F484873

General Info

Members Datasets Scaffolds Average Seq Length
891 706 1782 369

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2758568016|2758642233
Length 417
Sequence VRGVFSFLGRFIAALARLIAVPLGGLWRLFLKLGNLWKVAIAVAVIGLGGLYIYFIWQTQVWTNFNPDYPAKYSYQTAVTPGEEVQKTPAPLAATPEPATPAPSENSAGGTDTTPAAGNGDTNTQSETSTESQSQPMQAAQIPSTARKCSPSAIAEVAADLTDFNVNQNAWISSMLLYKVGFFGIDWDRTPFLDNKASFQRGINAAVRRTAIELVDNIGRLRGTSQIDGDLQKARGNLQFAEDAWYFGLSPFGPKTPTPSYYRSAIKDLRSFNTRLENCQATFDARADNLIQFVDRIASDLGSTSAILKDRAENYHAGWFDTRADDRFWFAYGQLYAYYGLLRAAHSDFRGVLAEKHLDGVWDEMERQLRSALDMQPFIVSNGSPDAWFTPSHLTTMGFYILRVRSNLVDVKQVLER

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
70 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
79 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
109 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
132 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
133 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
134 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
135 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
136 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
137 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
221 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
228 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
229 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
235 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
236 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
237 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
238 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
239 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
240 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
241 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
242 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
243 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
244 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
245 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
246 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
247 2512875024
248 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
249 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
250 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
251 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
252 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
253 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
254 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
255 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
256 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
257 2519899620 Rhizobium sp. Pop5 Isolate Nodule
258 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
259 2534681786 Brucella suis 92/29 Isolate Unclassified
260 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
261 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
262 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
263 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
264 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
265 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
266 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
267 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
268 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
269 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
270 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
271 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
272 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
273 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
274 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
275 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
276 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
277 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
278 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
279 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
280 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
281 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
282 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
283 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
284 2643221557 Ensifer sp. Root558 Isolate Unclassified
285 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
286 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
287 2643221607 Rhizobium sp. Root73 Isolate Unclassified
288 2643221610 Ensifer sp. Root74 Isolate Unclassified
289 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
290 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
291 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
292 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
293 2643221668 Ensifer sp. Root423 Isolate Unclassified
294 2643221675 Ensifer sp. Root1298 Isolate Unclassified
295 2643221680 Ensifer sp. Root1312 Isolate Unclassified
296 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
297 2643221688 Rhizobium sp. Root482 Isolate Unclassified
298 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
299 2643221719 Rhizobium sp. Root274 Isolate Unclassified
300 2643221726 Ensifer sp. Root954 Isolate Unclassified
301 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
302 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
303 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
304 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
305 2718217882 Rhizobium sp. N741 Isolate Nodule
306 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
307 2718218009 Rhizobium sp. N561 Isolate Nodule
308 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
309 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
310 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
311 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
312 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
313 2718218363 Rhizobium sp. N113 Isolate Nodule
314 2718218365 Rhizobium sp. N731 Isolate Nodule
315 2718218366 Rhizobium sp. N621 Isolate Nodule
316 2721755514 Rhizobium sp. N6212 Isolate Nodule
317 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
318 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
319 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
320 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
321 2721755810 Rhizobium sp. N871 Isolate Nodule
322 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
323 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
324 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
325 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
326 2728369365 Rhizobium sp. N1341 Isolate Nodule
327 2728369397 Rhizobium sp. N1314 Isolate Nodule
328 2738541293 Rhizobium sp. GV031 Isolate Unclassified
329 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
330 2738543024 Aminobacter sp. AP02 Isolate Unclassified
331 2751185800 Brucella pituitosa AA2 Isolate Unclassified
332 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
333 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
334 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
335 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
336 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
337 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
338 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
339 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
340 2791355256 Rhizobium sp. M10 Isolate Nodule
341 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
342 2791355260 Rhizobium sp. L9 Isolate Nodule
343 2791355262 Rhizobium sp. M1 Isolate Nodule
344 2791355263 Rhizobium chutanense C5 Isolate Nodule
345 2791355264 Rhizobium sp. S9 Isolate Nodule
346 2791355267 Rhizobium sp. L18 Isolate Nodule
347 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
348 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
349 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
350 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
351 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
352 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
353 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
354 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
355 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
356 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
357 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
358 2838048938 Rhizobium pisi 27/80 Isolate Nodule
359 2838061910 Rhizobium phaseoli L15 Isolate Nodule
360 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
361 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
362 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
363 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
364 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
365 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
366 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
367 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
368 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
369 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
370 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
371 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
372 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
373 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
374 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
375 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
376 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
377 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
378 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
379 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
380 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
381 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
382 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
383 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
384 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
385 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
386 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
387 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
388 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
389 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
390 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
391 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
392 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
393 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
394 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
395 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
396 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
397 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
398 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
399 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
400 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
401 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
402 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
403 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
404 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
405 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
406 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
407 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
408 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
409 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
410 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
411 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
412 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
413 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
414 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
415 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
416 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
417 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
418 2854911287 Brucella lupini LUP21 Isolate Unclassified
419 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
420 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
421 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
422 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
423 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
424 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
425 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
426 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
427 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
428 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
429 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
430 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
431 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
432 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
433 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
434 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
435 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
436 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
437 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
438 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
439 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
440 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
441 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
442 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
443 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
444 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
445 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
446 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
447 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
448 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
449 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
450 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
451 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
452 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
453 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
454 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
455 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
456 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
457 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
458 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
459 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
460 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
461 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
462 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
463 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
464 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
465 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
466 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
467 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
468 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
469 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
470 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
471 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
472 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
473 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
474 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
475 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
476 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
477 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
478 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
479 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
480 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
481 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
482 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
483 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
484 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
485 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
486 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
487 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
488 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
489 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
490 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
491 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
492 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
493 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
494 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
495 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
496 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
497 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
498 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
499 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
500 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
501 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
502 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
503 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
504 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
505 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
506 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
507 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
508 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
509 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
510 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
511 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
512 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
513 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
514 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
515 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
516 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
517 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
518 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
519 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
520 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
521 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
522 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
523 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
524 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
525 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
526 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
527 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
528 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
529 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
530 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
531 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
532 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
533 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
534 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
535 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
536 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
537 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
538 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
539 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
540 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
541 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
542 2933599457 Rhizobium phaseoli M3 Isolate Nodule
543 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
544 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
545 2936381700 Rhizobium chutanense C16 Isolate Unclassified
546 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
547 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
548 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
549 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
550 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
551 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
552 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
553 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
554 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
555 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
556 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
557 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
558 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
559 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
560 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
561 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
562 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
563 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
564 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
565 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
566 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
567 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
568 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
569 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
570 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
571 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
572 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
573 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
574 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
575 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
576 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
577 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
578 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
579 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
580 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
581 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
582 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
583 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
584 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
585 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
586 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
587 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
588 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
589 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
590 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
591 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
592 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
593 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
594 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
595 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
596 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
597 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
598 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
599 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
600 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
601 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
602 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
603 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
604 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
605 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
606 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
607 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
608 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
609 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
610 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
611 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
612 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
613 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
614 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
615 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
616 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
617 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
618 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
619 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
620 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
621 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
622 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
623 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
624 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
625 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
626 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
627 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
628 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
629 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
630 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
631 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
632 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
633 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
634 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
635 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
636 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
637 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
638 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
639 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
640 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
641 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
642 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
643 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
644 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
645 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
646 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
647 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
648 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
649 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
650 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
651 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
652 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
653 3004167301 Mesorhizobium loti 582 Isolate Unclassified
654 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
655 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
656 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
657 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
658 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
659 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
660 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
661 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
662 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
663 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
664 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
665 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
666 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
667 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
668 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
669 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
670 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
671 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
672 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
673 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
674 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
675 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
676 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
677 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
678 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
679 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
680 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
681 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
682 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
683 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
684 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
685 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
686 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
687 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
688 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
689 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
690 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
691 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
692 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
693 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
694 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
695 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
696 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
697 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
698 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
699 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
700 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
701 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
702 8024501048 Rhizobium sp. H4 Isolate Nodule
703 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
704 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
705 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
706 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.46
Metatranscriptomes 0.34
Isolates 53.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 9.54
Nodule 41.08
Rhizoplane 1.57
Rhizosphere 29.97
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000169 3300001979 Bacteria 26125
2 JGI24740J21852_10015314 3300001979 Bacteria 2804
3 JGI25155J39150_1000014 3300002704 Bacteria 196159
4 JGI25156J39149_1000037 3300002705 Bacteria 109690
5 JGI25156J39149_1000079 3300002705 Bacteria 73408
6 JGI25156J39149_1002192 3300002705 Bacteria 7272
7 JGI25162J39368_1000217 3300002737 Bacteria 59945
8 JGI25162J39368_1000497 3300002737 Bacteria 29860
9 JGI25154J39366_1000052 3300002738 Bacteria 120209
10 JGI25157J39369_1000040 3300002741 Bacteria 126165
11 JGI25157J39369_1000368 3300002741 Bacteria 30978
12 JGI25150J39212_1000417 3300002774 Bacteria 19610
13 JGI25159J45721_1000401 3300002987 Bacteria 20230
14 JGI25151J46595_10000146 3300003187 Bacteria 93373
15 JGI25151J46595_10000215 3300003187 Bacteria 69771
16 JGI25165J46597_1000006 3300003214 Bacteria 529784
17 JGI25165J46597_1000371 3300003214 Bacteria 50062
18 JGI25165J46597_1000387 3300003214 Bacteria 47369
19 JGI25165J46597_1000462 3300003214 Bacteria 40205
20 JGI25153J46596_10000878 3300003215 Bacteria 18292
21 JGI25153J46596_10004407 3300003215 Bacteria 7598
22 rootH1_10004680 3300003316 Bacteria 5042
23 rootH1_10157649 3300003316 Bacteria 2275
24 rootH2_10011583 3300003320 Bacteria 1919
25 rootL2_10035235 3300003322 Bacteria 16044
26 rootH1_10095850 3300003323 Bacteria 3208
27 JGI25160J50197_1000001 3300003354 Bacteria 782301
28 JGI25161J50226_1000001 3300003374 Bacteria 655036
29 Ga0006562J51391_1009537 3300003578 Bacteria 1642
30 Ga0055542_1000404 3300003762 Bacteria 42343
31 Ga0055526_1014748 3300003771 Bacteria 3189
32 Ga0055524_1000779 3300003775 Bacteria 21386
33 Ga0055528_1013046 3300003790 Bacteria 3179
34 Ga0055540_1000766 3300003792 Bacteria 21853
35 Ga0055543_1000282 3300004625 Bacteria 37267
36 Ga0065165_1000008 3300005262 Bacteria 334429
37 Ga0070658_10106001 3300005327 Bacteria 2325
38 Ga0070660_100118678 3300005339 Bacteria 2110
39 Ga0070674_100188281 3300005356 Bacteria 1586
40 Ga0070678_100314674 3300005456 Bacteria 1335
41 Ga0068867_100116920 3300005459 Bacteria 2056
42 Ga0068853_100248531 3300005539 Bacteria 1631
43 Ga0070665_100009296 3300005548 Bacteria 9949
44 Ga0070665_100067738 3300005548 Bacteria 3579
45 Ga0070665_100072614 3300005548 Bacteria 3448
46 Ga0070665_100217867 3300005548 Bacteria 1909
47 Ga0068855_100157342 3300005563 Bacteria 2581
48 Ga0068856_100025003 3300005614 Bacteria 5820
49 Ga0081455_10012443 3300005937 Bacteria 8492
50 Ga0081455_10015931 3300005937 Bacteria 7278
51 Ga0081540_1007880 3300005983 Bacteria 7525
52 Ga0081539_10002162 3300005985 Bacteria 28939
53 Ga0075365_10030777 3300006038 Bacteria 3440
54 Ga0075365_10031358 3300006038 Bacteria 3410
55 Ga0075365_10102700 3300006038 Bacteria 1959
56 Ga0075363_100053772 3300006048 Bacteria 2152
57 Ga0075364_10040215 3300006051 Bacteria 3033
58 Ga0075362_10041664 3300006177 Bacteria 2026
59 Ga0075362_10048465 3300006177 Bacteria 1896
60 Ga0075367_10023276 3300006178 Bacteria 3483
61 Ga0075370_10052367 3300006353 Bacteria 2316
62 Ga0075428_100022359 3300006844 Bacteria 7000
63 Ga0075430_100030561 3300006846 Bacteria 4575
64 Ga0075430_100167756 3300006846 Bacteria 1826
65 Ga0075431_100076396 3300006847 Bacteria 3456
66 Ga0075433_10002189 3300006852 Bacteria 14810
67 Ga0075434_100073228 3300006871 Bacteria 3418
68 Ga0075429_100011671 3300006880 Bacteria 7619
69 Ga0075429_100016796 3300006880 Bacteria 6335
70 Ga0079104_1000884 3300006946 Bacteria 24591
71 Ga0105240_10000014 3300009093 Bacteria 482033
72 Ga0105240_10171195 3300009093 Bacteria 2572
73 Ga0111539_10028098 3300009094 Bacteria 6868
74 Ga0111539_10043682 3300009094 Bacteria 5372
75 Ga0114129_10112120 3300009147 Bacteria 3762
76 Ga0114129_10290007 3300009147 Bacteria 2184
77 Ga0114129_10318118 3300009147 Bacteria 2069
78 Ga0105241_10085808 3300009174 Bacteria 2475
79 Ga0105237_10002639 3300009545 Bacteria 22073
80 Ga0105237_10057359 3300009545 Bacteria 3897
81 Ga0105237_10106306 3300009545 Bacteria 2798
82 Ga0105238_10011380 3300009551 Bacteria 8957
83 Ga0123341_1000112 3300009765 Bacteria 36073
84 Ga0105239_10002361 3300010375 Bacteria 24069
85 Ga0105239_10125132 3300010375 Bacteria 2857
86 Ga0105239_10372042 3300010375 Bacteria 1615
87 Ga0105239_10452583 3300010375 Bacteria 1457
88 Ga0157373_10024988 3300013100 Bacteria 4324
89 Ga0157371_10121496 3300013102 Bacteria 1857
90 Ga0157370_10121144 3300013104 Bacteria 2442
91 Ga0157369_10010177 3300013105 Bacteria 10733
92 Ga0157374_10139864 3300013296 Bacteria 2349
93 Ga0157378_10497700 3300013297 Bacteria 1217
94 Ga0157372_10184472 3300013307 Bacteria 2416
95 Ga0157372_10204080 3300013307 Bacteria 2290
96 Ga0157375_10481377 3300013308 Bacteria 1406
97 Ga0182008_10117236 3300014497 Bacteria 1322
98 Ga0182007_10001651 3300015262 Bacteria 11809
99 Ga0182007_10028281 3300015262 Bacteria 1927
100 Ga0209435_100027 3300025206 Bacteria 196217
101 Ga0209672_102276 3300025228 Bacteria 4927
102 Ga0209563_102869 3300025230 Bacteria 3747
103 Ga0209437_100051 3300025233 Bacteria 392523
104 Ga0209437_100060 3300025233 Bacteria 355034
105 Ga0207425_1000046 3300025245 Bacteria 189433
106 Ga0209646_1000086 3300025246 Bacteria 196217
107 Ga0209026_1000082 3300025250 Bacteria 196315
108 Ga0209026_1000089 3300025250 Bacteria 175907
109 Ga0209677_100273 3300025253 Bacteria 34599
110 Ga0209148_1000315 3300025254 Bacteria 68127
111 Ga0209759_1000040 3300025256 Bacteria 254501
112 Ga0209759_1000063 3300025256 Bacteria 196315
113 Ga0209129_1000171 3300025258 Bacteria 95724
114 Ga0209129_1003441 3300025258 Bacteria 6872
115 Ga0209233_1000010 3300025261 Bacteria 1194329
116 Ga0209233_1000095 3300025261 Bacteria 303783
117 Ga0209233_1000190 3300025261 Bacteria 130713
118 Ga0209233_1000228 3300025261 Bacteria 100100
119 Ga0209455_1000062 3300025272 Bacteria 335169
120 Ga0209673_1000025 3300025273 Bacteria 404572
121 Ga0209673_1002044 3300025273 Bacteria 15288
122 Ga0209130_1000003 3300025284 Bacteria 677988
123 Ga0209025_1000091 3300025294 Bacteria 250401
124 Ga0209025_1000137 3300025294 Bacteria 190136
125 Ga0209025_1005984 3300025294 Bacteria 9665
126 Ga0209564_1002269 3300025295 Bacteria 15752
127 Ga0209758_1000123 3300025297 Bacteria 190136
128 Ga0209758_1000671 3300025297 Bacteria 51169
129 Ga0209758_1008974 3300025297 Bacteria 6332
130 Ga0209758_1023979 3300025297 Bacteria 2736
131 Ga0209050_1033541 3300025298 Bacteria 1554
132 Ga0209256_1000153 3300025299 Bacteria 144736
133 Ga0209256_1002343 3300025299 Bacteria 15781
134 Ga0207426_1000011 3300025302 Bacteria 791203
135 Ga0209051_1001157 3300025303 Bacteria 23986
136 Ga0209257_1003543 3300025304 Bacteria 13267
137 Ga0207647_10064391 3300025904 Bacteria 2228
138 Ga0207645_10062918 3300025907 Bacteria 2371
139 Ga0207695_10000037 3300025913 Bacteria 476303
140 Ga0207695_10209051 3300025913 Bacteria 1863
141 Ga0207671_10000271 3300025914 Bacteria 77228
142 Ga0207671_10013350 3300025914 Bacteria 6546
143 Ga0207671_10110409 3300025914 Bacteria 2092
144 Ga0207657_10080315 3300025919 Bacteria 2741
145 Ga0207649_10211280 3300025920 Bacteria 1377
146 Ga0207694_10003084 3300025924 Bacteria 13339
147 Ga0207644_10366686 3300025931 Bacteria 1173
148 Ga0207667_10256344 3300025949 Bacteria 1789
149 Ga0207712_10099878 3300025961 Bacteria 2155
150 Ga0207640_10223557 3300025981 Bacteria 1443
151 Ga0207639_10118107 3300026041 Bacteria 2174
152 Ga0207678_10009953 3300026067 Bacteria 8341
153 Ga0207678_10096162 3300026067 Bacteria 2531
154 Ga0207702_10041065 3300026078 Bacteria 3878
155 Ga0207702_10055850 3300026078 Bacteria 3350
156 Ga0207675_100175405 3300026118 Bacteria 2051
157 Ga0207698_10027465 3300026142 Bacteria 4041
158 Ga0207698_10063155 3300026142 Bacteria 2896
159 Ga0209281_1000034 3300027111 Bacteria 382562
160 Ga0209371_1003106 3300027312 Bacteria 8469
161 Ga0207428_10033351 3300027907 Bacteria 4230
162 Ga0207428_10089923 3300027907 Bacteria 2386
163 Ga0268266_10103445 3300028379 Bacteria 2513
164 Ga0268266_10146381 3300028379 Bacteria 2124
165 Ga0307515_10000017 3300028794 Bacteria 550465
166 Ga0307515_10000285 3300028794 Bacteria 124535
167 Ga0307515_10007366 3300028794 Bacteria 21774
168 Ga0307515_10044010 3300028794 Bacteria 6917
169 Ga0268256_1004706 3300030500 Bacteria 5563
170 Ga0307513_10007623 3300031456 Bacteria 13986
171 Ga0307514_10163761 3300031649 Bacteria 1467
172 Ga0307412_10002165 3300031911 Bacteria 10901
173 Ga0307409_100101999 3300031995 Bacteria 2383
174 Ga0316593_10020378 3300032168 Bacteria 2061
175 Ga0316574_0064369 3300035398 Unclassified 2307
176 Ga0373927_0000191 3300035695 Bacteria 48913
177 Ga0316582_0023087 3300036647 Bacteria 3703
178 Ga0373925_0002944 3300037068 Bacteria 13435
179 Ga0395899_0000242 3300037312 Bacteria 72733
180 Ga0395900_0000318 3300037418 Bacteria 71328
181 Ga0395900_0158485 3300037418 Bacteria 2310
182 Ga0395898_0000547 3300037466 Bacteria 71322
183 Ga0395905_0000305 3300037471 Bacteria 71315
184 Ga0395905_0015895 3300037471 Bacteria 7150
185 Ga0395905_0092233 3300037471 Bacteria 2840
186 Ga0395901_0000093 3300038443 Bacteria 120300
187 Ga0395901_0311117 3300038443 Bacteria 1631
188 Ga0439436_0014596 3300041404 Bacteria 2367
189 Ga0439438_024347 3300041405 Bacteria 1658
190 Ga0439465_0001911 3300041413 Bacteria 6825
191 Ga0451835_0491401 3300041492 Bacteria 1853
192 Ga0451839_0575334 3300041496 Bacteria 2107
193 Ga0451841_0220125 3300041498 Bacteria 3691
194 Ga0451845_0754475 3300041501 Bacteria 2109
195 Ga0451846_63590 3300041502 Bacteria 2067
196 Ga0451847_0257076 3300041503 Bacteria 2060
197 Ga0451851_0897679 3300041507 Bacteria 2827
198 Ga0439449_0013739 3300042007 Bacteria 3047
199 Ga0439446_0053094 3300042156 Bacteria 1214
200 Ga0466970_0009978 3300044765 Bacteria 4809
201 Ga0466957_0020179 3300044842 Bacteria 3921
202 Ga0466959_0059075 3300045049 Bacteria 2793
203 Ga0466958_0022324 3300045836 Bacteria 3706
204 Ga0495629_0007120 3300046459 Bacteria 8241
205 Ga0495606_0003332 3300046507 Bacteria 17147
206 Ga0495606_0014346 3300046507 Bacteria 6193
207 Ga0495606_0034558 3300046507 Bacteria 3470
208 Ga0495610_0070856 3300046512 Bacteria 1627
209 Ga0495654_0000083 3300046530 Bacteria 107518
210 Ga0495656_0010866 3300046615 Bacteria 3326
211 Ga0495668_0050607 3300046616 Bacteria 2302
212 Ga0495625_0065234 3300046660 Bacteria 2567
213 Ga0495625_0116984 3300046660 Bacteria 1818
214 Ga0495635_0126460 3300046663 Bacteria 1743
215 Ga0495649_0093190 3300046694 Bacteria 1604
216 Ga0495600_0111463 3300046809 Bacteria 1781
217 Ga0495687_091668 3300047443 Bacteria 1162
218 Ga0495681_0050258 3300047470 Bacteria 1966
219 Ga0495686_0001854 3300047472 Bacteria 21201
220 Ga0495686_0045831 3300047472 Bacteria 2766
221 Ga0495615_0004474 3300048090 Bacteria 2443
222 Ga0496101_0068665 3300048904 Bacteria 2592
223 Ga0496101_0078387 3300048904 Bacteria 2437
224 Ga0496102_0028396 3300048905 Bacteria 4996
225 Ga0496102_0101093 3300048905 Bacteria 2678
226 Ga0496111_0000515 3300048914 Bacteria 19969
227 Ga0496111_0259358 3300048914 Bacteria 1290
228 Ga0496112_0089216 3300048915 Bacteria 3051
229 Ga0496112_0403401 3300048915 Bacteria 1307
230 Ga0496116_0000105 3300048919 Bacteria 192704
231 Ga0496116_0004457 3300048919 Bacteria 13343
232 Ga0496116_0015332 3300048919 Bacteria 6062
233 Ga0496116_0018029 3300048919 Bacteria 5455
234 Ga0496116_0020764 3300048919 Bacteria 4975
235 Ga0496116_0045041 3300048919 Bacteria 2990
236 Ga0496116_0058111 3300048919 Bacteria 2524
237 Ga0496117_0002822 3300048920 Bacteria 21139
238 Ga0496117_0007744 3300048920 Bacteria 10378
239 Ga0496117_0013159 3300048920 Bacteria 7237
240 Ga0496118_0001151 3300048921 Bacteria 40832
241 Ga0496118_0005439 3300048921 Bacteria 14477
242 Ga0496118_0011995 3300048921 Bacteria 8374
243 Ga0496118_0040895 3300048921 Bacteria 3678
244 Ga0496119_0004810 3300048922 Bacteria 13249
245 Ga0496119_0012326 3300048922 Bacteria 6958
246 Ga0496119_0056424 3300048922 Bacteria 2380
247 Ga0496119_0063054 3300048922 Bacteria 2206
248 Ga0496120_0001625 3300048923 Bacteria 26039
249 Ga0496120_0007332 3300048923 Bacteria 8228
250 Ga0496121_0003571 3300048924 Bacteria 21984
251 Ga0496121_0005249 3300048924 Bacteria 16749
252 Ga0496121_0006258 3300048924 Bacteria 14896
253 Ga0496121_0023594 3300048924 Bacteria 5916
254 Ga0496121_0026968 3300048924 Bacteria 5391
255 Ga0496121_0028920 3300048924 Bacteria 5145
256 Ga0496121_0053392 3300048924 Bacteria 3386
257 Ga0496122_0000157 3300048925 Bacteria 159733
258 Ga0496122_0011770 3300048925 Bacteria 8812
259 Ga0496122_0027825 3300048925 Bacteria 4820
260 Ga0496122_0028698 3300048925 Bacteria 4712
261 Ga0496122_0078594 3300048925 Bacteria 2310
262 Ga0496123_0000048 3300048926 Bacteria 244152
263 Ga0496123_0006482 3300048926 Bacteria 11329
264 Ga0496123_0007439 3300048926 Bacteria 10313
265 Ga0496123_0020766 3300048926 Bacteria 5127
266 Ga0496123_0050172 3300048926 Bacteria 2790
267 Ga0496124_0002089 3300048927 Bacteria 26962
268 Ga0496124_0006013 3300048927 Bacteria 13382
269 Ga0496124_0015984 3300048927 Bacteria 7162
270 Ga0496124_0021918 3300048927 Bacteria 5876
271 Ga0496124_0042668 3300048927 Bacteria 3904
272 Ga0496124_0058468 3300048927 Bacteria 3242
273 Ga0496124_0136772 3300048927 Bacteria 1939
274 Ga0496125_0025240 3300048928 Bacteria 5448
275 Ga0496125_0026245 3300048928 Bacteria 5313
276 Ga0496125_0094884 3300048928 Bacteria 2221
277 Ga0496125_0153950 3300048928 Bacteria 1574
278 Ga0496126_0100750 3300048929 Bacteria 2527
279 Ga0496126_0103580 3300048929 Bacteria 2487
280 Ga0496126_0114595 3300048929 Bacteria 2345
281 Ga0501031_0000274 3300049568 Bacteria 29130
282 Ga0501031_0020216 3300049568 Bacteria 4340
283 Ga0501031_0023879 3300049568 Bacteria 3987
284 Ga0501032_0000024 3300049569 Bacteria 143876
285 Ga0501032_0000597 3300049569 Bacteria 29147
286 Ga0501032_0005031 3300049569 Bacteria 9880
287 Ga0501032_0102261 3300049569 Bacteria 1899
288 Ga0501033_0000189 3300049570 Bacteria 59012
289 Ga0501033_0000365 3300049570 Bacteria 43281
290 Ga0501033_0001767 3300049570 Bacteria 18899
291 Ga0501033_0003117 3300049570 Bacteria 13769
292 Ga0501033_0003350 3300049570 Bacteria 13227
293 Ga0501033_0009793 3300049570 Bacteria 7360
294 Ga0501033_0167104 3300049570 Bacteria 1581
295 Ga0501034_0000317 3300049571 Bacteria 85341
296 Ga0501034_0002140 3300049571 Bacteria 24535
297 Ga0501034_0004533 3300049571 Bacteria 15441
298 Ga0501034_0012803 3300049571 Bacteria 8653
299 Ga0501034_0015236 3300049571 Bacteria 7901
300 Ga0501034_0050683 3300049571 Bacteria 4187
301 Ga0501034_0362763 3300049571 Bacteria 1376
302 Ga0501036_0000396 3300049572 Bacteria 30676
303 Ga0501036_0000460 3300049572 Bacteria 29152
304 Ga0501037_0000186 3300049573 Bacteria 57745
305 Ga0501037_0000363 3300049573 Bacteria 38033
306 Ga0501037_0000934 3300049573 Bacteria 21711
307 Ga0501037_0026795 3300049573 Bacteria 4258
308 Ga0501038_0000022 3300049574 Bacteria 151623
309 Ga0501038_0000064 3300049574 Bacteria 87975
310 Ga0501038_0014971 3300049574 Bacteria 7062
311 Ga0501038_0042256 3300049574 Bacteria 3970
312 Ga0501038_0064226 3300049574 Bacteria 3131
313 Ga0501039_0000017 3300049575 Bacteria 189412
314 Ga0501039_0000030 3300049575 Bacteria 130049
315 Ga0501040_0018778 3300049576 Bacteria 4593
316 Ga0501042_0034230 3300049578 Bacteria 3603
317 Ga0501043_0000050 3300049579 Bacteria 107465
318 Ga0501043_0000544 3300049579 Bacteria 33888
319 Ga0501043_0001343 3300049579 Bacteria 21530
320 Ga0501043_0250940 3300049579 Bacteria 1363
321 Ga0501046_0008673 3300049580 Bacteria 8837
322 Ga0501047_0006511 3300049581 Bacteria 10994
323 Ga0501047_0030273 3300049581 Bacteria 5219
324 Ga0501047_0040214 3300049581 Bacteria 4522
325 Ga0501047_0077229 3300049581 Bacteria 3204
326 Ga0501047_0169808 3300049581 Bacteria 2050
327 Ga0501048_0013328 3300049582 Bacteria 6099
328 Ga0501067_0053789 3300049583 Bacteria 2231
329 Ga0501067_0100427 3300049583 Bacteria 1607
330 Ga0501068_0027017 3300049584 Bacteria 3386
331 Ga0501068_0164340 3300049584 Bacteria 1400
332 Ga0501069_0038792 3300049585 Bacteria 2630
333 Ga0501070_0000174 3300049586 Bacteria 59663
334 Ga0501070_0001512 3300049586 Bacteria 20735
335 Ga0501070_0001911 3300049586 Bacteria 18392
336 Ga0501070_0009613 3300049586 Bacteria 8169
337 Ga0501070_0137351 3300049586 Bacteria 2018
338 Ga0501070_0159450 3300049586 Bacteria 1860
339 Ga0501071_0006176 3300049587 Bacteria 7767
340 Ga0501071_0045420 3300049587 Bacteria 3153
341 Ga0501071_0177716 3300049587 Bacteria 1594
342 Ga0501072_0028094 3300049588 Bacteria 4392
343 Ga0501073_0020107 3300049589 Bacteria 4815
344 Ga0501073_0069668 3300049589 Bacteria 2451
345 Ga0501073_0094968 3300049589 Bacteria 2071
346 Ga0501074_0000015 3300049590 Bacteria 79939
347 Ga0501074_0025441 3300049590 Bacteria 4299
348 Ga0501074_0034658 3300049590 Bacteria 3659
349 Ga0501074_0071732 3300049590 Bacteria 2489
350 Ga0501075_0017649 3300049591 Bacteria 5153
351 Ga0501076_0051456 3300049592 Bacteria 3260
352 Ga0501077_0056480 3300049593 Bacteria 2492
353 Ga0501079_0030186 3300049741 Bacteria 4165
354 Ga0501080_0006094 3300049742 Bacteria 10809
355 Ga0501080_0011270 3300049742 Bacteria 8184
356 Ga0501080_0012119 3300049742 Bacteria 7898
357 Ga0501080_0048661 3300049742 Bacteria 3945
358 Ga0501083_0000697 3300049744 Bacteria 21876
359 Ga0501083_0102070 3300049744 Bacteria 1891
360 Ga0501083_0162988 3300049744 Bacteria 1458
361 Ga0501280_000846 3300049776 Bacteria 6613
362 Ga0501035_0000021 3300049822 Bacteria 209085
363 Ga0501035_0000065 3300049822 Bacteria 129986
364 Ga0501035_0000070 3300049822 Bacteria 127442
365 Ga0501035_0001047 3300049822 Bacteria 28944
366 Ga0501035_0001622 3300049822 Bacteria 22762
367 Ga0501035_0002360 3300049822 Bacteria 18572
368 Ga0501035_0113320 3300049822 Bacteria 2375
369 Ga0501035_0127835 3300049822 Bacteria 2217
370 Ga0501044_0000037 3300049823 Bacteria 161924
371 Ga0501044_0000043 3300049823 Bacteria 151623
372 Ga0501044_0014501 3300049823 Bacteria 8502
373 Ga0501044_0028296 3300049823 Bacteria 5915
374 Ga0501044_0053288 3300049823 Bacteria 4162
375 Ga0501044_0063944 3300049823 Bacteria 3757
376 Ga0501044_0067498 3300049823 Bacteria 3644
377 Ga0501045_0011306 3300049824 Bacteria 6266
378 nmdc:mga03683_23137_c1 3300050489 Bacteria 2417
379 nmdc:mga03n38_10228_c1 3300050490 Bacteria 3443
380 nmdc:mga00v17_24208_c1 3300050491 Bacteria 3520
381 nmdc:mga0yw44_21518_c1 3300050492 Bacteria 3599
382 nmdc:mga0yw44_58729_c1 3300050492 Bacteria 2351
383 nmdc:mga0yw44_63067_c1 3300050492 Bacteria 2278
384 nmdc:mga06z11_22696_c1 3300050494 Bacteria 2936
385 nmdc:mga05p37_40823_c1 3300050507 Bacteria 5698
386 nmdc:mga05p37_42426_c1 3300050507 Bacteria 5589
387 nmdc:mga05p37_510890_c1 3300050507 Bacteria 1377
388 nmdc:mga09592_131367_c1 3300050508 Bacteria 2155
389 nmdc:mga09592_9435_c1 3300050508 Bacteria 7928
390 nmdc:mga0qj67_18493_c1 3300050509 Bacteria 5311
391 nmdc:mga06r32_144136_c1 3300050510 Bacteria 2359
392 nmdc:mga06r32_21243_c1 3300050510 Bacteria 5991
393 nmdc:mga08y16_19247_c1 3300050511 Bacteria 7196
394 nmdc:mga08y16_83979_c1 3300050511 Bacteria 3319
395 nmdc:mga0n895_450_c1 3300050512 Bacteria 22652
396 nmdc:mga0rr50_47889_c1 3300050513 Bacteria 3157
397 nmdc:mga0a205_1149_c1 3300050515 Bacteria 21996
398 Ga0500643_017106 3300053087 Bacteria 2437
399 Ga0500644_0006015 3300053088 Bacteria 3090
400 Ga0500607_072055 3300053121 Bacteria 1782
401 Ga0500618_000374 3300053125 Bacteria 30888
402 Ga0500618_002801 3300053125 Bacteria 6304
403 Ga0500618_010488 3300053125 Bacteria 2485
404 Ga0500568_0000054 3300053139 Bacteria 111105
405 Ga0500590_007124 3300053148 Bacteria 5499
406 Ga0500604_0033986 3300053151 Bacteria 1511
407 Ga0500616_0000309 3300053153 Bacteria 70113
408 Ga0500620_001495 3300053155 Bacteria 4351
409 Ga0500622_0000399 3300053156 Bacteria 41585
410 Ga0500622_0024007 3300053156 Bacteria 3227
411 Ga0500624_001261 3300053157 Bacteria 4439
412 Ga0500634_0011741 3300053161 Bacteria 4532
413 Ga0500636_0117321 3300053177 Bacteria 1497
414 Ga0500611_005172 3300053727 Bacteria 1818
415 Ga0501084_0166099 3300054114 Bacteria 1863
416 Ga0501082_0042247 3300060353 Bacteria 3930
417 Ga0501082_0182974 3300060353 Bacteria 1823
418 2758642233 2758568016 Bacteria 5645291
419 2503200259 2503198000 Bacteria 6884444
420 2509115103 2508501123 Bacteria 6283661
421 2509139496 2508501127 Bacteria 7037543
422 2509372207 2509276018 Bacteria 6910194
423 2509391803 2509276021 Bacteria 7634384
424 2509395074 2509276022 Bacteria 6200534
425 2509447341 2509276033 Bacteria 7180565
426 2510134179 2510065019 Bacteria 6903379
427 2510314194 2510065059 Bacteria 6847884
428 2511171623 2510917026 Bacteria 7046020
429 2511390163 2511231027 Bacteria 5013807
430 2512932373 2512875016 Bacteria 6529530
431 2512960377 2512875024 Bacteria 7195110
432 2513608499 2513237090 Bacteria 7096802
433 2513925181 2513237146 Bacteria 7166346
434 2513997685 2513237159 Bacteria 6810126
435 2514018073 2513237162 Bacteria 7468464
436 2514034517 2513237164 Bacteria 7563725
437 2514420339 2513237305 Bacteria 7293571
438 2514587680 2513237351 Bacteria 6968952
439 2515113346 2515075009 Bacteria 7288508
440 2517077310 2516653085 Bacteria 7346596
441 2520377030 2519899620 Bacteria 6499161
442 2524458857 2524023209 Bacteria 6679728
443 2535485261 2534681786 Bacteria 3308809
444 2561469267 2558860983 Bacteria 4133860
445 2585167441 2582581283 Bacteria 6030556
446 2585201994 2582581294 Bacteria 6626667
447 2585265666 2582581306 Bacteria 6450535
448 2585279293 2582581308 Bacteria 7413247
449 2585323103 2582581315 Bacteria 7318924
450 2585331215 2582581316 Bacteria 7774528
451 2585388871 2582581865 Bacteria 6644329
452 2585395430 2582581866 Bacteria 6859583
453 2585524738 2585427526 Bacteria 7258840
454 2585531223 2585427527 Bacteria 7273426
455 2585552854 2585427530 Bacteria 7383882
456 2585843473 2585427594 Bacteria 6180594
457 2588518441 2588253730 Bacteria 6881675
458 2597812262 2597489875 Bacteria 7010078
459 2599417088 2599185170 Bacteria 7295545
460 2599721612 2599185236 Bacteria 6875203
461 2599936262 2599185301 Bacteria 6161860
462 2616311034 2615840626 Bacteria 7921970
463 2616554472 2615840698 Bacteria 7319877
464 2617384834 2617270742 Bacteria 6808054
465 2643773839 2643221550 Bacteria 4619371
466 2643776450 2643221551 Bacteria 3750538
467 2643794897 2643221555 Bacteria 3749717
468 2643804198 2643221557 Bacteria 7184309
469 2643839176 2643221564 Bacteria 4193379
470 2643985510 2643221595 Bacteria 6565519
471 2644050236 2643221607 Bacteria 6314006
472 2644065028 2643221610 Bacteria 7480339
473 2644129740 2643221623 Bacteria 5239945
474 2644158350 2643221627 Bacteria 6761570
475 2644204702 2643221636 Bacteria 6583769
476 2644298907 2643221653 Bacteria 4569637
477 2644376563 2643221668 Bacteria 7306521
478 2644416701 2643221675 Bacteria 7473456
479 2644449741 2643221680 Bacteria 7473610
480 2644483156 2643221686 Bacteria 6310811
481 2644494312 2643221688 Bacteria 5260751
482 2644497803 2643221689 Bacteria 6042950
483 2644657136 2643221719 Bacteria 4568197
484 2644689873 2643221726 Bacteria 7455827
485 2671111209 2667528174 Bacteria 6435400
486 2688597438 2687453392 Bacteria 6880454
487 2694628532 2693429783 Bacteria 7019804
488 2694637555 2693429784 Bacteria 7241525
489 2719182020 2718217882 Bacteria 6556348
490 2719666380 2718217997 Bacteria 6740740
491 2719732736 2718218009 Bacteria 6478651
492 2720492800 2718218199 Bacteria 6740745
493 2720614267 2718218232 Bacteria 6720332
494 2720621036 2718218233 Bacteria 6662049
495 2720632359 2718218235 Bacteria 6630699
496 2720776087 2718218269 Bacteria 6906114
497 2721148111 2718218363 Bacteria 6524337
498 2721159563 2718218365 Bacteria 6274507
499 2721164947 2718218366 Bacteria 6425255
500 2722841117 2721755514 Bacteria 6424414
501 2723027686 2721755556 Bacteria 6745503
502 2723561314 2721755684 Bacteria 6859907
503 2723567937 2721755685 Bacteria 6704835
504 2723574655 2721755686 Bacteria 7343952
505 2724045492 2721755810 Bacteria 6479005
506 2724090694 2721755819 Bacteria 6906405
507 2724105202 2721755822 Bacteria 6726041
508 2724111030 2721755823 Bacteria 6752556
509 2730108622 2728369352 Bacteria 6745171
510 2730165255 2728369365 Bacteria 6555560
511 2730299195 2728369397 Bacteria 6274511
512 2738800322 2738541293 Bacteria 7065685
513 2738944070 2738541317 Bacteria 5340176
514 2739310033 2738543024 Bacteria 5603683
515 2753359913 2751185800 Bacteria 5467370
516 2756671723 2756170246 Bacteria 7451806
517 2765466511 2765235802 Bacteria 5618596
518 2770196971 2767802442 Bacteria 5747986
519 2776270421 2775506902 Bacteria 6208009
520 2776281660 2775506904 Bacteria 5954060
521 2776914191 2775507049 Bacteria 6284736
522 2778175654 2775507266 Bacteria 7392367
523 2792751928 2791355123 Bacteria 8049106
524 2793294210 2791355256 Bacteria 6798008
525 2793315866 2791355259 Bacteria 7254731
526 2793319402 2791355260 Bacteria 6598818
527 2793335446 2791355262 Bacteria 6774204
528 2793339496 2791355263 Bacteria 6872478
529 2793347027 2791355264 Bacteria 6429314
530 2793367669 2791355267 Bacteria 7222458
531 2805926849 2802429605 Bacteria 6875453
532 2805932762 2802429606 Bacteria 6346811
533 2819241085 2818991272 Bacteria 4622173
534 2819609361 2818991448 Bacteria 6772224
535 2819641327 2818991453 Bacteria 7181617
536 2821125738 2821123053 Bacteria 7836056
537 2837654661 2837651117 Bacteria 3772164
538 2838021679 2838016132 Bacteria 6577831
539 2838023629 2838022645 Bacteria 6494267
540 2838033379 2838029111 Bacteria 6603031
541 2838038706 2838035591 Bacteria 7166484
542 2838053327 2838048938 Bacteria 6044578
543 2838065445 2838061910 Bacteria 6794874
544 2838069925 2838068647 Bacteria 6208656
545 2838661372 2838661181 Bacteria 7385261
546 2838670585 2838668709 Bacteria 6671819
547 2838686816 2838686498 Bacteria 7807632
548 2838702956 2838701080 Bacteria 6669771
549 2838730226 2838729681 Bacteria 7400765
550 2838737811 2838736955 Bacteria 5760694
551 2838742759 2838742623 Bacteria 7396178
552 2839997509 2839993093 Bacteria 5512535
553 2840768983 2840764183 Bacteria 6358399
554 2841738269 2841734538 Bacteria 6784580
555 2841841820 2841840854 Bacteria 5761912
556 2841854644 2841851746 Bacteria 7532261
557 2841867183 2841864319 Bacteria 6742987
558 2842141599 2842140634 Bacteria 5759631
559 2842147786 2842146304 Bacteria 5957337
560 2842158336 2842156927 Bacteria 6894975
561 2842181952 2842180545 Bacteria 6888678
562 2842195832 2842192696 Bacteria 6147454
563 2842199143 2842198810 Bacteria 6608673
564 2842209590 2842205361 Bacteria 6340321
565 2842230049 2842229732 Bacteria 7475766
566 2842243938 2842243621 Bacteria 7421798
567 2842252852 2842250916 Bacteria 6579627
568 2842257977 2842257432 Bacteria 7401195
569 2842269510 2842264693 Bacteria 6472963
570 2842271646 2842271015 Bacteria 7807131
571 2842283044 2842278818 Bacteria 6340002
572 2842285382 2842285085 Bacteria 6011953
573 2842298207 2842298080 Bacteria 6123127
574 2842313996 2842311132 Bacteria 6616990
575 2842319764 2842317721 Bacteria 6793725
576 2842348458 2842341865 Bacteria 7003929
577 2842360193 2842357229 Bacteria 6485165
578 2842368319 2842363717 Bacteria 6844742
579 2842400118 2842395702 Bacteria 6780583
580 2842402742 2842402390 Bacteria 6681310
581 2842409887 2842409023 Bacteria 6687331
582 2842416535 2842415677 Bacteria 6596907
583 2842423539 2842422224 Bacteria 6239196
584 2842430488 2842428310 Bacteria 6767288
585 2842436700 2842434925 Bacteria 6502746
586 2842443458 2842441272 Bacteria 6769273
587 2842449328 2842447887 Bacteria 6754142
588 2842466742 2842462802 Bacteria 6588055
589 2842471430 2842469257 Bacteria 6752936
590 2842479955 2842475841 Bacteria 6603183
591 2842483845 2842482326 Bacteria 7212537
592 2842492293 2842489311 Bacteria 6620893
593 2842497846 2842495871 Bacteria 6820686
594 2842505260 2842502639 Bacteria 6604161
595 2842514269 2842509118 Bacteria 6850950
596 2842522071 2842521101 Bacteria 6569494
597 2842872154 2842871566 Bacteria 4827117
598 2844012815 2844009547 Bacteria 6728125
599 2844458113 2844454524 Bacteria 7952546
600 2847675162 2847670302 Bacteria 6165597
601 2847691338 2847686936 Bacteria 6278406
602 2854912570 2854911287 Bacteria 5582813
603 2856315028 2856314179 Bacteria 6477897
604 2856323341 2856320880 Bacteria 7263508
605 2856329352 2856328259 Bacteria 6528202
606 2856336460 2856334872 Bacteria 7037011
607 2856347251 2856342000 Bacteria 7176905
608 2856352928 2856349417 Bacteria 6230045
609 2856357193 2856356410 Bacteria 6297484
610 2856368218 2856364286 Bacteria 6939991
611 2857351591 2857349434 Bacteria 7926032
612 2857370379 2857367948 Bacteria 6965560
613 2857532299 2857531043 Bacteria 6754041
614 2869164042 2869162929 Bacteria 6399702
615 2869174652 2869169390 Bacteria 6659796
616 2869239104 2869234852 Bacteria 6654993
617 2869247171 2869242130 Bacteria 6609239
618 2869249990 2869249662 Bacteria 6868783
619 2869263880 2869256925 Bacteria 6981691
620 2869269967 2869264136 Bacteria 6880765
621 2869277371 2869271264 Bacteria 6908218
622 2869282820 2869278585 Bacteria 7077053
623 2869290163 2869285874 Bacteria 6901219
624 2871432447 2871429161 Bacteria 6547891
625 2871437941 2871435913 Bacteria 6880295
626 2871448198 2871444079 Bacteria 6423508
627 2871453153 2871451962 Bacteria 7336357
628 2871464790 2871459585 Bacteria 6866887
629 2871470966 2871466892 Bacteria 6923287
630 2871474691 2871474448 Bacteria 6806570
631 2871486580 2871481445 Bacteria 6700002
632 2871493068 2871488783 Bacteria 6929816
633 2871502476 2871495908 Bacteria 6935695
634 2874108758 2874102143 Bacteria 6342645
635 2874111546 2874109183 Bacteria 6517025
636 2874117451 2874116593 Bacteria 6674494
637 2874126958 2874123672 Bacteria 7238285
638 2874137487 2874131515 Bacteria 6820270
639 2874142480 2874139085 Bacteria 7021506
640 2874152413 2874146452 Bacteria 7533118
641 2874159814 2874155637 Bacteria 6724144
642 2874162782 2874162495 Bacteria 6174670
643 2874168865 2874168670 Bacteria 8062617
644 2876367595 2876363079 Bacteria 6544991
645 2876383157 2876377896 Bacteria 6565995
646 2876392810 2876386047 Bacteria 6698674
647 2876393887 2876392853 Bacteria 6660880
648 2876405136 2876399893 Bacteria 6927900
649 2876413523 2876406927 Bacteria 6191900
650 2876418330 2876413966 Bacteria 6831344
651 2876422274 2876420981 Bacteria 6687741
652 2878042271 2878035449 Bacteria 6555736
653 2878736239 2878730984 Bacteria 6380721
654 2878744336 2878738818 Bacteria 7136951
655 2878750061 2878745973 Bacteria 6867388
656 2878757113 2878753008 Bacteria 6922523
657 2878766368 2878760144 Bacteria 6823465
658 2878773564 2878767105 Bacteria 6898628
659 2878778782 2878774303 Bacteria 6108671
660 2878787131 2878781027 Bacteria 6834456
661 2881150161 2881147464 Bacteria 7779814
662 2881161270 2881155292 Bacteria 6461656
663 2881166995 2881161766 Bacteria 7127907
664 2881848200 2881845957 Bacteria 6611900
665 2881859477 2881853255 Bacteria 6698367
666 2881861753 2881861095 Bacteria 7128710
667 2882640771 2882632389 Bacteria 8154593
668 2882918472 2882912400 Bacteria 6801539
669 2885308514 2885305155 Bacteria 7348390
670 2885312701 2885312484 Bacteria 6415165
671 2885320479 2885318864 Bacteria 6729568
672 2885331295 2885326080 Bacteria 7134805
673 2885338103 2885334103 Bacteria 7216818
674 2885343163 2885342637 Bacteria 7011821
675 2885353731 2885350715 Bacteria 6787678
676 2888338503 2888337043 Bacteria 6629336
677 2888346006 2888343758 Bacteria 6611049
678 2888355314 2888350351 Bacteria 7372807
679 2889010293 2889010040 Bacteria 6749192
680 2889018041 2889016732 Bacteria 6700763
681 2889919911 2889914905 Bacteria 5702301
682 2894655720 2894652903 Bacteria 4587256
683 2899806236 2899803654 Bacteria 5577784
684 2903450373 2903448605 Bacteria 7357801
685 2903500840 2903492973 Bacteria 13473544
686 2903505121 2903492973 Bacteria 13473544
687 2903518645 2903513507 Bacteria 6344008
688 2903521888 2903521522 Bacteria 6525694
689 2903528265 2903528002 Bacteria 6586099
690 2903547517 2903540706 Bacteria 7062119
691 2904582091 2904578770 Bacteria 5302906
692 2904660218 2904659560 Bacteria 6685615
693 2906312419 2906308376 Bacteria 6841989
694 2906325128 2906321335 Bacteria 6579571
695 2906330475 2906328253 Bacteria 6585166
696 2906357966 2906354277 Bacteria 6991324
697 2906365229 2906363423 Bacteria 6856682
698 2906377753 2906370794 Bacteria 6881062
699 2906384286 2906378014 Bacteria 6911440
700 2906390974 2906386501 Bacteria 5977019
701 2906397919 2906393657 Bacteria 6790866
702 2906406941 2906401398 Bacteria 6693206
703 2906408745 2906408224 Bacteria 6162342
704 2906419672 2906414383 Bacteria 6580790
705 2906427916 2906427513 Bacteria 6375796
706 2913313580 2913308742 Bacteria 5350706
707 2915653292 2915650412 Bacteria 4288180
708 2919123131 2919119836 Bacteria 5208557
709 2919410223 2919408235 Bacteria 6149349
710 2922135435 2922130491 Bacteria 7173936
711 2922152397 2922151315 Bacteria 6902399
712 2922163459 2922158528 Bacteria 6573167
713 2922175443 2922172374 Bacteria 6167644
714 2922180858 2922178524 Bacteria 6025201
715 2922190606 2922185730 Bacteria 7113964
716 2924722352 2924718760 Bacteria 6331356
717 2924728165 2924726620 Bacteria 6271473
718 2924737686 2924733363 Bacteria 7574837
719 2924743048 2924741084 Bacteria 6661321
720 2924749451 2924748358 Bacteria 6154725
721 2924762214 2924754689 Bacteria 6774424
722 2924766247 2924762789 Bacteria 6561353
723 2924782366 2924776078 Bacteria 7492003
724 2924786416 2924784321 Bacteria 7416538
725 2928524085 2928521798 Bacteria 4960112
726 2933023530 2933016740 Bacteria 6355406
727 2933600731 2933599457 Bacteria 5858799
728 2936371809 2936367885 Bacteria 7324495
729 2936379644 2936375103 Bacteria 6652732
730 2936387814 2936381700 Bacteria 7006523
731 2937819437 2937813078 Bacteria 7783518
732 2937825190 2937822353 Bacteria 7290551
733 2937851018 2937848649 Bacteria 6983481
734 2937862023 2937861824 Bacteria 6660327
735 2937874223 2937868953 Bacteria 6639878
736 2937880907 2937877337 Bacteria 7246526
737 2937897633 2937891427 Bacteria 6357007
738 2937977101 2937972304 Bacteria 7532020
739 2937987485 2937980651 Bacteria 6517427
740 2938001392 2937994558 Bacteria 7036190
741 2938016584 2938014810 Bacteria 6700592
742 2954013031 2954011201 Bacteria 4762601
743 2958039603 2958034702 Bacteria 6989922
744 2958052768 2958041894 Bacteria 13082850
745 2958065137 2958064165 Bacteria 7158582
746 2958088537 2958084443 Bacteria 7312792
747 2958094529 2958092219 Bacteria 6861151
748 2958105898 2958100919 Bacteria 6800575
749 2958110492 2958108152 Bacteria 6681128
750 2958116508 2958115193 Bacteria 6923548
751 2958127088 2958122699 Bacteria 7280457
752 2958134551 2958130278 Bacteria 6897202
753 2958140281 2958137437 Bacteria 6050276
754 2958148750 2958144490 Bacteria 6677056
755 2958158655 2958158011 Bacteria 6058449
756 2958171546 2958165035 Bacteria 6906348
757 2958174782 2958172287 Bacteria 6716688
758 2958181032 2958179912 Bacteria 6874908
759 2961078868 2961077736 Bacteria 7079850
760 2961115543 2961114664 Bacteria 6680456
761 2961133359 2961127735 Bacteria 7196641
762 2961139596 2961136820 Bacteria 6775228
763 2961169987 2961163497 Bacteria 6901077
764 2961175558 2961170736 Bacteria 7072258
765 2961186683 2961183825 Bacteria 6688536
766 2963646832 2963644680 Bacteria 6530403
767 2965024738 2965018300 Bacteria 6883036
768 2965029677 2965025482 Bacteria 6532201
769 2965034605 2965032056 Bacteria 6887443
770 2965046107 2965040258 Bacteria 6855979
771 2965052120 2965047637 Bacteria 6623551
772 2965063078 2965062239 Bacteria 7412989
773 2965091412 2965089291 Bacteria 6866420
774 2965107661 2965102966 Bacteria 6800987
775 2965116101 2965110997 Bacteria 6693150
776 2965122516 2965119406 Bacteria 6956431
777 2967999386 2967996073 Bacteria 6787468
778 2968007798 2968003550 Bacteria 6929263
779 2968020931 2968016561 Bacteria 7022047
780 2968088367 2968083720 Bacteria 7351627
781 2968094979 2968091066 Bacteria 6052692
782 2968102015 2968097103 Bacteria 6107094
783 2968111276 2968110612 Bacteria 6814636
784 2968119544 2968117919 Bacteria 6536078
785 2968130538 2968128360 Bacteria 6270294
786 2968142502 2968138860 Bacteria 6605449
787 2968178379 2968171901 Bacteria 6894245
788 2970474228 2970469710 Bacteria 6969209
789 2970494952 2970489779 Bacteria 6517260
790 2970508146 2970503327 Bacteria 7099517
791 2970511525 2970510686 Bacteria 7006402
792 2970527537 2970524798 Bacteria 6840927
793 2970537956 2970532167 Bacteria 6553173
794 2970554245 2970547951 Bacteria 6931819
795 2970561224 2970554993 Bacteria 6814252
796 2970597429 2970593180 Bacteria 7073582
797 2970625924 2970619444 Bacteria 6986144
798 2970628758 2970627176 Bacteria 6680862
799 2977826272 2977821940 Bacteria 6906439
800 2977832625 2977828996 Bacteria 7007971
801 2977848207 2977843712 Bacteria 6753583
802 2977852724 2977851361 Bacteria 6694324
803 2977861593 2977858184 Bacteria 6215359
804 2977872637 2977864932 Bacteria 7534097
805 2977874019 2977872689 Bacteria 7270173
806 2977903372 2977898635 Bacteria 6675551
807 2977914131 2977907340 Bacteria 6577984
808 2977915852 2977915119 Bacteria 6829656
809 2977927429 2977922695 Bacteria 6956781
810 2977936467 2977935797 Bacteria 6252826
811 2977944574 2977942078 Bacteria 7570577
812 2977955655 2977950692 Bacteria 6893264
813 2977958517 2977957713 Bacteria 6877875
814 2977978903 2977971508 Bacteria 7472917
815 2977990922 2977986579 Bacteria 6581278
816 2979717463 2979710463 Bacteria 6785254
817 2979749015 2979742915 Bacteria 7301278
818 2979770432 2979764755 Bacteria 6610066
819 2979773421 2979772303 Bacteria 6618277
820 2979784214 2979779861 Bacteria 6219781
821 2979795387 2979793036 Bacteria 6808957
822 2979813330 2979808191 Bacteria 7179355
823 2984590187 2984587000 Bacteria 5263363
824 2987638775 2987636660 Bacteria 8088555
825 2987647218 2987645492 Bacteria 6117018
826 2987658807 2987652177 Bacteria 6969023
827 2987666228 2987659509 Bacteria 6966464
828 2987670828 2987666974 Bacteria 6509233
829 2987674214 2987673487 Bacteria 6884027
830 2989779469 2989776772 Bacteria 4843317
831 2996314453 2996310559 Bacteria 6357320
832 2996339836 2996336353 Bacteria 5511628
833 2996342295 2996341866 Bacteria 6643098
834 2996352438 2996348954 Bacteria 7239054
835 2996390224 2996386984 Bacteria 6978667
836 3000139800 3000135777 Bacteria 6891109
837 3002144978 3002141150 Bacteria 5254435
838 3004167865 3004167301 Bacteria 8330599
839 3004195234 3004188549 Bacteria 6952365
840 3004203571 3004195979 Bacteria 6776956
841 3004204982 3004203850 Bacteria 7307914
842 3004215241 3004211236 Bacteria 7417683
843 3004220717 3004218560 Bacteria 7421728
844 3004233330 3004232784 Bacteria 6662140
845 3004244080 3004239961 Bacteria 6892290
846 3004254645 3004248173 Bacteria 6563236
847 3004275476 3004268573 Bacteria 7043476
848 3004279120 3004275668 Bacteria 7114440
849 3004335506 3004334049 Bacteria 8449246
850 3005418956 3005416602 Bacteria 7064308
851 637075471 637000159 Bacteria 7596297
852 649871988 649633066 Bacteria 6690028
853 8002289391 8002285264 Bacteria 6717907
854 8004302894 8004300914 Bacteria 6132239
855 8004314115 8004312739 Bacteria 7444653
856 8004366794 8004361976 Bacteria 6858373
857 8004378688 8004374579 Bacteria 6898112
858 8004392369 8004387939 Bacteria 7049250
859 8004398133 8004395343 Bacteria 6620908
860 8004451438 8004445564 Bacteria 6322258
861 8004644898 8004640170 Bacteria 6723001
862 8004696406 8004695233 Bacteria 6731676
863 8004705441 8004703790 Bacteria 8006957
864 8004718678 8004714634 Bacteria 6776161
865 8004731715 8004727605 Bacteria 6643904
866 8005249923 8005246636 Bacteria 4933972
867 8005284592 8005282627 Bacteria 6675747
868 8005295741 8005289223 Bacteria 6634003
869 8005318152 8005314921 Bacteria 7072929
870 8005381159 8005376324 Bacteria 6590079
871 8005437507 8005430974 Bacteria 6689030
872 8005464030 8005460587 Bacteria 7157962
873 8005488970 8005484373 Bacteria 6297373
874 8005501120 8005497431 Bacteria 6477605
875 8005561449 8005556819 Bacteria 6908598
876 8005568227 8005563573 Bacteria 7153261
877 8005622488 8005619151 Bacteria 7030230
878 8005629989 8005626139 Bacteria 6534237
879 8005646052 8005645114 Bacteria 6950293
880 8005658843 8005658619 Bacteria 4500593
881 8005672538 8005668836 Bacteria 6953162
882 8005682663 8005682033 Bacteria 6726518
883 8005697637 8005695170 Bacteria 6912330
884 8018151331 8018150411 Bacteria 5549903
885 8018164341 8018163183 Bacteria 7277977
886 8024488267 8024486573 Bacteria 6540512
887 8024504659 8024501048 Bacteria 6427847
888 8054562181 8054558443 Bacteria 5204801
889 8055619736 8055617313 Bacteria 7548464
890 8056377614 8056375014 Bacteria 7006639
891 8056386263 8056382006 Bacteria 6408074
892 JGI24740J21852_10000169
893 JGI24740J21852_10015314
894 JGI25155J39150_1000014
895 JGI25156J39149_1000037
896 JGI25156J39149_1000079
897 JGI25156J39149_1002192
898 JGI25162J39368_1000217
899 JGI25162J39368_1000497
900 JGI25154J39366_1000052
901 JGI25157J39369_1000040
902 JGI25157J39369_1000368
903 JGI25150J39212_1000417
904 JGI25159J45721_1000401
905 JGI25151J46595_10000146
906 JGI25151J46595_10000215
907 JGI25165J46597_1000006
908 JGI25165J46597_1000371
909 JGI25165J46597_1000387
910 JGI25165J46597_1000462
911 JGI25153J46596_10000878
912 JGI25153J46596_10004407
913 rootH1_10004680
914 rootH1_10157649
915 rootH2_10011583
916 rootL2_10035235
917 rootH1_10095850
918 JGI25160J50197_1000001
919 JGI25161J50226_1000001
920 Ga0006562J51391_1009537
921 Ga0055542_1000404
922 Ga0055526_1014748
923 Ga0055524_1000779
924 Ga0055528_1013046
925 Ga0055540_1000766
926 Ga0055543_1000282
927 Ga0065165_1000008
928 Ga0070658_10106001
929 Ga0070660_100118678
930 Ga0070674_100188281
931 Ga0070678_100314674
932 Ga0068867_100116920
933 Ga0068853_100248531
934 Ga0070665_100009296
935 Ga0070665_100067738
936 Ga0070665_100072614
937 Ga0070665_100217867
938 Ga0068855_100157342
939 Ga0068856_100025003
940 Ga0081455_10012443
941 Ga0081455_10015931
942 Ga0081540_1007880
943 Ga0081539_10002162
944 Ga0075365_10030777
945 Ga0075365_10031358
946 Ga0075365_10102700
947 Ga0075363_100053772
948 Ga0075364_10040215
949 Ga0075362_10041664
950 Ga0075362_10048465
951 Ga0075367_10023276
952 Ga0075370_10052367
953 Ga0075428_100022359
954 Ga0075430_100030561
955 Ga0075430_100167756
956 Ga0075431_100076396
957 Ga0075433_10002189
958 Ga0075434_100073228
959 Ga0075429_100011671
960 Ga0075429_100016796
961 Ga0079104_1000884
962 Ga0105240_10000014
963 Ga0105240_10171195
964 Ga0111539_10028098
965 Ga0111539_10043682
966 Ga0114129_10112120
967 Ga0114129_10290007
968 Ga0114129_10318118
969 Ga0105241_10085808
970 Ga0105237_10002639
971 Ga0105237_10057359
972 Ga0105237_10106306
973 Ga0105238_10011380
974 Ga0123341_1000112
975 Ga0105239_10002361
976 Ga0105239_10125132
977 Ga0105239_10372042
978 Ga0105239_10452583
979 Ga0157373_10024988
980 Ga0157371_10121496
981 Ga0157370_10121144
982 Ga0157369_10010177
983 Ga0157374_10139864
984 Ga0157378_10497700
985 Ga0157372_10184472
986 Ga0157372_10204080
987 Ga0157375_10481377
988 Ga0182008_10117236
989 Ga0182007_10001651
990 Ga0182007_10028281
991 Ga0209435_100027
992 Ga0209672_102276
993 Ga0209563_102869
994 Ga0209437_100051
995 Ga0209437_100060
996 Ga0207425_1000046
997 Ga0209646_1000086
998 Ga0209026_1000082
999 Ga0209026_1000089
1000 Ga0209677_100273
1001 Ga0209148_1000315
1002 Ga0209759_1000040
1003 Ga0209759_1000063
1004 Ga0209129_1000171
1005 Ga0209129_1003441
1006 Ga0209233_1000010
1007 Ga0209233_1000095
1008 Ga0209233_1000190
1009 Ga0209233_1000228
1010 Ga0209455_1000062
1011 Ga0209673_1000025
1012 Ga0209673_1002044
1013 Ga0209130_1000003
1014 Ga0209025_1000091
1015 Ga0209025_1000137
1016 Ga0209025_1005984
1017 Ga0209564_1002269
1018 Ga0209758_1000123
1019 Ga0209758_1000671
1020 Ga0209758_1008974
1021 Ga0209758_1023979
1022 Ga0209050_1033541
1023 Ga0209256_1000153
1024 Ga0209256_1002343
1025 Ga0207426_1000011
1026 Ga0209051_1001157
1027 Ga0209257_1003543
1028 Ga0207647_10064391
1029 Ga0207645_10062918
1030 Ga0207695_10000037
1031 Ga0207695_10209051
1032 Ga0207671_10000271
1033 Ga0207671_10013350
1034 Ga0207671_10110409
1035 Ga0207657_10080315
1036 Ga0207649_10211280
1037 Ga0207694_10003084
1038 Ga0207644_10366686
1039 Ga0207667_10256344
1040 Ga0207712_10099878
1041 Ga0207640_10223557
1042 Ga0207639_10118107
1043 Ga0207678_10009953
1044 Ga0207678_10096162
1045 Ga0207702_10041065
1046 Ga0207702_10055850
1047 Ga0207675_100175405
1048 Ga0207698_10027465
1049 Ga0207698_10063155
1050 Ga0209281_1000034
1051 Ga0209371_1003106
1052 Ga0207428_10033351
1053 Ga0207428_10089923
1054 Ga0268266_10103445
1055 Ga0268266_10146381
1056 Ga0307515_10000017
1057 Ga0307515_10000285
1058 Ga0307515_10007366
1059 Ga0307515_10044010
1060 Ga0268256_1004706
1061 Ga0307513_10007623
1062 Ga0307514_10163761
1063 Ga0307412_10002165
1064 Ga0307409_100101999
1065 Ga0316593_10020378
1066 Ga0316574_0064369
1067 Ga0373927_0000191
1068 Ga0316582_0023087
1069 Ga0373925_0002944
1070 Ga0395899_0000242
1071 Ga0395900_0000318
1072 Ga0395900_0158485
1073 Ga0395898_0000547
1074 Ga0395905_0000305
1075 Ga0395905_0015895
1076 Ga0395905_0092233
1077 Ga0395901_0000093
1078 Ga0395901_0311117
1079 Ga0439436_0014596
1080 Ga0439438_024347
1081 Ga0439465_0001911
1082 Ga0451835_0491401
1083 Ga0451839_0575334
1084 Ga0451841_0220125
1085 Ga0451845_0754475
1086 Ga0451846_63590
1087 Ga0451847_0257076
1088 Ga0451851_0897679
1089 Ga0439449_0013739
1090 Ga0439446_0053094
1091 Ga0466970_0009978
1092 Ga0466957_0020179
1093 Ga0466959_0059075
1094 Ga0466958_0022324
1095 Ga0495629_0007120
1096 Ga0495606_0003332
1097 Ga0495606_0014346
1098 Ga0495606_0034558
1099 Ga0495610_0070856
1100 Ga0495654_0000083
1101 Ga0495656_0010866
1102 Ga0495668_0050607
1103 Ga0495625_0065234
1104 Ga0495625_0116984
1105 Ga0495635_0126460
1106 Ga0495649_0093190
1107 Ga0495600_0111463
1108 Ga0495687_091668
1109 Ga0495681_0050258
1110 Ga0495686_0001854
1111 Ga0495686_0045831
1112 Ga0495615_0004474
1113 Ga0496101_0068665
1114 Ga0496101_0078387
1115 Ga0496102_0028396
1116 Ga0496102_0101093
1117 Ga0496111_0000515
1118 Ga0496111_0259358
1119 Ga0496112_0089216
1120 Ga0496112_0403401
1121 Ga0496116_0000105
1122 Ga0496116_0004457
1123 Ga0496116_0015332
1124 Ga0496116_0018029
1125 Ga0496116_0020764
1126 Ga0496116_0045041
1127 Ga0496116_0058111
1128 Ga0496117_0002822
1129 Ga0496117_0007744
1130 Ga0496117_0013159
1131 Ga0496118_0001151
1132 Ga0496118_0005439
1133 Ga0496118_0011995
1134 Ga0496118_0040895
1135 Ga0496119_0004810
1136 Ga0496119_0012326
1137 Ga0496119_0056424
1138 Ga0496119_0063054
1139 Ga0496120_0001625
1140 Ga0496120_0007332
1141 Ga0496121_0003571
1142 Ga0496121_0005249
1143 Ga0496121_0006258
1144 Ga0496121_0023594
1145 Ga0496121_0026968
1146 Ga0496121_0028920
1147 Ga0496121_0053392
1148 Ga0496122_0000157
1149 Ga0496122_0011770
1150 Ga0496122_0027825
1151 Ga0496122_0028698
1152 Ga0496122_0078594
1153 Ga0496123_0000048
1154 Ga0496123_0006482
1155 Ga0496123_0007439
1156 Ga0496123_0020766
1157 Ga0496123_0050172
1158 Ga0496124_0002089
1159 Ga0496124_0006013
1160 Ga0496124_0015984
1161 Ga0496124_0021918
1162 Ga0496124_0042668
1163 Ga0496124_0058468
1164 Ga0496124_0136772
1165 Ga0496125_0025240
1166 Ga0496125_0026245
1167 Ga0496125_0094884
1168 Ga0496125_0153950
1169 Ga0496126_0100750
1170 Ga0496126_0103580
1171 Ga0496126_0114595
1172 Ga0501031_0000274
1173 Ga0501031_0020216
1174 Ga0501031_0023879
1175 Ga0501032_0000024
1176 Ga0501032_0000597
1177 Ga0501032_0005031
1178 Ga0501032_0102261
1179 Ga0501033_0000189
1180 Ga0501033_0000365
1181 Ga0501033_0001767
1182 Ga0501033_0003117
1183 Ga0501033_0003350
1184 Ga0501033_0009793
1185 Ga0501033_0167104
1186 Ga0501034_0000317
1187 Ga0501034_0002140
1188 Ga0501034_0004533
1189 Ga0501034_0012803
1190 Ga0501034_0015236
1191 Ga0501034_0050683
1192 Ga0501034_0362763
1193 Ga0501036_0000396
1194 Ga0501036_0000460
1195 Ga0501037_0000186
1196 Ga0501037_0000363
1197 Ga0501037_0000934
1198 Ga0501037_0026795
1199 Ga0501038_0000022
1200 Ga0501038_0000064
1201 Ga0501038_0014971
1202 Ga0501038_0042256
1203 Ga0501038_0064226
1204 Ga0501039_0000017
1205 Ga0501039_0000030
1206 Ga0501040_0018778
1207 Ga0501042_0034230
1208 Ga0501043_0000050
1209 Ga0501043_0000544
1210 Ga0501043_0001343
1211 Ga0501043_0250940
1212 Ga0501046_0008673
1213 Ga0501047_0006511
1214 Ga0501047_0030273
1215 Ga0501047_0040214
1216 Ga0501047_0077229
1217 Ga0501047_0169808
1218 Ga0501048_0013328
1219 Ga0501067_0053789
1220 Ga0501067_0100427
1221 Ga0501068_0027017
1222 Ga0501068_0164340
1223 Ga0501069_0038792
1224 Ga0501070_0000174
1225 Ga0501070_0001512
1226 Ga0501070_0001911
1227 Ga0501070_0009613
1228 Ga0501070_0137351
1229 Ga0501070_0159450
1230 Ga0501071_0006176
1231 Ga0501071_0045420
1232 Ga0501071_0177716
1233 Ga0501072_0028094
1234 Ga0501073_0020107
1235 Ga0501073_0069668
1236 Ga0501073_0094968
1237 Ga0501074_0000015
1238 Ga0501074_0025441
1239 Ga0501074_0034658
1240 Ga0501074_0071732
1241 Ga0501075_0017649
1242 Ga0501076_0051456
1243 Ga0501077_0056480
1244 Ga0501079_0030186
1245 Ga0501080_0006094
1246 Ga0501080_0011270
1247 Ga0501080_0012119
1248 Ga0501080_0048661
1249 Ga0501083_0000697
1250 Ga0501083_0102070
1251 Ga0501083_0162988
1252 Ga0501280_000846
1253 Ga0501035_0000021
1254 Ga0501035_0000065
1255 Ga0501035_0000070
1256 Ga0501035_0001047
1257 Ga0501035_0001622
1258 Ga0501035_0002360
1259 Ga0501035_0113320
1260 Ga0501035_0127835
1261 Ga0501044_0000037
1262 Ga0501044_0000043
1263 Ga0501044_0014501
1264 Ga0501044_0028296
1265 Ga0501044_0053288
1266 Ga0501044_0063944
1267 Ga0501044_0067498
1268 Ga0501045_0011306
1269 nmdc:mga03683_23137_c1
1270 nmdc:mga03n38_10228_c1
1271 nmdc:mga00v17_24208_c1
1272 nmdc:mga0yw44_21518_c1
1273 nmdc:mga0yw44_58729_c1
1274 nmdc:mga0yw44_63067_c1
1275 nmdc:mga06z11_22696_c1
1276 nmdc:mga05p37_40823_c1
1277 nmdc:mga05p37_42426_c1
1278 nmdc:mga05p37_510890_c1
1279 nmdc:mga09592_131367_c1
1280 nmdc:mga09592_9435_c1
1281 nmdc:mga0qj67_18493_c1
1282 nmdc:mga06r32_144136_c1
1283 nmdc:mga06r32_21243_c1
1284 nmdc:mga08y16_19247_c1
1285 nmdc:mga08y16_83979_c1
1286 nmdc:mga0n895_450_c1
1287 nmdc:mga0rr50_47889_c1
1288 nmdc:mga0a205_1149_c1
1289 Ga0500643_017106
1290 Ga0500644_0006015
1291 Ga0500607_072055
1292 Ga0500618_000374
1293 Ga0500618_002801
1294 Ga0500618_010488
1295 Ga0500568_0000054
1296 Ga0500590_007124
1297 Ga0500604_0033986
1298 Ga0500616_0000309
1299 Ga0500620_001495
1300 Ga0500622_0000399
1301 Ga0500622_0024007
1302 Ga0500624_001261
1303 Ga0500634_0011741
1304 Ga0500636_0117321
1305 Ga0500611_005172
1306 Ga0501084_0166099
1307 Ga0501082_0042247
1308 Ga0501082_0182974
1309 2758642233
1310 2503200259
1311 2509115103
1312 2509139496
1313 2509372207
1314 2509391803
1315 2509395074
1316 2509447341
1317 2510134179
1318 2510314194
1319 2511171623
1320 2511390163
1321 2512932373
1322 2512960377
1323 2513608499
1324 2513925181
1325 2513997685
1326 2514018073
1327 2514034517
1328 2514420339
1329 2514587680
1330 2515113346
1331 2517077310
1332 2520377030
1333 2524458857
1334 2535485261
1335 2561469267
1336 2585167441
1337 2585201994
1338 2585265666
1339 2585279293
1340 2585323103
1341 2585331215
1342 2585388871
1343 2585395430
1344 2585524738
1345 2585531223
1346 2585552854
1347 2585843473
1348 2588518441
1349 2597812262
1350 2599417088
1351 2599721612
1352 2599936262
1353 2616311034
1354 2616554472
1355 2617384834
1356 2643773839
1357 2643776450
1358 2643794897
1359 2643804198
1360 2643839176
1361 2643985510
1362 2644050236
1363 2644065028
1364 2644129740
1365 2644158350
1366 2644204702
1367 2644298907
1368 2644376563
1369 2644416701
1370 2644449741
1371 2644483156
1372 2644494312
1373 2644497803
1374 2644657136
1375 2644689873
1376 2671111209
1377 2688597438
1378 2694628532
1379 2694637555
1380 2719182020
1381 2719666380
1382 2719732736
1383 2720492800
1384 2720614267
1385 2720621036
1386 2720632359
1387 2720776087
1388 2721148111
1389 2721159563
1390 2721164947
1391 2722841117
1392 2723027686
1393 2723561314
1394 2723567937
1395 2723574655
1396 2724045492
1397 2724090694
1398 2724105202
1399 2724111030
1400 2730108622
1401 2730165255
1402 2730299195
1403 2738800322
1404 2738944070
1405 2739310033
1406 2753359913
1407 2756671723
1408 2765466511
1409 2770196971
1410 2776270421
1411 2776281660
1412 2776914191
1413 2778175654
1414 2792751928
1415 2793294210
1416 2793315866
1417 2793319402
1418 2793335446
1419 2793339496
1420 2793347027
1421 2793367669
1422 2805926849
1423 2805932762
1424 2819241085
1425 2819609361
1426 2819641327
1427 2821125738
1428 2837654661
1429 2838021679
1430 2838023629
1431 2838033379
1432 2838038706
1433 2838053327
1434 2838065445
1435 2838069925
1436 2838661372
1437 2838670585
1438 2838686816
1439 2838702956
1440 2838730226
1441 2838737811
1442 2838742759
1443 2839997509
1444 2840768983
1445 2841738269
1446 2841841820
1447 2841854644
1448 2841867183
1449 2842141599
1450 2842147786
1451 2842158336
1452 2842181952
1453 2842195832
1454 2842199143
1455 2842209590
1456 2842230049
1457 2842243938
1458 2842252852
1459 2842257977
1460 2842269510
1461 2842271646
1462 2842283044
1463 2842285382
1464 2842298207
1465 2842313996
1466 2842319764
1467 2842348458
1468 2842360193
1469 2842368319
1470 2842400118
1471 2842402742
1472 2842409887
1473 2842416535
1474 2842423539
1475 2842430488
1476 2842436700
1477 2842443458
1478 2842449328
1479 2842466742
1480 2842471430
1481 2842479955
1482 2842483845
1483 2842492293
1484 2842497846
1485 2842505260
1486 2842514269
1487 2842522071
1488 2842872154
1489 2844012815
1490 2844458113
1491 2847675162
1492 2847691338
1493 2854912570
1494 2856315028
1495 2856323341
1496 2856329352
1497 2856336460
1498 2856347251
1499 2856352928
1500 2856357193
1501 2856368218
1502 2857351591
1503 2857370379
1504 2857532299
1505 2869164042
1506 2869174652
1507 2869239104
1508 2869247171
1509 2869249990
1510 2869263880
1511 2869269967
1512 2869277371
1513 2869282820
1514 2869290163
1515 2871432447
1516 2871437941
1517 2871448198
1518 2871453153
1519 2871464790
1520 2871470966
1521 2871474691
1522 2871486580
1523 2871493068
1524 2871502476
1525 2874108758
1526 2874111546
1527 2874117451
1528 2874126958
1529 2874137487
1530 2874142480
1531 2874152413
1532 2874159814
1533 2874162782
1534 2874168865
1535 2876367595
1536 2876383157
1537 2876392810
1538 2876393887
1539 2876405136
1540 2876413523
1541 2876418330
1542 2876422274
1543 2878042271
1544 2878736239
1545 2878744336
1546 2878750061
1547 2878757113
1548 2878766368
1549 2878773564
1550 2878778782
1551 2878787131
1552 2881150161
1553 2881161270
1554 2881166995
1555 2881848200
1556 2881859477
1557 2881861753
1558 2882640771
1559 2882918472
1560 2885308514
1561 2885312701
1562 2885320479
1563 2885331295
1564 2885338103
1565 2885343163
1566 2885353731
1567 2888338503
1568 2888346006
1569 2888355314
1570 2889010293
1571 2889018041
1572 2889919911
1573 2894655720
1574 2899806236
1575 2903450373
1576 2903500840
1577 2903505121
1578 2903518645
1579 2903521888
1580 2903528265
1581 2903547517
1582 2904582091
1583 2904660218
1584 2906312419
1585 2906325128
1586 2906330475
1587 2906357966
1588 2906365229
1589 2906377753
1590 2906384286
1591 2906390974
1592 2906397919
1593 2906406941
1594 2906408745
1595 2906419672
1596 2906427916
1597 2913313580
1598 2915653292
1599 2919123131
1600 2919410223
1601 2922135435
1602 2922152397
1603 2922163459
1604 2922175443
1605 2922180858
1606 2922190606
1607 2924722352
1608 2924728165
1609 2924737686
1610 2924743048
1611 2924749451
1612 2924762214
1613 2924766247
1614 2924782366
1615 2924786416
1616 2928524085
1617 2933023530
1618 2933600731
1619 2936371809
1620 2936379644
1621 2936387814
1622 2937819437
1623 2937825190
1624 2937851018
1625 2937862023
1626 2937874223
1627 2937880907
1628 2937897633
1629 2937977101
1630 2937987485
1631 2938001392
1632 2938016584
1633 2954013031
1634 2958039603
1635 2958052768
1636 2958065137
1637 2958088537
1638 2958094529
1639 2958105898
1640 2958110492
1641 2958116508
1642 2958127088
1643 2958134551
1644 2958140281
1645 2958148750
1646 2958158655
1647 2958171546
1648 2958174782
1649 2958181032
1650 2961078868
1651 2961115543
1652 2961133359
1653 2961139596
1654 2961169987
1655 2961175558
1656 2961186683
1657 2963646832
1658 2965024738
1659 2965029677
1660 2965034605
1661 2965046107
1662 2965052120
1663 2965063078
1664 2965091412
1665 2965107661
1666 2965116101
1667 2965122516
1668 2967999386
1669 2968007798
1670 2968020931
1671 2968088367
1672 2968094979
1673 2968102015
1674 2968111276
1675 2968119544
1676 2968130538
1677 2968142502
1678 2968178379
1679 2970474228
1680 2970494952
1681 2970508146
1682 2970511525
1683 2970527537
1684 2970537956
1685 2970554245
1686 2970561224
1687 2970597429
1688 2970625924
1689 2970628758
1690 2977826272
1691 2977832625
1692 2977848207
1693 2977852724
1694 2977861593
1695 2977872637
1696 2977874019
1697 2977903372
1698 2977914131
1699 2977915852
1700 2977927429
1701 2977936467
1702 2977944574
1703 2977955655
1704 2977958517
1705 2977978903
1706 2977990922
1707 2979717463
1708 2979749015
1709 2979770432
1710 2979773421
1711 2979784214
1712 2979795387
1713 2979813330
1714 2984590187
1715 2987638775
1716 2987647218
1717 2987658807
1718 2987666228
1719 2987670828
1720 2987674214
1721 2989779469
1722 2996314453
1723 2996339836
1724 2996342295
1725 2996352438
1726 2996390224
1727 3000139800
1728 3002144978
1729 3004167865
1730 3004195234
1731 3004203571
1732 3004204982
1733 3004215241
1734 3004220717
1735 3004233330
1736 3004244080
1737 3004254645
1738 3004275476
1739 3004279120
1740 3004335506
1741 3005418956
1742 637075471
1743 649871988
1744 8002289391
1745 8004302894
1746 8004314115
1747 8004366794
1748 8004378688
1749 8004392369
1750 8004398133
1751 8004451438
1752 8004644898
1753 8004696406
1754 8004705441
1755 8004718678
1756 8004731715
1757 8005249923
1758 8005284592
1759 8005295741
1760 8005318152
1761 8005381159
1762 8005437507
1763 8005464030
1764 8005488970
1765 8005501120
1766 8005561449
1767 8005568227
1768 8005622488
1769 8005629989
1770 8005646052
1771 8005658843
1772 8005672538
1773 8005682663
1774 8005697637
1775 8018151331
1776 8018164341
1777 8024488267
1778 8024504659
1779 8054562181
1780 8055619736
1781 8056377614
1782 8056386263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10095

DUF2333

Uncharacterized protein conserved in bacteria (DUF2333)

310

417

0.86

PF10095

DUF2333

Uncharacterized protein conserved in bacteria (DUF2333)

139

317

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kvp-assembly1.cif.gz_A solution structure of the r10 domain of talin 0.4864 245 378
2kvp-assembly1.cif.gz_A solution structure of the r10 domain of talin 0.3847 245 378
6jmu-assembly2.cif.gz_B crystal structure of git1/paxillin complex 0.3777 252 374
6jmu-assembly2.cif.gz_B crystal structure of git1/paxillin complex 0.3432 252 374
7y5g-assembly1.cif.gz_A cryo-em structure of a eukaryotic znt8 in the presence of zinc 0.2989 159 376
ID Description Score Start End Superfamily
af_Q93483_1_234_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5831 244 371 1.20.1270.60
af_A0A286YA76_825_961_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5007 252 378 1.20.120.230
af_C4J5U5_34_257_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.463 252 376 1.20.1250.20
af_K7MEX1_94_281_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4599 245 379 1.20.120.1770
af_A0A286YA76_825_961_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4466 252 378 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A528TW73-F1-model_v4 DUF2333 family protein 0.9783 289 376
AF-H4F9R5-F1-model_v4 DUF2333 family protein 0.973 151 376
AF-A0A256FDI3-F1-model_v4 DUF2333 family protein 0.9643 44 376
AF-A0A527GBF7-F1-model_v4 DUF2333 family protein 0.962 148 337
AF-H4F9R5-F1-model_v4 DUF2333 family protein 0.9604 151 376

Map