567 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
568 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
569 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
570 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
571 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
572 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
573 2996887358 Rhizobium sp. R711 Isolate Nodule
574 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
575 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
576 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
577 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
578 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
579 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
580 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
581 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
582 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
583 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
584 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
585 8005258706 Rhizobium sp. R693 Isolate Nodule
586 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
587 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
588 8005321885 Rhizobium sp. R72 Isolate Nodule
589 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
590 8005395548 Rhizobium sp. R339 Isolate Nodule
591 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
592 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
593 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
594 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
595 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
596 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
597 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
598 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
599 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
600 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
601 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
602 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
603 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
604 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
605 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
606 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
607 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
608 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
609 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.05
Metatranscriptomes 0
Isolates 61.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 15.15
Nodule 48.37
Rhizoplane 2.81
Rhizosphere 16.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000080 3300002987 Bacteria 46567
2 JGI25152J39213_1005341 3300002773 Bacteria 3776
3 JGI25159J45721_1000354 3300002987 Bacteria 21222
4 JGI25159J45721_1000466 3300002987 Bacteria 18688
5 JGI25159J45721_1000514 3300002987 Bacteria 17677
6 JGI25151J46595_10011163 3300003187 Bacteria 4138
7 JGI25151J46595_10026634 3300003187 Bacteria 2329
8 JGI25153J46596_10000302 3300003215 Bacteria 36803
9 rootL2_10092790 3300003322 Bacteria 1842
10 JGI25160J50197_1000005 3300003354 Bacteria 417280
11 JGI25160J50197_1000014 3300003354 Bacteria 259862
12 JGI25160J50197_1000026 3300003354 Bacteria 184693
13 JGI25160J50197_1000160 3300003354 Bacteria 57733
14 JGI25161J50226_1000014 3300003374 Bacteria 191109
15 JGI25161J50226_1000022 3300003374 Bacteria 158544
16 Ga0055526_1004999 3300003771 Bacteria 7760
17 Ga0055526_1006491 3300003771 Bacteria 6333
18 Ga0055524_1000581 3300003775 Bacteria 26755
19 Ga0055524_1002487 3300003775 Bacteria 9469
20 Ga0055524_1006335 3300003775 Bacteria 5144
21 Ga0055524_1028674 3300003775 Bacteria 1663
22 Ga0055524_1035140 3300003775 Bacteria 1372
23 Ga0055536_1001262 3300003781 Bacteria 15581
24 Ga0055536_1006042 3300003781 Bacteria 5743
25 Ga0055536_1011844 3300003781 Bacteria 3294
26 Ga0055536_1019506 3300003781 Bacteria 2129
27 Ga0055528_1016836 3300003790 Bacteria 2563
28 Ga0055540_1006014 3300003792 Bacteria 4916
29 Ga0055540_1008423 3300003792 Bacteria 3716
30 Ga0055531_10001938 3300003794 Bacteria 14455
31 Ga0055531_10002976 3300003794 Bacteria 11011
32 Ga0055531_10003532 3300003794 Bacteria 9931
33 Ga0058692_1001187 3300003856 Bacteria 9990
34 Ga0058692_1005324 3300003856 Bacteria 3683
35 Ga0055543_1000005 3300004625 Bacteria 223621
36 Ga0055543_1000052 3300004625 Bacteria 104887
37 Ga0055543_1000324 3300004625 Bacteria 33093
38 Ga0065165_1000002 3300005262 Bacteria 444192
39 Ga0065165_1000073 3300005262 Bacteria 164910
40 Ga0065165_1000463 3300005262 Bacteria 63644
41 Ga0065165_1000534 3300005262 Bacteria 57771
42 Ga0065704_10079730 3300005289 Bacteria 4093
43 Ga0070683_100315588 3300005329 Bacteria 1487
44 Ga0070670_100000446 3300005331 Bacteria 33484
45 Ga0070668_100095965 3300005347 Bacteria 2343
46 Ga0070662_100140353 3300005457 Bacteria 1872
47 Ga0070665_100008536 3300005548 Bacteria 10365
48 Ga0075365_10011720 3300006038 Bacteria 5169
49 Ga0075365_10033506 3300006038 Bacteria 3311
50 Ga0075365_10093516 3300006038 Bacteria 2051
51 Ga0075368_10024529 3300006042 Bacteria 2311
52 Ga0075363_100135135 3300006048 Bacteria 1385
53 Ga0075364_10000058 3300006051 Bacteria 41383
54 Ga0075364_10022274 3300006051 Bacteria 3999
55 Ga0075367_10056064 3300006178 Bacteria 2340
56 Ga0075369_10063795 3300006186 Bacteria 1612
57 Ga0097621_100014591 3300006237 Bacteria 5886
58 Ga0075430_100172300 3300006846 Bacteria 1801
59 Ga0079104_1000045 3300006946 Bacteria 183705
60 Ga0099826_10000040 3300006948 Bacteria 98176
61 Ga0105251_10028109 3300009011 Bacteria 2845
62 Ga0105250_10036053 3300009092 Bacteria 1985
63 Ga0105243_10030726 3300009148 Bacteria 4138
64 Ga0105248_10391834 3300009177 Bacteria 1564
65 Ga0105246_10078453 3300011119 Bacteria 2345
66 Ga0157373_10061465 3300013100 Bacteria 2660
67 Ga0157371_10000042 3300013102 Bacteria 198938
68 Ga0157370_10000035 3300013104 Bacteria 137103
69 Ga0157370_10392398 3300013104 Bacteria 1278
70 Ga0171463_1013 3300013249 Bacteria 94945
71 Ga0183363_1072 3300015690 Bacteria 30043
72 Ga0214543_1000018 3300021327 Bacteria 272335
73 Ga0228711_1023402 3300022739 Bacteria 4603
74 Ga0228710_1002216 3300022740 Bacteria 30404
75 Ga0228710_1022978 3300022740 Bacteria 4660
76 Ga0209436_100101 3300025208 Bacteria 42360
77 Ga0209436_100162 3300025208 Bacteria 32237
78 Ga0209129_1000690 3300025258 Bacteria 22130
79 Ga0209129_1014727 3300025258 Bacteria 1650
80 Ga0209565_1015948 3300025263 Bacteria 1681
81 Ga0209455_1000196 3300025272 Bacteria 88682
82 Ga0209673_1002427 3300025273 Bacteria 12963
83 Ga0209673_1020551 3300025273 Bacteria 2335
84 Ga0209130_1000010 3300025284 Bacteria 444920
85 Ga0209130_1000013 3300025284 Bacteria 412810
86 Ga0209130_1000121 3300025284 Bacteria 127462
87 Ga0209130_1000309 3300025284 Bacteria 57785
88 Ga0209676_1000498 3300025292 Bacteria 62906
89 Ga0209676_1001837 3300025292 Bacteria 17566
90 Ga0209676_1002471 3300025292 Bacteria 13041
91 Ga0209676_1002760 3300025292 Bacteria 11746
92 Ga0209676_1026246 3300025292 Bacteria 1853
93 Ga0209676_1039150 3300025292 Bacteria 1350
94 Ga0209025_1000374 3300025294 Bacteria 93607
95 Ga0209025_1002206 3300025294 Bacteria 21532
96 Ga0209025_1004162 3300025294 Bacteria 12812
97 Ga0209025_1028032 3300025294 Bacteria 2772
98 Ga0209564_1000341 3300025295 Bacteria 89262
99 Ga0209564_1014365 3300025295 Bacteria 3300
100 Ga0209564_1018741 3300025295 Bacteria 2622
101 Ga0209758_1000237 3300025297 Bacteria 115867
102 Ga0209758_1000504 3300025297 Bacteria 63308
103 Ga0209758_1004696 3300025297 Bacteria 11158
104 Ga0209758_1054380 3300025297 Bacteria 1368
105 Ga0209050_1004289 3300025298 Bacteria 9752
106 Ga0209050_1004459 3300025298 Bacteria 9445
107 Ga0209256_1001577 3300025299 Bacteria 22383
108 Ga0209256_1004219 3300025299 Bacteria 9219
109 Ga0209256_1005600 3300025299 Bacteria 7134
110 Ga0209256_1006490 3300025299 Bacteria 6158
111 Ga0209256_1008108 3300025299 Bacteria 4956
112 Ga0209256_1035422 3300025299 Bacteria 1319
113 Ga0207426_1000022 3300025302 Bacteria 547377
114 Ga0207426_1000036 3300025302 Bacteria 444920
115 Ga0207426_1000075 3300025302 Bacteria 321337
116 Ga0207426_1000503 3300025302 Bacteria 57785
117 Ga0207426_1004564 3300025302 Bacteria 6692
118 Ga0209051_1000751 3300025303 Bacteria 34884
119 Ga0209051_1001177 3300025303 Bacteria 23706
120 Ga0209051_1005962 3300025303 Bacteria 6975
121 Ga0209051_1012132 3300025303 Bacteria 4188
122 Ga0209257_1000599 3300025304 Bacteria 59865
123 Ga0209257_1003754 3300025304 Bacteria 12550
124 Ga0209257_1004578 3300025304 Bacteria 10575
125 Ga0207650_10000377 3300025925 Bacteria 41945
126 Ga0207706_10153279 3300025933 Bacteria 2027
127 Ga0207668_10087555 3300025972 Bacteria 2278
128 Ga0207639_10157689 3300026041 Bacteria 1909
129 Ga0207675_100313109 3300026118 Bacteria 1531
130 Ga0209281_1000034 3300027111 Bacteria 382562
131 Ga0209281_1000329 3300027111 Bacteria 82668
132 Ga0209281_1001431 3300027111 Bacteria 14142
133 Ga0209371_1000003 3300027312 Bacteria 1122971
134 Ga0209371_1000976 3300027312 Bacteria 22110
135 Ga0209282_1000167 3300027666 Bacteria 37134
136 Ga0209813_10018111 3300027866 Bacteria 1942
137 Ga0268266_10026910 3300028379 Bacteria 4893
138 Ga0307515_10000017 3300028794 Bacteria 550465
139 Ga0307515_10003211 3300028794 Bacteria 34601
140 Ga0268256_1000004 3300030500 Bacteria 1122967
141 Ga0268256_1002843 3300030500 Bacteria 8345
142 Ga0307513_10012532 3300031456 Bacteria 10453
143 Ga0307406_10234063 3300031901 Bacteria 1374
144 Ga0307412_10042257 3300031911 Bacteria 2961
145 Ga0316583_10005162 3300032133 Bacteria 4681
146 Ga0315913_1001354 3300033430 Bacteria 26738
147 Ga0400483_096903 3300039062 Bacteria 1618
148 Ga0439436_0001038 3300041404 Bacteria 7791
149 Ga0439439_0042391 3300041406 Bacteria 1182
150 Ga0439466_0066989 3300041411 Bacteria 1149
151 Ga0439465_0001159 3300041413 Bacteria 8469
152 Ga0451847_0640839 3300041503 Bacteria 1440
153 Ga0451843_0064174 3300041509 Bacteria 2050
154 Ga0451853_1456325 3300041512 Bacteria 1273
155 Ga0439433_0019251 3300041999 Bacteria 1521
156 Ga0439445_0037170 3300042004 Bacteria 1284
157 Ga0439449_0002803 3300042007 Bacteria 6773
158 Ga0439449_0026727 3300042007 Bacteria 2154
159 Ga0450906_025852 3300042145 Bacteria 1042
160 Ga0439434_0012203 3300042435 Bacteria 2543
161 Ga0466970_0223628 3300044765 Bacteria 1051
162 Ga0495592_0187009 3300046454 Bacteria 1406
163 Ga0495629_0080780 3300046459 Bacteria 2269
164 Ga0495638_0087826 3300046460 Bacteria 1878
165 Ga0495651_0013067 3300046462 Bacteria 6415
166 Ga0495650_0029699 3300046471 Bacteria 2488
167 Ga0495605_0061223 3300046474 Bacteria 1802
168 Ga0495662_0037583 3300046476 Bacteria 2338
169 Ga0495585_0066109 3300046492 Bacteria 1980
170 Ga0495607_0012006 3300046501 Bacteria 5732
171 Ga0495583_0007050 3300046506 Bacteria 7184
172 Ga0495606_0001382 3300046507 Bacteria 32786
173 Ga0495606_0011311 3300046507 Bacteria 7292
174 Ga0495606_0101138 3300046507 Bacteria 1755
175 Ga0495608_0209264 3300046511 Bacteria 1227
176 Ga0495620_0021093 3300046515 Bacteria 3168
177 Ga0495630_0091286 3300046517 Bacteria 2301
178 Ga0495643_0025352 3300046522 Bacteria 3355
179 Ga0495643_0032352 3300046522 Bacteria 2904
180 Ga0495648_0016808 3300046524 Bacteria 5259
181 Ga0495652_0142184 3300046529 Bacteria 1886
182 Ga0495654_0000147 3300046530 Bacteria 72993
183 Ga0495654_0000655 3300046530 Bacteria 27305
184 Ga0495587_0067202 3300046536 Bacteria 2090
185 Ga0495597_0003958 3300046542 Bacteria 8339
186 Ga0495633_0012310 3300046558 Bacteria 4559
187 Ga0495633_0062910 3300046558 Bacteria 1737
188 Ga0495633_0081338 3300046558 Bacteria 1507
189 Ga0495668_0146063 3300046616 Bacteria 1295
190 Ga0495635_0164778 3300046663 Bacteria 1508
191 Ga0495588_0075050 3300046674 Bacteria 1761
192 Ga0495624_0024647 3300046690 Bacteria 3957
193 Ga0495670_0040774 3300046691 Bacteria 2316
194 Ga0495670_0052467 3300046691 Bacteria 2042
195 Ga0495686_0000090 3300047472 Bacteria 193179
196 Ga0495686_0027326 3300047472 Bacteria 3727
197 Ga0495686_0039286 3300047472 Bacteria 3023
198 Ga0495686_0047527 3300047472 Bacteria 2709
199 Ga0495686_0162505 3300047472 Bacteria 1304
200 Ga0495626_0022527 3300048091 Bacteria 3109
201 Ga0496100_0267745 3300048903 Bacteria 1269
202 Ga0496101_0021998 3300048904 Bacteria 4385
203 Ga0496102_0019077 3300048905 Bacteria 6036
204 Ga0496103_0009448 3300048906 Bacteria 5774
205 Ga0496104_0000378 3300048907 Bacteria 39345
206 Ga0496105_0001811 3300048908 Bacteria 15296
207 Ga0496106_0000188 3300048909 Bacteria 43820
208 Ga0496107_0307065 3300048910 Bacteria 1181
209 Ga0496109_0195011 3300048912 Bacteria 1904
210 Ga0496110_0007052 3300048913 Bacteria 8941
211 Ga0496110_0073334 3300048913 Bacteria 3038
212 Ga0496110_0244761 3300048913 Bacteria 1632
213 Ga0496111_0000414 3300048914 Bacteria 21472
214 Ga0496111_0000571 3300048914 Bacteria 19245
215 Ga0496113_0025584 3300048916 Bacteria 4209
216 Ga0496114_0010906 3300048917 Bacteria 7241
217 Ga0496116_0005240 3300048919 Bacteria 12117
218 Ga0496116_0027246 3300048919 Bacteria 4163
219 Ga0496116_0078095 3300048919 Bacteria 2066
220 Ga0496117_0000036 3300048920 Bacteria 325635
221 Ga0496118_0009373 3300048921 Bacteria 9909
222 Ga0496118_0048676 3300048921 Bacteria 3270
223 Ga0496118_0078334 3300048921 Bacteria 2339
224 Ga0496118_0092938 3300048921 Bacteria 2068
225 Ga0496119_0001603 3300048922 Bacteria 26894
226 Ga0496119_0010135 3300048922 Bacteria 7960
227 Ga0496119_0014224 3300048922 Bacteria 6250
228 Ga0496119_0032383 3300048922 Bacteria 3485
229 Ga0496119_0065867 3300048922 Bacteria 2143
230 Ga0496120_0000036 3300048923 Bacteria 206505
231 Ga0496120_0002229 3300048923 Bacteria 20320
232 Ga0496120_0015026 3300048923 Bacteria 5124
233 Ga0496121_0000005 3300048924 Bacteria 1034486
234 Ga0496121_0002138 3300048924 Bacteria 31031
235 Ga0496121_0003960 3300048924 Bacteria 20448
236 Ga0496121_0016194 3300048924 Bacteria 7719
237 Ga0496121_0138928 3300048924 Bacteria 1805
238 Ga0496121_0167015 3300048924 Bacteria 1603
239 Ga0496122_0000002 3300048925 Bacteria 905834
240 Ga0496122_0000215 3300048925 Bacteria 128810
241 Ga0496122_0029881 3300048925 Bacteria 4582
242 Ga0496122_0031051 3300048925 Bacteria 4457
243 Ga0496122_0039878 3300048925 Bacteria 3739
244 Ga0496122_0040195 3300048925 Bacteria 3721
245 Ga0496122_0055260 3300048925 Bacteria 2972
246 Ga0496122_0065842 3300048925 Bacteria 2623
247 Ga0496122_0073963 3300048925 Bacteria 2413
248 Ga0496123_0000002 3300048926 Bacteria 1811682
249 Ga0496123_0000306 3300048926 Bacteria 95266
250 Ga0496123_0008710 3300048926 Bacteria 9263
251 Ga0496124_0000206 3300048927 Bacteria 116591
252 Ga0496124_0000724 3300048927 Bacteria 54104
253 Ga0496124_0004794 3300048927 Bacteria 15575
254 Ga0496124_0010515 3300048927 Bacteria 9361
255 Ga0496124_0018098 3300048927 Bacteria 6614
256 Ga0496124_0024568 3300048927 Bacteria 5473
257 Ga0496124_0032649 3300048927 Bacteria 4593
258 Ga0496124_0044063 3300048927 Bacteria 3831
259 Ga0496124_0126072 3300048927 Bacteria 2039
260 Ga0496125_0000034 3300048928 Bacteria 348231
261 Ga0496125_0000163 3300048928 Bacteria 148473
262 Ga0496125_0000171 3300048928 Bacteria 145308
263 Ga0496125_0014681 3300048928 Bacteria 7614
264 Ga0496125_0018289 3300048928 Bacteria 6659
265 Ga0496125_0093671 3300048928 Bacteria 2241
266 Ga0496125_0134564 3300048928 Bacteria 1732
267 Ga0496125_0147178 3300048928 Bacteria 1625
268 Ga0496126_0005143 3300048929 Bacteria 15142
269 Ga0496126_0034008 3300048929 Bacteria 4792
270 Ga0496126_0193083 3300048929 Bacteria 1723
271 Ga0501032_0006208 3300049569 Bacteria 8789
272 Ga0501032_0120514 3300049569 Bacteria 1734
273 Ga0501033_0011169 3300049570 Bacteria 6878
274 Ga0501033_0239087 3300049570 Bacteria 1288
275 Ga0501034_0418815 3300049571 Bacteria 1261
276 Ga0501036_0135580 3300049572 Bacteria 2078
277 Ga0501036_0279145 3300049572 Bacteria 1398
278 Ga0501037_0000077 3300049573 Bacteria 91081
279 Ga0501037_0187495 3300049573 Bacteria 1465
280 Ga0501043_0000114 3300049579 Bacteria 75782
281 Ga0501043_0007992 3300049579 Bacteria 8352
282 Ga0501043_0185681 3300049579 Bacteria 1619
283 Ga0501067_0028120 3300049583 Bacteria 3115
284 Ga0501068_0034112 3300049584 Bacteria 3034
285 Ga0501069_0000016 3300049585 Bacteria 142565
286 Ga0501070_0000450 3300049586 Bacteria 37447
287 Ga0501073_0018348 3300049589 Bacteria 5056
288 Ga0501073_0313786 3300049589 Bacteria 1082
289 Ga0501074_0000067 3300049590 Bacteria 49686
290 Ga0501080_0002371 3300049742 Bacteria 16432
291 Ga0501080_0106045 3300049742 Bacteria 2605
292 Ga0501083_0000111 3300049744 Bacteria 55529
293 Ga0501280_003248 3300049776 Bacteria 2532
294 Ga0501035_0001093 3300049822 Bacteria 28434
295 Ga0501044_0000003 3300049823 Bacteria 345647
296 Ga0501044_0246499 3300049823 Bacteria 1729
297 Ga0501044_0314354 3300049823 Bacteria 1492
298 nmdc:mga03683_57944_c1 3300050489 Bacteria 1632
299 nmdc:mga00v17_273_c1 3300050491 Bacteria 30498
300 nmdc:mga00v17_42_c1 3300050491 Bacteria 79984
301 nmdc:mga00v17_457_c1 3300050491 Bacteria 22863
302 nmdc:mga00v17_8788_c1 3300050491 Bacteria 5442
303 nmdc:mga0yw44_11102_c1 3300050492 Bacteria 4631
304 nmdc:mga0yw44_18730_c1 3300050492 Bacteria 3800
305 nmdc:mga0yw44_524_c1 3300050492 Bacteria 13742
306 nmdc:mga06z11_40104_c1 3300050494 Bacteria 2335
307 nmdc:mga04h51_4990_c1 3300050495 Bacteria 3349
308 nmdc:mga0sz30_197_c1 3300050516 Bacteria 22540
309 Ga0495619_0106202 3300053085 Bacteria 1915
310 Ga0500578_0036521 3300053086 Bacteria 3155
311 Ga0500581_002510 3300053089 Bacteria 8048
312 Ga0500651_0197915 3300053093 Bacteria 1187
313 Ga0500560_000019 3300053107 Bacteria 20063
314 Ga0500560_000279 3300053107 Bacteria 6438
315 Ga0500572_003810 3300053111 Bacteria 3426
316 Ga0500618_000175 3300053125 Bacteria 53230
317 Ga0500618_000271 3300053125 Bacteria 39933
318 Ga0500618_000356 3300053125 Bacteria 31771
319 Ga0500618_007572 3300053125 Bacteria 3085
320 Ga0500658_0001984 3300053134 Bacteria 8000
321 Ga0500561_0000107 3300053137 Bacteria 16095
322 Ga0500568_0000204 3300053139 Bacteria 52334
323 Ga0500568_0000382 3300053139 Bacteria 33853
324 Ga0500573_0001030 3300053140 Bacteria 12870
325 Ga0500590_000026 3300053148 Bacteria 36766
326 Ga0500616_0000341 3300053153 Bacteria 66760
327 Ga0500616_0022490 3300053153 Bacteria 3518
328 Ga0500622_0000973 3300053156 Bacteria 24257
329 Ga0500624_000700 3300053157 Bacteria 8417
330 Ga0500633_0001859 3300053160 Bacteria 4151
331 Ga0500634_0001772 3300053161 Bacteria 8672
332 Ga0500634_0004085 3300053161 Bacteria 6670
333 Ga0500634_0004915 3300053161 Bacteria 6271
334 Ga0500636_0000001 3300053177 Bacteria 324086
335 Ga0500636_0000044 3300053177 Bacteria 66762
336 Ga0500636_0004690 3300053177 Bacteria 7760
337 Ga0501082_0006930 3300060353 Bacteria 9794
338 2509073414 2508501114 Bacteria 7082538
339 2509110810 2508501122 Bacteria 6292184
340 2509378536 2509276019 Bacteria 6802256
341 2510136439 2510065019 Bacteria 6903379
342 2510304637 2510065057 Bacteria 6649661
343 2510843237 2510461069 Bacteria 5505000
344 2510892317 2510461076 Bacteria 8618824
345 2511173275 2510917026 Bacteria 7046020
346 2511499833 2511231052 Bacteria 6974333
347 2512530230 2512047086 Bacteria 6850303
348 2512974800 2512875026 Bacteria 6861065
349 2513568072 2513237084 Bacteria 7231967
350 2513578380 2513237085 Bacteria 7695351
351 2513584847 2513237086 Bacteria 7265287
352 2513603865 2513237089 Bacteria 6553624
353 2513617392 2513237091 Bacteria 6900273
354 2513621143 2513237091 Bacteria 6900273
355 2513631014 2513237093 Bacteria 7545552
356 2513883070 2513237140 Bacteria 7076289
357 2513903125 2513237143 Bacteria 6664116
358 2513984770 2513237156 Bacteria 6402557
359 2514001149 2513237159 Bacteria 6810126
360 2514004179 2513237160 Bacteria 6650282
361 2514021115 2513237162 Bacteria 7468464
362 2515108601 2515075009 Bacteria 7288508
363 2515609892 2515154107 Bacteria 6795637
364 2515632225 2515154113 Bacteria 7807172
365 2515658322 2515154116 Bacteria 7552979
366 2515738110 2515154134 Bacteria 7220242
367 2516206622 2516143018 Bacteria 6951533
368 2516897397 2516653046 Bacteria 6989037
369 2517041210 2516653077 Bacteria 7555578
370 2517080166 2516653085 Bacteria 7346596
371 2517098165 2517093000 Bacteria 7412387
372 2517567447 2517487022 Bacteria 7227575
373 2524452383 2524023207 Bacteria 6813453
374 2524457165 2524023209 Bacteria 6679728
375 2524459746 2524023209 Bacteria 6679728
376 2530649014 2529292951 Bacteria 6916614
377 2535520442 2534681796 Bacteria 7146037
378 2537875925 2537561587 Bacteria 5425293
379 2551677426 2551306084 Bacteria 8942552
380 2551687825 2551306085 Bacteria 7347181
381 2551691469 2551306086 Bacteria 6843938
382 2551692577 2551306086 Bacteria 6843938
383 2551700510 2551306087 Bacteria 7351905
384 2551712948 2551306089 Bacteria 7162724
385 2551718227 2551306090 Bacteria 7953713
386 2551725073 2551306091 Bacteria 7086830
387 2551728044 2551306091 Bacteria 7086830
388 2551737383 2551306092 Bacteria 6992595
389 2551738667 2551306092 Bacteria 6992595
390 2551743994 2551306093 Bacteria 7064773
391 2554245819 2554235003 Bacteria 5877155
392 2558861929 2558860100 Bacteria 8458965
393 2559296414 2558860242 Bacteria 5568029
394 2561468486 2558860983 Bacteria 4133860
395 2585168520 2582581283 Bacteria 6030556
396 2585169527 2582581283 Bacteria 6030556
397 2585231184 2582581299 Bacteria 6518058
398 2585257947 2582581304 Bacteria 5831370
399 2585397739 2582581866 Bacteria 6859583
400 2585525586 2585427526 Bacteria 7258840
401 2585996346 2585427633 Bacteria 6413184
402 2585997544 2585427633 Bacteria 6413184
403 2586000954 2585427634 Bacteria 6455027
404 2586002150 2585427634 Bacteria 6455027
405 2597816253 2597489875 Bacteria 7010078
406 2599334003 2599185156 Bacteria 5403036
407 2599605538 2599185210 Bacteria 5624189
408 2599721867 2599185236 Bacteria 6875203
409 2600197060 2599185352 Bacteria 7228948
410 2600197973 2599185352 Bacteria 7228948
411 2600374311 2600254933 Bacteria 4750527
412 2601611740 2600255279 Bacteria 5605316
413 2601749529 2600255308 Bacteria 5611129
414 2643777630 2643221551 Bacteria 3750538
415 2643796078 2643221555 Bacteria 3749717
416 2643806390 2643221557 Bacteria 7184309
417 2643813877 2643221558 Bacteria 5460675
418 2643911984 2643221580 Bacteria 3816678
419 2643917682 2643221582 Bacteria 5804683
420 2644106104 2643221618 Bacteria 7717186
421 2644106380 2643221618 Bacteria 7717186
422 2644106523 2643221618 Bacteria 7717186
423 2644145986 2643221626 Bacteria 8069654
424 2644146933 2643221626 Bacteria 8069654
425 2644149238 2643221626 Bacteria 8069654
426 2644308405 2643221655 Bacteria 7722067
427 2644308457 2643221655 Bacteria 7722067
428 2644310715 2643221655 Bacteria 7722067
429 2644331822 2643221659 Bacteria 7890716
430 2644332118 2643221659 Bacteria 7890716
431 2644334498 2643221659 Bacteria 7890716
432 2644379336 2643221668 Bacteria 7306521
433 2644380057 2643221668 Bacteria 7306521
434 2644412348 2643221674 Bacteria 3919126
435 2644415178 2643221675 Bacteria 7473456
436 2644491890 2643221688 Bacteria 5260751
437 2644497198 2643221689 Bacteria 6042950
438 2644522783 2643221693 Bacteria 5513853
439 2644542202 2643221698 Bacteria 7756764
440 2644544492 2643221698 Bacteria 7756764
441 2644545303 2643221698 Bacteria 7756764
442 2644615650 2643221712 Bacteria 7729434
443 2644615793 2643221712 Bacteria 7729434
444 2644616549 2643221712 Bacteria 7729434
445 2644672383 2643221723 Bacteria 7095460
446 2644674622 2643221723 Bacteria 7095460
447 2657684285 2657244999 Bacteria 5946535
448 2692318159 2690316117 Bacteria 6800650
449 2725947844 2724679232 Bacteria 7646494
450 2753463928 2751185821 Bacteria 6189929
451 2757569340 2757320392 Bacteria 3737298
452 2758638515 2758568016 Bacteria 5645291
453 2766065125 2765235942 Bacteria 7445910
454 2774868970 2773857925 Bacteria 6472445
455 2792621377 2791355091 Bacteria 6135441
456 2792627935 2791355092 Bacteria 6248105
457 2792643372 2791355094 Bacteria 7011481
458 2793280705 2791355253 Bacteria 5171699
459 2793332011 2791355261 Bacteria 6661293
460 2802718358 2802428858 Bacteria 6636079
461 2802724065 2802428859 Bacteria 6667919
462 2802725848 2802428859 Bacteria 6667919
463 2802731444 2802428860 Bacteria 6525526
464 2802736365 2802428861 Bacteria 6534206
465 2802744339 2802428862 Bacteria 6633353
466 2802750071 2802428863 Bacteria 6410669
467 2802752025 2802428863 Bacteria 6410669
468 2804754247 2802429268 Bacteria 6094027
469 2808988634 2808606387 Bacteria 5697198
470 2819557796 2818991439 Bacteria 6907412
471 2819684975 2818991461 Bacteria 7026071
472 2821127444 2821123053 Bacteria 7836056
473 2838069162 2838068647 Bacteria 6208656
474 2838679807 2838675328 Bacteria 4909118
475 2838687477 2838686498 Bacteria 7807632
476 2838717423 2838714209 Bacteria 5525906
477 2838724376 2838719591 Bacteria 5523910
478 2838729307 2838724970 Bacteria 4908691
479 2838734111 2838729681 Bacteria 7400765
480 2838737969 2838736955 Bacteria 5760694
481 2838746563 2838742623 Bacteria 7396178
482 2840880247 2840878972 Bacteria 5483153
483 2841734662 2841734538 Bacteria 6784580
484 2841841662 2841840854 Bacteria 5761912
485 2841850734 2841846520 Bacteria 5345850
486 2841854027 2841851746 Bacteria 7532261
487 2841864018 2841859092 Bacteria 5436171
488 2842116717 2842110456 Bacteria 7656360
489 2842129539 2842124991 Bacteria 5346824
490 2842134684 2842130223 Bacteria 4909145
491 2842141440 2842140634 Bacteria 5759631
492 2842156798 2842152218 Bacteria 4908957
493 2842159606 2842156927 Bacteria 6894975
494 2842164055 2842163707 Bacteria 6916235
495 2842173056 2842170452 Bacteria 5525737
496 2842180416 2842175837 Bacteria 4908771
497 2842182824 2842180545 Bacteria 6888678
498 2842191925 2842187318 Bacteria 5524014
499 2842216241 2842211629 Bacteria 5523832
500 2842221601 2842217011 Bacteria 7497767
501 2842228961 2842224351 Bacteria 5524473
502 2842232535 2842229732 Bacteria 7475766
503 2842247222 2842243621 Bacteria 7421798
504 2842259091 2842257432 Bacteria 7401195
505 2842265537 2842264693 Bacteria 6472963
506 2842272489 2842271015 Bacteria 7807131
507 2842299281 2842298080 Bacteria 6123127
508 2842301651 2842298080 Bacteria 6123127
509 2842309823 2842304105 Bacteria 7023636
510 2842334371 2842333319 Bacteria 8899485
511 2842358748 2842357229 Bacteria 6485165
512 2842361780 2842357229 Bacteria 6485165
513 2842422352 2842422224 Bacteria 6239196
514 2842428413 2842428310 Bacteria 6767288
515 2842435027 2842434925 Bacteria 6502746
516 2842442111 2842441272 Bacteria 6769273
517 2842449491 2842447887 Bacteria 6754142
518 2842466640 2842462802 Bacteria 6588055
519 2842469359 2842469257 Bacteria 6752936
520 2842512178 2842509118 Bacteria 6850950
521 2842513450 2842509118 Bacteria 6850950
522 2842520800 2842515876 Bacteria 5436280
523 2842526876 2842521101 Bacteria 6569494
524 2842925718 2842922631 Bacteria 5824079
525 2842927033 2842922631 Bacteria 5824079
526 2844165814 2844163670 Bacteria 7266046
527 2844166777 2844163670 Bacteria 7266046
528 2844460473 2844454524 Bacteria 7952546
529 2847423336 2847417321 Bacteria 6913799
530 2848997211 2848992105 Bacteria 6810864
531 2850084033 2850079185 Bacteria 6848280
532 2852394570 2852387548 Bacteria 8025568
533 2852395231 2852387548 Bacteria 8025568
534 2854684840 2854681122 Bacteria 4548679
535 2854901135 2854896431 Bacteria 5869725
536 2854918526 2854916844 Bacteria 5725939
537 2854920244 2854916844 Bacteria 5725939
538 2855830206 2855825444 Bacteria 6785811
539 2855830707 2855825444 Bacteria 6785811
540 2855845520 2855839649 Bacteria 7135830
541 2855845998 2855839649 Bacteria 7135830
542 2855874472 2855872281 Bacteria 6964271
543 2856320232 2856314179 Bacteria 6477897
544 2856345633 2856342000 Bacteria 7176905
545 2857357303 2857349434 Bacteria 7926032
546 2857518044 2857516855 Bacteria 7787325
547 2857536542 2857531043 Bacteria 6754041
548 2858804327 2858800743 Bacteria 6603254
549 2858805387 2858800743 Bacteria 6603254
550 2871476348 2871474448 Bacteria 6806570
551 2878042540 2878035449 Bacteria 6555736
552 2878793525 2878788777 Bacteria 6567085
553 2882457462 2882456835 Bacteria 6863978
554 2885346216 2885342637 Bacteria 7011821
555 2885355118 2885350715 Bacteria 6787678
556 2889791407 2889790730 Bacteria 5689708
557 2889920184 2889914905 Bacteria 5702301
558 2896389297 2896384573 Bacteria 7700774
559 2899793665 2899792073 Bacteria 4926588
560 2899848761 2899845264 Bacteria 5672268
561 2906420989 2906414383 Bacteria 6580790
562 2913296404 2913295892 Bacteria 6333755
563 2915980991 2915980308 Bacteria 6624279
564 2915990897 2915986958 Bacteria 6739310
565 2915996054 2915993759 Bacteria 7016183
566 2915998123 2915993759 Bacteria 7016183
567 2916003037 2916000859 Bacteria 6865702
568 2916009166 2916007675 Bacteria 6898660
569 2916009278 2916007675 Bacteria 6898660
570 2916017178 2916014648 Bacteria 6946486
571 2916019280 2916014648 Bacteria 6946486
572 2916025671 2916021584 Bacteria 6854472
573 2916030672 2916028427 Bacteria 6748433
574 2916034019 2916028427 Bacteria 6748433
575 2916037986 2916035215 Bacteria 6755766
576 2916041027 2916035215 Bacteria 6755766
577 2916043897 2916041962 Bacteria 6820487
578 2916048242 2916041962 Bacteria 6820487
579 2916052018 2916048683 Bacteria 6543552
580 2916053055 2916048683 Bacteria 6543552
581 2916060378 2916055098 Bacteria 6758838
582 2916060571 2916055098 Bacteria 6758838
583 2916075633 2916068649 Bacteria 6943657
584 2916077750 2916076590 Bacteria 6596108
585 2919119176 2919114240 Bacteria 5700270
586 2919174566 2919171160 Bacteria 6499771
587 2919177084 2919171160 Bacteria 6499771
588 2919682390 2919679072 Bacteria 4629602
589 2920828039 2920822456 Bacteria 6897201
590 2921207371 2921201388 Bacteria 6926299
591 2921208296 2921201388 Bacteria 6926299
592 2921211949 2921208531 Bacteria 6745326
593 2921215247 2921208531 Bacteria 6745326
594 2921241830 2921237296 Bacteria 6876710
595 2921243191 2921237296 Bacteria 6876710
596 2921248397 2921244191 Bacteria 6568419
597 2921251331 2921250672 Bacteria 6677771
598 2921262163 2921257292 Bacteria 6808382
599 2921263033 2921257292 Bacteria 6808382
600 2921267850 2921263974 Bacteria 6864552
601 2921269587 2921263974 Bacteria 6864552
602 2921285376 2921282425 Bacteria 6826397
603 2921295418 2921289301 Bacteria 7316391
604 2921297070 2921296804 Bacteria 7176999
605 2921302884 2921296804 Bacteria 7176999
606 2924144629 2924144063 Bacteria 6883928
607 2924152435 2924150972 Bacteria 7169444
608 2924152981 2924150972 Bacteria 7169444
609 2924161175 2924158325 Bacteria 7188855
610 2924161498 2924158325 Bacteria 7188855
611 2924167132 2924165586 Bacteria 7260590
612 2924175991 2924172951 Bacteria 6749356
613 2924178751 2924172951 Bacteria 6749356
614 2924184498 2924179722 Bacteria 6843264
615 2924186603 2924186466 Bacteria 6876637
616 2924194487 2924193448 Bacteria 6955718
617 2924197581 2924193448 Bacteria 6955718
618 2924202038 2924200457 Bacteria 6757188
619 2924208456 2924207177 Bacteria 6917007
620 2924209765 2924207177 Bacteria 6917007
621 2924219053 2924214083 Bacteria 7080103
622 2924223078 2924221636 Bacteria 7113495
623 2924223438 2924221636 Bacteria 7113495
624 2924229261 2924228884 Bacteria 6633132
625 2924229659 2924228884 Bacteria 6633132
626 2926759208 2926754445 Bacteria 5964435
627 2926763362 2926760298 Bacteria 5505990
628 2928525522 2928521798 Bacteria 4960112
629 2929142661 2929138655 Bacteria 5810547
630 2929143234 2929138655 Bacteria 5810547
631 2933011403 2933006813 Bacteria 4912075
632 2933016587 2933011516 Bacteria 5439334
633 2933576265 2933570622 Bacteria 7023390
634 2933592933 2933586486 Bacteria 7667493
635 2933596026 2933594066 Bacteria 5594265
636 2933599827 2933599457 Bacteria 5858799
637 2935903156 2935901341 Bacteria 7341747
638 2936374384 2936367885 Bacteria 7324495
639 2936378774 2936375103 Bacteria 6652732
640 2937000317 2936996657 Bacteria 6298727
641 2937006313 2937002841 Bacteria 6934057
642 2937009168 2937002841 Bacteria 6934057
643 2937011493 2937009748 Bacteria 6746052
644 2937017597 2937016420 Bacteria 6782579
645 2937019917 2937016420 Bacteria 6782579
646 2937023586 2937023124 Bacteria 6815156
647 2937026999 2937023124 Bacteria 6815156
648 2937035921 2937029754 Bacteria 6424026
649 2937036387 2937036028 Bacteria 6846469
650 2937043377 2937042894 Bacteria 6741576
651 2937049185 2937042894 Bacteria 6741576
652 2937050268 2937049772 Bacteria 6757901
653 2937056024 2937049772 Bacteria 6757901
654 2937061061 2937056579 Bacteria 7107896
655 2937068283 2937063883 Bacteria 7199456
656 2937074105 2937071275 Bacteria 6984483
657 2937077075 2937071275 Bacteria 6984483
658 2937091376 2937084907 Bacteria 6618516
659 2937092701 2937091812 Bacteria 6979387
660 2937093484 2937091812 Bacteria 6979387
661 2937103933 2937098957 Bacteria 7249374
662 2937104305 2937098957 Bacteria 7249374
663 2937111693 2937106411 Bacteria 6947143
664 2937113429 2937106411 Bacteria 6947143
665 2937116580 2937113482 Bacteria 6505872
666 2937120457 2937119839 Bacteria 6597547
667 2937123295 2937119839 Bacteria 6597547
668 2937128692 2937126314 Bacteria 6771275
669 2937132881 2937126314 Bacteria 6771275
670 2937842798 2937836603 Bacteria 6811263
671 2941505198 2941499720 Bacteria 7599444
672 2954012436 2954011201 Bacteria 4762601
673 2957386793 2957382221 Bacteria 6737050
674 2957394578 2957388812 Bacteria 6778072
675 2957396283 2957395598 Bacteria 6822399
676 2957399163 2957395598 Bacteria 6822399
677 2957407043 2957402308 Bacteria 6741770
678 2957409288 2957408893 Bacteria 6558585
679 2957413615 2957408893 Bacteria 6558585
680 2957415472 2957415311 Bacteria 6991633
681 2957420899 2957415311 Bacteria 6991633
682 2957426612 2957422303 Bacteria 7172205
683 2957430886 2957430029 Bacteria 7022557
684 2957430914 2957430029 Bacteria 7022557
685 2957439615 2957437181 Bacteria 6568994
686 2957444861 2957443900 Bacteria 6869977
687 2957449628 2957443900 Bacteria 6869977
688 2957453066 2957450854 Bacteria 6765715
689 2957463503 2957457609 Bacteria 6967680
690 2957464598 2957457609 Bacteria 6967680
691 2957465160 2957464669 Bacteria 6568877
692 2957473721 2957471148 Bacteria 6797643
693 2957476949 2957471148 Bacteria 6797643
694 2957480866 2957478035 Bacteria 6756658
695 2957483551 2957478035 Bacteria 6756658
696 2957487432 2957484790 Bacteria 6703082
697 2957489430 2957484790 Bacteria 6703082
698 2957491867 2957491536 Bacteria 6695180
699 2957502881 2957498199 Bacteria 7126688
700 2957503407 2957498199 Bacteria 7126688
701 2957505765 2957505466 Bacteria 7253085
702 2958074898 2958071322 Bacteria 6815895
703 2960587896 2960584000 Bacteria 6864594
704 2960592497 2960591022 Bacteria 6622873
705 2960601134 2960597568 Bacteria 6550735
706 2960605638 2960603979 Bacteria 6898737
707 2960606780 2960603979 Bacteria 6898737
708 2960612737 2960610863 Bacteria 6691244
709 2960614971 2960610863 Bacteria 6691244
710 2960621989 2960617483 Bacteria 6727748
711 2960623831 2960617483 Bacteria 6727748
712 2960628541 2960624210 Bacteria 6875384
713 2960628956 2960624210 Bacteria 6875384
714 2960632236 2960631154 Bacteria 6732508
715 2960636118 2960631154 Bacteria 6732508
716 2960643344 2960637947 Bacteria 7296468
717 2960646955 2960645483 Bacteria 7211087
718 2960656934 2960652885 Bacteria 7083688
719 2960661575 2960660292 Bacteria 7041660
720 2960666301 2960660292 Bacteria 7041660
721 2960670382 2960667422 Bacteria 6763020
722 2960676211 2960674078 Bacteria 6609048
723 2960681134 2960680706 Bacteria 6624464
724 2960693397 2960687367 Bacteria 6535474
725 2964614724 2964607997 Bacteria 7101408
726 2964618856 2964615318 Bacteria 6809089
727 2964620522 2964615318 Bacteria 6809089
728 2964625541 2964621998 Bacteria 6834995
729 2964634850 2964628898 Bacteria 7083044
730 2964637976 2964636051 Bacteria 7091832
731 2964638516 2964636051 Bacteria 7091832
732 2964644283 2964643177 Bacteria 6820887
733 2964651108 2964649959 Bacteria 6675118
734 2964653251 2964649959 Bacteria 6675118
735 2964659871 2964656573 Bacteria 7100150
736 2964662670 2964656573 Bacteria 7100150
737 2964664242 2964663802 Bacteria 7019362
738 2964666392 2964663802 Bacteria 7019362
739 2964673234 2964670856 Bacteria 6851364
740 2964678581 2964678106 Bacteria 6792020
741 2964680308 2964678106 Bacteria 6792020
742 2964691590 2964685014 Bacteria 6839111
743 2964695479 2964691889 Bacteria 6802758
744 2964696707 2964691889 Bacteria 6802758
745 2964699749 2964698721 Bacteria 6765331
746 2964708790 2964705432 Bacteria 7114648
747 2964712528 2964705432 Bacteria 7114648
748 2964718126 2964712639 Bacteria 6695970
749 2964723560 2964719344 Bacteria 7286602
750 2965062944 2965062239 Bacteria 7412989
751 2967665085 2967664464 Bacteria 6948836
752 2967665948 2967664464 Bacteria 6948836
753 2967672763 2967671571 Bacteria 7021409
754 2967678050 2967671571 Bacteria 7021409
755 2967679001 2967678726 Bacteria 7264382
756 2967683729 2967678726 Bacteria 7264382
757 2967692004 2967686174 Bacteria 6678622
758 2967694006 2967693043 Bacteria 6804451
759 2967697593 2967693043 Bacteria 6804451
760 2967701900 2967699805 Bacteria 6854538
761 2967703464 2967699805 Bacteria 6854538
762 2967707836 2967706974 Bacteria 7186053
763 2967708353 2967706974 Bacteria 7186053
764 2967718006 2967714385 Bacteria 7000047
765 2967719354 2967714385 Bacteria 7000047
766 2967724429 2967721400 Bacteria 7073753
767 2967725222 2967721400 Bacteria 7073753
768 2967729126 2967728569 Bacteria 6641507
769 2967740413 2967735183 Bacteria 6827012
770 2967747726 2967742019 Bacteria 6794534
771 2967755251 2967748971 Bacteria 6733771
772 2967760492 2967755722 Bacteria 6814706
773 2967760812 2967755722 Bacteria 6814706
774 2967763462 2967762386 Bacteria 6923502
775 2967768374 2967762386 Bacteria 6923502
776 2967770216 2967769361 Bacteria 6587838
777 2967781886 2967775926 Bacteria 6738189
778 2967781948 2967775926 Bacteria 6738189
779 2968092051 2968091066 Bacteria 6052692
780 2970024605 2970019648 Bacteria 7072033
781 2970025242 2970019648 Bacteria 7072033
782 2970029663 2970026789 Bacteria 6785236
783 2970039883 2970033650 Bacteria 7118744
784 2970045155 2970040964 Bacteria 6731123
785 2970047277 2970040964 Bacteria 6731123
786 2970054713 2970047711 Bacteria 7088379
787 2970060133 2970054988 Bacteria 6611507
788 2970063488 2970061556 Bacteria 7099761
789 2970063669 2970061556 Bacteria 7099761
790 2970069743 2970068827 Bacteria 7123112
791 2970082109 2970076120 Bacteria 6697332
792 2970091420 2970088815 Bacteria 6933825
793 2970093035 2970088815 Bacteria 6933825
794 2970099987 2970095765 Bacteria 6936963
795 2970103109 2970102677 Bacteria 6812532
796 2970107062 2970102677 Bacteria 6812532
797 2970110328 2970109326 Bacteria 6863976
798 2970112559 2970109326 Bacteria 6863976
799 2970117074 2970116247 Bacteria 6501857
800 2970124180 2970122695 Bacteria 6625855
801 2970129884 2970129317 Bacteria 6806560
802 2970133122 2970129317 Bacteria 6806560
803 2970138061 2970136068 Bacteria 7207982
804 2970139195 2970136068 Bacteria 7207982
805 2970144926 2970143518 Bacteria 6446480
806 2970152570 2970149975 Bacteria 6779706
807 2970154694 2970149975 Bacteria 6779706
808 2970160918 2970156795 Bacteria 7168044
809 2970166608 2970164137 Bacteria 6861252
810 2970168758 2970164137 Bacteria 6861252
811 2970172488 2970170962 Bacteria 6876229
812 2970175395 2970170962 Bacteria 6876229
813 2970181342 2970177841 Bacteria 6768001
814 2970184625 2970177841 Bacteria 6768001
815 2970188571 2970184632 Bacteria 7054431
816 2970189886 2970184632 Bacteria 7054431
817 2970196197 2970191845 Bacteria 7032787
818 2970529533 2970524798 Bacteria 6840927
819 2977523583 2977516862 Bacteria 6940108
820 2977524237 2977523885 Bacteria 6960446
821 2977527847 2977523885 Bacteria 6960446
822 2977537278 2977530762 Bacteria 6951399
823 2977539492 2977537788 Bacteria 6929320
824 2977543022 2977537788 Bacteria 6929320
825 2977550106 2977544691 Bacteria 6875412
826 2977555433 2977551784 Bacteria 7125765
827 2977556541 2977551784 Bacteria 7125765
828 2977565299 2977558990 Bacteria 6863948
829 2977567416 2977565890 Bacteria 6901543
830 2977572468 2977565890 Bacteria 6901543
831 2977573435 2977572785 Bacteria 6763888
832 2977576693 2977572785 Bacteria 6763888
833 2977583389 2977579622 Bacteria 6772100
834 2977585339 2977579622 Bacteria 6772100
835 2977949353 2977942078 Bacteria 7570577
836 2979091605 2979089926 Bacteria 5670289
837 2979097126 2979095461 Bacteria 5669583
838 2979102836 2979100975 Bacteria 5423623
839 2984509275 2984509177 Bacteria 5274802
840 2984520025 2984518228 Bacteria 5277463
841 2984537604 2984537506 Bacteria 5277481
842 2984604353 2984601300 Bacteria 5455244
843 2987644693 2987636660 Bacteria 8088555
844 2989773021 2989771324 Bacteria 5605128
845 2989781364 2989776772 Bacteria 4843317
846 2995394612 2995392953 Bacteria 4539380
847 2996316373 2996310559 Bacteria 6357320
848 2996887423 2996887358 Bacteria 5795980
849 3000019256 3000017691 Bacteria 3772574
850 3000406375 3000405567 Bacteria 3779330
851 3004210845 3004203850 Bacteria 7307914
852 3005597260 3005594810 Bacteria 8716512
853 643822638 643692032 Bacteria 6891900
854 648737882 648276728 Bacteria 6968865
855 648739344 648276728 Bacteria 6968865
856 650842810 650716007 Bacteria 5573770
857 8003574832 8003570095 Bacteria 5747666
858 8003997528 8003992118 Bacteria 7266902
859 8003998214 8003992118 Bacteria 7266902
860 8004006165 8003999396 Bacteria 7063185
861 8004637625 8004633249 Bacteria 6723080
862 8005259884 8005258706 Bacteria 6184835
863 8005301669 8005301065 Bacteria 6614431
864 8005307925 8005307578 Bacteria 7395396
865 8005321950 8005321885 Bacteria 5795980
866 8005379813 8005376324 Bacteria 6590079
867 8005399151 8005395548 Bacteria 6806915
868 8005467225 8005460587 Bacteria 7157962
869 8005548194 8005542996 Bacteria 7077758
870 8005562345 8005556819 Bacteria 6908598
871 8005565507 8005563573 Bacteria 7153261
872 8018153476 8018150411 Bacteria 5549903
873 8018165516 8018163183 Bacteria 7277977
874 8023688077 8023680758 Bacteria 7729763
875 8024485024 8024479707 Bacteria 6954785
876 8024487608 8024486573 Bacteria 6540512
877 8046769100 8046767195 Bacteria 7547379
878 8046773427 8046767195 Bacteria 7547379
879 8046774589 8046767195 Bacteria 7547379
880 8054462142 8054460903 Bacteria 4872905
881 8054561487 8054558443 Bacteria 5204801
882 8054563949 8054563764 Bacteria 5592885
883 8055435285 8055431914 Bacteria 4551896
884 8055622894 8055617313 Bacteria 7548464
885 8056876891 8056875544 Bacteria 4355797
886 8057135757 8057132660 Bacteria 4061191
887 8057576501 8057575449 Bacteria 7367519
888 8057581370 8057575449 Bacteria 7367519
889 8057878005 8057874678 Bacteria 7494653
890 JGI25159J45721_1000080
891 JGI25152J39213_1005341
892 JGI25159J45721_1000354
893 JGI25159J45721_1000466
894 JGI25159J45721_1000514
895 JGI25151J46595_10011163
896 JGI25151J46595_10026634
897 JGI25153J46596_10000302
898 rootL2_10092790
899 JGI25160J50197_1000005
900 JGI25160J50197_1000014
901 JGI25160J50197_1000026
902 JGI25160J50197_1000160
903 JGI25161J50226_1000014
904 JGI25161J50226_1000022
905 Ga0055526_1004999
906 Ga0055526_1006491
907 Ga0055524_1000581
908 Ga0055524_1002487
909 Ga0055524_1006335
910 Ga0055524_1028674
911 Ga0055524_1035140
912 Ga0055536_1001262
913 Ga0055536_1006042
914 Ga0055536_1011844
915 Ga0055536_1019506
916 Ga0055528_1016836
917 Ga0055540_1006014
918 Ga0055540_1008423
919 Ga0055531_10001938
920 Ga0055531_10002976
921 Ga0055531_10003532
922 Ga0058692_1001187
923 Ga0058692_1005324
924 Ga0055543_1000005
925 Ga0055543_1000052
926 Ga0055543_1000324
927 Ga0065165_1000002
928 Ga0065165_1000073
929 Ga0065165_1000463
930 Ga0065165_1000534
931 Ga0065704_10079730
932 Ga0070683_100315588
933 Ga0070670_100000446
934 Ga0070668_100095965
935 Ga0070662_100140353
936 Ga0070665_100008536
937 Ga0075365_10011720
938 Ga0075365_10033506
939 Ga0075365_10093516
940 Ga0075368_10024529
941 Ga0075363_100135135
942 Ga0075364_10000058
943 Ga0075364_10022274
944 Ga0075367_10056064
945 Ga0075369_10063795
946 Ga0097621_100014591
947 Ga0075430_100172300
948 Ga0079104_1000045
949 Ga0099826_10000040
950 Ga0105251_10028109
951 Ga0105250_10036053
952 Ga0105243_10030726
953 Ga0105248_10391834
954 Ga0105246_10078453
955 Ga0157373_10061465
956 Ga0157371_10000042
957 Ga0157370_10000035
958 Ga0157370_10392398
959 Ga0171463_1013
960 Ga0183363_1072
961 Ga0214543_1000018
962 Ga0228711_1023402
963 Ga0228710_1002216
964 Ga0228710_1022978
965 Ga0209436_100101
966 Ga0209436_100162
967 Ga0209129_1000690
968 Ga0209129_1014727
969 Ga0209565_1015948
970 Ga0209455_1000196
971 Ga0209673_1002427
972 Ga0209673_1020551
973 Ga0209130_1000010
974 Ga0209130_1000013
975 Ga0209130_1000121
976 Ga0209130_1000309
977 Ga0209676_1000498
978 Ga0209676_1001837
979 Ga0209676_1002471
980 Ga0209676_1002760
981 Ga0209676_1026246
982 Ga0209676_1039150
983 Ga0209025_1000374
984 Ga0209025_1002206
985 Ga0209025_1004162
986 Ga0209025_1028032
987 Ga0209564_1000341
988 Ga0209564_1014365
989 Ga0209564_1018741
990 Ga0209758_1000237
991 Ga0209758_1000504
992 Ga0209758_1004696
993 Ga0209758_1054380
994 Ga0209050_1004289
995 Ga0209050_1004459
996 Ga0209256_1001577
997 Ga0209256_1004219
998 Ga0209256_1005600
999 Ga0209256_1006490
1000 Ga0209256_1008108
1001 Ga0209256_1035422
1002 Ga0207426_1000022
1003 Ga0207426_1000036
1004 Ga0207426_1000075
1005 Ga0207426_1000503
1006 Ga0207426_1004564
1007 Ga0209051_1000751
1008 Ga0209051_1001177
1009 Ga0209051_1005962
1010 Ga0209051_1012132
1011 Ga0209257_1000599
1012 Ga0209257_1003754
1013 Ga0209257_1004578
1014 Ga0207650_10000377
1015 Ga0207706_10153279
1016 Ga0207668_10087555
1017 Ga0207639_10157689
1018 Ga0207675_100313109
1019 Ga0209281_1000034
1020 Ga0209281_1000329
1021 Ga0209281_1001431
1022 Ga0209371_1000003
1023 Ga0209371_1000976
1024 Ga0209282_1000167
1025 Ga0209813_10018111
1026 Ga0268266_10026910
1027 Ga0307515_10000017
1028 Ga0307515_10003211
1029 Ga0268256_1000004
1030 Ga0268256_1002843
1031 Ga0307513_10012532
1032 Ga0307406_10234063
1033 Ga0307412_10042257
1034 Ga0316583_10005162
1035 Ga0315913_1001354
1036 Ga0400483_096903
1037 Ga0439436_0001038
1038 Ga0439439_0042391
1039 Ga0439466_0066989
1040 Ga0439465_0001159
1041 Ga0451847_0640839
1042 Ga0451843_0064174
1043 Ga0451853_1456325
1044 Ga0439433_0019251
1045 Ga0439445_0037170
1046 Ga0439449_0002803
1047 Ga0439449_0026727
1048 Ga0450906_025852
1049 Ga0439434_0012203
1050 Ga0466970_0223628
1051 Ga0495592_0187009
1052 Ga0495629_0080780
1053 Ga0495638_0087826
1054 Ga0495651_0013067
1055 Ga0495650_0029699
1056 Ga0495605_0061223
1057 Ga0495662_0037583
1058 Ga0495585_0066109
1059 Ga0495607_0012006
1060 Ga0495583_0007050
1061 Ga0495606_0001382
1062 Ga0495606_0011311
1063 Ga0495606_0101138
1064 Ga0495608_0209264
1065 Ga0495620_0021093
1066 Ga0495630_0091286
1067 Ga0495643_0025352
1068 Ga0495643_0032352
1069 Ga0495648_0016808
1070 Ga0495652_0142184
1071 Ga0495654_0000147
1072 Ga0495654_0000655
1073 Ga0495587_0067202
1074 Ga0495597_0003958
1075 Ga0495633_0012310
1076 Ga0495633_0062910
1077 Ga0495633_0081338
1078 Ga0495668_0146063
1079 Ga0495635_0164778
1080 Ga0495588_0075050
1081 Ga0495624_0024647
1082 Ga0495670_0040774
1083 Ga0495670_0052467
1084 Ga0495686_0000090
1085 Ga0495686_0027326
1086 Ga0495686_0039286
1087 Ga0495686_0047527
1088 Ga0495686_0162505
1089 Ga0495626_0022527
1090 Ga0496100_0267745
1091 Ga0496101_0021998
1092 Ga0496102_0019077
1093 Ga0496103_0009448
1094 Ga0496104_0000378
1095 Ga0496105_0001811
1096 Ga0496106_0000188
1097 Ga0496107_0307065
1098 Ga0496109_0195011
1099 Ga0496110_0007052
1100 Ga0496110_0073334
1101 Ga0496110_0244761
1102 Ga0496111_0000414
1103 Ga0496111_0000571
1104 Ga0496113_0025584
1105 Ga0496114_0010906
1106 Ga0496116_0005240
1107 Ga0496116_0027246
1108 Ga0496116_0078095
1109 Ga0496117_0000036
1110 Ga0496118_0009373
1111 Ga0496118_0048676
1112 Ga0496118_0078334
1113 Ga0496118_0092938
1114 Ga0496119_0001603
1115 Ga0496119_0010135
1116 Ga0496119_0014224
1117 Ga0496119_0032383
1118 Ga0496119_0065867
1119 Ga0496120_0000036
1120 Ga0496120_0002229
1121 Ga0496120_0015026
1122 Ga0496121_0000005
1123 Ga0496121_0002138
1124 Ga0496121_0003960
1125 Ga0496121_0016194
1126 Ga0496121_0138928
1127 Ga0496121_0167015
1128 Ga0496122_0000002
1129 Ga0496122_0000215
1130 Ga0496122_0029881
1131 Ga0496122_0031051
1132 Ga0496122_0039878
1133 Ga0496122_0040195
1134 Ga0496122_0055260
1135 Ga0496122_0065842
1136 Ga0496122_0073963
1137 Ga0496123_0000002
1138 Ga0496123_0000306
1139 Ga0496123_0008710
1140 Ga0496124_0000206
1141 Ga0496124_0000724
1142 Ga0496124_0004794
1143 Ga0496124_0010515
1144 Ga0496124_0018098
1145 Ga0496124_0024568
1146 Ga0496124_0032649
1147 Ga0496124_0044063
1148 Ga0496124_0126072
1149 Ga0496125_0000034
1150 Ga0496125_0000163
1151 Ga0496125_0000171
1152 Ga0496125_0014681
1153 Ga0496125_0018289
1154 Ga0496125_0093671
1155 Ga0496125_0134564
1156 Ga0496125_0147178
1157 Ga0496126_0005143
1158 Ga0496126_0034008
1159 Ga0496126_0193083
1160 Ga0501032_0006208
1161 Ga0501032_0120514
1162 Ga0501033_0011169
1163 Ga0501033_0239087
1164 Ga0501034_0418815
1165 Ga0501036_0135580
1166 Ga0501036_0279145
1167 Ga0501037_0000077
1168 Ga0501037_0187495
1169 Ga0501043_0000114
1170 Ga0501043_0007992
1171 Ga0501043_0185681
1172 Ga0501067_0028120
1173 Ga0501068_0034112
1174 Ga0501069_0000016
1175 Ga0501070_0000450
1176 Ga0501073_0018348
1177 Ga0501073_0313786
1178 Ga0501074_0000067
1179 Ga0501080_0002371
1180 Ga0501080_0106045
1181 Ga0501083_0000111
1182 Ga0501280_003248
1183 Ga0501035_0001093
1184 Ga0501044_0000003
1185 Ga0501044_0246499
1186 Ga0501044_0314354
1187 nmdc:mga03683_57944_c1
1188 nmdc:mga00v17_273_c1
1189 nmdc:mga00v17_42_c1
1190 nmdc:mga00v17_457_c1
1191 nmdc:mga00v17_8788_c1
1192 nmdc:mga0yw44_11102_c1
1193 nmdc:mga0yw44_18730_c1
1194 nmdc:mga0yw44_524_c1
1195 nmdc:mga06z11_40104_c1
1196 nmdc:mga04h51_4990_c1
1197 nmdc:mga0sz30_197_c1
1198 Ga0495619_0106202
1199 Ga0500578_0036521
1200 Ga0500581_002510
1201 Ga0500651_0197915
1202 Ga0500560_000019
1203 Ga0500560_000279
1204 Ga0500572_003810
1205 Ga0500618_000175
1206 Ga0500618_000271
1207 Ga0500618_000356
1208 Ga0500618_007572
1209 Ga0500658_0001984
1210 Ga0500561_0000107
1211 Ga0500568_0000204
1212 Ga0500568_0000382
1213 Ga0500573_0001030
1214 Ga0500590_000026
1215 Ga0500616_0000341
1216 Ga0500616_0022490
1217 Ga0500622_0000973
1218 Ga0500624_000700
1219 Ga0500633_0001859
1220 Ga0500634_0001772
1221 Ga0500634_0004085
1222 Ga0500634_0004915
1223 Ga0500636_0000001
1224 Ga0500636_0000044
1225 Ga0500636_0004690
1226 Ga0501082_0006930
1227 2509073414
1228 2509110810
1229 2509378536
1230 2510136439
1231 2510304637
1232 2510843237
1233 2510892317
1234 2511173275
1235 2511499833
1236 2512530230
1237 2512974800
1238 2513568072
1239 2513578380
1240 2513584847
1241 2513603865
1242 2513617392
1243 2513621143
1244 2513631014
1245 2513883070
1246 2513903125
1247 2513984770
1248 2514001149
1249 2514004179
1250 2514021115
1251 2515108601
1252 2515609892
1253 2515632225
1254 2515658322
1255 2515738110
1256 2516206622
1257 2516897397
1258 2517041210
1259 2517080166
1260 2517098165
1261 2517567447
1262 2524452383
1263 2524457165
1264 2524459746
1265 2530649014
1266 2535520442
1267 2537875925
1268 2551677426
1269 2551687825
1270 2551691469
1271 2551692577
1272 2551700510
1273 2551712948
1274 2551718227
1275 2551725073
1276 2551728044
1277 2551737383
1278 2551738667
1279 2551743994
1280 2554245819
1281 2558861929
1282 2559296414
1283 2561468486
1284 2585168520
1285 2585169527
1286 2585231184
1287 2585257947
1288 2585397739
1289 2585525586
1290 2585996346
1291 2585997544
1292 2586000954
1293 2586002150
1294 2597816253
1295 2599334003
1296 2599605538
1297 2599721867
1298 2600197060
1299 2600197973
1300 2600374311
1301 2601611740
1302 2601749529
1303 2643777630
1304 2643796078
1305 2643806390
1306 2643813877
1307 2643911984
1308 2643917682
1309 2644106104
1310 2644106380
1311 2644106523
1312 2644145986
1313 2644146933
1314 2644149238
1315 2644308405
1316 2644308457
1317 2644310715
1318 2644331822
1319 2644332118
1320 2644334498
1321 2644379336
1322 2644380057
1323 2644412348
1324 2644415178
1325 2644491890
1326 2644497198
1327 2644522783
1328 2644542202
1329 2644544492
1330 2644545303
1331 2644615650
1332 2644615793
1333 2644616549
1334 2644672383
1335 2644674622
1336 2657684285
1337 2692318159
1338 2725947844
1339 2753463928
1340 2757569340
1341 2758638515
1342 2766065125
1343 2774868970
1344 2792621377
1345 2792627935
1346 2792643372
1347 2793280705
1348 2793332011
1349 2802718358
1350 2802724065
1351 2802725848
1352 2802731444
1353 2802736365
1354 2802744339
1355 2802750071
1356 2802752025
1357 2804754247
1358 2808988634
1359 2819557796
1360 2819684975
1361 2821127444
1362 2838069162
1363 2838679807
1364 2838687477
1365 2838717423
1366 2838724376
1367 2838729307
1368 2838734111
1369 2838737969
1370 2838746563
1371 2840880247
1372 2841734662
1373 2841841662
1374 2841850734
1375 2841854027
1376 2841864018
1377 2842116717
1378 2842129539
1379 2842134684
1380 2842141440
1381 2842156798
1382 2842159606
1383 2842164055
1384 2842173056
1385 2842180416
1386 2842182824
1387 2842191925
1388 2842216241
1389 2842221601
1390 2842228961
1391 2842232535
1392 2842247222
1393 2842259091
1394 2842265537
1395 2842272489
1396 2842299281
1397 2842301651
1398 2842309823
1399 2842334371
1400 2842358748
1401 2842361780
1402 2842422352
1403 2842428413
1404 2842435027
1405 2842442111
1406 2842449491
1407 2842466640
1408 2842469359
1409 2842512178
1410 2842513450
1411 2842520800
1412 2842526876
1413 2842925718
1414 2842927033
1415 2844165814
1416 2844166777
1417 2844460473
1418 2847423336
1419 2848997211
1420 2850084033
1421 2852394570
1422 2852395231
1423 2854684840
1424 2854901135
1425 2854918526
1426 2854920244
1427 2855830206
1428 2855830707
1429 2855845520
1430 2855845998
1431 2855874472
1432 2856320232
1433 2856345633
1434 2857357303
1435 2857518044
1436 2857536542
1437 2858804327
1438 2858805387
1439 2871476348
1440 2878042540
1441 2878793525
1442 2882457462
1443 2885346216
1444 2885355118
1445 2889791407
1446 2889920184
1447 2896389297
1448 2899793665
1449 2899848761
1450 2906420989
1451 2913296404
1452 2915980991
1453 2915990897
1454 2915996054
1455 2915998123
1456 2916003037
1457 2916009166
1458 2916009278
1459 2916017178
1460 2916019280
1461 2916025671
1462 2916030672
1463 2916034019
1464 2916037986
1465 2916041027
1466 2916043897
1467 2916048242
1468 2916052018
1469 2916053055
1470 2916060378
1471 2916060571
1472 2916075633
1473 2916077750
1474 2919119176
1475 2919174566
1476 2919177084
1477 2919682390
1478 2920828039
1479 2921207371
1480 2921208296
1481 2921211949
1482 2921215247
1483 2921241830
1484 2921243191
1485 2921248397
1486 2921251331
1487 2921262163
1488 2921263033
1489 2921267850
1490 2921269587
1491 2921285376
1492 2921295418
1493 2921297070
1494 2921302884
1495 2924144629
1496 2924152435
1497 2924152981
1498 2924161175
1499 2924161498
1500 2924167132
1501 2924175991
1502 2924178751
1503 2924184498
1504 2924186603
1505 2924194487
1506 2924197581
1507 2924202038
1508 2924208456
1509 2924209765
1510 2924219053
1511 2924223078
1512 2924223438
1513 2924229261
1514 2924229659
1515 2926759208
1516 2926763362
1517 2928525522
1518 2929142661
1519 2929143234
1520 2933011403
1521 2933016587
1522 2933576265
1523 2933592933
1524 2933596026
1525 2933599827
1526 2935903156
1527 2936374384
1528 2936378774
1529 2937000317
1530 2937006313
1531 2937009168
1532 2937011493
1533 2937017597
1534 2937019917
1535 2937023586
1536 2937026999
1537 2937035921
1538 2937036387
1539 2937043377
1540 2937049185
1541 2937050268
1542 2937056024
1543 2937061061
1544 2937068283
1545 2937074105
1546 2937077075
1547 2937091376
1548 2937092701
1549 2937093484
1550 2937103933
1551 2937104305
1552 2937111693
1553 2937113429
1554 2937116580
1555 2937120457
1556 2937123295
1557 2937128692
1558 2937132881
1559 2937842798
1560 2941505198
1561 2954012436
1562 2957386793
1563 2957394578
1564 2957396283
1565 2957399163
1566 2957407043
1567 2957409288
1568 2957413615
1569 2957415472
1570 2957420899
1571 2957426612
1572 2957430886
1573 2957430914
1574 2957439615
1575 2957444861
1576 2957449628
1577 2957453066
1578 2957463503
1579 2957464598
1580 2957465160
1581 2957473721
1582 2957476949
1583 2957480866
1584 2957483551
1585 2957487432
1586 2957489430
1587 2957491867
1588 2957502881
1589 2957503407
1590 2957505765
1591 2958074898
1592 2960587896
1593 2960592497
1594 2960601134
1595 2960605638
1596 2960606780
1597 2960612737
1598 2960614971
1599 2960621989
1600 2960623831
1601 2960628541
1602 2960628956
1603 2960632236
1604 2960636118
1605 2960643344
1606 2960646955
1607 2960656934
1608 2960661575
1609 2960666301
1610 2960670382
1611 2960676211
1612 2960681134
1613 2960693397
1614 2964614724
1615 2964618856
1616 2964620522
1617 2964625541
1618 2964634850
1619 2964637976
1620 2964638516
1621 2964644283
1622 2964651108
1623 2964653251
1624 2964659871
1625 2964662670
1626 2964664242
1627 2964666392
1628 2964673234
1629 2964678581
1630 2964680308
1631 2964691590
1632 2964695479
1633 2964696707
1634 2964699749
1635 2964708790
1636 2964712528
1637 2964718126
1638 2964723560
1639 2965062944
1640 2967665085
1641 2967665948
1642 2967672763
1643 2967678050
1644 2967679001
1645 2967683729
1646 2967692004
1647 2967694006
1648 2967697593
1649 2967701900
1650 2967703464
1651 2967707836
1652 2967708353
1653 2967718006
1654 2967719354
1655 2967724429
1656 2967725222
1657 2967729126
1658 2967740413
1659 2967747726
1660 2967755251
1661 2967760492
1662 2967760812
1663 2967763462
1664 2967768374
1665 2967770216
1666 2967781886
1667 2967781948
1668 2968092051
1669 2970024605
1670 2970025242
1671 2970029663
1672 2970039883
1673 2970045155
1674 2970047277
1675 2970054713
1676 2970060133
1677 2970063488
1678 2970063669
1679 2970069743
1680 2970082109
1681 2970091420
1682 2970093035
1683 2970099987
1684 2970103109
1685 2970107062
1686 2970110328
1687 2970112559
1688 2970117074
1689 2970124180
1690 2970129884
1691 2970133122
1692 2970138061
1693 2970139195
1694 2970144926
1695 2970152570
1696 2970154694
1697 2970160918
1698 2970166608
1699 2970168758
1700 2970172488
1701 2970175395
1702 2970181342
1703 2970184625
1704 2970188571
1705 2970189886
1706 2970196197
1707 2970529533
1708 2977523583
1709 2977524237
1710 2977527847
1711 2977537278
1712 2977539492
1713 2977543022
1714 2977550106
1715 2977555433
1716 2977556541
1717 2977565299
1718 2977567416
1719 2977572468
1720 2977573435
1721 2977576693
1722 2977583389
1723 2977585339
1724 2977949353
1725 2979091605
1726 2979097126
1727 2979102836
1728 2984509275
1729 2984520025
1730 2984537604
1731 2984604353
1732 2987644693
1733 2989773021
1734 2989781364
1735 2995394612
1736 2996316373
1737 2996887423
1738 3000019256
1739 3000406375
1740 3004210845
1741 3005597260
1742 643822638
1743 648737882
1744 648739344
1745 650842810
1746 8003574832
1747 8003997528
1748 8003998214
1749 8004006165
1750 8004637625
1751 8005259884
1752 8005301669
1753 8005307925
1754 8005321950
1755 8005379813
1756 8005399151
1757 8005467225
1758 8005548194
1759 8005562345
1760 8005565507
1761 8018153476
1762 8018165516
1763 8023688077
1764 8024485024
1765 8024487608
1766 8046769100
1767 8046773427
1768 8046774589
1769 8054462142
1770 8054561487
1771 8054563949
1772 8055435285
1773 8055622894
1774 8056876891
1775 8057135757
1776 8057576501
1777 8057581370
1778 8057878005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

48

336

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ur7-assembly1.cif.gz_D crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate 0.9916 3 303
5hwm-assembly1.cif.gz_A crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid 0.991 3 303
4ur7-assembly1.cif.gz_D crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate 0.9883 3 303
5hwm-assembly1.cif.gz_A crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid 0.9812 3 303
6rb7-assembly1.cif.gz_E ruminococcus gnavus sialic acid aldolase catalytic lysine mutant 0.9079 12 299
ID Description Score Start End Superfamily
5hwjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.992 3 303 3.20.20.70
5hwjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9822 3 303 3.20.20.70
3eb2C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9054 15 299 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9047 15 300 3.20.20.70
3e96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8998 8 300 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0B5E042-F1-model_v4 Probable 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (5-keto-4-deoxy-glucarate dehydratase) (KDGDH) 0.994 3 303 GO:0008840
GO:0042838
GO:0047448
AF-F0G4A0-F1-model_v4 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) 0.9938 200 300 GO:0047448
AF-A0A561QVP7-F1-model_v4 Probable 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (5-keto-4-deoxy-glucarate dehydratase) (KDGDH) 0.9931 3 303 GO:0008840
GO:0042838
GO:0047448
AF-A0A358B2K8-F1-model_v4 Probable 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (5-keto-4-deoxy-glucarate dehydratase) (KDGDH) 0.9922 3 303 GO:0008840
GO:0042838
GO:0047448
AF-A0A2W7I908-F1-model_v4 5-dehydro-4-deoxyglucarate dehydratase 0.9906 123 300 GO:0008840

Map