F484884

General Info

Members Datasets Scaffolds Average Seq Length
892 424 862 407

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001159|Ga0105240_1000115945
Length 437
Sequence MLQNGARLAALPCIHPDCNLRLQLTFYVITMNAPLSASSSLFTAIEMAPRDPILGITEGFNADKNPGKTNLGVGVYYDDNGKVPLLECVKKAEAELAAKLAPRTYLPIDGLATYDKAVQELVFGADSAVVQEKRAITVQALGGTGALKLGADFLKHFSPAGTQVWISDPSWENHRALFEMAGFTVNNYPYYDAATRGVNFAGMLDALKTMASGSVVLLHACCHNPTGADLTADQWTQVIEVVTSRGLIPFLDMAYQGFGDGIEEDGKVVRRFAEAGGPLFVSNSFSKSFSLYGERVGALSIVASSNEEAARVLSQLKRVVRTNYSNPPIHGGQVVATALASPELRALWERELAEMRVRIREMRQLLVAKLKEKAPAHDFDFVIKQRGMFSYSGLTKAQVERLRNEFSIYAVDTGRICVAALNTKNIDAVVDAIAKVL

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
5 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
6 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
7 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
8 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
9 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
10 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
11 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
12 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
13 2818991446 Variovorax sp. 1180 Isolate Unclassified
14 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
15 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
16 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
17 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
18 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
19 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
20 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
21 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
22 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
23 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
24 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
25 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
26 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
27 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
28 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
29 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
30 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
31 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
32 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
33 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
34 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
35 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
38 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
71 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
72 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
73 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
74 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
75 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
94 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
104 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
107 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
113 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
114 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
115 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
128 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
129 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
130 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
131 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
165 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
166 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
172 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
174 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
175 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
177 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
250 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
254 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
255 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
256 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
257 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
258 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
259 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
260 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
266 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
267 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
272 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
277 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
279 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
282 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
284 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
285 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
286 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
287 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
288 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
289 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
290 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
291 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
292 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
296 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
297 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
298 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
299 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
300 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
301 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
302 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
303 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
304 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
307 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
310 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
315 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
316 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
320 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
321 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
322 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
323 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
326 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
329 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
330 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
331 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
332 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
333 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
334 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
345 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
346 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
350 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
351 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
352 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
353 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
354 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
355 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
356 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
362 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
363 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
366 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
370 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
387 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
388 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
389 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
390 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
391 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
392 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
393 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
394 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
395 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
399 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
402 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
403 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
404 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
405 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
406 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
407 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
408 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
409 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
410 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
411 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
412 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
413 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
414 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
415 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
416 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
417 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
418 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
419 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
420 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.08
Metatranscriptomes 0.56
Isolates 3.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 0.56
Rhizoplane 1.46
Rhizosphere 90.81
Stem 0
Stem Tuber 0
Unclassified 4.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1003320 3300001976 Bacteria 2121
2 JGI25155J39150_1001225 3300002704 Bacteria 2142
3 JGI25155J39150_1001229 3300002704 Bacteria 2133
4 JGI25156J39149_1010718 3300002705 Bacteria 2133
5 JGI25154J39366_1000191 3300002738 Bacteria 45381
6 JGI25154J39366_1000480 3300002738 Bacteria 20794
7 JGI25157J39369_1000104 3300002741 Bacteria 72176
8 rootH1_10206713 3300003323 Bacteria 3605
9 Ga0055538_1000030 3300003751 Bacteria 200831
10 Ga0055539_1000040 3300003752 Bacteria 200831
11 Ga0055533_1000050 3300003756 Bacteria 200831
12 Ga0055532_1000015 3300003758 Bacteria 340197
13 Ga0055525_1000060 3300003759 Bacteria 200831
14 Ga0055531_10002446 3300003794 Bacteria 12429
15 Ga0055541_1000027 3300003841 Bacteria 200831
16 Ga0070658_10042776 3300005327 Bacteria 3659
17 Ga0070658_10069033 3300005327 Bacteria 2891
18 Ga0070658_10199760 3300005327 Bacteria 1687
19 Ga0070676_10026728 3300005328 Bacteria 3268
20 Ga0070683_100008026 3300005329 Bacteria 8960
21 Ga0070683_100026330 3300005329 Bacteria 5235
22 Ga0070683_100093821 3300005329 Bacteria 2820
23 Ga0070683_100196290 3300005329 Bacteria 1916
24 Ga0070690_100001105 3300005330 Bacteria 13870
25 Ga0070690_100001269 3300005330 Bacteria 13108
26 Ga0070690_100011220 3300005330 Bacteria 5237
27 Ga0070690_100040592 3300005330 Bacteria 2944
28 Ga0070670_100001864 3300005331 Bacteria 17178
29 Ga0070670_100030573 3300005331 Bacteria 4637
30 Ga0070670_100055921 3300005331 Bacteria 3386
31 Ga0070670_100091813 3300005331 Bacteria 2611
32 Ga0070670_100134088 3300005331 Bacteria 2139
33 Ga0070677_10009478 3300005333 Bacteria 3302
34 Ga0068869_100013703 3300005334 Bacteria 5401
35 Ga0068869_100018160 3300005334 Bacteria 4782
36 Ga0068869_100023519 3300005334 Bacteria 4256
37 Ga0070666_10005718 3300005335 Bacteria 7630
38 Ga0070666_10006786 3300005335 Bacteria 7051
39 Ga0070666_10063171 3300005335 Bacteria 2509
40 Ga0070666_10134793 3300005335 Bacteria 1717
41 Ga0070680_100002623 3300005336 Bacteria 13314
42 Ga0070680_100111719 3300005336 Bacteria 2275
43 Ga0070682_100003932 3300005337 Bacteria 8247
44 Ga0070682_100196090 3300005337 Bacteria 1421
45 Ga0068868_100000248 3300005338 Bacteria 36775
46 Ga0068868_100006459 3300005338 Bacteria 8298
47 Ga0068868_100107819 3300005338 Bacteria 2261
48 Ga0068868_100146417 3300005338 Bacteria 1942
49 Ga0068868_100185198 3300005338 Bacteria 1729
50 Ga0070660_100036493 3300005339 Bacteria 3724
51 Ga0070660_100108394 3300005339 Bacteria 2207
52 Ga0070689_100056782 3300005340 Bacteria 3036
53 Ga0070691_10071661 3300005341 Bacteria 1682
54 Ga0070687_100000174 3300005343 Bacteria 22203
55 Ga0070687_100010369 3300005343 Bacteria 4028
56 Ga0070661_100002911 3300005344 Bacteria 11794
57 Ga0070661_100005962 3300005344 Bacteria 8386
58 Ga0070661_100041448 3300005344 Bacteria 3360
59 Ga0070661_100048336 3300005344 Bacteria 3114
60 Ga0070661_100063541 3300005344 Bacteria 2711
61 Ga0070661_100115397 3300005344 Bacteria 2008
62 Ga0070661_100209646 3300005344 Bacteria 1491
63 Ga0070661_100229722 3300005344 Bacteria 1426
64 Ga0070692_10001675 3300005345 Bacteria 8197
65 Ga0070692_10004443 3300005345 Bacteria 5865
66 Ga0070692_10019700 3300005345 Bacteria 3260
67 Ga0070668_100026383 3300005347 Bacteria 4409
68 Ga0070668_100058146 3300005347 Bacteria 2991
69 Ga0070668_100163089 3300005347 Bacteria 1810
70 Ga0070668_100168113 3300005347 Bacteria 1784
71 Ga0070668_100325493 3300005347 Bacteria 1295
72 Ga0070669_100074012 3300005353 Bacteria 2525
73 Ga0070669_100234163 3300005353 Bacteria 1457
74 Ga0070675_100003564 3300005354 Bacteria 11829
75 Ga0070675_100027326 3300005354 Bacteria 4584
76 Ga0070675_100041586 3300005354 Bacteria 3755
77 Ga0070675_100212672 3300005354 Bacteria 1681
78 Ga0070671_100008147 3300005355 Bacteria 8387
79 Ga0070671_100110669 3300005355 Bacteria 2307
80 Ga0070674_100025562 3300005356 Bacteria 3846
81 Ga0070674_100044869 3300005356 Bacteria 3017
82 Ga0070674_100049805 3300005356 Bacteria 2882
83 Ga0070674_100050233 3300005356 Bacteria 2870
84 Ga0070674_100087970 3300005356 Bacteria 2235
85 Ga0070674_100127207 3300005356 Bacteria 1895
86 Ga0070674_100263459 3300005356 Viruses 1359
87 Ga0070673_100007890 3300005364 Bacteria 7055
88 Ga0070673_100074411 3300005364 Bacteria 2737
89 Ga0070688_100010185 3300005365 Bacteria 5175
90 Ga0070688_100018508 3300005365 Bacteria 4020
91 Ga0070659_100001405 3300005366 Bacteria 17367
92 Ga0070659_100009086 3300005366 Bacteria 7291
93 Ga0070659_100048477 3300005366 Bacteria 3337
94 Ga0070659_100069662 3300005366 Bacteria 2793
95 Ga0070659_100079596 3300005366 Bacteria 2615
96 Ga0070667_100029329 3300005367 Bacteria 4583
97 Ga0070667_100322758 3300005367 Bacteria 1393
98 Ga0070703_10012077 3300005406 Bacteria 2446
99 Ga0070714_100004937 3300005435 Bacteria 10138
100 Ga0070714_100044774 3300005435 Bacteria 3747
101 Ga0070714_100133240 3300005435 Bacteria 2222
102 Ga0070713_100059304 3300005436 Bacteria 3196
103 Ga0070713_100098605 3300005436 Bacteria 2527
104 Ga0070710_10022467 3300005437 Bacteria 3299
105 Ga0070710_10146780 3300005437 Bacteria 1451
106 Ga0070701_10001316 3300005438 Bacteria 9144
107 Ga0070701_10004921 3300005438 Bacteria 5468
108 Ga0070701_10083175 3300005438 Bacteria 1737
109 Ga0070705_100001553 3300005440 Bacteria 12035
110 Ga0070705_100060945 3300005440 Bacteria 2240
111 Ga0070700_100002982 3300005441 Bacteria 8685
112 Ga0070700_100042156 3300005441 Bacteria 2801
113 Ga0070700_100077756 3300005441 Bacteria 2134
114 Ga0070694_100000640 3300005444 Bacteria 19291
115 Ga0070663_100051824 3300005455 Bacteria 2925
116 Ga0070678_100030786 3300005456 Bacteria 3693
117 Ga0070678_100124191 3300005456 Bacteria 2040
118 Ga0070678_100145135 3300005456 Bacteria 1904
119 Ga0070681_10006372 3300005458 Bacteria 11470
120 Ga0070681_10006813 3300005458 Bacteria 11119
121 Ga0070681_10018828 3300005458 Bacteria 6910
122 Ga0070681_10030114 3300005458 Bacteria 5445
123 Ga0070681_10036353 3300005458 Bacteria 4945
124 Ga0070681_10157994 3300005458 Bacteria 2191
125 Ga0068867_100001768 3300005459 Bacteria 15036
126 Ga0068867_100004416 3300005459 Bacteria 9889
127 Ga0068867_100020346 3300005459 Bacteria 4729
128 Ga0068867_100053305 3300005459 Bacteria 2987
129 Ga0068867_100099615 3300005459 Bacteria 2217
130 Ga0068867_100119422 3300005459 Bacteria 2035
131 Ga0070685_10002126 3300005466 Bacteria 10235
132 Ga0070706_100035302 3300005467 Bacteria 4618
133 Ga0070706_100069013 3300005467 Bacteria 3269
134 Ga0070706_100100127 3300005467 Bacteria 2692
135 Ga0070706_100119845 3300005467 Bacteria 2452
136 Ga0070707_100098030 3300005468 Bacteria 2839
137 Ga0070707_100180343 3300005468 Bacteria 2059
138 Ga0070707_100205719 3300005468 Bacteria 1918
139 Ga0070698_100106399 3300005471 Bacteria 2774
140 Ga0070699_100010928 3300005518 Bacteria 7852
141 Ga0070679_100026716 3300005530 Bacteria 5676
142 Ga0070679_100123561 3300005530 Bacteria 2572
143 Ga0070679_100135837 3300005530 Bacteria 2440
144 Ga0070679_100139345 3300005530 Bacteria 2406
145 Ga0070684_100023441 3300005535 Bacteria 5163
146 Ga0070684_100038983 3300005535 Bacteria 4085
147 Ga0070684_100044391 3300005535 Bacteria 3844
148 Ga0070684_100054381 3300005535 Bacteria 3488
149 Ga0070697_100009963 3300005536 Bacteria 7416
150 Ga0070697_100127121 3300005536 Bacteria 2135
151 Ga0068853_100023977 3300005539 Bacteria 5114
152 Ga0068853_100029086 3300005539 Bacteria 4654
153 Ga0068853_100097097 3300005539 Bacteria 2600
154 Ga0068853_100100021 3300005539 Bacteria 2562
155 Ga0068853_100289300 3300005539 Bacteria 1512
156 Ga0070672_100010958 3300005543 Bacteria 6309
157 Ga0070672_100039307 3300005543 Bacteria 3623
158 Ga0070686_100002477 3300005544 Bacteria 10164
159 Ga0070686_100002620 3300005544 Bacteria 9920
160 Ga0070686_100070789 3300005544 Bacteria 2281
161 Ga0070695_100002755 3300005545 Bacteria 10193
162 Ga0070695_100018639 3300005545 Bacteria 4215
163 Ga0070695_100038602 3300005545 Bacteria 3014
164 Ga0070695_100055355 3300005545 Bacteria 2556
165 Ga0070696_100119446 3300005546 Bacteria 1906
166 Ga0070693_100000080 3300005547 Bacteria 40022
167 Ga0070693_100010781 3300005547 Bacteria 4586
168 Ga0070665_100004969 3300005548 Bacteria 13785
169 Ga0070665_100006564 3300005548 Bacteria 11828
170 Ga0070665_100195446 3300005548 Bacteria 2024
171 Ga0070704_100000771 3300005549 Bacteria 15797
172 Ga0070704_100001040 3300005549 Bacteria 14318
173 Ga0068855_100004066 3300005563 Bacteria 17854
174 Ga0068855_100005360 3300005563 Bacteria 15644
175 Ga0068855_100008469 3300005563 Bacteria 12437
176 Ga0068855_100019016 3300005563 Bacteria 8257
177 Ga0068855_100120936 3300005563 Bacteria 2997
178 Ga0068855_100206001 3300005563 Bacteria 2213
179 Ga0068855_100288881 3300005563 Bacteria 1818
180 Ga0070664_100013598 3300005564 Bacteria 6631
181 Ga0070664_100038834 3300005564 Bacteria 4009
182 Ga0070664_100041725 3300005564 Bacteria 3872
183 Ga0070664_100072205 3300005564 Bacteria 2959
184 Ga0070664_100137256 3300005564 Bacteria 2151
185 Ga0070664_100204365 3300005564 Bacteria 1763
186 Ga0068857_100002553 3300005577 Bacteria 14914
187 Ga0068857_100136170 3300005577 Bacteria 2217
188 Ga0068857_100207739 3300005577 Bacteria 1786
189 Ga0068854_100001135 3300005578 Bacteria 16011
190 Ga0068854_100058275 3300005578 Bacteria 2787
191 Ga0068856_100003437 3300005614 Bacteria 16010
192 Ga0068856_100009915 3300005614 Bacteria 9253
193 Ga0068856_100039912 3300005614 Bacteria 4609
194 Ga0068856_100049225 3300005614 Bacteria 4154
195 Ga0068856_100056071 3300005614 Bacteria 3888
196 Ga0068856_100068242 3300005614 Bacteria 3514
197 Ga0068856_100422790 3300005614 Bacteria 1352
198 Ga0070702_100000077 3300005615 Bacteria 28226
199 Ga0070702_100063416 3300005615 Bacteria 2158
200 Ga0068852_100195764 3300005616 Bacteria 1910
201 Ga0068852_100237701 3300005616 Bacteria 1739
202 Ga0068859_100001882 3300005617 Bacteria 21378
203 Ga0068859_100004368 3300005617 Bacteria 14419
204 Ga0068859_100005815 3300005617 Bacteria 12527
205 Ga0068859_100131980 3300005617 Bacteria 2570
206 Ga0068864_100041930 3300005618 Bacteria 3915
207 Ga0068864_100055952 3300005618 Bacteria 3408
208 Ga0068864_100111160 3300005618 Bacteria 2441
209 Ga0068864_100130887 3300005618 Bacteria 2253
210 Ga0068864_100202369 3300005618 Bacteria 1825
211 Ga0068864_100211282 3300005618 Bacteria 1787
212 Ga0068866_10000235 3300005718 Bacteria 26083
213 Ga0068866_10001036 3300005718 Bacteria 12234
214 Ga0068866_10003590 3300005718 Bacteria 6352
215 Ga0068866_10004757 3300005718 Bacteria 5570
216 Ga0068861_100001590 3300005719 Bacteria 14459
217 Ga0068861_100003534 3300005719 Bacteria 10391
218 Ga0068851_10028942 3300005834 Bacteria 2739
219 Ga0068851_10056336 3300005834 Bacteria 2004
220 Ga0068870_10003940 3300005840 Bacteria 6336
221 Ga0068863_100010881 3300005841 Bacteria 8821
222 Ga0068863_100018240 3300005841 Bacteria 6719
223 Ga0068863_100039105 3300005841 Bacteria 4514
224 Ga0068863_100133102 3300005841 Bacteria 2374
225 Ga0068863_100136061 3300005841 Bacteria 2347
226 Ga0068858_100001240 3300005842 Bacteria 26338
227 Ga0068858_100005814 3300005842 Bacteria 12049
228 Ga0068858_100019754 3300005842 Bacteria 6298
229 Ga0068858_100029119 3300005842 Bacteria 5127
230 Ga0068858_100054541 3300005842 Bacteria 3696
231 Ga0068858_100064806 3300005842 Bacteria 3382
232 Ga0068860_100005458 3300005843 Bacteria 12889
233 Ga0068862_100001295 3300005844 Bacteria 23374
234 Ga0068862_100048870 3300005844 Bacteria 3612
235 Ga0068862_100069381 3300005844 Bacteria 3042
236 Ga0068862_100140044 3300005844 Bacteria 2146
237 Ga0068862_100180010 3300005844 Bacteria 1897
238 Ga0081539_10028636 3300005985 Bacteria 3499
239 Ga0075368_10004247 3300006042 Bacteria 4839
240 Ga0075363_100014425 3300006048 Bacteria 3861
241 Ga0075363_100063936 3300006048 Bacteria 1987
242 Ga0070716_100006825 3300006173 Bacteria 5595
243 Ga0070716_100081939 3300006173 Bacteria 1928
244 Ga0070716_100116228 3300006173 Bacteria 1666
245 Ga0070712_100173613 3300006175 Bacteria 1674
246 Ga0075362_10005235 3300006177 Bacteria 4731
247 Ga0075366_10022633 3300006195 Bacteria 3658
248 Ga0097621_100007945 3300006237 Bacteria 7612
249 Ga0097621_100018836 3300006237 Bacteria 5284
250 Ga0097621_100020501 3300006237 Bacteria 5093
251 Ga0097621_100083058 3300006237 Bacteria 2669
252 Ga0097621_100140851 3300006237 Bacteria 2061
253 Ga0097621_100291683 3300006237 Bacteria 1438
254 Ga0097621_100322331 3300006237 Bacteria 1369
255 Ga0068871_100001034 3300006358 Bacteria 18634
256 Ga0068871_100002192 3300006358 Bacteria 13269
257 Ga0068871_100005143 3300006358 Bacteria 9143
258 Ga0068871_100007401 3300006358 Bacteria 7840
259 Ga0068871_100122459 3300006358 Bacteria 2198
260 Ga0068871_100221218 3300006358 Bacteria 1640
261 Ga0075428_100140035 3300006844 Bacteria 2630
262 Ga0075430_100000185 3300006846 Bacteria 41854
263 Ga0075430_100077234 3300006846 Bacteria 2791
264 Ga0075431_100025662 3300006847 Bacteria 6040
265 Ga0075433_10019262 3300006852 Bacteria 5683
266 Ga0075434_100005588 3300006871 Bacteria 11454
267 Ga0075434_100067779 3300006871 Bacteria 3555
268 Ga0075434_100230662 3300006871 Bacteria 1871
269 Ga0075429_100000155 3300006880 Bacteria 42828
270 Ga0075429_100002759 3300006880 Bacteria 14847
271 Ga0075429_100052124 3300006880 Bacteria 3560
272 Ga0068865_100001333 3300006881 Bacteria 14363
273 Ga0075436_100001429 3300006914 Bacteria 16228
274 Ga0097620_100001882 3300006931 Bacteria 21378
275 Ga0097620_100004369 3300006931 Bacteria 14419
276 Ga0097620_100005815 3300006931 Bacteria 12527
277 Ga0097620_100131985 3300006931 Bacteria 2570
278 Ga0075435_100007088 3300007076 Bacteria 7960
279 Ga0075435_100209101 3300007076 Bacteria 1655
280 Ga0105244_10043892 3300009036 Bacteria 2305
281 Ga0105250_10000036 3300009092 Bacteria 147009
282 Ga0105240_10001159 3300009093 Bacteria 46178
283 Ga0105240_10010466 3300009093 Bacteria 13036
284 Ga0105240_10025784 3300009093 Bacteria 7720
285 Ga0105240_10034293 3300009093 Bacteria 6547
286 Ga0105240_10234946 3300009093 Bacteria 2128
287 Ga0111539_10017094 3300009094 Bacteria 8978
288 Ga0111539_10103277 3300009094 Bacteria 3345
289 Ga0111539_10148308 3300009094 Bacteria 2746
290 Ga0105245_10000971 3300009098 Bacteria 26167
291 Ga0105245_10004793 3300009098 Bacteria 11939
292 Ga0105245_10007616 3300009098 Bacteria 9481
293 Ga0105245_10170410 3300009098 Bacteria 2073
294 Ga0105245_10244277 3300009098 Bacteria 1742
295 Ga0105245_10338833 3300009098 Bacteria 1486
296 Ga0114129_10000710 3300009147 Bacteria 42045
297 Ga0114129_10130741 3300009147 Bacteria 3448
298 Ga0105243_10001264 3300009148 Bacteria 22719
299 Ga0105241_10063502 3300009174 Bacteria 2850
300 Ga0105241_10110536 3300009174 Bacteria 2199
301 Ga0105242_10000678 3300009176 Bacteria 26735
302 Ga0105242_10001649 3300009176 Bacteria 17647
303 Ga0105242_10025972 3300009176 Bacteria 4638
304 Ga0105242_10157199 3300009176 Bacteria 1987
305 Ga0105248_10005206 3300009177 Bacteria 14330
306 Ga0105248_10011205 3300009177 Bacteria 9889
307 Ga0105248_10243461 3300009177 Bacteria 2024
308 Ga0105237_10025491 3300009545 Bacteria 6047
309 Ga0105237_10056649 3300009545 Bacteria 3923
310 Ga0105237_10211289 3300009545 Bacteria 1940
311 Ga0105238_10003490 3300009551 Bacteria 15647
312 Ga0105238_10017073 3300009551 Bacteria 7367
313 Ga0105238_10166478 3300009551 Bacteria 2180
314 Ga0105249_10001554 3300009553 Bacteria 20143
315 Ga0105249_10121009 3300009553 Bacteria 2487
316 Ga0105239_10012027 3300010375 Bacteria 9651
317 Ga0105239_10049376 3300010375 Bacteria 4614
318 Ga0105239_10138351 3300010375 Bacteria 2712
319 Ga0105246_10012762 3300011119 Bacteria 5250
320 Ga0105246_10067299 3300011119 Bacteria 2509
321 Ga0105246_10109532 3300011119 Bacteria 2026
322 Ga0157373_10016441 3300013100 Bacteria 5397
323 Ga0157373_10017574 3300013100 Bacteria 5210
324 Ga0157373_10046914 3300013100 Bacteria 3082
325 Ga0157373_10051415 3300013100 Bacteria 2935
326 Ga0157371_10000001 3300013102 Bacteria 1162285
327 Ga0157371_10015868 3300013102 Bacteria 5636
328 Ga0157370_10012909 3300013104 Bacteria 8635
329 Ga0157370_10044198 3300013104 Bacteria 4283
330 Ga0157370_10047576 3300013104 Bacteria 4111
331 Ga0157369_10007438 3300013105 Bacteria 12612
332 Ga0157369_10121265 3300013105 Bacteria 2774
333 Ga0157369_10291553 3300013105 Bacteria 1699
334 Ga0157374_10003963 3300013296 Bacteria 12447
335 Ga0157374_10022424 3300013296 Bacteria 5634
336 Ga0157374_10223532 3300013296 Bacteria 1848
337 Ga0157374_10342087 3300013296 Bacteria 1485
338 Ga0157378_10001171 3300013297 Bacteria 23874
339 Ga0157378_10001515 3300013297 Bacteria 21042
340 Ga0157378_10005239 3300013297 Bacteria 11387
341 Ga0157378_10006586 3300013297 Bacteria 10147
342 Ga0157378_10038165 3300013297 Bacteria 4256
343 Ga0157378_10194720 3300013297 Bacteria 1914
344 Ga0157378_10236588 3300013297 Bacteria 1743
345 Ga0163162_10005150 3300013306 Bacteria 12598
346 Ga0163162_10093528 3300013306 Bacteria 3091
347 Ga0163162_10161525 3300013306 Bacteria 2362
348 Ga0157372_10012456 3300013307 Bacteria 9065
349 Ga0157372_10013385 3300013307 Bacteria 8758
350 Ga0157372_10046607 3300013307 Bacteria 4813
351 Ga0157372_10058819 3300013307 Bacteria 4297
352 Ga0157372_10309234 3300013307 Bacteria 1839
353 Ga0157375_10199739 3300013308 Bacteria 2155
354 Ga0157375_10379949 3300013308 Bacteria 1579
355 Ga0163163_10018244 3300014325 Bacteria 6564
356 Ga0163163_10049808 3300014325 Bacteria 4123
357 Ga0157380_10001363 3300014326 Bacteria 15913
358 Ga0157380_10278953 3300014326 Bacteria 1528
359 Ga0182008_10005412 3300014497 Bacteria 7276
360 Ga0157379_10000193 3300014968 Bacteria 47012
361 Ga0157379_10000412 3300014968 Bacteria 34763
362 Ga0157379_10102662 3300014968 Bacteria 2566
363 Ga0157379_10276504 3300014968 Bacteria 1528
364 Ga0157376_10097207 3300014969 Bacteria 2565
365 Ga0157376_10101602 3300014969 Bacteria 2513
366 Ga0157376_10173430 3300014969 Bacteria 1966
367 Ga0163161_10029262 3300017792 Bacteria 3916
368 Ga0163161_10146738 3300017792 Bacteria 1790
369 Ga0213872_10003416 3300021361 Bacteria 8826
370 Ga0209435_100035 3300025206 Bacteria 142907
371 Ga0209784_100005 3300025224 Bacteria 1040422
372 Ga0209566_100005 3300025225 Bacteria 1040422
373 Ga0209674_100009 3300025226 Bacteria 1040422
374 Ga0209147_100004 3300025229 Bacteria 1371850
375 Ga0209563_100012 3300025230 Bacteria 1040422
376 Ga0209437_100045 3300025233 Bacteria 429809
377 Ga0209258_100533 3300025242 Bacteria 36157
378 Ga0209646_1000121 3300025246 Bacteria 144839
379 Ga0209646_1000146 3300025246 Bacteria 104682
380 Ga0209026_1000165 3300025250 Bacteria 101338
381 Ga0209677_100006 3300025253 Bacteria 1040422
382 Ga0209759_1000064 3300025256 Bacteria 193120
383 Ga0209759_1000095 3300025256 Bacteria 158102
384 Ga0207697_10001831 3300025315 Bacteria 11404
385 Ga0207697_10022989 3300025315 Bacteria 2553
386 Ga0207656_10009351 3300025321 Bacteria 3640
387 Ga0207656_10018132 3300025321 Bacteria 2766
388 Ga0207696_1000135 3300025711 Bacteria 129665
389 Ga0207653_10005400 3300025885 Bacteria 3996
390 Ga0207682_10002492 3300025893 Bacteria 8227
391 Ga0207642_10001248 3300025899 Bacteria 7879
392 Ga0207642_10003544 3300025899 Bacteria 4945
393 Ga0207642_10062376 3300025899 Bacteria 1738
394 Ga0207680_10046659 3300025903 Bacteria 2562
395 Ga0207680_10165519 3300025903 Bacteria 1486
396 Ga0207685_10039432 3300025905 Bacteria 1753
397 Ga0207699_10136314 3300025906 Bacteria 1608
398 Ga0207645_10008107 3300025907 Bacteria 7362
399 Ga0207645_10039067 3300025907 Bacteria 3041
400 Ga0207643_10000285 3300025908 Bacteria 35142
401 Ga0207643_10010856 3300025908 Bacteria 4912
402 Ga0207643_10025228 3300025908 Bacteria 3284
403 Ga0207705_10041011 3300025909 Bacteria 3321
404 Ga0207705_10064646 3300025909 Bacteria 2644
405 Ga0207684_10033504 3300025910 Bacteria 4367
406 Ga0207684_10109960 3300025910 Bacteria 2359
407 Ga0207654_10061234 3300025911 Bacteria 2201
408 Ga0207707_10002100 3300025912 Bacteria 18010
409 Ga0207707_10022716 3300025912 Bacteria 5485
410 Ga0207707_10029710 3300025912 Bacteria 4780
411 Ga0207707_10044480 3300025912 Bacteria 3872
412 Ga0207695_10006838 3300025913 Bacteria 14685
413 Ga0207695_10010357 3300025913 Bacteria 11410
414 Ga0207695_10017610 3300025913 Bacteria 8303
415 Ga0207695_10093070 3300025913 Bacteria 3024
416 Ga0207695_10115702 3300025913 Unclassified 2656
417 Ga0207695_10222885 3300025913 Bacteria 1792
418 Ga0207671_10088339 3300025914 Bacteria 2332
419 Ga0207693_10007642 3300025915 Bacteria 8875
420 Ga0207693_10208681 3300025915 Bacteria 1536
421 Ga0207663_10002690 3300025916 Bacteria 8576
422 Ga0207660_10001992 3300025917 Bacteria 13608
423 Ga0207660_10034109 3300025917 Bacteria 3525
424 Ga0207660_10209295 3300025917 Bacteria 1526
425 Ga0207662_10003360 3300025918 Bacteria 8217
426 Ga0207662_10038739 3300025918 Bacteria 2794
427 Ga0207657_10010009 3300025919 Bacteria 9486
428 Ga0207657_10015062 3300025919 Bacteria 7511
429 Ga0207657_10038120 3300025919 Bacteria 4283
430 Ga0207657_10054888 3300025919 Bacteria 3443
431 Ga0207649_10005296 3300025920 Bacteria 6979
432 Ga0207649_10044346 3300025920 Bacteria 2722
433 Ga0207652_10006566 3300025921 Bacteria 9374
434 Ga0207652_10006878 3300025921 Bacteria 9161
435 Ga0207652_10029671 3300025921 Bacteria 4575
436 Ga0207652_10033920 3300025921 Bacteria 4300
437 Ga0207652_10146000 3300025921 Bacteria 2117
438 Ga0207652_10195810 3300025921 Bacteria 1818
439 Ga0207652_10203168 3300025921 Bacteria 1783
440 Ga0207646_10000871 3300025922 Bacteria 38971
441 Ga0207646_10032065 3300025922 Bacteria 4755
442 Ga0207646_10258345 3300025922 Bacteria 1574
443 Ga0207681_10052343 3300025923 Bacteria 2768
444 Ga0207681_10168189 3300025923 Bacteria 1659
445 Ga0207694_10004100 3300025924 Bacteria 11458
446 Ga0207694_10036238 3300025924 Bacteria 3785
447 Ga0207694_10223066 3300025924 Bacteria 1538
448 Ga0207650_10012257 3300025925 Bacteria 5917
449 Ga0207650_10038645 3300025925 Bacteria 3487
450 Ga0207650_10041143 3300025925 Bacteria 3385
451 Ga0207650_10067131 3300025925 Bacteria 2691
452 Ga0207659_10016272 3300025926 Bacteria 4838
453 Ga0207687_10000559 3300025927 Bacteria 25090
454 Ga0207687_10000672 3300025927 Bacteria 23041
455 Ga0207687_10005796 3300025927 Bacteria 8174
456 Ga0207687_10013830 3300025927 Bacteria 5271
457 Ga0207700_10081359 3300025928 Bacteria 2529
458 Ga0207664_10000605 3300025929 Bacteria 24837
459 Ga0207664_10178478 3300025929 Bacteria 1822
460 Ga0207664_10236546 3300025929 Bacteria 1589
461 Ga0207644_10008061 3300025931 Bacteria 6892
462 Ga0207644_10010312 3300025931 Bacteria 6157
463 Ga0207644_10065567 3300025931 Bacteria 2641
464 Ga0207690_10017234 3300025932 Bacteria 4407
465 Ga0207690_10127122 3300025932 Bacteria 1860
466 Ga0207706_10006730 3300025933 Bacteria 10626
467 Ga0207706_10103577 3300025933 Bacteria 2503
468 Ga0207706_10125100 3300025933 Bacteria 2261
469 Ga0207706_10143110 3300025933 Bacteria 2103
470 Ga0207686_10001056 3300025934 Bacteria 16313
471 Ga0207686_10003959 3300025934 Bacteria 7945
472 Ga0207686_10040458 3300025934 Bacteria 2834
473 Ga0207709_10004251 3300025935 Bacteria 8299
474 Ga0207670_10003490 3300025936 Bacteria 8345
475 Ga0207669_10029061 3300025937 Bacteria 3051
476 Ga0207669_10046559 3300025937 Bacteria 2564
477 Ga0207669_10084444 3300025937 Bacteria 2046
478 Ga0207704_10001080 3300025938 Bacteria 12107
479 Ga0207665_10006817 3300025939 Bacteria 7565
480 Ga0207665_10012295 3300025939 Bacteria 5621
481 Ga0207665_10120728 3300025939 Bacteria 1851
482 Ga0207691_10031374 3300025940 Bacteria 4960
483 Ga0207691_10041415 3300025940 Bacteria 4253
484 Ga0207691_10043038 3300025940 Bacteria 4163
485 Ga0207691_10109071 3300025940 Bacteria 2463
486 Ga0207711_10001920 3300025941 Bacteria 18880
487 Ga0207689_10002117 3300025942 Bacteria 18668
488 Ga0207689_10003389 3300025942 Bacteria 14559
489 Ga0207689_10057750 3300025942 Bacteria 3192
490 Ga0207661_10026917 3300025944 Bacteria 4389
491 Ga0207679_10003681 3300025945 Bacteria 9500
492 Ga0207679_10006418 3300025945 Bacteria 7430
493 Ga0207679_10062508 3300025945 Bacteria 2775
494 Ga0207679_10096757 3300025945 Bacteria 2298
495 Ga0207679_10188558 3300025945 Bacteria 1712
496 Ga0207667_10004125 3300025949 Bacteria 17854
497 Ga0207667_10014658 3300025949 Bacteria 8925
498 Ga0207667_10022843 3300025949 Bacteria 6899
499 Ga0207667_10027013 3300025949 Bacteria 6260
500 Ga0207667_10028315 3300025949 Bacteria 6086
501 Ga0207667_10047280 3300025949 Bacteria 4555
502 Ga0207667_10047894 3300025949 Bacteria 4521
503 Ga0207667_10067062 3300025949 Bacteria 3738
504 Ga0207667_10114184 3300025949 Bacteria 2784
505 Ga0207667_10144304 3300025949 Bacteria 2451
506 Ga0207651_10123651 3300025960 Bacteria 1967
507 Ga0207712_10186631 3300025961 Bacteria 1633
508 Ga0207668_10025378 3300025972 Bacteria 3835
509 Ga0207668_10051096 3300025972 Bacteria 2853
510 Ga0207668_10099570 3300025972 Bacteria 2157
511 Ga0207668_10144495 3300025972 Bacteria 1833
512 Ga0207668_10147055 3300025972 Bacteria 1819
513 Ga0207668_10292218 3300025972 Bacteria 1341
514 Ga0207640_10040625 3300025981 Bacteria 2952
515 Ga0207640_10064681 3300025981 Bacteria 2437
516 Ga0207640_10185926 3300025981 Bacteria 1562
517 Ga0207658_10001941 3300025986 Bacteria 15443
518 Ga0207658_10161122 3300025986 Bacteria 1839
519 Ga0207677_10000152 3300026023 Bacteria 55261
520 Ga0207677_10023066 3300026023 Bacteria 3836
521 Ga0207677_10053288 3300026023 Bacteria 2753
522 Ga0207677_10109554 3300026023 Bacteria 2053
523 Ga0207703_10001959 3300026035 Bacteria 18192
524 Ga0207703_10003771 3300026035 Bacteria 12596
525 Ga0207703_10033462 3300026035 Bacteria 4075
526 Ga0207703_10041234 3300026035 Bacteria 3697
527 Ga0207703_10100025 3300026035 Bacteria 2456
528 Ga0207703_10158457 3300026035 Bacteria 1981
529 Ga0207639_10024338 3300026041 Bacteria 4381
530 Ga0207639_10070808 3300026041 Bacteria 2725
531 Ga0207639_10089887 3300026041 Bacteria 2455
532 Ga0207678_10049849 3300026067 Bacteria 3618
533 Ga0207678_10050253 3300026067 Bacteria 3603
534 Ga0207678_10134735 3300026067 Bacteria 2108
535 Ga0207708_10000572 3300026075 Bacteria 28469
536 Ga0207708_10000733 3300026075 Bacteria 24638
537 Ga0207708_10037617 3300026075 Bacteria 3686
538 Ga0207708_10092211 3300026075 Bacteria 2337
539 Ga0207702_10005129 3300026078 Bacteria 11519
540 Ga0207702_10013104 3300026078 Bacteria 6893
541 Ga0207702_10026167 3300026078 Bacteria 4843
542 Ga0207702_10039964 3300026078 Bacteria 3932
543 Ga0207702_10187145 3300026078 Bacteria 1910
544 Ga0207641_10289167 3300026088 Bacteria 1544
545 Ga0207648_10000485 3300026089 Bacteria 44215
546 Ga0207648_10004346 3300026089 Bacteria 14578
547 Ga0207648_10005282 3300026089 Bacteria 13034
548 Ga0207648_10022516 3300026089 Bacteria 5656
549 Ga0207648_10046896 3300026089 Bacteria 3788
550 Ga0207648_10102147 3300026089 Bacteria 2513
551 Ga0207676_10000751 3300026095 Bacteria 25372
552 Ga0207676_10030198 3300026095 Bacteria 4066
553 Ga0207676_10067316 3300026095 Bacteria 2860
554 Ga0207676_10083620 3300026095 Bacteria 2600
555 Ga0207676_10091079 3300026095 Bacteria 2504
556 Ga0207674_10000089 3300026116 Bacteria 99911
557 Ga0207674_10002196 3300026116 Bacteria 24709
558 Ga0207674_10004995 3300026116 Bacteria 15857
559 Ga0207674_10011754 3300026116 Bacteria 9823
560 Ga0207674_10130754 3300026116 Bacteria 2474
561 Ga0207674_10336256 3300026116 Bacteria 1460
562 Ga0207675_100000376 3300026118 Bacteria 42834
563 Ga0207675_100003172 3300026118 Bacteria 16131
564 Ga0207675_100005060 3300026118 Bacteria 12690
565 Ga0207675_100108523 3300026118 Bacteria 2618
566 Ga0207675_100234210 3300026118 Bacteria 1772
567 Ga0207675_100281733 3300026118 Bacteria 1615
568 Ga0207683_10005924 3300026121 Bacteria 10472
569 Ga0207683_10009180 3300026121 Bacteria 8426
570 Ga0207683_10017338 3300026121 Bacteria 6138
571 Ga0207683_10037993 3300026121 Bacteria 4193
572 Ga0207698_10075124 3300026142 Bacteria 2699
573 Ga0207698_10102133 3300026142 Bacteria 2380
574 Ga0207698_10231023 3300026142 Bacteria 1679
575 Ga0209969_1001789 3300027360 Bacteria 2955
576 Ga0209981_1003119 3300027378 Bacteria 2141
577 Ga0210000_1000925 3300027462 Bacteria 4093
578 Ga0209970_1002431 3300027614 Bacteria 3173
579 Ga0209971_1003125 3300027682 Bacteria 3953
580 Ga0209998_10007097 3300027717 Bacteria 2322
581 Ga0209974_10003341 3300027876 Bacteria 5797
582 Ga0209974_10003512 3300027876 Bacteria 5644
583 Ga0207428_10001921 3300027907 Bacteria 21040
584 Ga0207428_10141463 3300027907 Bacteria 1836
585 Ga0268266_10057382 3300028379 Bacteria 3350
586 Ga0268266_10081529 3300028379 Bacteria 2821
587 Ga0268266_10227798 3300028379 Bacteria 1716
588 Ga0268265_10001650 3300028380 Bacteria 18276
589 Ga0268265_10056843 3300028380 Bacteria 2979
590 Ga0268265_10182498 3300028380 Bacteria 1804
591 Ga0268264_10001723 3300028381 Bacteria 20127
592 Ga0268264_10001768 3300028381 Bacteria 19778
593 Ga0268264_10161220 3300028381 Bacteria 2020
594 Ga0307511_10004280 3300030521 Bacteria 14568
595 Ga0265332_10000100 3300031238 Bacteria 74633
596 Ga0265332_10000528 3300031238 Bacteria 26011
597 Ga0265331_10001073 3300031250 Bacteria 21220
598 Ga0265327_10003590 3300031251 Bacteria 14643
599 Ga0265327_10035803 3300031251 Bacteria 2739
600 Ga0307513_10084969 3300031456 Bacteria 3249
601 Ga0307509_10000075 3300031507 Bacteria 139230
602 Ga0316575_10001505 3300031665 Bacteria 7526
603 Ga0316575_10038592 3300031665 Bacteria 1884
604 Ga0307413_10010491 3300031824 Bacteria 4498
605 Ga0307413_10125129 3300031824 Bacteria 1749
606 Ga0307410_10021080 3300031852 Bacteria 4002
607 Ga0307406_10007665 3300031901 Bacteria 5994
608 Ga0307407_10014060 3300031903 Bacteria 3906
609 Ga0307407_10174253 3300031903 Bacteria 1420
610 Ga0307412_10040990 3300031911 Bacteria 2998
611 Ga0307409_100055292 3300031995 Bacteria 3063
612 Ga0307414_10046388 3300032004 Bacteria 2983
613 Ga0316583_10002992 3300032133 Bacteria 5941
614 Ga0316583_10014620 3300032133 Bacteria 2828
615 Ga0316583_10014703 3300032133 Bacteria 2819
616 Ga0373934_0028531 3300035086 Bacteria 2176
617 Ga0373940_0015423 3300035088 Bacteria 1879
618 Ga0373923_0017482 3300035111 Bacteria 2744
619 Ga0373932_0002340 3300035112 Bacteria 4812
620 Ga0373956_0022319 3300035119 Bacteria 2708
621 Ga0373956_0058833 3300035119 Bacteria 1738
622 Ga0373943_0111940 3300035170 Bacteria 1441
623 Ga0373946_0004883 3300035171 Bacteria 4829
624 Ga0373946_0021591 3300035171 Bacteria 2498
625 Ga0373955_0065471 3300035172 Bacteria 2017
626 Ga0373942_0007255 3300035207 Bacteria 2569
627 Ga0373924_0009013 3300035410 Bacteria 3647
628 Ga0373924_0022634 3300035410 Bacteria 2457
629 Ga0373927_0003672 3300035695 Bacteria 10930
630 Ga0373927_0053739 3300035695 Bacteria 2606
631 Ga0373927_0061454 3300035695 Bacteria 2430
632 Ga0373947_0134043 3300035725 Bacteria 1583
633 Ga0373937_0023239 3300036401 Bacteria 5581
634 Ga0373937_0046774 3300036401 Bacteria 3957
635 Ga0373937_0151716 3300036401 Bacteria 2171
636 Ga0316582_0064871 3300036647 Bacteria 2350
637 Ga0373925_0037826 3300037068 Bacteria 3564
638 Ga0373925_0053838 3300037068 Bacteria 3009
639 Ga0395899_0001504 3300037312 Bacteria 19797
640 Ga0395900_0021401 3300037418 Bacteria 6611
641 Ga0395900_0072258 3300037418 Bacteria 3547
642 Ga0395900_0167570 3300037418 Bacteria 2238
643 Ga0395900_0234990 3300037418 Bacteria 1841
644 Ga0395905_0013587 3300037471 Bacteria 7800
645 Ga0395905_0022957 3300037471 Bacteria 5896
646 Ga0395905_0083599 3300037471 Bacteria 2991
647 Ga0316581_0003055 3300037588 Bacteria 4120
648 Ga0395901_0003952 3300038443 Bacteria 14914
649 Ga0395901_0133174 3300038443 Bacteria 2612
650 Ga0436361_0424301 3300039447 Bacteria 5551
651 Ga0436361_0808852 3300039447 Bacteria 3251
652 Ga0436361_1101324 3300039447 Bacteria 10036
653 Ga0451833_0827264 3300041491 Bacteria 1892
654 Ga0451853_1088632 3300041512 Bacteria 3122
655 Ga0451577_0143352 3300042876 Bacteria 2147
656 Ga0466972_0000118 3300044658 Bacteria 66725
657 Ga0466965_0074507 3300044683 Bacteria 1710
658 Ga0466965_0129243 3300044683 Bacteria 1309
659 Ga0466966_0114349 3300044684 Bacteria 1662
660 Ga0453684_0155856 3300044712 Bacteria 2708
661 Ga0453684_0287591 3300044712 Bacteria 1873
662 Ga0466968_0020764 3300044735 Bacteria 2654
663 Ga0466970_0030695 3300044765 Bacteria 2834
664 Ga0466959_0007661 3300045049 Bacteria 7590
665 Ga0451576_0003154 3300045051 Bacteria 23070
666 Ga0451576_0007446 3300045051 Bacteria 13079
667 Ga0451576_0099038 3300045051 Bacteria 3032
668 Ga0466967_0183907 3300045976 Bacteria 1972
669 Ga0495592_0001499 3300046454 Bacteria 16268
670 Ga0495590_0000060 3300046457 Bacteria 89639
671 Ga0495590_0005738 3300046457 Bacteria 4877
672 Ga0495653_0013272 3300046463 Bacteria 6716
673 Ga0495650_0000048 3300046471 Bacteria 334427
674 Ga0495650_0000611 3300046471 Bacteria 48647
675 Ga0495580_0179195 3300046472 Bacteria 1463
676 Ga0495582_0001174 3300046473 Bacteria 14749
677 Ga0495605_0009761 3300046474 Bacteria 5391
678 Ga0495605_0039084 3300046474 Bacteria 2378
679 Ga0495662_0010145 3300046476 Bacteria 4617
680 Ga0495584_0022108 3300046491 Bacteria 3227
681 Ga0495584_0072019 3300046491 Bacteria 1736
682 Ga0495585_0080823 3300046492 Bacteria 1761
683 Ga0495594_0000969 3300046499 Bacteria 14907
684 Ga0495596_0001010 3300046500 Bacteria 16742
685 Ga0495596_0010841 3300046500 Bacteria 3954
686 Ga0495607_0034021 3300046501 Bacteria 3096
687 Ga0495606_0150696 3300046507 Bacteria 1365
688 Ga0495608_0004799 3300046511 Bacteria 9663
689 Ga0495616_0011045 3300046513 Bacteria 5188
690 Ga0495628_0007056 3300046516 Bacteria 9728
691 Ga0495630_0012579 3300046517 Bacteria 6150
692 Ga0495648_0003194 3300046524 Bacteria 14567
693 Ga0495666_0007946 3300046526 Bacteria 5313
694 Ga0495666_0009041 3300046526 Bacteria 4984
695 Ga0495666_0075724 3300046526 Bacteria 1595
696 Ga0495665_0007930 3300046531 Bacteria 5755
697 Ga0495640_0006366 3300046533 Bacteria 9344
698 Ga0495586_0000614 3300046535 Bacteria 20627
699 Ga0495586_0007982 3300046535 Bacteria 5647
700 Ga0495609_0038429 3300046538 Bacteria 2157
701 Ga0495621_0007197 3300046539 Bacteria 3286
702 Ga0495597_0000287 3300046542 Bacteria 45422
703 Ga0495597_0017089 3300046542 Bacteria 3418
704 Ga0495645_0125615 3300046543 Bacteria 1802
705 Ga0495633_0030072 3300046558 Bacteria 2639
706 Ga0495667_0031867 3300046559 Bacteria 3535
707 Ga0495668_0010322 3300046616 Bacteria 5658
708 Ga0495634_0021286 3300046642 Bacteria 4586
709 Ga0495634_0029779 3300046642 Bacteria 3777
710 Ga0495625_0003621 3300046660 Bacteria 15166
711 Ga0495635_0010433 3300046663 Bacteria 6499
712 Ga0495635_0016749 3300046663 Bacteria 5121
713 Ga0495659_0018457 3300046664 Bacteria 2324
714 Ga0495659_0019768 3300046664 Bacteria 2255
715 Ga0495588_0022916 3300046674 Bacteria 3087
716 Ga0495588_0127658 3300046674 Bacteria 1341
717 Ga0495623_0058481 3300046679 Bacteria 2423
718 Ga0495623_0086710 3300046679 Bacteria 1929
719 Ga0495647_0079348 3300046681 Bacteria 1329
720 Ga0495658_0105310 3300046683 Bacteria 1689
721 Ga0495669_0000120 3300046684 Bacteria 50677
722 Ga0495613_0071220 3300046689 Bacteria 2534
723 Ga0495613_0107223 3300046689 Bacteria 2015
724 Ga0495670_0002251 3300046691 Bacteria 9517
725 Ga0495670_0006501 3300046691 Bacteria 5743
726 Ga0495589_0080805 3300046794 Bacteria 1581
727 Ga0495589_0085734 3300046794 Bacteria 1530
728 Ga0495600_0015358 3300046809 Bacteria 4841
729 Ga0495604_0007280 3300047317 Bacteria 8763
730 Ga0495604_0045252 3300047317 Bacteria 3435
731 Ga0495604_0120788 3300047317 Bacteria 1897
732 Ga0495674_0141902 3300047319 Bacteria 2019
733 Ga0495672_0000579 3300047320 Bacteria 41410
734 Ga0495672_0002951 3300047320 Bacteria 14983
735 Ga0495676_0000243 3300047321 Bacteria 43967
736 Ga0495680_0003331 3300047322 Bacteria 15885
737 Ga0495680_0067273 3300047322 Bacteria 2739
738 Ga0495680_0077915 3300047322 Bacteria 2509
739 Ga0495683_0021245 3300047323 Bacteria 3346
740 Ga0495683_0115580 3300047323 Bacteria 1277
741 Ga0495675_0015371 3300047444 Bacteria 4841
742 Ga0495675_0021810 3300047444 Bacteria 4080
743 Ga0495677_0001567 3300047445 Bacteria 9225
744 Ga0495677_0002736 3300047445 Bacteria 6890
745 Ga0495681_0008274 3300047470 Bacteria 6535
746 Ga0495593_0002036 3300047673 Bacteria 12055
747 Ga0495593_0029177 3300047673 Bacteria 3026
748 Ga0495593_0110063 3300047673 Bacteria 1407
749 Ga0495593_0117282 3300047673 Bacteria 1356
750 Ga0495602_0135600 3300048088 Bacteria 1956
751 Ga0495614_0001096 3300048089 Bacteria 11586
752 Ga0495614_0080835 3300048089 Bacteria 1408
753 Ga0495626_0000085 3300048091 Bacteria 125255
754 Ga0495626_0001155 3300048091 Bacteria 22059
755 Ga0496102_0189368 3300048905 Bacteria 1938
756 Ga0496103_0124972 3300048906 Bacteria 1640
757 Ga0496104_0027013 3300048907 Bacteria 5307
758 Ga0496105_0047121 3300048908 Bacteria 3557
759 Ga0496106_0146477 3300048909 Bacteria 1860
760 Ga0496107_0026851 3300048910 Bacteria 4086
761 Ga0496108_0024922 3300048911 Bacteria 4927
762 Ga0496109_0006173 3300048912 Bacteria 10068
763 Ga0496111_0046015 3300048914 Bacteria 3141
764 Ga0496112_0002563 3300048915 Bacteria 14680
765 Ga0496112_0191155 3300048915 Bacteria 2009
766 Ga0496114_0201361 3300048917 Bacteria 1744
767 Ga0496114_0224788 3300048917 Bacteria 1648
768 Ga0496121_0143328 3300048924 Bacteria 1769
769 Ga0496122_0002624 3300048925 Bacteria 25161
770 Ga0496123_0000441 3300048926 Bacteria 74721
771 Ga0496125_0006509 3300048928 Bacteria 12601
772 Ga0496125_0177688 3300048928 Bacteria 1422
773 Ga0501031_0250515 3300049568 Bacteria 1151
774 Ga0501033_0162602 3300049570 Bacteria 1606
775 Ga0501034_0000597 3300049571 Bacteria 57052
776 Ga0501034_0022430 3300049571 Bacteria 6434
777 Ga0501034_0023404 3300049571 Bacteria 6295
778 Ga0501036_0000381 3300049572 Bacteria 31374
779 Ga0501037_0145560 3300049573 Bacteria 1695
780 Ga0501038_0039872 3300049574 Bacteria 4106
781 Ga0501039_0000492 3300049575 Bacteria 28646
782 Ga0501040_0133105 3300049576 Bacteria 1749
783 Ga0501041_0000582 3300049577 Bacteria 19027
784 Ga0501041_0113998 3300049577 Bacteria 1678
785 Ga0501042_0002244 3300049578 Bacteria 11789
786 Ga0501043_0137183 3300049579 Bacteria 1916
787 Ga0501046_0000630 3300049580 Bacteria 34607
788 Ga0501047_0072506 3300049581 Bacteria 3315
789 Ga0501048_0000975 3300049582 Bacteria 21200
790 Ga0501067_0011453 3300049583 Bacteria 4912
791 Ga0501068_0106643 3300049584 Bacteria 1739
792 Ga0501069_0075632 3300049585 Bacteria 1892
793 Ga0501070_0057313 3300049586 Bacteria 3229
794 Ga0501070_0074382 3300049586 Bacteria 2812
795 Ga0501070_0074594 3300049586 Bacteria 2808
796 Ga0501071_0022080 3300049587 Bacteria 4435
797 Ga0501071_0102382 3300049587 Bacteria 2112
798 Ga0501072_0007467 3300049588 Bacteria 8294
799 Ga0501072_0009345 3300049588 Bacteria 7452
800 Ga0501072_0013819 3300049588 Bacteria 6183
801 Ga0501072_0138287 3300049588 Bacteria 1942
802 Ga0501073_0005246 3300049589 Bacteria 9717
803 Ga0501074_0009609 3300049590 Bacteria 7023
804 Ga0501074_0038867 3300049590 Bacteria 3447
805 Ga0501076_0000475 3300049592 Bacteria 25328
806 Ga0501076_0201359 3300049592 Bacteria 1626
807 Ga0501077_0010221 3300049593 Bacteria 5844
808 Ga0501079_0066070 3300049741 Bacteria 2791
809 Ga0501080_0020873 3300049742 Bacteria 6062
810 Ga0501080_0047422 3300049742 Bacteria 3999
811 Ga0501081_0000755 3300049743 Bacteria 18932
812 Ga0501081_0116226 3300049743 Bacteria 1902
813 Ga0501081_0158111 3300049743 Bacteria 1631
814 Ga0501083_0047896 3300049744 Bacteria 2886
815 Ga0501035_0113978 3300049822 Bacteria 2368
816 Ga0501045_0011426 3300049824 Bacteria 6237
817 Ga0501045_0171341 3300049824 Bacteria 1616
818 nmdc:mga0k408_22524_c1 3300050493 Bacteria 3548
819 nmdc:mga06z11_13863_c1 3300050494 Bacteria 3554
820 nmdc:mga07m45_3938_c1 3300050496 Bacteria 7217
821 nmdc:mga05p37_2235_c1 3300050507 Bacteria 22561
822 nmdc:mga05p37_61569_c1 3300050507 Bacteria 4620
823 nmdc:mga09592_1165_c1 3300050508 Bacteria 20987
824 nmdc:mga09592_142_c1 3300050508 Bacteria 24140
825 nmdc:mga09592_163367_c1 3300050508 Bacteria 1924
826 nmdc:mga09592_360479_c1 3300050508 Bacteria 1258
827 nmdc:mga0qj67_3315_c1 3300050509 Bacteria 11608
828 nmdc:mga06r32_198392_c1 3300050510 Bacteria 1994
829 nmdc:mga06r32_284486_c1 3300050510 Bacteria 1640
830 nmdc:mga06r32_29298_c1 3300050510 Bacteria 5158
831 nmdc:mga06r32_7017_c1 3300050510 Bacteria 10130
832 nmdc:mga08y16_128288_c1 3300050511 Bacteria 2638
833 nmdc:mga08y16_151745_c1 3300050511 Bacteria 2408
834 nmdc:mga08y16_206001_c1 3300050511 Bacteria 2038
835 nmdc:mga08y16_255611_c1 3300050511 Bacteria 1810
836 nmdc:mga08y16_47099_c1 3300050511 Bacteria 4514
837 nmdc:mga0n895_223519_c1 3300050512 Bacteria 1911
838 nmdc:mga0n895_5375_c1 3300050512 Bacteria 10686
839 nmdc:mga0rr50_11962_c1 3300050513 Bacteria 5584
840 nmdc:mga0rr50_250801_c1 3300050513 Bacteria 1470
841 nmdc:mga0rr50_264031_c1 3300050513 Bacteria 1433
842 nmdc:mga0rr50_80429_c1 3300050513 Bacteria 2512
843 nmdc:mga08x19_122613_c1 3300050514 Bacteria 1743
844 nmdc:mga08x19_218263_c1 3300050514 Bacteria 1310
845 nmdc:mga08x19_5509_c1 3300050514 Bacteria 7488
846 nmdc:mga0a205_170613_c1 3300050515 Bacteria 2072
847 nmdc:mga0a205_30241_c1 3300050515 Bacteria 5185
848 Ga0495601_0141704 3300053077 Bacteria 1568
849 Ga0495619_0152842 3300053085 Bacteria 1592
850 Ga0500583_0006344 3300053092 Bacteria 4060
851 Ga0500594_0003858 3300053118 Bacteria 3302
852 Ga0500604_0002482 3300053151 Bacteria 5027
853 Ga0501084_0028512 3300054114 Bacteria 4667
854 Ga0501084_0052900 3300054114 Bacteria 3397
855 Ga0501084_0304495 3300054114 Bacteria 1346
856 Ga0587090_000148 3300059510 Bacteria 4676
857 Ga0587115_000944 3300059626 Bacteria 2439
858 Ga0587071_006610 3300060344 Bacteria 1818
859 Ga0587111_0000273 3300060346 Bacteria 4368
860 Ga0587111_0002885 3300060346 Bacteria 2367
861 Ga0501082_0020839 3300060353 Bacteria 5654
862 Ga0501082_0264518 3300060353 Bacteria 1496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0250515 Ga0501031_0250515_23_1117 364
2 3300009094 Ga0111539_10103277 Ga0111539_101032772 367
3 3300005545 Ga0070695_100055355 Ga0070695_1000553555 386
4 3300005618 Ga0068864_100202369 Ga0068864_1002023692 386
5 3300006871 Ga0075434_100230662 Ga0075434_1002306622 386
6 3300009094 Ga0111539_10017094 Ga0111539_100170942 386
7 3300009098 Ga0105245_10000971 Ga0105245_100009715 386
8 3300009176 Ga0105242_10001649 Ga0105242_100016499 386
9 3300009553 Ga0105249_10001554 Ga0105249_100015548 386
10 3300011119 Ga0105246_10012762 Ga0105246_100127623 386
11 3300013297 Ga0157378_10006586 Ga0157378_100065865 386
12 3300027907 Ga0207428_10141463 Ga0207428_101414633 386
13 3300046681 Ga0495647_0079348 Ga0495647_0079348_86_1246 386
14 3300049577 Ga0501041_0113998 Ga0501041_0113998_204_1364 386
15 3300049587 Ga0501071_0102382 Ga0501071_0102382_286_1446 386
16 3300049588 Ga0501072_0138287 Ga0501072_0138287_661_1821 386
17 3300049743 Ga0501081_0158111 Ga0501081_0158111_436_1596 386
18 3300050508 nmdc:mga09592_360479_c1 nmdc:mga09592_360479_c1_38_1198 386
19 3300050511 nmdc:mga08y16_151745_c1 nmdc:mga08y16_151745_c1_1007_2167 386
20 3300050511 nmdc:mga08y16_206001_c1 nmdc:mga08y16_206001_c1_665_1825 386
21 3300050513 nmdc:mga0rr50_11962_c1 nmdc:mga0rr50_11962_c1_202_1362 386
22 3300050513 nmdc:mga0rr50_250801_c1 nmdc:mga0rr50_250801_c1_152_1312 386
23 3300050514 nmdc:mga08x19_5509_c1 nmdc:mga08x19_5509_c1_280_1440 386
24 3300050515 nmdc:mga0a205_170613_c1 nmdc:mga0a205_170613_c1_615_1775 386
25 3300054114 Ga0501084_0052900 Ga0501084_0052900_1292_2452 386
26 3300046501 Ga0495607_0034021 Ga0495607_0034021_788_1957 389
27 3300044683 Ga0466965_0129243 Ga0466965_0129243_17_1189 390
28 3300044765 Ga0466970_0030695 Ga0466970_0030695_470_1642 390
29 3300045049 Ga0466959_0007661 Ga0466959_0007661_5876_7048 390
30 3300046507 Ga0495606_0150696 Ga0495606_0150696_28_1200 390
31 3300049824 Ga0501045_0171341 Ga0501045_0171341_430_1605 390
32 3300009098 Ga0105245_10004793 Ga0105245_100047939 391
33 3300013296 Ga0157374_10003963 Ga0157374_100039637 391
34 3300013297 Ga0157378_10005239 Ga0157378_100052398 391
35 3300013306 Ga0163162_10005150 Ga0163162_100051506 391
36 3300013306 Ga0163162_10093528 Ga0163162_100935284 391
37 3300013308 Ga0157375_10379949 Ga0157375_103799493 391
38 3300014968 Ga0157379_10000412 Ga0157379_100004126 391
39 3300035086 Ga0373934_0028531 Ga0373934_0028531_70_1245 391
40 3300035119 Ga0373956_0022319 Ga0373956_0022319_1151_2326 391
41 3300035171 Ga0373946_0004883 Ga0373946_0004883_2607_3782 391
42 3300035172 Ga0373955_0065471 Ga0373955_0065471_334_1509 391
43 3300035207 Ga0373942_0007255 Ga0373942_0007255_13_1188 391
44 3300035695 Ga0373927_0003672 Ga0373927_0003672_5806_6981 391
45 3300035695 Ga0373927_0061454 Ga0373927_0061454_1009_2184 391
46 3300035725 Ga0373947_0134043 Ga0373947_0134043_210_1385 391
47 3300036401 Ga0373937_0046774 Ga0373937_0046774_27_1202 391
48 3300037068 Ga0373925_0037826 Ga0373925_0037826_239_1414 391
49 3300046473 Ga0495582_0001174 Ga0495582_0001174_9405_10580 391
50 3300046531 Ga0495665_0007930 Ga0495665_0007930_4204_5379 391
51 3300046543 Ga0495645_0125615 Ga0495645_0125615_321_1496 391
52 3300046663 Ga0495635_0010433 Ga0495635_0010433_428_1603 391
53 3300046689 Ga0495613_0071220 Ga0495613_0071220_924_2099 391
54 3300047319 Ga0495674_0141902 Ga0495674_0141902_24_1199 391
55 3300047673 Ga0495593_0110063 Ga0495593_0110063_79_1254 391
56 3300048907 Ga0496104_0027013 Ga0496104_0027013_1353_2528 391
57 3300048915 Ga0496112_0002563 Ga0496112_0002563_51_1226 391
58 3300050513 nmdc:mga0rr50_264031_c1 nmdc:mga0rr50_264031_c1_36_1211 391
59 3300049570 Ga0501033_0162602 Ga0501033_0162602_358_1536 392
60 3300049573 Ga0501037_0145560 Ga0501037_0145560_410_1588 392
61 3300049575 Ga0501039_0000492 Ga0501039_0000492_211_1389 392
62 3300049577 Ga0501041_0000582 Ga0501041_0000582_1126_2304 392
63 3300049584 Ga0501068_0106643 Ga0501068_0106643_493_1671 392
64 3300049587 Ga0501071_0022080 Ga0501071_0022080_11_1189 392
65 3300049588 Ga0501072_0013819 Ga0501072_0013819_4907_6085 392
66 3300049744 Ga0501083_0047896 Ga0501083_0047896_1669_2847 392
67 iso_pu_bacteria 2818991446 2819596909 394
68 3300025321 Ga0207656_10009351 Ga0207656_100093512 396
69 3300006048 Ga0075363_100063936 Ga0075363_1000639362 397
70 3300049822 Ga0501035_0113978 Ga0501035_0113978_911_2107 397
71 iso_pu_bacteria 2524023205 2524441108 397
72 3300003794 Ga0055531_10002446 Ga0055531_100024467 398
73 3300045051 Ga0451576_0007446 Ga0451576_0007446_6219_7418 399
74 3300003323 rootH1_10206713 rootH1_102067132 400
75 3300005330 Ga0070690_100001105 Ga0070690_10000110510 400
76 3300005336 Ga0070680_100002623 Ga0070680_10000262311 400
77 3300005338 Ga0068868_100000248 Ga0068868_1000002488 400
78 3300005343 Ga0070687_100000174 Ga0070687_10000017412 400
79 3300005344 Ga0070661_100002911 Ga0070661_1000029115 400
80 3300005345 Ga0070692_10001675 Ga0070692_100016752 400
81 3300005366 Ga0070659_100001405 Ga0070659_1000014051 400
82 3300005406 Ga0070703_10012077 Ga0070703_100120772 400
83 3300005438 Ga0070701_10004921 Ga0070701_100049212 400
84 3300005440 Ga0070705_100001553 Ga0070705_1000015536 400
85 3300005441 Ga0070700_100002982 Ga0070700_1000029822 400
86 3300005444 Ga0070694_100000640 Ga0070694_10000064016 400
87 3300005459 Ga0068867_100001768 Ga0068867_10000176812 400
88 3300005530 Ga0070679_100139345 Ga0070679_1001393452 400
89 3300005544 Ga0070686_100002620 Ga0070686_1000026205 400
90 3300005545 Ga0070695_100002755 Ga0070695_1000027556 400
91 3300005547 Ga0070693_100000080 Ga0070693_10000008019 400
92 3300005549 Ga0070704_100001040 Ga0070704_10000104011 400
93 3300005578 Ga0068854_100001135 Ga0068854_1000011356 400
94 3300005614 Ga0068856_100039912 Ga0068856_1000399128 400
95 3300005614 Ga0068856_100422790 Ga0068856_1004227901 400
96 3300005615 Ga0070702_100000077 Ga0070702_10000007716 400
97 3300005617 Ga0068859_100004368 Ga0068859_10000436813 400
98 3300005618 Ga0068864_100055952 Ga0068864_1000559522 400
99 3300005718 Ga0068866_10001036 Ga0068866_100010365 400
100 3300005719 Ga0068861_100003534 Ga0068861_1000035345 400
101 3300005842 Ga0068858_100005814 Ga0068858_1000058145 400
102 3300005843 Ga0068860_100005458 Ga0068860_1000054589 400
103 3300005844 Ga0068862_100001295 Ga0068862_1000012956 400
104 3300006358 Ga0068871_100002192 Ga0068871_1000021922 400
105 3300006846 Ga0075430_100000185 Ga0075430_10000018521 400
106 3300006871 Ga0075434_100005588 Ga0075434_1000055882 400
107 3300006880 Ga0075429_100000155 Ga0075429_10000015545 400
108 3300006881 Ga0068865_100001333 Ga0068865_10000133312 400
109 3300006914 Ga0075436_100001429 Ga0075436_1000014294 400
110 3300006931 Ga0097620_100004369 Ga0097620_10000436913 400
111 3300007076 Ga0075435_100007088 Ga0075435_1000070882 400
112 3300009092 Ga0105250_10000036 Ga0105250_1000003644 400
113 3300009148 Ga0105243_10001264 Ga0105243_1000126419 400
114 3300013306 Ga0163162_10161525 Ga0163162_101615251 400
115 3300014968 Ga0157379_10000193 Ga0157379_100001939 400
116 3300021361 Ga0213872_10003416 Ga0213872_100034162 400
117 3300025711 Ga0207696_1000135 Ga0207696_100013584 400
118 3300025885 Ga0207653_10005400 Ga0207653_100054002 400
119 3300025899 Ga0207642_10003544 Ga0207642_100035448 400
120 3300025917 Ga0207660_10001992 Ga0207660_1000199211 400
121 3300025919 Ga0207657_10010009 Ga0207657_100100096 400
122 3300025921 Ga0207652_10006878 Ga0207652_100068784 400
123 3300025927 Ga0207687_10000672 Ga0207687_1000067218 400
124 3300025934 Ga0207686_10001056 Ga0207686_1000105617 400
125 3300025935 Ga0207709_10004251 Ga0207709_100042515 400
126 3300025936 Ga0207670_10003490 Ga0207670_1000349012 400
127 3300025945 Ga0207679_10006418 Ga0207679_100064186 400
128 3300025949 Ga0207667_10014658 Ga0207667_100146582 400
129 3300025961 Ga0207712_10186631 Ga0207712_101866312 400
130 3300026023 Ga0207677_10023066 Ga0207677_100230665 400
131 3300026035 Ga0207703_10003771 Ga0207703_100037712 400
132 3300026075 Ga0207708_10000733 Ga0207708_100007336 400
133 3300026089 Ga0207648_10004346 Ga0207648_1000434612 400
134 3300026095 Ga0207676_10083620 Ga0207676_100836202 400
135 3300026118 Ga0207675_100005060 Ga0207675_1000050604 400
136 3300027907 Ga0207428_10001921 Ga0207428_1000192117 400
137 3300028380 Ga0268265_10001650 Ga0268265_100016505 400
138 3300028381 Ga0268264_10001768 Ga0268264_1000176811 400
139 3300031507 Ga0307509_10000075 Ga0307509_1000007595 400
140 3300031665 Ga0316575_10001505 Ga0316575_100015054 400
141 3300032133 Ga0316583_10014620 Ga0316583_100146201 400
142 3300032133 Ga0316583_10014703 Ga0316583_100147032 400
143 3300035088 Ga0373940_0015423 Ga0373940_0015423_121_1362 400
144 3300035112 Ga0373932_0002340 Ga0373932_0002340_2868_4109 400
145 3300036647 Ga0316582_0064871 Ga0316582_0064871_1138_2340 400
146 3300037588 Ga0316581_0003055 Ga0316581_0003055_2123_3325 400
147 3300039447 Ga0436361_1101324 Ga0436361_1101324_7637_8842 400
148 3300041491 Ga0451833_0827264 Ga0451833_0827264_577_1779 400
149 3300041512 Ga0451853_1088632 Ga0451853_1088632_158_1360 400
150 3300044658 Ga0466972_0000118 Ga0466972_0000118_12848_14050 400
151 3300045051 Ga0451576_0099038 Ga0451576_0099038_277_1518 400
152 3300045976 Ga0466967_0183907 Ga0466967_0183907_468_1670 400
153 3300046454 Ga0495592_0001499 Ga0495592_0001499_9325_10527 400
154 3300046476 Ga0495662_0010145 Ga0495662_0010145_1887_3089 400
155 3300046511 Ga0495608_0004799 Ga0495608_0004799_6050_7252 400
156 3300046516 Ga0495628_0007056 Ga0495628_0007056_600_1802 400
157 3300046517 Ga0495630_0012579 Ga0495630_0012579_597_1799 400
158 3300046526 Ga0495666_0075724 Ga0495666_0075724_230_1432 400
159 3300046533 Ga0495640_0006366 Ga0495640_0006366_462_1664 400
160 3300046535 Ga0495586_0000614 Ga0495586_0000614_11162_12364 400
161 3300046559 Ga0495667_0031867 Ga0495667_0031867_1928_3130 400
162 3300046642 Ga0495634_0029779 Ga0495634_0029779_687_1889 400
163 3300046683 Ga0495658_0105310 Ga0495658_0105310_32_1234 400
164 3300046689 Ga0495613_0107223 Ga0495613_0107223_351_1553 400
165 3300047317 Ga0495604_0007280 Ga0495604_0007280_463_1665 400
166 3300047322 Ga0495680_0003331 Ga0495680_0003331_8004_9206 400
167 3300047673 Ga0495593_0117282 Ga0495593_0117282_141_1343 400
168 3300049572 Ga0501036_0000381 Ga0501036_0000381_29614_30816 400
169 3300049574 Ga0501038_0039872 Ga0501038_0039872_1951_3153 400
170 3300049578 Ga0501042_0002244 Ga0501042_0002244_4377_5579 400
171 3300049579 Ga0501043_0137183 Ga0501043_0137183_55_1257 400
172 3300049580 Ga0501046_0000630 Ga0501046_0000630_32647_33849 400
173 3300049581 Ga0501047_0072506 Ga0501047_0072506_1573_2775 400
174 3300049582 Ga0501048_0000975 Ga0501048_0000975_19899_21101 400
175 3300049592 Ga0501076_0000475 Ga0501076_0000475_650_1852 400
176 3300049593 Ga0501077_0010221 Ga0501077_0010221_4280_5482 400
177 3300049743 Ga0501081_0000755 Ga0501081_0000755_146_1348 400
178 3300049824 Ga0501045_0011426 Ga0501045_0011426_1625_2827 400
179 3300050507 nmdc:mga05p37_61569_c1 nmdc:mga05p37_61569_c1_2010_3212 400
180 3300050508 nmdc:mga09592_1165_c1 nmdc:mga09592_1165_c1_17732_18934 400
181 3300050509 nmdc:mga0qj67_3315_c1 nmdc:mga0qj67_3315_c1_3195_4397 400
182 3300050510 nmdc:mga06r32_284486_c1 nmdc:mga06r32_284486_c1_346_1548 400
183 3300050511 nmdc:mga08y16_47099_c1 nmdc:mga08y16_47099_c1_1201_2403 400
184 3300053077 Ga0495601_0141704 Ga0495601_0141704_245_1447 400
185 3300053085 Ga0495619_0152842 Ga0495619_0152842_341_1543 400
186 3300054114 Ga0501084_0028512 Ga0501084_0028512_3382_4584 400
187 3300060353 Ga0501082_0020839 Ga0501082_0020839_92_1294 400
188 iso_pu_bacteria 2511231003 2511251299 400
189 iso_pu_bacteria 2511231026 2511385098 400
190 iso_pu_bacteria 2521172590 2521559048 400
191 iso_pu_bacteria 2548876994 2550696983 400
192 iso_pu_bacteria 2551306416 2553003864 400
193 iso_pu_bacteria 2643221603 2644030077 400
194 iso_pu_bacteria 2765235838 2765568700 400
195 iso_pu_bacteria 2808606386 2808981442 400
196 iso_pu_bacteria 2808606415 2809129027 400
197 iso_pu_bacteria 2808606419 2809148647 400
198 iso_pu_bacteria 2818991445 2819592391 400
199 iso_pu_bacteria 2818991449 2819615566 400
200 iso_pu_bacteria 2839094727 2839096415 400
201 iso_pu_bacteria 2852618963 2852621182 400
202 iso_pu_bacteria 2884811622 2884811949 400
203 iso_pu_bacteria 2884836552 2884840133 400
204 iso_pu_bacteria 2884852848 2884857100 400
205 iso_pu_bacteria 2896154374 2896157686 400
206 iso_pu_bacteria 2904439833 2904444882 400
207 iso_pu_bacteria 2904530477 2904532303 400
208 iso_pu_bacteria 2904584206 2904584745 400
209 iso_pu_bacteria 2904589729 2904591267 400
210 iso_pu_bacteria 2904601388 2904605192 400
211 iso_pu_bacteria 2919046199 2919048361 400
212 iso_pu_bacteria 2919079590 2919081116 400
213 iso_pu_bacteria 2923510766 2923512721 400
214 iso_pu_bacteria 2928130867 2928132725 400
215 3300005334 Ga0068869_100018160 Ga0068869_1000181604 401
216 3300005336 Ga0070680_100111719 Ga0070680_1001117192 401
217 3300005344 Ga0070661_100115397 Ga0070661_1001153972 401
218 3300005356 Ga0070674_100050233 Ga0070674_1000502333 401
219 3300005356 Ga0070674_100263459 Ga0070674_1002634592 401
220 3300005458 Ga0070681_10006813 Ga0070681_100068132 401
221 3300005458 Ga0070681_10018828 Ga0070681_100188286 401
222 3300005467 Ga0070706_100119845 Ga0070706_1001198451 401
223 3300005530 Ga0070679_100026716 Ga0070679_1000267162 401
224 3300005539 Ga0068853_100029086 Ga0068853_1000290863 401
225 3300005563 Ga0068855_100120936 Ga0068855_1001209361 401
226 3300005563 Ga0068855_100206001 Ga0068855_1002060012 401
227 3300005614 Ga0068856_100049225 Ga0068856_1000492252 401
228 3300005841 Ga0068863_100039105 Ga0068863_1000391054 401
229 3300006173 Ga0070716_100116228 Ga0070716_1001162282 401
230 3300006237 Ga0097621_100083058 Ga0097621_1000830581 401
231 3300006358 Ga0068871_100005143 Ga0068871_1000051437 401
232 3300006846 Ga0075430_100077234 Ga0075430_1000772342 401
233 3300006847 Ga0075431_100025662 Ga0075431_1000256623 401
234 3300006880 Ga0075429_100052124 Ga0075429_1000521242 401
235 3300009174 Ga0105241_10063502 Ga0105241_100635022 401
236 3300009177 Ga0105248_10011205 Ga0105248_100112052 401
237 3300009545 Ga0105237_10025491 Ga0105237_100254912 401
238 3300010375 Ga0105239_10049376 Ga0105239_100493764 401
239 3300013307 Ga0157372_10309234 Ga0157372_103092342 401
240 3300014969 Ga0157376_10173430 Ga0157376_101734302 401
241 3300025910 Ga0207684_10109960 Ga0207684_101099602 401
242 3300025912 Ga0207707_10044480 Ga0207707_100444802 401
243 3300025922 Ga0207646_10032065 Ga0207646_100320653 401
244 3300025937 Ga0207669_10046559 Ga0207669_100465592 401
245 3300025942 Ga0207689_10002117 Ga0207689_100021174 401
246 3300025949 Ga0207667_10047280 Ga0207667_100472802 401
247 3300026035 Ga0207703_10100025 Ga0207703_101000251 401
248 3300026041 Ga0207639_10024338 Ga0207639_100243383 401
249 3300026078 Ga0207702_10026167 Ga0207702_100261673 401
250 3300026116 Ga0207674_10130754 Ga0207674_101307541 401
251 3300028379 Ga0268266_10227798 Ga0268266_102277982 401
252 3300031665 Ga0316575_10038592 Ga0316575_100385921 401
253 3300031824 Ga0307413_10125129 Ga0307413_101251291 401
254 3300032133 Ga0316583_10002992 Ga0316583_100029923 401
255 3300036401 Ga0373937_0151716 Ga0373937_0151716_778_1983 401
256 3300042876 Ga0451577_0143352 Ga0451577_0143352_167_1372 401
257 3300044712 Ga0453684_0155856 Ga0453684_0155856_1082_2287 401
258 3300045051 Ga0451576_0003154 Ga0451576_0003154_9530_10735 401
259 3300049586 Ga0501070_0074382 Ga0501070_0074382_518_1723 401
260 3300049741 Ga0501079_0066070 Ga0501079_0066070_1108_2313 401
261 3300049743 Ga0501081_0116226 Ga0501081_0116226_122_1327 401
262 3300050508 nmdc:mga09592_163367_c1 nmdc:mga09592_163367_c1_244_1449 401
263 3300050510 nmdc:mga06r32_198392_c1 nmdc:mga06r32_198392_c1_11_1216 401
264 3300050510 nmdc:mga06r32_29298_c1 nmdc:mga06r32_29298_c1_3105_4310 401
265 3300054114 Ga0501084_0304495 Ga0501084_0304495_45_1250 401
266 3300006042 Ga0075368_10004247 Ga0075368_100042472 402
267 3300006048 Ga0075363_100014425 Ga0075363_1000144252 402
268 3300006177 Ga0075362_10005235 Ga0075362_100052354 402
269 3300006195 Ga0075366_10022633 Ga0075366_100226332 402
270 3300031238 Ga0265332_10000100 Ga0265332_1000010017 402
271 3300035170 Ga0373943_0111940 Ga0373943_0111940_20_1228 402
272 3300050493 nmdc:mga0k408_22524_c1 nmdc:mga0k408_22524_c1_803_2032 402
273 3300050494 nmdc:mga06z11_13863_c1 nmdc:mga06z11_13863_c1_213_1442 402
274 3300050496 nmdc:mga07m45_3938_c1 nmdc:mga07m45_3938_c1_5898_7127 402
275 3300005563 Ga0068855_100005360 Ga0068855_1000053608 403
276 3300005842 Ga0068858_100054541 Ga0068858_1000545412 403
277 3300009093 Ga0105240_10034293 Ga0105240_100342935 403
278 3300009545 Ga0105237_10056649 Ga0105237_100566492 403
279 3300013102 Ga0157371_10000001 Ga0157371_10000001165 403
280 3300025913 Ga0207695_10115702 Ga0207695_101157022 403
281 3300025949 Ga0207667_10027013 Ga0207667_100270135 403
282 3300026035 Ga0207703_10041234 Ga0207703_100412342 403
283 3300046457 Ga0495590_0000060 Ga0495590_0000060_34242_35540 403
284 3300046457 Ga0495590_0005738 Ga0495590_0005738_538_1749 403
285 3300046463 Ga0495653_0013272 Ga0495653_0013272_4007_5218 403
286 3300046471 Ga0495650_0000048 Ga0495650_0000048_179941_181242 403
287 3300046471 Ga0495650_0000611 Ga0495650_0000611_39712_40923 403
288 3300046474 Ga0495605_0009761 Ga0495605_0009761_736_2034 403
289 3300046474 Ga0495605_0039084 Ga0495605_0039084_487_1698 403
290 3300046491 Ga0495584_0022108 Ga0495584_0022108_182_1393 403
291 3300046491 Ga0495584_0072019 Ga0495584_0072019_95_1306 403
292 3300046492 Ga0495585_0080823 Ga0495585_0080823_149_1360 403
293 3300046499 Ga0495594_0000969 Ga0495594_0000969_431_1642 403
294 3300046500 Ga0495596_0001010 Ga0495596_0001010_1728_2939 403
295 3300046500 Ga0495596_0010841 Ga0495596_0010841_617_1828 403
296 3300046513 Ga0495616_0011045 Ga0495616_0011045_3402_4613 403
297 3300046524 Ga0495648_0003194 Ga0495648_0003194_584_1795 403
298 3300046526 Ga0495666_0007946 Ga0495666_0007946_3574_4785 403
299 3300046526 Ga0495666_0009041 Ga0495666_0009041_3406_4617 403
300 3300046535 Ga0495586_0007982 Ga0495586_0007982_526_1737 403
301 3300046538 Ga0495609_0038429 Ga0495609_0038429_307_1518 403
302 3300046542 Ga0495597_0000287 Ga0495597_0000287_35440_36738 403
303 3300046542 Ga0495597_0017089 Ga0495597_0017089_1700_2911 403
304 3300046558 Ga0495633_0030072 Ga0495633_0030072_942_2153 403
305 3300046616 Ga0495668_0010322 Ga0495668_0010322_520_1731 403
306 3300046642 Ga0495634_0021286 Ga0495634_0021286_561_1772 403
307 3300046663 Ga0495635_0016749 Ga0495635_0016749_2235_3446 403
308 3300046664 Ga0495659_0018457 Ga0495659_0018457_263_1534 403
309 3300046674 Ga0495588_0022916 Ga0495588_0022916_487_1698 403
310 3300046674 Ga0495588_0127658 Ga0495588_0127658_26_1237 403
311 3300046679 Ga0495623_0058481 Ga0495623_0058481_718_1929 403
312 3300046679 Ga0495623_0086710 Ga0495623_0086710_502_1713 403
313 3300046684 Ga0495669_0000120 Ga0495669_0000120_9817_11028 403
314 3300046691 Ga0495670_0002251 Ga0495670_0002251_462_1673 403
315 3300046691 Ga0495670_0006501 Ga0495670_0006501_4176_5387 403
316 3300046794 Ga0495589_0080805 Ga0495589_0080805_236_1447 403
317 3300046794 Ga0495589_0085734 Ga0495589_0085734_11_1222 403
318 3300046809 Ga0495600_0015358 Ga0495600_0015358_628_1839 403
319 3300047317 Ga0495604_0045252 Ga0495604_0045252_1622_2833 403
320 3300047317 Ga0495604_0120788 Ga0495604_0120788_140_1351 403
321 3300047320 Ga0495672_0000579 Ga0495672_0000579_39611_40822 403
322 3300047320 Ga0495672_0002951 Ga0495672_0002951_13437_14648 403
323 3300047321 Ga0495676_0000243 Ga0495676_0000243_42087_43298 403
324 3300047322 Ga0495680_0067273 Ga0495680_0067273_479_1690 403
325 3300047322 Ga0495680_0077915 Ga0495680_0077915_34_1245 403
326 3300047323 Ga0495683_0021245 Ga0495683_0021245_2101_3312 403
327 3300047323 Ga0495683_0115580 Ga0495683_0115580_35_1246 403
328 3300047444 Ga0495675_0015371 Ga0495675_0015371_3088_4299 403
329 3300047444 Ga0495675_0021810 Ga0495675_0021810_552_1763 403
330 3300047445 Ga0495677_0001567 Ga0495677_0001567_55_1266 403
331 3300047445 Ga0495677_0002736 Ga0495677_0002736_4592_5803 403
332 3300047470 Ga0495681_0008274 Ga0495681_0008274_543_1754 403
333 3300047673 Ga0495593_0002036 Ga0495593_0002036_6867_8078 403
334 3300047673 Ga0495593_0029177 Ga0495593_0029177_1231_2442 403
335 3300048088 Ga0495602_0135600 Ga0495602_0135600_553_1764 403
336 3300048089 Ga0495614_0001096 Ga0495614_0001096_1455_2666 403
337 3300048089 Ga0495614_0080835 Ga0495614_0080835_32_1243 403
338 3300048091 Ga0495626_0000085 Ga0495626_0000085_76690_77901 403
339 3300048091 Ga0495626_0001155 Ga0495626_0001155_7251_8462 403
340 3300049571 Ga0501034_0022430 Ga0501034_0022430_2598_3809 403
341 iso_pu_bacteria 2842333319 2842333752 403
342 3300002704 JGI25155J39150_1001225 JGI25155J39150_10012252 404
343 3300002704 JGI25155J39150_1001229 JGI25155J39150_10012292 404
344 3300002705 JGI25156J39149_1010718 JGI25156J39149_10107182 404
345 3300002738 JGI25154J39366_1000191 JGI25154J39366_10001912 404
346 3300002738 JGI25154J39366_1000480 JGI25154J39366_100048024 404
347 3300002741 JGI25157J39369_1000104 JGI25157J39369_100010460 404
348 3300003751 Ga0055538_1000030 Ga0055538_1000030108 404
349 3300003752 Ga0055539_1000040 Ga0055539_1000040108 404
350 3300003756 Ga0055533_1000050 Ga0055533_1000050108 404
351 3300003758 Ga0055532_1000015 Ga0055532_1000015100 404
352 3300003759 Ga0055525_1000060 Ga0055525_1000060108 404
353 3300003841 Ga0055541_1000027 Ga0055541_1000027108 404
354 3300005345 Ga0070692_10019700 Ga0070692_100197002 404
355 3300005441 Ga0070700_100042156 Ga0070700_1000421562 404
356 3300005459 Ga0068867_100053305 Ga0068867_1000533052 404
357 3300005471 Ga0070698_100106399 Ga0070698_1001063992 404
358 3300005563 Ga0068855_100004066 Ga0068855_10000406616 404
359 3300005563 Ga0068855_100019016 Ga0068855_1000190162 404
360 3300005616 Ga0068852_100195764 Ga0068852_1001957642 404
361 3300005841 Ga0068863_100136061 Ga0068863_1001360612 404
362 3300005985 Ga0081539_10028636 Ga0081539_100286362 404
363 3300006844 Ga0075428_100140035 Ga0075428_1001400353 404
364 3300006880 Ga0075429_100002759 Ga0075429_1000027597 404
365 3300009036 Ga0105244_10043892 Ga0105244_100438922 404
366 3300009093 Ga0105240_10001159 Ga0105240_1000115945 404
367 3300009094 Ga0111539_10148308 Ga0111539_101483082 404
368 3300009098 Ga0105245_10338833 Ga0105245_103388331 404
369 3300009147 Ga0114129_10000710 Ga0114129_1000071012 404
370 3300010375 Ga0105239_10012027 Ga0105239_100120274 404
371 3300013100 Ga0157373_10051415 Ga0157373_100514152 404
372 3300013104 Ga0157370_10047576 Ga0157370_100475762 404
373 3300013296 Ga0157374_10342087 Ga0157374_103420872 404
374 3300014497 Ga0182008_10005412 Ga0182008_100054122 404
375 3300025206 Ga0209435_100035 Ga0209435_100035100 404
376 3300025224 Ga0209784_100005 Ga0209784_100005815 404
377 3300025225 Ga0209566_100005 Ga0209566_100005815 404
378 3300025226 Ga0209674_100009 Ga0209674_100009815 404
379 3300025229 Ga0209147_100004 Ga0209147_100004666 404
380 3300025230 Ga0209563_100012 Ga0209563_100012815 404
381 3300025233 Ga0209437_100045 Ga0209437_1000457 404
382 3300025242 Ga0209258_100533 Ga0209258_10053327 404
383 3300025246 Ga0209646_1000121 Ga0209646_1000121102 404
384 3300025246 Ga0209646_1000146 Ga0209646_100014647 404
385 3300025250 Ga0209026_1000165 Ga0209026_100016560 404
386 3300025253 Ga0209677_100006 Ga0209677_100006815 404
387 3300025256 Ga0209759_1000064 Ga0209759_100006446 404
388 3300025256 Ga0209759_1000095 Ga0209759_1000095102 404
389 3300025913 Ga0207695_10006838 Ga0207695_1000683812 404
390 3300025913 Ga0207695_10010357 Ga0207695_100103576 404
391 3300025913 Ga0207695_10222885 Ga0207695_102228852 404
392 3300025914 Ga0207671_10088339 Ga0207671_100883393 404
393 3300025949 Ga0207667_10004125 Ga0207667_1000412516 404
394 3300025949 Ga0207667_10028315 Ga0207667_100283156 404
395 3300025949 Ga0207667_10144304 Ga0207667_101443042 404
396 3300025981 Ga0207640_10040625 Ga0207640_100406252 404
397 3300026075 Ga0207708_10037617 Ga0207708_100376173 404
398 3300026116 Ga0207674_10336256 Ga0207674_103362561 404
399 3300026142 Ga0207698_10231023 Ga0207698_102310232 404
400 3300027360 Ga0209969_1001789 Ga0209969_10017892 404
401 3300027378 Ga0209981_1003119 Ga0209981_10031192 404
402 3300027462 Ga0210000_1000925 Ga0210000_10009253 404
403 3300027614 Ga0209970_1002431 Ga0209970_10024312 404
404 3300027682 Ga0209971_1003125 Ga0209971_10031252 404
405 3300027717 Ga0209998_10007097 Ga0209998_100070973 404
406 3300027876 Ga0209974_10003341 Ga0209974_100033412 404
407 3300027876 Ga0209974_10003512 Ga0209974_100035122 404
408 3300037312 Ga0395899_0001504 Ga0395899_0001504_2847_4136 404
409 3300037418 Ga0395900_0021401 Ga0395900_0021401_3336_4625 404
410 3300037418 Ga0395900_0072258 Ga0395900_0072258_188_1402 404
411 3300037418 Ga0395900_0234990 Ga0395900_0234990_179_1393 404
412 3300037471 Ga0395905_0013587 Ga0395905_0013587_6035_7324 404
413 3300037471 Ga0395905_0022957 Ga0395905_0022957_2020_3234 404
414 3300037471 Ga0395905_0083599 Ga0395905_0083599_194_1408 404
415 3300038443 Ga0395901_0003952 Ga0395901_0003952_6241_7455 404
416 3300039447 Ga0436361_0424301 Ga0436361_0424301_1717_2934 404
417 3300039447 Ga0436361_0808852 Ga0436361_0808852_1338_2552 404
418 3300044683 Ga0466965_0074507 Ga0466965_0074507_61_1275 404
419 3300044684 Ga0466966_0114349 Ga0466966_0114349_356_1570 404
420 3300044735 Ga0466968_0020764 Ga0466968_0020764_790_2004 404
421 3300046660 Ga0495625_0003621 Ga0495625_0003621_928_2151 404
422 3300048905 Ga0496102_0189368 Ga0496102_0189368_112_1326 404
423 3300048914 Ga0496111_0046015 Ga0496111_0046015_135_1349 404
424 3300048917 Ga0496114_0201361 Ga0496114_0201361_460_1674 404
425 3300048924 Ga0496121_0143328 Ga0496121_0143328_412_1635 404
426 3300048925 Ga0496122_0002624 Ga0496122_0002624_638_1951 404
427 3300048926 Ga0496123_0000441 Ga0496123_0000441_655_1968 404
428 3300048928 Ga0496125_0006509 Ga0496125_0006509_693_2006 404
429 3300048928 Ga0496125_0177688 Ga0496125_0177688_84_1307 404
430 3300049571 Ga0501034_0000597 Ga0501034_0000597_50093_51307 404
431 3300049571 Ga0501034_0023404 Ga0501034_0023404_263_1477 404
432 3300049586 Ga0501070_0074594 Ga0501070_0074594_41_1255 404
433 3300049588 Ga0501072_0009345 Ga0501072_0009345_4234_5448 404
434 3300049589 Ga0501073_0005246 Ga0501073_0005246_2539_3870 404
435 3300049590 Ga0501074_0009609 Ga0501074_0009609_2788_4119 404
436 3300049592 Ga0501076_0201359 Ga0501076_0201359_128_1345 404
437 3300049742 Ga0501080_0020873 Ga0501080_0020873_2850_4181 404
438 3300050507 nmdc:mga05p37_2235_c1 nmdc:mga05p37_2235_c1_8876_10090 404
439 3300050508 nmdc:mga09592_142_c1 nmdc:mga09592_142_c1_13997_15211 404
440 3300050510 nmdc:mga06r32_7017_c1 nmdc:mga06r32_7017_c1_8310_9524 404
441 3300050511 nmdc:mga08y16_128288_c1 nmdc:mga08y16_128288_c1_1299_2513 404
442 3300059510 Ga0587090_000148 Ga0587090_000148_1046_2260 404
443 3300059626 Ga0587115_000944 Ga0587115_000944_590_1879 404
444 3300060344 Ga0587071_006610 Ga0587071_006610_383_1672 404
445 3300060346 Ga0587111_0000273 Ga0587111_0000273_2305_3594 404
446 3300060346 Ga0587111_0002885 Ga0587111_0002885_1024_2238 404
447 3300060353 Ga0501082_0264518 Ga0501082_0264518_21_1235 404
448 3300005327 Ga0070658_10199760 Ga0070658_101997601 405
449 3300005328 Ga0070676_10026728 Ga0070676_100267282 405
450 3300005329 Ga0070683_100008026 Ga0070683_1000080266 405
451 3300005330 Ga0070690_100001269 Ga0070690_1000012692 405
452 3300005330 Ga0070690_100011220 Ga0070690_1000112202 405
453 3300005330 Ga0070690_100040592 Ga0070690_1000405923 405
454 3300005331 Ga0070670_100001864 Ga0070670_10000186410 405
455 3300005331 Ga0070670_100055921 Ga0070670_1000559212 405
456 3300005331 Ga0070670_100091813 Ga0070670_1000918133 405
457 3300005331 Ga0070670_100134088 Ga0070670_1001340882 405
458 3300005334 Ga0068869_100023519 Ga0068869_1000235193 405
459 3300005335 Ga0070666_10005718 Ga0070666_100057184 405
460 3300005335 Ga0070666_10006786 Ga0070666_100067863 405
461 3300005337 Ga0070682_100003932 Ga0070682_1000039324 405
462 3300005338 Ga0068868_100006459 Ga0068868_1000064599 405
463 3300005338 Ga0068868_100107819 Ga0068868_1001078192 405
464 3300005338 Ga0068868_100146417 Ga0068868_1001464171 405
465 3300005338 Ga0068868_100185198 Ga0068868_1001851982 405
466 3300005341 Ga0070691_10071661 Ga0070691_100716612 405
467 3300005343 Ga0070687_100010369 Ga0070687_1000103693 405
468 3300005344 Ga0070661_100048336 Ga0070661_1000483362 405
469 3300005345 Ga0070692_10004443 Ga0070692_100044433 405
470 3300005347 Ga0070668_100026383 Ga0070668_1000263832 405
471 3300005347 Ga0070668_100163089 Ga0070668_1001630893 405
472 3300005347 Ga0070668_100168113 Ga0070668_1001681131 405
473 3300005347 Ga0070668_100325493 Ga0070668_1003254931 405
474 3300005353 Ga0070669_100234163 Ga0070669_1002341632 405
475 3300005354 Ga0070675_100003564 Ga0070675_1000035647 405
476 3300005354 Ga0070675_100041586 Ga0070675_1000415866 405
477 3300005354 Ga0070675_100212672 Ga0070675_1002126723 405
478 3300005355 Ga0070671_100008147 Ga0070671_10000814710 405
479 3300005355 Ga0070671_100110669 Ga0070671_1001106693 405
480 3300005356 Ga0070674_100044869 Ga0070674_1000448693 405
481 3300005356 Ga0070674_100049805 Ga0070674_1000498053 405
482 3300005364 Ga0070673_100007890 Ga0070673_1000078903 405
483 3300005364 Ga0070673_100074411 Ga0070673_1000744113 405
484 3300005365 Ga0070688_100010185 Ga0070688_1000101855 405
485 3300005366 Ga0070659_100009086 Ga0070659_1000090866 405
486 3300005366 Ga0070659_100069662 Ga0070659_1000696622 405
487 3300005367 Ga0070667_100029329 Ga0070667_1000293291 405
488 3300005367 Ga0070667_100322758 Ga0070667_1003227582 405
489 3300005435 Ga0070714_100044774 Ga0070714_1000447742 405
490 3300005436 Ga0070713_100098605 Ga0070713_1000986052 405
491 3300005437 Ga0070710_10022467 Ga0070710_100224675 405
492 3300005437 Ga0070710_10146780 Ga0070710_101467802 405
493 3300005438 Ga0070701_10001316 Ga0070701_100013167 405
494 3300005440 Ga0070705_100060945 Ga0070705_1000609454 405
495 3300005455 Ga0070663_100051824 Ga0070663_1000518242 405
496 3300005456 Ga0070678_100124191 Ga0070678_1001241912 405
497 3300005456 Ga0070678_100145135 Ga0070678_1001451352 405
498 3300005459 Ga0068867_100004416 Ga0068867_1000044162 405
499 3300005459 Ga0068867_100020346 Ga0068867_1000203463 405
500 3300005459 Ga0068867_100099615 Ga0068867_1000996152 405
501 3300005459 Ga0068867_100119422 Ga0068867_1001194222 405
502 3300005467 Ga0070706_100035302 Ga0070706_1000353029 405
503 3300005467 Ga0070706_100069013 Ga0070706_1000690132 405
504 3300005467 Ga0070706_100100127 Ga0070706_1001001272 405
505 3300005468 Ga0070707_100098030 Ga0070707_1000980302 405
506 3300005468 Ga0070707_100180343 Ga0070707_1001803432 405
507 3300005468 Ga0070707_100205719 Ga0070707_1002057193 405
508 3300005518 Ga0070699_100010928 Ga0070699_1000109286 405
509 3300005535 Ga0070684_100023441 Ga0070684_1000234413 405
510 3300005536 Ga0070697_100009963 Ga0070697_1000099633 405
511 3300005536 Ga0070697_100127121 Ga0070697_1001271211 405
512 3300005539 Ga0068853_100023977 Ga0068853_1000239773 405
513 3300005539 Ga0068853_100100021 Ga0068853_1001000213 405
514 3300005543 Ga0070672_100039307 Ga0070672_1000393072 405
515 3300005544 Ga0070686_100002477 Ga0070686_1000024777 405
516 3300005545 Ga0070695_100018639 Ga0070695_1000186395 405
517 3300005545 Ga0070695_100038602 Ga0070695_1000386022 405
518 3300005546 Ga0070696_100119446 Ga0070696_1001194462 405
519 3300005547 Ga0070693_100010781 Ga0070693_1000107815 405
520 3300005548 Ga0070665_100006564 Ga0070665_10000656414 405
521 3300005548 Ga0070665_100195446 Ga0070665_1001954462 405
522 3300005549 Ga0070704_100000771 Ga0070704_1000007712 405
523 3300005564 Ga0070664_100072205 Ga0070664_1000722052 405
524 3300005578 Ga0068854_100058275 Ga0068854_1000582752 405
525 3300005614 Ga0068856_100068242 Ga0068856_1000682424 405
526 3300005615 Ga0070702_100063416 Ga0070702_1000634162 405
527 3300005617 Ga0068859_100001882 Ga0068859_10000188220 405
528 3300005617 Ga0068859_100005815 Ga0068859_1000058156 405
529 3300005617 Ga0068859_100131980 Ga0068859_1001319802 405
530 3300005618 Ga0068864_100041930 Ga0068864_1000419302 405
531 3300005618 Ga0068864_100111160 Ga0068864_1001111601 405
532 3300005618 Ga0068864_100211282 Ga0068864_1002112822 405
533 3300005718 Ga0068866_10000235 Ga0068866_100002354 405
534 3300005718 Ga0068866_10004757 Ga0068866_100047574 405
535 3300005719 Ga0068861_100001590 Ga0068861_10000159011 405
536 3300005841 Ga0068863_100010881 Ga0068863_1000108815 405
537 3300005841 Ga0068863_100018240 Ga0068863_1000182402 405
538 3300005841 Ga0068863_100133102 Ga0068863_1001331023 405
539 3300005842 Ga0068858_100001240 Ga0068858_10000124023 405
540 3300005842 Ga0068858_100019754 Ga0068858_1000197542 405
541 3300005842 Ga0068858_100064806 Ga0068858_1000648062 405
542 3300005844 Ga0068862_100048870 Ga0068862_1000488702 405
543 3300005844 Ga0068862_100069381 Ga0068862_1000693814 405
544 3300006173 Ga0070716_100006825 Ga0070716_1000068256 405
545 3300006173 Ga0070716_100081939 Ga0070716_1000819394 405
546 3300006175 Ga0070712_100173613 Ga0070712_1001736133 405
547 3300006237 Ga0097621_100007945 Ga0097621_10000794510 405
548 3300006237 Ga0097621_100018836 Ga0097621_1000188364 405
549 3300006237 Ga0097621_100020501 Ga0097621_1000205015 405
550 3300006237 Ga0097621_100140851 Ga0097621_1001408512 405
551 3300006237 Ga0097621_100291683 Ga0097621_1002916832 405
552 3300006358 Ga0068871_100001034 Ga0068871_1000010343 405
553 3300006358 Ga0068871_100007401 Ga0068871_1000074016 405
554 3300006358 Ga0068871_100221218 Ga0068871_1002212181 405
555 3300006852 Ga0075433_10019262 Ga0075433_100192624 405
556 3300006871 Ga0075434_100067779 Ga0075434_1000677795 405
557 3300006931 Ga0097620_100001882 Ga0097620_1000018824 405
558 3300006931 Ga0097620_100005815 Ga0097620_1000058156 405
559 3300006931 Ga0097620_100131985 Ga0097620_1001319852 405
560 3300007076 Ga0075435_100209101 Ga0075435_1002091011 405
561 3300009093 Ga0105240_10234946 Ga0105240_102349463 405
562 3300009098 Ga0105245_10007616 Ga0105245_100076164 405
563 3300009098 Ga0105245_10170410 Ga0105245_101704102 405
564 3300009098 Ga0105245_10244277 Ga0105245_102442772 405
565 3300009147 Ga0114129_10130741 Ga0114129_101307414 405
566 3300009176 Ga0105242_10000678 Ga0105242_1000067824 405
567 3300009176 Ga0105242_10025972 Ga0105242_100259722 405
568 3300009177 Ga0105248_10243461 Ga0105248_102434612 405
569 3300009551 Ga0105238_10017073 Ga0105238_100170737 405
570 3300009553 Ga0105249_10121009 Ga0105249_101210092 405
571 3300011119 Ga0105246_10067299 Ga0105246_100672991 405
572 3300013104 Ga0157370_10044198 Ga0157370_100441984 405
573 3300013105 Ga0157369_10121265 Ga0157369_101212652 405
574 3300013296 Ga0157374_10223532 Ga0157374_102235322 405
575 3300013297 Ga0157378_10001171 Ga0157378_100011712 405
576 3300013297 Ga0157378_10001515 Ga0157378_1000151511 405
577 3300013297 Ga0157378_10038165 Ga0157378_100381653 405
578 3300013297 Ga0157378_10236588 Ga0157378_102365882 405
579 3300013308 Ga0157375_10199739 Ga0157375_101997392 405
580 3300014325 Ga0163163_10018244 Ga0163163_100182447 405
581 3300014325 Ga0163163_10049808 Ga0163163_100498083 405
582 3300014326 Ga0157380_10001363 Ga0157380_100013637 405
583 3300014968 Ga0157379_10276504 Ga0157379_102765041 405
584 3300014969 Ga0157376_10097207 Ga0157376_100972072 405
585 3300014969 Ga0157376_10101602 Ga0157376_101016022 405
586 3300017792 Ga0163161_10029262 Ga0163161_100292624 405
587 3300025315 Ga0207697_10022989 Ga0207697_100229892 405
588 3300025899 Ga0207642_10001248 Ga0207642_100012486 405
589 3300025899 Ga0207642_10062376 Ga0207642_100623763 405
590 3300025905 Ga0207685_10039432 Ga0207685_100394322 405
591 3300025907 Ga0207645_10039067 Ga0207645_100390674 405
592 3300025908 Ga0207643_10010856 Ga0207643_100108563 405
593 3300025908 Ga0207643_10025228 Ga0207643_100252282 405
594 3300025910 Ga0207684_10033504 Ga0207684_100335045 405
595 3300025915 Ga0207693_10007642 Ga0207693_100076427 405
596 3300025915 Ga0207693_10208681 Ga0207693_102086811 405
597 3300025916 Ga0207663_10002690 Ga0207663_100026902 405
598 3300025918 Ga0207662_10038739 Ga0207662_100387393 405
599 3300025919 Ga0207657_10015062 Ga0207657_100150626 405
600 3300025921 Ga0207652_10029671 Ga0207652_100296715 405
601 3300025922 Ga0207646_10000871 Ga0207646_1000087144 405
602 3300025922 Ga0207646_10258345 Ga0207646_102583453 405
603 3300025923 Ga0207681_10168189 Ga0207681_101681893 405
604 3300025925 Ga0207650_10038645 Ga0207650_100386452 405
605 3300025925 Ga0207650_10041143 Ga0207650_100411432 405
606 3300025925 Ga0207650_10067131 Ga0207650_100671312 405
607 3300025927 Ga0207687_10000559 Ga0207687_1000055916 405
608 3300025927 Ga0207687_10005796 Ga0207687_100057964 405
609 3300025927 Ga0207687_10013830 Ga0207687_100138302 405
610 3300025928 Ga0207700_10081359 Ga0207700_100813592 405
611 3300025929 Ga0207664_10000605 Ga0207664_100006058 405
612 3300025931 Ga0207644_10065567 Ga0207644_100655672 405
613 3300025932 Ga0207690_10017234 Ga0207690_100172345 405
614 3300025933 Ga0207706_10143110 Ga0207706_101431102 405
615 3300025934 Ga0207686_10003959 Ga0207686_100039597 405
616 3300025934 Ga0207686_10040458 Ga0207686_100404583 405
617 3300025937 Ga0207669_10029061 Ga0207669_100290612 405
618 3300025938 Ga0207704_10001080 Ga0207704_100010807 405
619 3300025939 Ga0207665_10006817 Ga0207665_100068176 405
620 3300025939 Ga0207665_10012295 Ga0207665_100122956 405
621 3300025939 Ga0207665_10120728 Ga0207665_101207282 405
622 3300025940 Ga0207691_10031374 Ga0207691_100313746 405
623 3300025941 Ga0207711_10001920 Ga0207711_100019207 405
624 3300025942 Ga0207689_10003389 Ga0207689_1000338913 405
625 3300025945 Ga0207679_10062508 Ga0207679_100625082 405
626 3300025949 Ga0207667_10067062 Ga0207667_100670624 405
627 3300025960 Ga0207651_10123651 Ga0207651_101236512 405
628 3300025972 Ga0207668_10025378 Ga0207668_100253785 405
629 3300025972 Ga0207668_10099570 Ga0207668_100995704 405
630 3300025972 Ga0207668_10144495 Ga0207668_101444953 405
631 3300025972 Ga0207668_10147055 Ga0207668_101470553 405
632 3300025972 Ga0207668_10292218 Ga0207668_102922181 405
633 3300025981 Ga0207640_10064681 Ga0207640_100646812 405
634 3300025986 Ga0207658_10001941 Ga0207658_1000194115 405
635 3300026023 Ga0207677_10000152 Ga0207677_100001526 405
636 3300026023 Ga0207677_10053288 Ga0207677_100532881 405
637 3300026023 Ga0207677_10109554 Ga0207677_101095542 405
638 3300026035 Ga0207703_10001959 Ga0207703_100019598 405
639 3300026035 Ga0207703_10158457 Ga0207703_101584572 405
640 3300026041 Ga0207639_10070808 Ga0207639_100708082 405
641 3300026041 Ga0207639_10089887 Ga0207639_100898873 405
642 3300026067 Ga0207678_10050253 Ga0207678_100502535 405
643 3300026067 Ga0207678_10134735 Ga0207678_101347352 405
644 3300026075 Ga0207708_10000572 Ga0207708_1000057218 405
645 3300026078 Ga0207702_10187145 Ga0207702_101871453 405
646 3300026088 Ga0207641_10289167 Ga0207641_102891672 405
647 3300026089 Ga0207648_10000485 Ga0207648_1000048531 405
648 3300026089 Ga0207648_10005282 Ga0207648_100052826 405
649 3300026089 Ga0207648_10102147 Ga0207648_101021472 405
650 3300026095 Ga0207676_10000751 Ga0207676_1000075122 405
651 3300026095 Ga0207676_10030198 Ga0207676_100301983 405
652 3300026095 Ga0207676_10067316 Ga0207676_100673161 405
653 3300026095 Ga0207676_10091079 Ga0207676_100910792 405
654 3300026116 Ga0207674_10011754 Ga0207674_100117547 405
655 3300026118 Ga0207675_100003172 Ga0207675_1000031727 405
656 3300026118 Ga0207675_100234210 Ga0207675_1002342102 405
657 3300026118 Ga0207675_100281733 Ga0207675_1002817332 405
658 3300026121 Ga0207683_10009180 Ga0207683_1000918010 405
659 3300026121 Ga0207683_10017338 Ga0207683_100173382 405
660 3300026142 Ga0207698_10102133 Ga0207698_101021331 405
661 3300028380 Ga0268265_10056843 Ga0268265_100568432 405
662 3300028380 Ga0268265_10182498 Ga0268265_101824982 405
663 3300028381 Ga0268264_10001723 Ga0268264_100017238 405
664 3300028381 Ga0268264_10161220 Ga0268264_101612202 405
665 3300030521 Ga0307511_10004280 Ga0307511_100042801 405
666 3300031238 Ga0265332_10000528 Ga0265332_1000052826 405
667 3300031250 Ga0265331_10001073 Ga0265331_100010733 405
668 3300031251 Ga0265327_10003590 Ga0265327_1000359016 405
669 3300031251 Ga0265327_10035803 Ga0265327_100358033 405
670 3300031824 Ga0307413_10010491 Ga0307413_100104912 405
671 3300031852 Ga0307410_10021080 Ga0307410_100210805 405
672 3300031901 Ga0307406_10007665 Ga0307406_100076658 405
673 3300031903 Ga0307407_10014060 Ga0307407_100140603 405
674 3300031903 Ga0307407_10174253 Ga0307407_101742531 405
675 3300031911 Ga0307412_10040990 Ga0307412_100409901 405
676 3300031995 Ga0307409_100055292 Ga0307409_1000552922 405
677 3300032004 Ga0307414_10046388 Ga0307414_100463881 405
678 3300035111 Ga0373923_0017482 Ga0373923_0017482_375_1592 405
679 3300035119 Ga0373956_0058833 Ga0373956_0058833_456_1673 405
680 3300035171 Ga0373946_0021591 Ga0373946_0021591_130_1347 405
681 3300035410 Ga0373924_0009013 Ga0373924_0009013_585_1802 405
682 3300035410 Ga0373924_0022634 Ga0373924_0022634_20_1237 405
683 3300035695 Ga0373927_0053739 Ga0373927_0053739_1231_2448 405
684 3300036401 Ga0373937_0023239 Ga0373937_0023239_1879_3096 405
685 3300037068 Ga0373925_0053838 Ga0373925_0053838_152_1369 405
686 3300046539 Ga0495621_0007197 Ga0495621_0007197_1796_3013 405
687 3300046664 Ga0495659_0019768 Ga0495659_0019768_307_1524 405
688 3300048906 Ga0496103_0124972 Ga0496103_0124972_94_1311 405
689 3300048915 Ga0496112_0191155 Ga0496112_0191155_572_1789 405
690 3300049576 Ga0501040_0133105 Ga0501040_0133105_47_1264 405
691 3300050512 nmdc:mga0n895_223519_c1 nmdc:mga0n895_223519_c1_142_1359 405
692 3300050512 nmdc:mga0n895_5375_c1 nmdc:mga0n895_5375_c1_3403_4707 405
693 3300050514 nmdc:mga08x19_122613_c1 nmdc:mga08x19_122613_c1_510_1727 405
694 3300050514 nmdc:mga08x19_218263_c1 nmdc:mga08x19_218263_c1_80_1297 405
695 3300050515 nmdc:mga0a205_30241_c1 nmdc:mga0a205_30241_c1_3770_5074 405
696 3300053092 Ga0500583_0006344 Ga0500583_0006344_1588_2901 405
697 3300053118 Ga0500594_0003858 Ga0500594_0003858_1187_2422 405
698 3300053151 Ga0500604_0002482 Ga0500604_0002482_1568_2884 405
699 3300005335 Ga0070666_10063171 Ga0070666_100631714 406
700 3300005356 Ga0070674_100087970 Ga0070674_1000879703 406
701 3300005456 Ga0070678_100030786 Ga0070678_1000307862 406
702 3300005458 Ga0070681_10030114 Ga0070681_100301143 406
703 3300005530 Ga0070679_100135837 Ga0070679_1001358374 406
704 3300005548 Ga0070665_100004969 Ga0070665_1000049694 406
705 3300005563 Ga0068855_100288881 Ga0068855_1002888812 406
706 3300005577 Ga0068857_100207739 Ga0068857_1002077391 406
707 3300009551 Ga0105238_10166478 Ga0105238_101664781 406
708 3300013100 Ga0157373_10016441 Ga0157373_100164412 406
709 3300025912 Ga0207707_10002100 Ga0207707_100021002 406
710 3300025920 Ga0207649_10044346 Ga0207649_100443462 406
711 3300025921 Ga0207652_10006566 Ga0207652_100065663 406
712 3300025921 Ga0207652_10146000 Ga0207652_101460003 406
713 3300025924 Ga0207694_10223066 Ga0207694_102230661 406
714 3300025937 Ga0207669_10084444 Ga0207669_100844441 406
715 3300025945 Ga0207679_10096757 Ga0207679_100967572 406
716 3300028379 Ga0268266_10081529 Ga0268266_100815291 406
717 3300044712 Ga0453684_0287591 Ga0453684_0287591_327_1547 406
718 3300049583 Ga0501067_0011453 Ga0501067_0011453_1646_2953 406
719 3300049585 Ga0501069_0075632 Ga0501069_0075632_263_1570 406
720 3300049586 Ga0501070_0057313 Ga0501070_0057313_510_1817 406
721 3300049588 Ga0501072_0007467 Ga0501072_0007467_498_1805 406
722 3300049590 Ga0501074_0038867 Ga0501074_0038867_267_1574 406
723 3300049742 Ga0501080_0047422 Ga0501080_0047422_1048_2355 406
724 3300050513 nmdc:mga0rr50_80429_c1 nmdc:mga0rr50_80429_c1_339_1559 406
725 3300025940 Ga0207691_10043038 Ga0207691_100430382 408
726 3300005327 Ga0070658_10042776 Ga0070658_100427763 409
727 3300005327 Ga0070658_10069033 Ga0070658_100690335 409
728 3300005329 Ga0070683_100026330 Ga0070683_1000263303 409
729 3300005335 Ga0070666_10134793 Ga0070666_101347933 409
730 3300005337 Ga0070682_100196090 Ga0070682_1001960901 409
731 3300005339 Ga0070660_100036493 Ga0070660_1000364932 409
732 3300005344 Ga0070661_100041448 Ga0070661_1000414482 409
733 3300005344 Ga0070661_100229722 Ga0070661_1002297222 409
734 3300005353 Ga0070669_100074012 Ga0070669_1000740122 409
735 3300005366 Ga0070659_100048477 Ga0070659_1000484774 409
736 3300005435 Ga0070714_100133240 Ga0070714_1001332403 409
737 3300005458 Ga0070681_10006372 Ga0070681_100063727 409
738 3300005458 Ga0070681_10157994 Ga0070681_101579941 409
739 3300005535 Ga0070684_100038983 Ga0070684_1000389833 409
740 3300005539 Ga0068853_100289300 Ga0068853_1002893001 409
741 3300005543 Ga0070672_100010958 Ga0070672_1000109584 409
742 3300005564 Ga0070664_100038834 Ga0070664_1000388342 409
743 3300005614 Ga0068856_100003437 Ga0068856_1000034377 409
744 3300005614 Ga0068856_100056071 Ga0068856_1000560714 409
745 3300005834 Ga0068851_10028942 Ga0068851_100289422 409
746 3300005844 Ga0068862_100180010 Ga0068862_1001800102 409
747 3300009177 Ga0105248_10005206 Ga0105248_1000520615 409
748 3300009545 Ga0105237_10211289 Ga0105237_102112893 409
749 3300013100 Ga0157373_10046914 Ga0157373_100469144 409
750 3300013102 Ga0157371_10015868 Ga0157371_100158683 409
751 3300013297 Ga0157378_10194720 Ga0157378_101947204 409
752 3300013307 Ga0157372_10013385 Ga0157372_100133852 409
753 3300013307 Ga0157372_10058819 Ga0157372_100588195 409
754 3300025321 Ga0207656_10018132 Ga0207656_100181322 409
755 3300025903 Ga0207680_10165519 Ga0207680_101655192 409
756 3300025912 Ga0207707_10022716 Ga0207707_100227162 409
757 3300025917 Ga0207660_10034109 Ga0207660_100341092 409
758 3300025921 Ga0207652_10033920 Ga0207652_100339202 409
759 3300025924 Ga0207694_10036238 Ga0207694_100362384 409
760 3300025929 Ga0207664_10178478 Ga0207664_101784781 409
761 3300025931 Ga0207644_10010312 Ga0207644_100103124 409
762 3300025932 Ga0207690_10127122 Ga0207690_101271222 409
763 3300025933 Ga0207706_10103577 Ga0207706_101035772 409
764 3300025940 Ga0207691_10041415 Ga0207691_100414153 409
765 3300025949 Ga0207667_10114184 Ga0207667_101141842 409
766 3300026067 Ga0207678_10049849 Ga0207678_100498492 409
767 3300026078 Ga0207702_10013104 Ga0207702_100131044 409
768 3300026078 Ga0207702_10039964 Ga0207702_100399643 409
769 3300026116 Ga0207674_10004995 Ga0207674_100049956 409
770 3300026118 Ga0207675_100108523 Ga0207675_1001085232 409
771 3300026142 Ga0207698_10075124 Ga0207698_100751244 409
772 3300037418 Ga0395900_0167570 Ga0395900_0167570_691_1920 409
773 3300038443 Ga0395901_0133174 Ga0395901_0133174_1240_2469 409
774 3300005347 Ga0070668_100058146 Ga0070668_1000581464 410
775 3300005354 Ga0070675_100027326 Ga0070675_1000273264 410
776 3300005356 Ga0070674_100127207 Ga0070674_1001272072 410
777 3300005436 Ga0070713_100059304 Ga0070713_1000593042 410
778 3300005834 Ga0068851_10056336 Ga0068851_100563362 410
779 3300006237 Ga0097621_100322331 Ga0097621_1003223311 410
780 3300009093 Ga0105240_10025784 Ga0105240_100257842 410
781 3300013104 Ga0157370_10012909 Ga0157370_100129092 410
782 3300013307 Ga0157372_10046607 Ga0157372_100466074 410
783 3300025913 Ga0207695_10093070 Ga0207695_100930704 410
784 3300025917 Ga0207660_10209295 Ga0207660_102092951 410
785 3300025921 Ga0207652_10203168 Ga0207652_102031681 410
786 3300025926 Ga0207659_10016272 Ga0207659_100162723 410
787 3300025972 Ga0207668_10051096 Ga0207668_100510964 410
788 3300025986 Ga0207658_10161122 Ga0207658_101611222 410
789 3300006358 Ga0068871_100122459 Ga0068871_1001224592 412
790 3300017792 Ga0163161_10146738 Ga0163161_101467382 412
791 3300026089 Ga0207648_10046896 Ga0207648_100468961 412
792 3300026121 Ga0207683_10005924 Ga0207683_100059246 412
793 3300031456 Ga0307513_10084969 Ga0307513_100849692 412
794 3300025921 Ga0207652_10195810 Ga0207652_101958102 413
795 3300005344 Ga0070661_100005962 Ga0070661_1000059624 414
796 3300005435 Ga0070714_100004937 Ga0070714_1000049377 414
797 3300005458 Ga0070681_10036353 Ga0070681_100363533 414
798 3300005530 Ga0070679_100123561 Ga0070679_1001235614 414
799 3300005535 Ga0070684_100044391 Ga0070684_1000443913 414
800 3300005535 Ga0070684_100054381 Ga0070684_1000543812 414
801 3300005563 Ga0068855_100008469 Ga0068855_1000084696 414
802 3300005564 Ga0070664_100041725 Ga0070664_1000417253 414
803 3300005564 Ga0070664_100137256 Ga0070664_1001372562 414
804 3300005564 Ga0070664_100204365 Ga0070664_1002043652 414
805 3300005577 Ga0068857_100002553 Ga0068857_1000025538 414
806 3300005614 Ga0068856_100009915 Ga0068856_1000099155 414
807 3300009093 Ga0105240_10010466 Ga0105240_100104667 414
808 3300009174 Ga0105241_10110536 Ga0105241_101105362 414
809 3300009551 Ga0105238_10003490 Ga0105238_1000349012 414
810 3300013100 Ga0157373_10017574 Ga0157373_100175746 414
811 3300013105 Ga0157369_10007438 Ga0157369_100074388 414
812 3300013307 Ga0157372_10012456 Ga0157372_100124567 414
813 3300025906 Ga0207699_10136314 Ga0207699_101363143 414
814 3300025909 Ga0207705_10041011 Ga0207705_100410112 414
815 3300025911 Ga0207654_10061234 Ga0207654_100612342 414
816 3300025912 Ga0207707_10029710 Ga0207707_100297104 414
817 3300025913 Ga0207695_10017610 Ga0207695_100176105 414
818 3300025919 Ga0207657_10054888 Ga0207657_100548882 414
819 3300025920 Ga0207649_10005296 Ga0207649_100052963 414
820 3300025924 Ga0207694_10004100 Ga0207694_100041008 414
821 3300025929 Ga0207664_10236546 Ga0207664_102365461 414
822 3300025933 Ga0207706_10125100 Ga0207706_101251002 414
823 3300025944 Ga0207661_10026917 Ga0207661_100269173 414
824 3300025945 Ga0207679_10003681 Ga0207679_100036818 414
825 3300025949 Ga0207667_10022843 Ga0207667_100228432 414
826 3300025949 Ga0207667_10047894 Ga0207667_100478942 414
827 3300026078 Ga0207702_10005129 Ga0207702_100051294 414
828 3300026116 Ga0207674_10000089 Ga0207674_1000008974 414
829 3300001976 JGI24752J21851_1003320 JGI24752J21851_10033202 415
830 3300005329 Ga0070683_100093821 Ga0070683_1000938211 415
831 3300005329 Ga0070683_100196290 Ga0070683_1001962902 415
832 3300005331 Ga0070670_100030573 Ga0070670_1000305735 415
833 3300005333 Ga0070677_10009478 Ga0070677_100094784 415
834 3300005334 Ga0068869_100013703 Ga0068869_1000137032 415
835 3300005339 Ga0070660_100108394 Ga0070660_1001083942 415
836 3300005340 Ga0070689_100056782 Ga0070689_1000567822 415
837 3300005344 Ga0070661_100063541 Ga0070661_1000635412 415
838 3300005344 Ga0070661_100209646 Ga0070661_1002096461 415
839 3300005356 Ga0070674_100025562 Ga0070674_1000255621 415
840 3300005365 Ga0070688_100018508 Ga0070688_1000185083 415
841 3300005366 Ga0070659_100079596 Ga0070659_1000795964 415
842 3300005438 Ga0070701_10083175 Ga0070701_100831752 415
843 3300005441 Ga0070700_100077756 Ga0070700_1000777562 415
844 3300005466 Ga0070685_10002126 Ga0070685_100021268 415
845 3300005539 Ga0068853_100097097 Ga0068853_1000970974 415
846 3300005544 Ga0070686_100070789 Ga0070686_1000707893 415
847 3300005564 Ga0070664_100013598 Ga0070664_1000135982 415
848 3300005577 Ga0068857_100136170 Ga0068857_1001361704 415
849 3300005616 Ga0068852_100237701 Ga0068852_1002377011 415
850 3300005618 Ga0068864_100130887 Ga0068864_1001308872 415
851 3300005718 Ga0068866_10003590 Ga0068866_100035905 415
852 3300005840 Ga0068870_10003940 Ga0068870_100039402 415
853 3300005842 Ga0068858_100029119 Ga0068858_1000291191 415
854 3300005844 Ga0068862_100140044 Ga0068862_1001400443 415
855 3300009176 Ga0105242_10157199 Ga0105242_101571993 415
856 3300010375 Ga0105239_10138351 Ga0105239_101383512 415
857 3300011119 Ga0105246_10109532 Ga0105246_101095322 415
858 3300013105 Ga0157369_10291553 Ga0157369_102915532 415
859 3300013296 Ga0157374_10022424 Ga0157374_100224242 415
860 3300014326 Ga0157380_10278953 Ga0157380_102789532 415
861 3300014968 Ga0157379_10102662 Ga0157379_101026623 415
862 3300025315 Ga0207697_10001831 Ga0207697_100018316 415
863 3300025893 Ga0207682_10002492 Ga0207682_100024923 415
864 3300025903 Ga0207680_10046659 Ga0207680_100466595 415
865 3300025907 Ga0207645_10008107 Ga0207645_100081075 415
866 3300025908 Ga0207643_10000285 Ga0207643_100002852 415
867 3300025909 Ga0207705_10064646 Ga0207705_100646465 415
868 3300025918 Ga0207662_10003360 Ga0207662_100033603 415
869 3300025919 Ga0207657_10038120 Ga0207657_100381205 415
870 3300025923 Ga0207681_10052343 Ga0207681_100523432 415
871 3300025925 Ga0207650_10012257 Ga0207650_100122574 415
872 3300025931 Ga0207644_10008061 Ga0207644_100080614 415
873 3300025933 Ga0207706_10006730 Ga0207706_100067303 415
874 3300025940 Ga0207691_10109071 Ga0207691_101090712 415
875 3300025942 Ga0207689_10057750 Ga0207689_100577502 415
876 3300025945 Ga0207679_10188558 Ga0207679_101885582 415
877 3300025981 Ga0207640_10185926 Ga0207640_101859261 415
878 3300026035 Ga0207703_10033462 Ga0207703_100334623 415
879 3300026075 Ga0207708_10092211 Ga0207708_100922112 415
880 3300026089 Ga0207648_10022516 Ga0207648_100225164 415
881 3300026116 Ga0207674_10002196 Ga0207674_1000219620 415
882 3300026118 Ga0207675_100000376 Ga0207675_10000037638 415
883 3300026121 Ga0207683_10037993 Ga0207683_100379935 415
884 3300028379 Ga0268266_10057382 Ga0268266_100573822 415
885 3300046472 Ga0495580_0179195 Ga0495580_0179195_104_1351 415
886 3300048908 Ga0496105_0047121 Ga0496105_0047121_133_1380 415
887 3300048909 Ga0496106_0146477 Ga0496106_0146477_288_1535 415
888 3300048910 Ga0496107_0026851 Ga0496107_0026851_275_1522 415
889 3300048911 Ga0496108_0024922 Ga0496108_0024922_3288_4535 415
890 3300048912 Ga0496109_0006173 Ga0496109_0006173_194_1441 415
891 3300048917 Ga0496114_0224788 Ga0496114_0224788_33_1280 415
892 3300050511 nmdc:mga08y16_255611_c1 nmdc:mga08y16_255611_c1_163_1410 415

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

66

433

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ii0-assembly6.cif.gz_C crystal structure of human glutamate oxaloacetate transaminase 1 (got1) 0.9826 21 402
8e9v-assembly1.cif.gz_B crystal structure of e. coli aspartate aminotransferase mutant vfit in the ligand-free form at 303 k 0.9804 10 401
8e9u-assembly1.cif.gz_B crystal structure of e. coli aspartate aminotransferase mutant hex in the ligand-free form at 303 k 0.9803 7 401
8e9o-assembly1.cif.gz_B crystal structure of e. coli aspartate aminotransferase mutant vfiy bound to maleic acid at 278 k 0.9799 7 401
4dbc-assembly1.cif.gz_A-2 substrate activation in aspartate aminotransferase 0.9792 9 401
ID Description Score Start End Superfamily
af_P04693_310_397_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9845 317 401 3.90.1150.10
4f4eB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9827 69 308 3.40.640.10
af_Q7ZUW8_47_325_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9778 54 321 3.40.640.10
af_O42652_49_324_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9751 54 321 3.40.640.10
3ii0A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9746 323 401 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A484V252-F1-model_v4 Aspartate aminotransferase (EC 2.6.1.1) 0.9846 7 402 GO:0004069
GO:0004838
GO:0005829
GO:0030170
GO:0033585
GO:0042802
AF-A0A3E2B7U4-F1-model_v4 deleted 0.9843 9 402
AF-A0A1I8API5-F1-model_v4 Aspartate aminotransferase (EC 2.6.1.1) 0.9843 57 399 GO:0004069
GO:0004838
GO:0005829
GO:0016747
GO:0030170
GO:0033585
GO:0042802
AF-A0A379FLZ3-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9836 9 402 GO:0004838
GO:0005829
GO:0030170
GO:0033585
GO:0042802
AF-A0A3M3KDY0-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9828 1 401 GO:0004838
GO:0005829
GO:0030170
GO:0033585
GO:0042802

Feature Viewer

pLDDT pTM Quality
91.38 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map