F484896
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 892 | 416 | 819 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300046543|Ga0495645_0027114|Ga0495645_0027114_817_1749 |
| Length | 310 |
| Sequence | MVGPPRHQITRRGQPALARRPLLRPDPVVYAAHMGMPRRIALGQLPVSPDPAVNLTRVQVALADAAAGGASLAVFPEATQARFGTDLQAVAEPLDGPFGAGLAGAARGTGVALVAGVFEPAPDGRVYNTAVGYDAAGQRVAAYRKIHLFDSLGETESKVVAPGSAPVLADLAGLRVGLLTCYDIRFPELARSLVAQGADLLVVPAAWAAGLFKEEHWVTLVRARAIENTVWVAAAGQVPDPASPRTRAPTGIGRSMLVDPMGTVRLDLGPFPGMAVGEIDTALTARVRDALPCLEHRREDVFGPAAGHGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 3 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 4 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 5 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 6 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 7 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 8 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 9 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 10 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 11 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 12 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 13 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 14 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 15 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 16 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 17 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 18 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 19 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 20 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 21 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 22 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 23 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 24 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 25 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 26 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 27 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 28 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 29 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 30 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 31 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 32 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 33 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 34 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 35 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 36 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 37 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 38 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 39 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 40 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 41 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 42 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 43 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 44 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 45 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 46 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 47 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 48 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 49 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 50 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 51 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 52 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 53 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 54 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 55 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 56 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 57 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 58 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 59 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 60 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 61 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 62 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 63 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 64 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 65 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 66 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 67 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 68 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 69 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 70 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 71 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 72 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 73 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 74 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 75 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 77 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 78 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 79 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 80 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 82 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 85 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 87 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 106 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 111 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 113 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 119 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 121 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 122 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 123 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 125 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 126 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 127 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 128 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 129 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 130 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 131 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 136 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 137 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 138 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 139 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 141 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 142 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 143 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 159 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 176 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 177 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 235 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 243 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 244 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 246 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 249 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 261 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 270 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 274 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 276 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 280 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 281 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 282 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 283 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 284 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 285 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 288 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 289 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 290 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 359 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 360 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 361 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 362 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 363 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 366 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 367 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 368 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 369 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 370 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 371 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 372 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 373 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 374 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 375 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 376 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 377 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 378 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 379 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 380 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 381 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 410 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 411 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 412 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 413 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 414 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 415 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 416 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.14 |
| Metatranscriptomes | 0.67 |
| Isolates | 8.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.22 |
| Bulb | 0.11 |
| Endosphere | 2.58 |
| Nodule | 0.11 |
| Rhizoplane | 8.86 |
| Rhizosphere | 79.26 |
| Stem | 0 |
| Stem Tuber | 0.56 |
| Unclassified | 8.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C7199 | 2010549000 | Bacteria | 2551 |
| 2 | JGI24739J22299_10003841 | 3300001989 | Bacteria | 5732 |
| 3 | JGI25158J39367_1002551 | 3300002739 | Bacteria | 2941 |
| 4 | JGI25159J45721_1000026 | 3300002987 | Bacteria | 114104 |
| 5 | JGI25160J50197_1000013 | 3300003354 | Bacteria | 263367 |
| 6 | JGI25161J50226_1000926 | 3300003374 | Bacteria | 10521 |
| 7 | Ga0055529_1002427 | 3300003763 | Bacteria | 3622 |
| 8 | Ga0055536_1011284 | 3300003781 | Bacteria | 3443 |
| 9 | Ga0058692_1000074 | 3300003856 | Bacteria | 75738 |
| 10 | Ga0058692_1001321 | 3300003856 | Bacteria | 9300 |
| 11 | Ga0058692_1003259 | 3300003856 | Bacteria | 5078 |
| 12 | Ga0058692_1005996 | 3300003856 | Bacteria | 3391 |
| 13 | Ga0055543_1000132 | 3300004625 | Bacteria | 61786 |
| 14 | Ga0065165_1000021 | 3300005262 | Bacteria | 262983 |
| 15 | Ga0070658_10000228 | 3300005327 | Bacteria | 49676 |
| 16 | Ga0070658_10246953 | 3300005327 | Bacteria | 1514 |
| 17 | Ga0070690_100163860 | 3300005330 | Bacteria | 1525 |
| 18 | Ga0070677_10190406 | 3300005333 | Bacteria | 983 |
| 19 | Ga0070666_10073526 | 3300005335 | Bacteria | 2328 |
| 20 | Ga0068868_100040999 | 3300005338 | Bacteria | 3605 |
| 21 | Ga0070660_100183977 | 3300005339 | Bacteria | 1691 |
| 22 | Ga0070689_100090525 | 3300005340 | Bacteria | 2411 |
| 23 | Ga0070687_100018464 | 3300005343 | Bacteria | 3227 |
| 24 | Ga0070668_100010302 | 3300005347 | Bacteria | 6941 |
| 25 | Ga0070671_100090724 | 3300005355 | Bacteria | 2558 |
| 26 | Ga0070674_100161998 | 3300005356 | Bacteria | 1698 |
| 27 | Ga0070673_100047481 | 3300005364 | Bacteria | 3341 |
| 28 | Ga0070688_100224395 | 3300005365 | Bacteria | 1326 |
| 29 | Ga0070659_100130011 | 3300005366 | Bacteria | 2044 |
| 30 | Ga0070659_100382883 | 3300005366 | Bacteria | 1185 |
| 31 | Ga0070667_100267977 | 3300005367 | Bacteria | 1531 |
| 32 | Ga0070709_10006893 | 3300005434 | Bacteria | 6204 |
| 33 | Ga0070709_10013984 | 3300005434 | Bacteria | 4528 |
| 34 | Ga0070709_10087492 | 3300005434 | Bacteria | 2047 |
| 35 | Ga0070709_10099374 | 3300005434 | Bacteria | 1935 |
| 36 | Ga0070709_10100478 | 3300005434 | Bacteria | 1926 |
| 37 | Ga0070709_10141140 | 3300005434 | Bacteria | 1655 |
| 38 | Ga0070709_10226095 | 3300005434 | Bacteria | 1337 |
| 39 | Ga0070714_100006364 | 3300005435 | Bacteria | 9109 |
| 40 | Ga0070714_100013140 | 3300005435 | Bacteria | 6629 |
| 41 | Ga0070714_100034525 | 3300005435 | Bacteria | 4235 |
| 42 | Ga0070714_100177646 | 3300005435 | Bacteria | 1935 |
| 43 | Ga0070714_100189200 | 3300005435 | Bacteria | 1877 |
| 44 | Ga0070714_100250862 | 3300005435 | Bacteria | 1636 |
| 45 | Ga0070714_100326359 | 3300005435 | Bacteria | 1436 |
| 46 | Ga0070714_100373752 | 3300005435 | Bacteria | 1342 |
| 47 | Ga0070713_100012739 | 3300005436 | Bacteria | 6179 |
| 48 | Ga0070713_100023274 | 3300005436 | Bacteria | 4804 |
| 49 | Ga0070713_100173060 | 3300005436 | Bacteria | 1935 |
| 50 | Ga0070710_10003256 | 3300005437 | Bacteria | 7698 |
| 51 | Ga0070710_10010458 | 3300005437 | Bacteria | 4560 |
| 52 | Ga0070710_10013641 | 3300005437 | Bacteria | 4076 |
| 53 | Ga0070710_10067800 | 3300005437 | Bacteria | 2048 |
| 54 | Ga0070710_10078106 | 3300005437 | Bacteria | 1925 |
| 55 | Ga0070710_10100036 | 3300005437 | Bacteria | 1725 |
| 56 | Ga0070711_100012223 | 3300005439 | Bacteria | 5358 |
| 57 | Ga0070711_100018699 | 3300005439 | Bacteria | 4429 |
| 58 | Ga0070711_100122385 | 3300005439 | Bacteria | 1926 |
| 59 | Ga0070711_100276269 | 3300005439 | Bacteria | 1327 |
| 60 | Ga0070700_100041611 | 3300005441 | Bacteria | 2817 |
| 61 | Ga0070694_100117670 | 3300005444 | Bacteria | 1902 |
| 62 | Ga0070708_100002499 | 3300005445 | Bacteria | 14189 |
| 63 | Ga0070708_100122769 | 3300005445 | Bacteria | 2398 |
| 64 | Ga0070663_100079030 | 3300005455 | Bacteria | 2412 |
| 65 | Ga0070662_100029335 | 3300005457 | Bacteria | 3839 |
| 66 | Ga0070662_100058765 | 3300005457 | Bacteria | 2799 |
| 67 | Ga0070681_10035795 | 3300005458 | Bacteria | 4986 |
| 68 | Ga0070706_100012251 | 3300005467 | Bacteria | 7947 |
| 69 | Ga0070706_100045554 | 3300005467 | Bacteria | 4051 |
| 70 | Ga0070706_100098000 | 3300005467 | Bacteria | 2723 |
| 71 | Ga0070706_100491012 | 3300005467 | Bacteria | 1142 |
| 72 | Ga0070707_100000127 | 3300005468 | Bacteria | 71273 |
| 73 | Ga0070707_100005476 | 3300005468 | Bacteria | 11869 |
| 74 | Ga0070707_100047143 | 3300005468 | Bacteria | 4125 |
| 75 | Ga0070707_100105675 | 3300005468 | Bacteria | 2730 |
| 76 | Ga0070707_100197599 | 3300005468 | Bacteria | 1960 |
| 77 | Ga0070707_100238481 | 3300005468 | Bacteria | 1770 |
| 78 | Ga0070698_100000597 | 3300005471 | Bacteria | 38839 |
| 79 | Ga0070698_100001111 | 3300005471 | Bacteria | 29683 |
| 80 | Ga0070698_100015856 | 3300005471 | Bacteria | 7958 |
| 81 | Ga0070698_100070265 | 3300005471 | Bacteria | 3513 |
| 82 | Ga0070699_100211551 | 3300005518 | Bacteria | 1726 |
| 83 | Ga0070684_100187419 | 3300005535 | Bacteria | 1882 |
| 84 | Ga0070684_100257898 | 3300005535 | Bacteria | 1594 |
| 85 | Ga0070684_100277689 | 3300005535 | Bacteria | 1534 |
| 86 | Ga0070697_100160824 | 3300005536 | Bacteria | 1897 |
| 87 | Ga0068853_100059551 | 3300005539 | Bacteria | 3299 |
| 88 | Ga0070686_100099316 | 3300005544 | Bacteria | 1963 |
| 89 | Ga0070695_100133801 | 3300005545 | Bacteria | 1711 |
| 90 | Ga0070696_100036096 | 3300005546 | Bacteria | 3406 |
| 91 | Ga0070693_100045748 | 3300005547 | Bacteria | 2482 |
| 92 | Ga0070693_100267772 | 3300005547 | Bacteria | 1139 |
| 93 | Ga0070665_100800828 | 3300005548 | Unclassified | 955 |
| 94 | Ga0068855_100012535 | 3300005563 | Bacteria | 10230 |
| 95 | Ga0068855_100151405 | 3300005563 | Bacteria | 2638 |
| 96 | Ga0068855_100442921 | 3300005563 | Bacteria | 1418 |
| 97 | Ga0070664_100107971 | 3300005564 | Bacteria | 2426 |
| 98 | Ga0068857_100295364 | 3300005577 | Bacteria | 1493 |
| 99 | Ga0068854_100258875 | 3300005578 | Bacteria | 1392 |
| 100 | Ga0068854_100325682 | 3300005578 | Bacteria | 1250 |
| 101 | Ga0068854_100375522 | 3300005578 | Bacteria | 1170 |
| 102 | Ga0068856_100143534 | 3300005614 | Bacteria | 2395 |
| 103 | Ga0068856_100248806 | 3300005614 | Bacteria | 1793 |
| 104 | Ga0070702_100007313 | 3300005615 | Bacteria | 5282 |
| 105 | Ga0068859_100265256 | 3300005617 | Bacteria | 1809 |
| 106 | Ga0068864_100167239 | 3300005618 | Bacteria | 2003 |
| 107 | Ga0068864_100239190 | 3300005618 | Bacteria | 1682 |
| 108 | Ga0068861_100186722 | 3300005719 | Bacteria | 1729 |
| 109 | Ga0068861_100235500 | 3300005719 | Bacteria | 1555 |
| 110 | Ga0068863_100140133 | 3300005841 | Bacteria | 2311 |
| 111 | Ga0068863_100174675 | 3300005841 | Bacteria | 2061 |
| 112 | Ga0068863_100692142 | 3300005841 | Bacteria | 1013 |
| 113 | Ga0068858_100394263 | 3300005842 | Bacteria | 1329 |
| 114 | Ga0068860_100038155 | 3300005843 | Bacteria | 4596 |
| 115 | Ga0081540_1000607 | 3300005983 | Bacteria | 34146 |
| 116 | Ga0070717_10035786 | 3300006028 | Bacteria | 4023 |
| 117 | Ga0070717_10038025 | 3300006028 | Bacteria | 3910 |
| 118 | Ga0070717_10089211 | 3300006028 | Bacteria | 2600 |
| 119 | Ga0070717_10120059 | 3300006028 | Bacteria | 2251 |
| 120 | Ga0070717_10280615 | 3300006028 | Bacteria | 1477 |
| 121 | Ga0070717_10346515 | 3300006028 | Bacteria | 1327 |
| 122 | Ga0070715_10013346 | 3300006163 | Bacteria | 3015 |
| 123 | Ga0070715_10019017 | 3300006163 | Bacteria | 2627 |
| 124 | Ga0070715_10042184 | 3300006163 | Bacteria | 1916 |
| 125 | Ga0070716_100000033 | 3300006173 | Bacteria | 57092 |
| 126 | Ga0070716_100003740 | 3300006173 | Bacteria | 7203 |
| 127 | Ga0070716_100007664 | 3300006173 | Bacteria | 5326 |
| 128 | Ga0070716_100014428 | 3300006173 | Bacteria | 4046 |
| 129 | Ga0070716_100069817 | 3300006173 | Bacteria | 2060 |
| 130 | Ga0070716_100081178 | 3300006173 | Bacteria | 1935 |
| 131 | Ga0070716_100099505 | 3300006173 | Bacteria | 1779 |
| 132 | Ga0070712_100013295 | 3300006175 | Bacteria | 5257 |
| 133 | Ga0075370_10196546 | 3300006353 | Unclassified | 1189 |
| 134 | Ga0068871_100055167 | 3300006358 | Bacteria | 3225 |
| 135 | Ga0075433_10048108 | 3300006852 | Bacteria | 3708 |
| 136 | Ga0075433_10056908 | 3300006852 | Bacteria | 3417 |
| 137 | Ga0075434_100124282 | 3300006871 | Bacteria | 2597 |
| 138 | Ga0075434_100128530 | 3300006871 | Bacteria | 2551 |
| 139 | Ga0097620_100265239 | 3300006931 | Bacteria | 1809 |
| 140 | Ga0075435_100080504 | 3300007076 | Bacteria | 2674 |
| 141 | Ga0099794_10154508 | 3300007265 | Bacteria | 1165 |
| 142 | Ga0099795_10034876 | 3300007788 | Bacteria | 1756 |
| 143 | Ga0105251_10030726 | 3300009011 | Bacteria | 2694 |
| 144 | Ga0105244_10000006 | 3300009036 | Bacteria | 357997 |
| 145 | Ga0105244_10000289 | 3300009036 | Bacteria | 49668 |
| 146 | Ga0105244_10003529 | 3300009036 | Bacteria | 11115 |
| 147 | Ga0105244_10007132 | 3300009036 | Bacteria | 7142 |
| 148 | Ga0105244_10009637 | 3300009036 | Bacteria | 5917 |
| 149 | Ga0105244_10058879 | 3300009036 | Bacteria | 1937 |
| 150 | Ga0105250_10000003 | 3300009092 | Bacteria | 547770 |
| 151 | Ga0105250_10000255 | 3300009092 | Bacteria | 44136 |
| 152 | Ga0105250_10008174 | 3300009092 | Bacteria | 4456 |
| 153 | Ga0105240_10062261 | 3300009093 | Bacteria | 4646 |
| 154 | Ga0105240_10293906 | 3300009093 | Bacteria | 1861 |
| 155 | Ga0111539_10020866 | 3300009094 | Bacteria | 8067 |
| 156 | Ga0105245_10341041 | 3300009098 | Bacteria | 1482 |
| 157 | Ga0105247_10074403 | 3300009101 | Bacteria | 2130 |
| 158 | Ga0114129_10002251 | 3300009147 | Bacteria | 26657 |
| 159 | Ga0105243_10015921 | 3300009148 | Bacteria | 5688 |
| 160 | Ga0105243_10185776 | 3300009148 | Bacteria | 1811 |
| 161 | Ga0105242_10191874 | 3300009176 | Bacteria | 1809 |
| 162 | Ga0105248_10206676 | 3300009177 | Bacteria | 2212 |
| 163 | Ga0105237_10076284 | 3300009545 | Bacteria | 3343 |
| 164 | Ga0105238_10337601 | 3300009551 | Bacteria | 1494 |
| 165 | Ga0105239_10044658 | 3300010375 | Bacteria | 4857 |
| 166 | Ga0105246_10056693 | 3300011119 | Bacteria | 2709 |
| 167 | Ga0157344_1001748 | 3300012476 | Bacteria | 1076 |
| 168 | Ga0157373_10001089 | 3300013100 | Bacteria | 20928 |
| 169 | Ga0157373_10009629 | 3300013100 | Bacteria | 7130 |
| 170 | Ga0157373_10033991 | 3300013100 | Bacteria | 3663 |
| 171 | Ga0157371_10002939 | 3300013102 | Bacteria | 15892 |
| 172 | Ga0157371_10044825 | 3300013102 | Bacteria | 3149 |
| 173 | Ga0157371_10098415 | 3300013102 | Bacteria | 2074 |
| 174 | Ga0157371_10133227 | 3300013102 | Bacteria | 1768 |
| 175 | Ga0157370_10000320 | 3300013104 | Bacteria | 60398 |
| 176 | Ga0157370_10002483 | 3300013104 | Bacteria | 22235 |
| 177 | Ga0157370_10012210 | 3300013104 | Bacteria | 8928 |
| 178 | Ga0157370_10202944 | 3300013104 | Bacteria | 1839 |
| 179 | Ga0157369_10011430 | 3300013105 | Bacteria | 10083 |
| 180 | Ga0157374_10052816 | 3300013296 | Bacteria | 3787 |
| 181 | Ga0157372_10000880 | 3300013307 | Bacteria | 32652 |
| 182 | Ga0157372_10144281 | 3300013307 | Bacteria | 2745 |
| 183 | Ga0157372_10367631 | 3300013307 | Bacteria | 1676 |
| 184 | Ga0157375_10761197 | 3300013308 | Bacteria | 1119 |
| 185 | Ga0163163_10112678 | 3300014325 | Bacteria | 2750 |
| 186 | Ga0157379_10259662 | 3300014968 | Bacteria | 1578 |
| 187 | Ga0182006_1004488 | 3300015261 | Bacteria | 6872 |
| 188 | Ga0182006_1027933 | 3300015261 | Bacteria | 2299 |
| 189 | Ga0182007_10011714 | 3300015262 | Bacteria | 3404 |
| 190 | Ga0163161_10358412 | 3300017792 | Bacteria | 1161 |
| 191 | Ga0197907_11138267 | 3300020069 | Bacteria | 1183 |
| 192 | Ga0206356_11018721 | 3300020070 | Bacteria | 1476 |
| 193 | Ga0206350_11235534 | 3300020080 | Bacteria | 1305 |
| 194 | Ga0206353_11457304 | 3300020082 | Bacteria | 1183 |
| 195 | Ga0213876_10006391 | 3300021384 | Bacteria | 6426 |
| 196 | Ga0213875_10000678 | 3300021388 | Bacteria | 26732 |
| 197 | Ga0213875_10007236 | 3300021388 | Bacteria | 5755 |
| 198 | Ga0224712_10068754 | 3300022467 | Bacteria | 1432 |
| 199 | Ga0209436_100024 | 3300025208 | Bacteria | 95606 |
| 200 | Ga0209455_1000688 | 3300025272 | Bacteria | 19945 |
| 201 | Ga0209130_1000039 | 3300025284 | Bacteria | 263493 |
| 202 | Ga0209676_1000026 | 3300025292 | Bacteria | 574599 |
| 203 | Ga0209050_1004960 | 3300025298 | Bacteria | 8671 |
| 204 | Ga0207426_1000099 | 3300025302 | Bacteria | 263493 |
| 205 | Ga0207696_1000004 | 3300025711 | Bacteria | 671626 |
| 206 | Ga0207696_1000007 | 3300025711 | Bacteria | 578417 |
| 207 | Ga0207696_1000525 | 3300025711 | Bacteria | 31632 |
| 208 | Ga0207696_1000749 | 3300025711 | Bacteria | 21617 |
| 209 | Ga0207655_1000023 | 3300025728 | Bacteria | 467070 |
| 210 | Ga0207655_1000040 | 3300025728 | Bacteria | 335311 |
| 211 | Ga0207655_1002562 | 3300025728 | Bacteria | 14546 |
| 212 | Ga0207655_1011312 | 3300025728 | Bacteria | 5322 |
| 213 | Ga0207655_1013688 | 3300025728 | Bacteria | 4638 |
| 214 | Ga0207713_1066086 | 3300025735 | Bacteria | 1355 |
| 215 | Ga0207653_10016699 | 3300025885 | Bacteria | 2306 |
| 216 | Ga0207692_10004364 | 3300025898 | Bacteria | 5600 |
| 217 | Ga0207692_10011656 | 3300025898 | Bacteria | 3750 |
| 218 | Ga0207692_10012684 | 3300025898 | Bacteria | 3627 |
| 219 | Ga0207692_10026070 | 3300025898 | Bacteria | 2739 |
| 220 | Ga0207692_10095128 | 3300025898 | Bacteria | 1624 |
| 221 | Ga0207692_10130167 | 3300025898 | Bacteria | 1420 |
| 222 | Ga0207688_10010495 | 3300025901 | Bacteria | 5038 |
| 223 | Ga0207680_10320191 | 3300025903 | Bacteria | 1084 |
| 224 | Ga0207647_10112645 | 3300025904 | Bacteria | 1608 |
| 225 | Ga0207685_10010853 | 3300025905 | Bacteria | 2711 |
| 226 | Ga0207685_10014795 | 3300025905 | Bacteria | 2452 |
| 227 | Ga0207685_10058066 | 3300025905 | Bacteria | 1521 |
| 228 | Ga0207699_10001401 | 3300025906 | Bacteria | 11443 |
| 229 | Ga0207699_10002013 | 3300025906 | Bacteria | 9599 |
| 230 | Ga0207699_10008123 | 3300025906 | Bacteria | 5164 |
| 231 | Ga0207699_10013024 | 3300025906 | Bacteria | 4242 |
| 232 | Ga0207699_10044260 | 3300025906 | Bacteria | 2591 |
| 233 | Ga0207699_10090248 | 3300025906 | Bacteria | 1922 |
| 234 | Ga0207705_10000534 | 3300025909 | Bacteria | 32117 |
| 235 | Ga0207705_10250942 | 3300025909 | Bacteria | 1349 |
| 236 | Ga0207684_10001704 | 3300025910 | Bacteria | 23348 |
| 237 | Ga0207684_10051640 | 3300025910 | Bacteria | 3488 |
| 238 | Ga0207684_10094283 | 3300025910 | Bacteria | 2553 |
| 239 | Ga0207684_10160837 | 3300025910 | Bacteria | 1934 |
| 240 | Ga0207707_10098726 | 3300025912 | Bacteria | 2552 |
| 241 | Ga0207707_10271126 | 3300025912 | Bacteria | 1471 |
| 242 | Ga0207695_10017654 | 3300025913 | Bacteria | 8290 |
| 243 | Ga0207671_10102092 | 3300025914 | Bacteria | 2174 |
| 244 | Ga0207671_10292723 | 3300025914 | Bacteria | 1286 |
| 245 | Ga0207693_10010158 | 3300025915 | Bacteria | 7647 |
| 246 | Ga0207693_10089790 | 3300025915 | Bacteria | 2408 |
| 247 | Ga0207693_10145038 | 3300025915 | Bacteria | 1867 |
| 248 | Ga0207693_10146280 | 3300025915 | Bacteria | 1858 |
| 249 | Ga0207693_10202479 | 3300025915 | Bacteria | 1561 |
| 250 | Ga0207663_10011449 | 3300025916 | Bacteria | 4760 |
| 251 | Ga0207663_10045372 | 3300025916 | Bacteria | 2703 |
| 252 | Ga0207663_10055787 | 3300025916 | Bacteria | 2481 |
| 253 | Ga0207663_10072922 | 3300025916 | Bacteria | 2220 |
| 254 | Ga0207663_10100640 | 3300025916 | Bacteria | 1940 |
| 255 | Ga0207663_10166551 | 3300025916 | Bacteria | 1561 |
| 256 | Ga0207662_10015130 | 3300025918 | Bacteria | 4336 |
| 257 | Ga0207657_10003200 | 3300025919 | Bacteria | 17524 |
| 258 | Ga0207649_10016696 | 3300025920 | Bacteria | 4148 |
| 259 | Ga0207646_10000264 | 3300025922 | Bacteria | 71299 |
| 260 | Ga0207646_10007362 | 3300025922 | Bacteria | 11210 |
| 261 | Ga0207646_10044705 | 3300025922 | Bacteria | 3975 |
| 262 | Ga0207646_10101971 | 3300025922 | Bacteria | 2573 |
| 263 | Ga0207646_10127942 | 3300025922 | Bacteria | 2284 |
| 264 | Ga0207646_10533187 | 3300025922 | Bacteria | 1056 |
| 265 | Ga0207694_10146342 | 3300025924 | Bacteria | 1902 |
| 266 | Ga0207700_10002700 | 3300025928 | Bacteria | 10223 |
| 267 | Ga0207700_10005267 | 3300025928 | Bacteria | 7713 |
| 268 | Ga0207700_10028659 | 3300025928 | Bacteria | 3919 |
| 269 | Ga0207700_10031683 | 3300025928 | Bacteria | 3760 |
| 270 | Ga0207700_10069497 | 3300025928 | Bacteria | 2703 |
| 271 | Ga0207700_10092498 | 3300025928 | Bacteria | 2391 |
| 272 | Ga0207700_10093082 | 3300025928 | Bacteria | 2384 |
| 273 | Ga0207700_10122255 | 3300025928 | Bacteria | 2113 |
| 274 | Ga0207700_10189293 | 3300025928 | Bacteria | 1728 |
| 275 | Ga0207700_10376132 | 3300025928 | Bacteria | 1241 |
| 276 | Ga0207664_10000276 | 3300025929 | Bacteria | 38889 |
| 277 | Ga0207664_10009308 | 3300025929 | Bacteria | 6887 |
| 278 | Ga0207664_10009808 | 3300025929 | Bacteria | 6740 |
| 279 | Ga0207664_10023594 | 3300025929 | Bacteria | 4611 |
| 280 | Ga0207664_10036478 | 3300025929 | Bacteria | 3800 |
| 281 | Ga0207664_10053935 | 3300025929 | Bacteria | 3184 |
| 282 | Ga0207664_10069685 | 3300025929 | Bacteria | 2828 |
| 283 | Ga0207664_10069729 | 3300025929 | Bacteria | 2827 |
| 284 | Ga0207664_10069961 | 3300025929 | Bacteria | 2823 |
| 285 | Ga0207664_10121916 | 3300025929 | Bacteria | 2183 |
| 286 | Ga0207664_10123763 | 3300025929 | Bacteria | 2168 |
| 287 | Ga0207690_10019520 | 3300025932 | Bacteria | 4177 |
| 288 | Ga0207706_10012201 | 3300025933 | Bacteria | 7831 |
| 289 | Ga0207706_10015746 | 3300025933 | Bacteria | 6835 |
| 290 | Ga0207709_10014250 | 3300025935 | Bacteria | 4387 |
| 291 | Ga0207670_10112011 | 3300025936 | Bacteria | 1968 |
| 292 | Ga0207665_10000079 | 3300025939 | Bacteria | 62721 |
| 293 | Ga0207665_10002232 | 3300025939 | Bacteria | 13066 |
| 294 | Ga0207665_10032301 | 3300025939 | Bacteria | 3466 |
| 295 | Ga0207665_10034619 | 3300025939 | Bacteria | 3351 |
| 296 | Ga0207665_10052244 | 3300025939 | Bacteria | 2753 |
| 297 | Ga0207665_10070146 | 3300025939 | Bacteria | 2390 |
| 298 | Ga0207665_10115216 | 3300025939 | Bacteria | 1893 |
| 299 | Ga0207665_10116373 | 3300025939 | Bacteria | 1884 |
| 300 | Ga0207689_10003777 | 3300025942 | Bacteria | 13797 |
| 301 | Ga0207679_10187016 | 3300025945 | Bacteria | 1718 |
| 302 | Ga0207668_10152931 | 3300025972 | Bacteria | 1788 |
| 303 | Ga0207658_10116540 | 3300025986 | Bacteria | 2122 |
| 304 | Ga0207677_10051214 | 3300026023 | Bacteria | 2798 |
| 305 | Ga0207703_10061543 | 3300026035 | Bacteria | 3073 |
| 306 | Ga0207639_10230458 | 3300026041 | Bacteria | 1605 |
| 307 | Ga0207708_10032974 | 3300026075 | Bacteria | 3933 |
| 308 | Ga0207702_10082246 | 3300026078 | Bacteria | 2799 |
| 309 | Ga0207702_10173178 | 3300026078 | Bacteria | 1981 |
| 310 | Ga0207702_10221506 | 3300026078 | Bacteria | 1763 |
| 311 | Ga0207641_10192970 | 3300026088 | Bacteria | 1873 |
| 312 | Ga0207674_10004694 | 3300026116 | Bacteria | 16395 |
| 313 | Ga0207674_10016544 | 3300026116 | Bacteria | 8068 |
| 314 | Ga0207675_100074065 | 3300026118 | Bacteria | 3186 |
| 315 | Ga0207675_100287896 | 3300026118 | Bacteria | 1597 |
| 316 | Ga0207683_10003826 | 3300026121 | Bacteria | 13035 |
| 317 | Ga0207683_10371498 | 3300026121 | Bacteria | 1314 |
| 318 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 319 | Ga0209371_1000170 | 3300027312 | Bacteria | 97312 |
| 320 | Ga0209371_1000270 | 3300027312 | Bacteria | 60585 |
| 321 | Ga0209371_1000273 | 3300027312 | Bacteria | 60163 |
| 322 | Ga0209371_1003951 | 3300027312 | Bacteria | 6787 |
| 323 | Ga0209371_1004826 | 3300027312 | Bacteria | 5658 |
| 324 | Ga0207428_10026486 | 3300027907 | Bacteria | 4840 |
| 325 | Ga0265319_1001112 | 3300028563 | Bacteria | 16720 |
| 326 | Ga0265334_10001022 | 3300028573 | Bacteria | 13779 |
| 327 | Ga0265318_10008929 | 3300028577 | Bacteria | 4439 |
| 328 | Ga0265336_10007499 | 3300028666 | Bacteria | 3876 |
| 329 | Ga0265338_10000315 | 3300028800 | Bacteria | 87685 |
| 330 | Ga0265324_10001954 | 3300029957 | Bacteria | 11051 |
| 331 | Ga0268256_1000022 | 3300030500 | Bacteria | 531115 |
| 332 | Ga0268256_1000142 | 3300030500 | Bacteria | 97311 |
| 333 | Ga0268256_1000229 | 3300030500 | Bacteria | 60064 |
| 334 | Ga0268256_1003310 | 3300030500 | Bacteria | 7396 |
| 335 | Ga0268256_1003665 | 3300030500 | Bacteria | 6787 |
| 336 | Ga0268256_1005127 | 3300030500 | Bacteria | 5216 |
| 337 | Ga0265332_10001756 | 3300031238 | Bacteria | 11737 |
| 338 | Ga0265320_10001056 | 3300031240 | Bacteria | 20465 |
| 339 | Ga0265340_10002199 | 3300031247 | Bacteria | 11160 |
| 340 | Ga0265316_10007428 | 3300031344 | Bacteria | 10327 |
| 341 | Ga0307508_10203997 | 3300031616 | Bacteria | 1578 |
| 342 | Ga0265314_10006818 | 3300031711 | Bacteria | 10009 |
| 343 | Ga0265342_10000413 | 3300031712 | Bacteria | 46857 |
| 344 | Ga0316214_1002703 | 3300033545 | Bacteria | 2194 |
| 345 | Ga0316212_1001409 | 3300033547 | Bacteria | 3269 |
| 346 | Ga0373930_0028625 | 3300034816 | Bacteria | 1135 |
| 347 | Ga0373948_0039466 | 3300034817 | Bacteria | 982 |
| 348 | Ga0373958_0004767 | 3300034819 | Bacteria | 2023 |
| 349 | Ga0373959_0015384 | 3300034820 | Bacteria | 1405 |
| 350 | Ga0373959_0016178 | 3300034820 | Bacteria | 1379 |
| 351 | Ga0373926_0063968 | 3300035083 | Bacteria | 1344 |
| 352 | Ga0373926_0072951 | 3300035083 | Bacteria | 1263 |
| 353 | Ga0373929_0007014 | 3300035085 | Bacteria | 2049 |
| 354 | Ga0373934_0000147 | 3300035086 | Bacteria | 25688 |
| 355 | Ga0373934_0005724 | 3300035086 | Bacteria | 4602 |
| 356 | Ga0373934_0013165 | 3300035086 | Bacteria | 3124 |
| 357 | Ga0373934_0053865 | 3300035086 | Bacteria | 1596 |
| 358 | Ga0373934_0057480 | 3300035086 | Bacteria | 1547 |
| 359 | Ga0373934_0109020 | 3300035086 | Bacteria | 1122 |
| 360 | Ga0373940_0011546 | 3300035088 | Bacteria | 2099 |
| 361 | Ga0373944_0000478 | 3300035089 | Bacteria | 9285 |
| 362 | Ga0373944_0010279 | 3300035089 | Bacteria | 2549 |
| 363 | Ga0373944_0077381 | 3300035089 | Bacteria | 1093 |
| 364 | Ga0373951_0025536 | 3300035091 | Bacteria | 1373 |
| 365 | Ga0373923_0002363 | 3300035111 | Bacteria | 5788 |
| 366 | Ga0373923_0032811 | 3300035111 | Bacteria | 2099 |
| 367 | Ga0373923_0139215 | 3300035111 | Bacteria | 1096 |
| 368 | Ga0373936_0001389 | 3300035113 | Bacteria | 8784 |
| 369 | Ga0373936_0021800 | 3300035113 | Bacteria | 2492 |
| 370 | Ga0373936_0045778 | 3300035113 | Bacteria | 1762 |
| 371 | Ga0373936_0076511 | 3300035113 | Bacteria | 1387 |
| 372 | Ga0373945_0002843 | 3300035116 | Bacteria | 5442 |
| 373 | Ga0373945_0025351 | 3300035116 | Bacteria | 2059 |
| 374 | Ga0373945_0047307 | 3300035116 | Bacteria | 1572 |
| 375 | Ga0373953_0000058 | 3300035117 | Bacteria | 28394 |
| 376 | Ga0373953_0028495 | 3300035117 | Bacteria | 2153 |
| 377 | Ga0373953_0044206 | 3300035117 | Bacteria | 1780 |
| 378 | Ga0373954_0002851 | 3300035118 | Bacteria | 7288 |
| 379 | Ga0373954_0015678 | 3300035118 | Bacteria | 3389 |
| 380 | Ga0373954_0019143 | 3300035118 | Bacteria | 3086 |
| 381 | Ga0373954_0020254 | 3300035118 | Bacteria | 3007 |
| 382 | Ga0373954_0064136 | 3300035118 | Bacteria | 1737 |
| 383 | Ga0373956_0000532 | 3300035119 | Bacteria | 15593 |
| 384 | Ga0373956_0002843 | 3300035119 | Bacteria | 7006 |
| 385 | Ga0373956_0052098 | 3300035119 | Bacteria | 1840 |
| 386 | Ga0373957_0000135 | 3300035120 | Bacteria | 18273 |
| 387 | Ga0373957_0003564 | 3300035120 | Bacteria | 4622 |
| 388 | Ga0373957_0012480 | 3300035120 | Bacteria | 2862 |
| 389 | Ga0373957_0058451 | 3300035120 | Bacteria | 1490 |
| 390 | Ga0373943_0001717 | 3300035170 | Bacteria | 9929 |
| 391 | Ga0373943_0032741 | 3300035170 | Bacteria | 2472 |
| 392 | Ga0373946_0001997 | 3300035171 | Bacteria | 7141 |
| 393 | Ga0373946_0007296 | 3300035171 | Bacteria | 4035 |
| 394 | Ga0373955_0001363 | 3300035172 | Bacteria | 10382 |
| 395 | Ga0373955_0007242 | 3300035172 | Bacteria | 5090 |
| 396 | Ga0373955_0010380 | 3300035172 | Bacteria | 4397 |
| 397 | Ga0373955_0035832 | 3300035172 | Bacteria | 2630 |
| 398 | Ga0373955_0126639 | 3300035172 | Bacteria | 1488 |
| 399 | Ga0373955_0196758 | 3300035172 | Bacteria | 1199 |
| 400 | Ga0373942_0046417 | 3300035207 | Bacteria | 1203 |
| 401 | Ga0373961_0014119 | 3300035241 | Bacteria | 2025 |
| 402 | Ga0373961_0068093 | 3300035241 | Bacteria | 1095 |
| 403 | Ga0373924_0004968 | 3300035410 | Bacteria | 4681 |
| 404 | Ga0373924_0015077 | 3300035410 | Bacteria | 2930 |
| 405 | Ga0373924_0047522 | 3300035410 | Bacteria | 1770 |
| 406 | Ga0373931_0076418 | 3300035691 | Bacteria | 1839 |
| 407 | Ga0373931_0110009 | 3300035691 | Bacteria | 1562 |
| 408 | Ga0373931_0119194 | 3300035691 | Bacteria | 1506 |
| 409 | Ga0373935_0000168 | 3300035692 | Bacteria | 30620 |
| 410 | Ga0373935_0008796 | 3300035692 | Bacteria | 6047 |
| 411 | Ga0373935_0016503 | 3300035692 | Bacteria | 4467 |
| 412 | Ga0373935_0025642 | 3300035692 | Bacteria | 3633 |
| 413 | Ga0373935_0056401 | 3300035692 | Bacteria | 2504 |
| 414 | Ga0373935_0056603 | 3300035692 | Bacteria | 2500 |
| 415 | Ga0373935_0326146 | 3300035692 | Bacteria | 1090 |
| 416 | Ga0373935_0390846 | 3300035692 | Bacteria | 997 |
| 417 | Ga0373927_0005960 | 3300035695 | Bacteria | 8348 |
| 418 | Ga0373927_0063242 | 3300035695 | Bacteria | 2393 |
| 419 | Ga0373927_0164218 | 3300035695 | Bacteria | 1455 |
| 420 | Ga0373933_0000002 | 3300035724 | Bacteria | 151785 |
| 421 | Ga0373933_0013496 | 3300035724 | Bacteria | 4529 |
| 422 | Ga0373933_0063035 | 3300035724 | Bacteria | 2240 |
| 423 | Ga0373933_0165734 | 3300035724 | Bacteria | 1404 |
| 424 | Ga0373947_0000007 | 3300035725 | Bacteria | 192259 |
| 425 | Ga0373947_0000631 | 3300035725 | Bacteria | 20809 |
| 426 | Ga0373947_0009158 | 3300035725 | Bacteria | 5691 |
| 427 | Ga0373947_0022856 | 3300035725 | Bacteria | 3629 |
| 428 | Ga0373947_0046020 | 3300035725 | Bacteria | 2612 |
| 429 | Ga0373947_0081182 | 3300035725 | Bacteria | 2007 |
| 430 | Ga0373947_0107054 | 3300035725 | Bacteria | 1763 |
| 431 | Ga0373947_0125306 | 3300035725 | Bacteria | 1635 |
| 432 | Ga0373937_0000014 | 3300036401 | Bacteria | 151785 |
| 433 | Ga0373937_0003979 | 3300036401 | Bacteria | 12502 |
| 434 | Ga0373937_0006593 | 3300036401 | Bacteria | 10025 |
| 435 | Ga0373937_0021178 | 3300036401 | Bacteria | 5835 |
| 436 | Ga0373937_0142412 | 3300036401 | Bacteria | 2243 |
| 437 | Ga0373937_0303881 | 3300036401 | Bacteria | 1508 |
| 438 | Ga0373937_0360588 | 3300036401 | Bacteria | 1377 |
| 439 | Ga0373937_0465673 | 3300036401 | Bacteria | 1200 |
| 440 | Ga0372808_005086 | 3300036459 | Bacteria | 1716 |
| 441 | Ga0373925_0029398 | 3300037068 | Bacteria | 4032 |
| 442 | Ga0373925_0074817 | 3300037068 | Bacteria | 2566 |
| 443 | Ga0373925_0124218 | 3300037068 | Bacteria | 2006 |
| 444 | Ga0373925_0256210 | 3300037068 | Bacteria | 1404 |
| 445 | Ga0436364_0287407 | 3300037853 | Bacteria | 132611 |
| 446 | Ga0436364_0416023 | 3300037853 | Bacteria | 2325 |
| 447 | Ga0436364_0645051 | 3300037853 | Bacteria | 7687 |
| 448 | Ga0436364_1093265 | 3300037853 | Bacteria | 12190 |
| 449 | Ga0436364_1549559 | 3300037853 | Bacteria | 7764 |
| 450 | Ga0395901_0070679 | 3300038443 | Bacteria | 3637 |
| 451 | Ga0436365_0528481 | 3300039437 | Bacteria | 36434 |
| 452 | Ga0436360_1239965 | 3300039438 | Bacteria | 1481 |
| 453 | Ga0436363_1047826 | 3300039450 | Bacteria | 2588 |
| 454 | Ga0439438_000001 | 3300041405 | Bacteria | 1263568 |
| 455 | Ga0439438_012054 | 3300041405 | Bacteria | 2665 |
| 456 | Ga0439447_001587 | 3300041407 | Bacteria | 8320 |
| 457 | Ga0439447_007745 | 3300041407 | Bacteria | 3380 |
| 458 | Ga0439466_0000003 | 3300041411 | Bacteria | 486229 |
| 459 | Ga0439432_006224 | 3300042006 | Bacteria | 4272 |
| 460 | Ga0439432_108905 | 3300042006 | Bacteria | 825 |
| 461 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 462 | Ga0439452_000029 | 3300042010 | Bacteria | 197977 |
| 463 | Ga0439464_0000630 | 3300042439 | Bacteria | 7485 |
| 464 | Ga0466965_0107561 | 3300044683 | Bacteria | 1431 |
| 465 | Ga0466968_0130979 | 3300044735 | Bacteria | 1141 |
| 466 | Ga0466970_0214549 | 3300044765 | Bacteria | 1073 |
| 467 | Ga0466957_0120956 | 3300044842 | Bacteria | 1669 |
| 468 | Ga0466959_0102133 | 3300045049 | Bacteria | 2052 |
| 469 | Ga0466967_0099778 | 3300045976 | Bacteria | 2652 |
| 470 | Ga0466967_0410293 | 3300045976 | Bacteria | 1319 |
| 471 | Ga0495617_010813 | 3300046452 | Bacteria | 3125 |
| 472 | Ga0495592_0000133 | 3300046454 | Bacteria | 66075 |
| 473 | Ga0495592_0010718 | 3300046454 | Bacteria | 6911 |
| 474 | Ga0495592_0059770 | 3300046454 | Bacteria | 2805 |
| 475 | Ga0495592_0166426 | 3300046454 | Bacteria | 1513 |
| 476 | Ga0495603_0089124 | 3300046455 | Bacteria | 1805 |
| 477 | Ga0495603_0112658 | 3300046455 | Bacteria | 1586 |
| 478 | Ga0495591_000094 | 3300046458 | Bacteria | 101106 |
| 479 | Ga0495591_003750 | 3300046458 | Bacteria | 7681 |
| 480 | Ga0495629_0008393 | 3300046459 | Bacteria | 7599 |
| 481 | Ga0495629_0333247 | 3300046459 | Bacteria | 1037 |
| 482 | Ga0495629_0353274 | 3300046459 | Bacteria | 1002 |
| 483 | Ga0495641_0007980 | 3300046461 | Bacteria | 6524 |
| 484 | Ga0495641_0060568 | 3300046461 | Bacteria | 1710 |
| 485 | Ga0495641_0105591 | 3300046461 | Bacteria | 1256 |
| 486 | Ga0495651_0000470 | 3300046462 | Bacteria | 30998 |
| 487 | Ga0495651_0035996 | 3300046462 | Bacteria | 3853 |
| 488 | Ga0495651_0040835 | 3300046462 | Bacteria | 3604 |
| 489 | Ga0495651_0051289 | 3300046462 | Bacteria | 3181 |
| 490 | Ga0495651_0064398 | 3300046462 | Bacteria | 2801 |
| 491 | Ga0495651_0207439 | 3300046462 | Bacteria | 1366 |
| 492 | Ga0495651_0235536 | 3300046462 | Bacteria | 1258 |
| 493 | Ga0495653_0009353 | 3300046463 | Bacteria | 8018 |
| 494 | Ga0495653_0009767 | 3300046463 | Bacteria | 7845 |
| 495 | Ga0495653_0016076 | 3300046463 | Bacteria | 6099 |
| 496 | Ga0495653_0034825 | 3300046463 | Bacteria | 3977 |
| 497 | Ga0495653_0049781 | 3300046463 | Bacteria | 3225 |
| 498 | Ga0495653_0061641 | 3300046463 | Bacteria | 2837 |
| 499 | Ga0495653_0068709 | 3300046463 | Bacteria | 2657 |
| 500 | Ga0495653_0102003 | 3300046463 | Bacteria | 2077 |
| 501 | Ga0495653_0103945 | 3300046463 | Bacteria | 2053 |
| 502 | Ga0495650_0000033 | 3300046471 | Bacteria | 412188 |
| 503 | Ga0495580_0027686 | 3300046472 | Bacteria | 4123 |
| 504 | Ga0495582_0032023 | 3300046473 | Bacteria | 2892 |
| 505 | Ga0495582_0338028 | 3300046473 | Bacteria | 867 |
| 506 | Ga0495639_0000320 | 3300046475 | Bacteria | 23322 |
| 507 | Ga0495639_0026037 | 3300046475 | Bacteria | 2583 |
| 508 | Ga0495639_0203579 | 3300046475 | Bacteria | 969 |
| 509 | Ga0495662_0002566 | 3300046476 | Bacteria | 9168 |
| 510 | Ga0495662_0004176 | 3300046476 | Bacteria | 7275 |
| 511 | Ga0495662_0022474 | 3300046476 | Bacteria | 3045 |
| 512 | Ga0495662_0040446 | 3300046476 | Bacteria | 2252 |
| 513 | Ga0495664_0000448 | 3300046477 | Bacteria | 20228 |
| 514 | Ga0495664_0006281 | 3300046477 | Bacteria | 6561 |
| 515 | Ga0495664_0028833 | 3300046477 | Bacteria | 3243 |
| 516 | Ga0495664_0077031 | 3300046477 | Bacteria | 1996 |
| 517 | Ga0495664_0118957 | 3300046477 | Bacteria | 1597 |
| 518 | Ga0495664_0221419 | 3300046477 | Bacteria | 1145 |
| 519 | Ga0495584_0016303 | 3300046491 | Bacteria | 3789 |
| 520 | Ga0495585_0010040 | 3300046492 | Bacteria | 5656 |
| 521 | Ga0495594_0051741 | 3300046499 | Bacteria | 2260 |
| 522 | Ga0495596_0049964 | 3300046500 | Bacteria | 1639 |
| 523 | Ga0495607_0007504 | 3300046501 | Bacteria | 7533 |
| 524 | Ga0495606_0000619 | 3300046507 | Bacteria | 55941 |
| 525 | Ga0495608_0000028 | 3300046511 | Bacteria | 151829 |
| 526 | Ga0495608_0029188 | 3300046511 | Bacteria | 3744 |
| 527 | Ga0495608_0050926 | 3300046511 | Bacteria | 2746 |
| 528 | Ga0495608_0083617 | 3300046511 | Unclassified | 2072 |
| 529 | Ga0495608_0096678 | 3300046511 | Bacteria | 1907 |
| 530 | Ga0495608_0224496 | 3300046511 | Bacteria | 1177 |
| 531 | Ga0495616_0009885 | 3300046513 | Bacteria | 5548 |
| 532 | Ga0495618_0034967 | 3300046514 | Bacteria | 3152 |
| 533 | Ga0495618_0226890 | 3300046514 | Bacteria | 1177 |
| 534 | Ga0495628_0015201 | 3300046516 | Bacteria | 6430 |
| 535 | Ga0495628_0330766 | 3300046516 | Bacteria | 1123 |
| 536 | Ga0495630_0003650 | 3300046517 | Bacteria | 10727 |
| 537 | Ga0495630_0014182 | 3300046517 | Bacteria | 5801 |
| 538 | Ga0495630_0046772 | 3300046517 | Bacteria | 3235 |
| 539 | Ga0495630_0360397 | 3300046517 | Bacteria | 1113 |
| 540 | Ga0495644_0001575 | 3300046523 | Bacteria | 9299 |
| 541 | Ga0495648_0001078 | 3300046524 | Bacteria | 27737 |
| 542 | Ga0495666_0001809 | 3300046526 | Bacteria | 10565 |
| 543 | Ga0495652_0000031 | 3300046529 | Bacteria | 151765 |
| 544 | Ga0495652_0033870 | 3300046529 | Bacteria | 4455 |
| 545 | Ga0495652_0040118 | 3300046529 | Bacteria | 4046 |
| 546 | Ga0495652_0069590 | 3300046529 | Bacteria | 2945 |
| 547 | Ga0495652_0106238 | 3300046529 | Bacteria | 2267 |
| 548 | Ga0495654_0000078 | 3300046530 | Bacteria | 110443 |
| 549 | Ga0495654_0000572 | 3300046530 | Bacteria | 29558 |
| 550 | Ga0495665_0004183 | 3300046531 | Bacteria | 7786 |
| 551 | Ga0495665_0061954 | 3300046531 | Bacteria | 1975 |
| 552 | Ga0495640_0007267 | 3300046533 | Bacteria | 8726 |
| 553 | Ga0495640_0015708 | 3300046533 | Bacteria | 5686 |
| 554 | Ga0495640_0028735 | 3300046533 | Bacteria | 4000 |
| 555 | Ga0495640_0051727 | 3300046533 | Bacteria | 2823 |
| 556 | Ga0495640_0093850 | 3300046533 | Bacteria | 1977 |
| 557 | Ga0495587_0000023 | 3300046536 | Bacteria | 151763 |
| 558 | Ga0495587_0005276 | 3300046536 | Bacteria | 8446 |
| 559 | Ga0495587_0010020 | 3300046536 | Bacteria | 6051 |
| 560 | Ga0495587_0015949 | 3300046536 | Bacteria | 4677 |
| 561 | Ga0495587_0031703 | 3300046536 | Bacteria | 3198 |
| 562 | Ga0495587_0095139 | 3300046536 | Bacteria | 1719 |
| 563 | Ga0495645_0019460 | 3300046543 | Bacteria | 4887 |
| 564 | Ga0495645_0027114 | 3300046543 | Bacteria | 4161 |
| 565 | Ga0495622_0096476 | 3300046557 | Bacteria | 1357 |
| 566 | Ga0495667_0000054 | 3300046559 | Bacteria | 105009 |
| 567 | Ga0495667_0006695 | 3300046559 | Bacteria | 7818 |
| 568 | Ga0495667_0013554 | 3300046559 | Bacteria | 5514 |
| 569 | Ga0495667_0017159 | 3300046559 | Bacteria | 4889 |
| 570 | Ga0495667_0019274 | 3300046559 | Bacteria | 4603 |
| 571 | Ga0495667_0031395 | 3300046559 | Bacteria | 3566 |
| 572 | Ga0495667_0033362 | 3300046559 | Bacteria | 3446 |
| 573 | Ga0495634_0013714 | 3300046642 | Bacteria | 5851 |
| 574 | Ga0495634_0019228 | 3300046642 | Bacteria | 4855 |
| 575 | Ga0495634_0040494 | 3300046642 | Bacteria | 3168 |
| 576 | Ga0495634_0093688 | 3300046642 | Bacteria | 1947 |
| 577 | Ga0495635_0007650 | 3300046663 | Bacteria | 7539 |
| 578 | Ga0495635_0008781 | 3300046663 | Bacteria | 7055 |
| 579 | Ga0495635_0027823 | 3300046663 | Bacteria | 3931 |
| 580 | Ga0495635_0028828 | 3300046663 | Bacteria | 3858 |
| 581 | Ga0495635_0043890 | 3300046663 | Bacteria | 3084 |
| 582 | Ga0495635_0049874 | 3300046663 | Bacteria | 2885 |
| 583 | Ga0495635_0067471 | 3300046663 | Bacteria | 2454 |
| 584 | Ga0495635_0171289 | 3300046663 | Bacteria | 1476 |
| 585 | Ga0495657_0000022 | 3300046675 | Bacteria | 151837 |
| 586 | Ga0495657_0030011 | 3300046675 | Bacteria | 3810 |
| 587 | Ga0495657_0031045 | 3300046675 | Bacteria | 3737 |
| 588 | Ga0495657_0031256 | 3300046675 | Bacteria | 3722 |
| 589 | Ga0495657_0038661 | 3300046675 | Bacteria | 3282 |
| 590 | Ga0495657_0040463 | 3300046675 | Bacteria | 3197 |
| 591 | Ga0495657_0156406 | 3300046675 | Bacteria | 1412 |
| 592 | Ga0495599_0000236 | 3300046678 | Bacteria | 34674 |
| 593 | Ga0495599_0016837 | 3300046678 | Bacteria | 4540 |
| 594 | Ga0495599_0020373 | 3300046678 | Bacteria | 4130 |
| 595 | Ga0495599_0022142 | 3300046678 | Bacteria | 3966 |
| 596 | Ga0495599_0056496 | 3300046678 | Bacteria | 2456 |
| 597 | Ga0495623_0001119 | 3300046679 | Bacteria | 18089 |
| 598 | Ga0495623_0183373 | 3300046679 | Bacteria | 1214 |
| 599 | Ga0495646_0007017 | 3300046680 | Bacteria | 7152 |
| 600 | Ga0495646_0010149 | 3300046680 | Bacteria | 5988 |
| 601 | Ga0495646_0022432 | 3300046680 | Bacteria | 3983 |
| 602 | Ga0495646_0023398 | 3300046680 | Bacteria | 3890 |
| 603 | Ga0495647_0003056 | 3300046681 | Bacteria | 5336 |
| 604 | Ga0495647_0259251 | 3300046681 | Bacteria | 775 |
| 605 | Ga0495658_0018793 | 3300046683 | Bacteria | 3599 |
| 606 | Ga0495658_0043551 | 3300046683 | Bacteria | 2511 |
| 607 | Ga0495613_0283285 | 3300046689 | Bacteria | 1150 |
| 608 | Ga0495624_0001756 | 3300046690 | Bacteria | 16592 |
| 609 | Ga0495624_0009799 | 3300046690 | Bacteria | 6626 |
| 610 | Ga0495624_0049025 | 3300046690 | Bacteria | 2679 |
| 611 | Ga0495624_0066180 | 3300046690 | Bacteria | 2256 |
| 612 | Ga0495624_0154202 | 3300046690 | Bacteria | 1404 |
| 613 | Ga0495649_0003646 | 3300046694 | Bacteria | 10274 |
| 614 | Ga0495600_0004245 | 3300046809 | Bacteria | 8559 |
| 615 | Ga0495600_0027973 | 3300046809 | Bacteria | 3646 |
| 616 | Ga0495600_0065520 | 3300046809 | Bacteria | 2375 |
| 617 | Ga0495600_0138543 | 3300046809 | Bacteria | 1579 |
| 618 | Ga0495660_0000011 | 3300046810 | Bacteria | 361397 |
| 619 | Ga0495660_0010971 | 3300046810 | Bacteria | 5264 |
| 620 | Ga0495581_0015452 | 3300047315 | Bacteria | 4432 |
| 621 | Ga0495581_0063933 | 3300047315 | Bacteria | 2126 |
| 622 | Ga0495581_0159974 | 3300047315 | Bacteria | 1316 |
| 623 | Ga0495604_0000022 | 3300047317 | Bacteria | 151744 |
| 624 | Ga0495604_0013825 | 3300047317 | Bacteria | 6438 |
| 625 | Ga0495604_0023576 | 3300047317 | Bacteria | 4910 |
| 626 | Ga0495674_0007792 | 3300047319 | Bacteria | 10224 |
| 627 | Ga0495674_0010705 | 3300047319 | Bacteria | 8677 |
| 628 | Ga0495672_0000004 | 3300047320 | Bacteria | 631810 |
| 629 | Ga0495672_0000012 | 3300047320 | Bacteria | 519975 |
| 630 | Ga0495676_0021929 | 3300047321 | Bacteria | 5567 |
| 631 | Ga0495676_0052961 | 3300047321 | Bacteria | 3236 |
| 632 | Ga0495676_0084085 | 3300047321 | Bacteria | 2402 |
| 633 | Ga0495676_0168764 | 3300047321 | Bacteria | 1542 |
| 634 | Ga0495680_0000271 | 3300047322 | Bacteria | 57595 |
| 635 | Ga0495680_0006193 | 3300047322 | Bacteria | 11151 |
| 636 | Ga0495680_0023422 | 3300047322 | Bacteria | 5134 |
| 637 | Ga0495680_0034344 | 3300047322 | Bacteria | 4096 |
| 638 | Ga0495680_0057442 | 3300047322 | Bacteria | 3009 |
| 639 | Ga0495680_0115945 | 3300047322 | Bacteria | 1981 |
| 640 | Ga0495680_0209314 | 3300047322 | Bacteria | 1396 |
| 641 | Ga0495683_0012720 | 3300047323 | Bacteria | 4415 |
| 642 | Ga0495683_0046086 | 3300047323 | Bacteria | 2189 |
| 643 | Ga0495675_0002876 | 3300047444 | Bacteria | 10327 |
| 644 | Ga0495675_0107570 | 3300047444 | Bacteria | 1742 |
| 645 | Ga0495675_0134404 | 3300047444 | Bacteria | 1536 |
| 646 | Ga0495675_0312110 | 3300047444 | Bacteria | 932 |
| 647 | Ga0495679_007102 | 3300047446 | Bacteria | 4722 |
| 648 | Ga0495673_0000023 | 3300047469 | Bacteria | 539904 |
| 649 | Ga0495681_0010484 | 3300047470 | Bacteria | 5607 |
| 650 | Ga0495684_0012825 | 3300047471 | Bacteria | 6468 |
| 651 | Ga0495684_0018097 | 3300047471 | Bacteria | 5430 |
| 652 | Ga0495684_0021015 | 3300047471 | Bacteria | 5028 |
| 653 | Ga0495684_0037960 | 3300047471 | Bacteria | 3694 |
| 654 | Ga0495684_0050488 | 3300047471 | Bacteria | 3175 |
| 655 | Ga0495684_0097573 | 3300047471 | Bacteria | 2223 |
| 656 | Ga0495684_0161727 | 3300047471 | Bacteria | 1669 |
| 657 | Ga0495593_0007205 | 3300047673 | Bacteria | 6519 |
| 658 | Ga0495593_0043384 | 3300047673 | Bacteria | 2410 |
| 659 | Ga0495593_0177028 | 3300047673 | Bacteria | 1074 |
| 660 | Ga0495602_0000390 | 3300048088 | Bacteria | 41015 |
| 661 | Ga0495602_0022179 | 3300048088 | Bacteria | 6223 |
| 662 | Ga0495602_0024707 | 3300048088 | Bacteria | 5827 |
| 663 | Ga0495602_0042039 | 3300048088 | Bacteria | 4167 |
| 664 | Ga0495602_0044304 | 3300048088 | Bacteria | 4037 |
| 665 | Ga0495602_0101537 | 3300048088 | Bacteria | 2359 |
| 666 | Ga0495602_0168912 | 3300048088 | Bacteria | 1699 |
| 667 | Ga0495614_0023362 | 3300048089 | Bacteria | 2667 |
| 668 | Ga0496100_0029777 | 3300048903 | Bacteria | 3380 |
| 669 | Ga0496100_0040778 | 3300048903 | Bacteria | 2956 |
| 670 | Ga0496100_0222597 | 3300048903 | Bacteria | 1385 |
| 671 | Ga0496101_0000029 | 3300048904 | Bacteria | 198515 |
| 672 | Ga0496101_0032361 | 3300048904 | Bacteria | 3681 |
| 673 | Ga0496101_0154937 | 3300048904 | Bacteria | 1754 |
| 674 | Ga0496102_0048291 | 3300048905 | Bacteria | 3870 |
| 675 | Ga0496102_0150527 | 3300048905 | Bacteria | 2186 |
| 676 | Ga0496102_0209553 | 3300048905 | Bacteria | 1838 |
| 677 | Ga0496102_0212587 | 3300048905 | Bacteria | 1823 |
| 678 | Ga0496103_0027084 | 3300048906 | Bacteria | 3471 |
| 679 | Ga0496104_0035650 | 3300048907 | Bacteria | 4645 |
| 680 | Ga0496104_0036938 | 3300048907 | Bacteria | 4567 |
| 681 | Ga0496104_0130924 | 3300048907 | Bacteria | 2409 |
| 682 | Ga0496104_0224506 | 3300048907 | Bacteria | 1790 |
| 683 | Ga0496104_0624739 | 3300048907 | Bacteria | 987 |
| 684 | Ga0496105_0000685 | 3300048908 | Bacteria | 22794 |
| 685 | Ga0496105_0032555 | 3300048908 | Bacteria | 4279 |
| 686 | Ga0496105_0054596 | 3300048908 | Bacteria | 3298 |
| 687 | Ga0496105_0189835 | 3300048908 | Bacteria | 1680 |
| 688 | Ga0496106_0118233 | 3300048909 | Bacteria | 2069 |
| 689 | Ga0496106_0140248 | 3300048909 | Bacteria | 1901 |
| 690 | Ga0496106_0250942 | 3300048909 | Bacteria | 1414 |
| 691 | Ga0496108_0008888 | 3300048911 | Bacteria | 8144 |
| 692 | Ga0496108_0069967 | 3300048911 | Bacteria | 2961 |
| 693 | Ga0496108_0105500 | 3300048911 | Bacteria | 2406 |
| 694 | Ga0496109_0055319 | 3300048912 | Bacteria | 3620 |
| 695 | Ga0496109_0082488 | 3300048912 | Bacteria | 2963 |
| 696 | Ga0496109_0335198 | 3300048912 | Bacteria | 1428 |
| 697 | Ga0496110_0036536 | 3300048913 | Bacteria | 4266 |
| 698 | Ga0496110_0265463 | 3300048913 | Bacteria | 1563 |
| 699 | Ga0496112_0036188 | 3300048915 | Bacteria | 4814 |
| 700 | Ga0496112_0111966 | 3300048915 | Bacteria | 2699 |
| 701 | Ga0496112_0459529 | 3300048915 | Bacteria | 1211 |
| 702 | Ga0496113_0328017 | 3300048916 | Bacteria | 1227 |
| 703 | Ga0496114_0022763 | 3300048917 | Bacteria | 5107 |
| 704 | Ga0496114_0285599 | 3300048917 | Bacteria | 1455 |
| 705 | Ga0496114_0303938 | 3300048917 | Bacteria | 1408 |
| 706 | Ga0496115_0024609 | 3300048918 | Bacteria | 4682 |
| 707 | Ga0496115_0149297 | 3300048918 | Bacteria | 1929 |
| 708 | Ga0496115_0234054 | 3300048918 | Bacteria | 1514 |
| 709 | Ga0496116_0000579 | 3300048919 | Bacteria | 48897 |
| 710 | Ga0496116_0001066 | 3300048919 | Bacteria | 33115 |
| 711 | Ga0496116_0024816 | 3300048919 | Bacteria | 4422 |
| 712 | Ga0496116_0048578 | 3300048919 | Bacteria | 2846 |
| 713 | Ga0496116_0252864 | 3300048919 | Bacteria | 875 |
| 714 | Ga0496117_0000180 | 3300048920 | Bacteria | 128746 |
| 715 | Ga0496117_0000644 | 3300048920 | Bacteria | 56210 |
| 716 | Ga0496117_0008147 | 3300048920 | Bacteria | 10014 |
| 717 | Ga0496117_0132910 | 3300048920 | Bacteria | 1504 |
| 718 | Ga0496118_0000247 | 3300048921 | Bacteria | 95745 |
| 719 | Ga0496118_0002990 | 3300048921 | Bacteria | 21862 |
| 720 | Ga0496118_0009235 | 3300048921 | Bacteria | 10014 |
| 721 | Ga0496118_0014808 | 3300048921 | Bacteria | 7274 |
| 722 | Ga0496118_0016504 | 3300048921 | Bacteria | 6773 |
| 723 | Ga0496118_0146260 | 3300048921 | Bacteria | 1487 |
| 724 | Ga0496119_0000043 | 3300048922 | Bacteria | 192373 |
| 725 | Ga0496119_0000045 | 3300048922 | Bacteria | 191361 |
| 726 | Ga0496119_0000178 | 3300048922 | Bacteria | 89153 |
| 727 | Ga0496119_0000650 | 3300048922 | Bacteria | 46907 |
| 728 | Ga0496119_0001482 | 3300048922 | Bacteria | 28129 |
| 729 | Ga0496119_0023253 | 3300048922 | Bacteria | 4405 |
| 730 | Ga0496120_0000043 | 3300048923 | Bacteria | 195584 |
| 731 | Ga0496120_0000346 | 3300048923 | Bacteria | 76271 |
| 732 | Ga0496120_0000407 | 3300048923 | Bacteria | 69144 |
| 733 | Ga0496120_0000459 | 3300048923 | Bacteria | 64233 |
| 734 | Ga0496120_0000894 | 3300048923 | Bacteria | 41926 |
| 735 | Ga0496120_0019025 | 3300048923 | Bacteria | 4407 |
| 736 | Ga0496121_0000967 | 3300048924 | Bacteria | 51547 |
| 737 | Ga0496121_0009019 | 3300048924 | Bacteria | 11558 |
| 738 | Ga0496122_0006878 | 3300048925 | Bacteria | 12874 |
| 739 | Ga0496122_0068741 | 3300048925 | Bacteria | 2541 |
| 740 | Ga0496122_0112495 | 3300048925 | Bacteria | 1782 |
| 741 | Ga0496123_0003607 | 3300048926 | Bacteria | 17147 |
| 742 | Ga0496123_0051276 | 3300048926 | Bacteria | 2748 |
| 743 | Ga0496123_0058663 | 3300048926 | Bacteria | 2494 |
| 744 | Ga0496124_0000463 | 3300048927 | Bacteria | 70325 |
| 745 | Ga0496124_0001570 | 3300048927 | Bacteria | 33020 |
| 746 | Ga0496124_0005426 | 3300048927 | Bacteria | 14353 |
| 747 | Ga0496124_0022087 | 3300048927 | Bacteria | 5844 |
| 748 | Ga0496124_0050436 | 3300048927 | Bacteria | 3547 |
| 749 | Ga0496124_0060607 | 3300048927 | Bacteria | 3174 |
| 750 | Ga0496124_0070201 | 3300048927 | Bacteria | 2906 |
| 751 | Ga0496124_0148026 | 3300048927 | Unclassified | 1845 |
| 752 | Ga0496125_0048738 | 3300048928 | Bacteria | 3528 |
| 753 | Ga0496125_0094002 | 3300048928 | Bacteria | 2236 |
| 754 | Ga0496125_0149596 | 3300048928 | Bacteria | 1606 |
| 755 | Ga0496126_0002412 | 3300048929 | Bacteria | 25320 |
| 756 | Ga0496126_0084761 | 3300048929 | Bacteria | 2794 |
| 757 | Ga0496126_0099670 | 3300048929 | Bacteria | 2544 |
| 758 | Ga0496126_0202904 | 3300048929 | Bacteria | 1673 |
| 759 | Ga0495678_000415 | 3300049459 | Bacteria | 43047 |
| 760 | Ga0495678_011026 | 3300049459 | Bacteria | 4348 |
| 761 | Ga0495682_0000004 | 3300049460 | Bacteria | 378337 |
| 762 | Ga0501034_0004181 | 3300049571 | Bacteria | 16111 |
| 763 | Ga0501034_0023236 | 3300049571 | Bacteria | 6318 |
| 764 | Ga0501034_0521419 | 3300049571 | Bacteria | 1100 |
| 765 | Ga0501036_0000170 | 3300049572 | Bacteria | 42985 |
| 766 | Ga0501036_0007170 | 3300049572 | Bacteria | 9079 |
| 767 | Ga0501037_0004187 | 3300049573 | Bacteria | 10460 |
| 768 | Ga0501037_0027151 | 3300049573 | Bacteria | 4229 |
| 769 | Ga0501038_0006542 | 3300049574 | Bacteria | 10780 |
| 770 | Ga0501038_0034960 | 3300049574 | Bacteria | 4416 |
| 771 | Ga0501039_0078463 | 3300049575 | Bacteria | 2569 |
| 772 | Ga0501039_0188459 | 3300049575 | Bacteria | 1622 |
| 773 | Ga0501042_0002573 | 3300049578 | Bacteria | 11151 |
| 774 | Ga0501042_0080873 | 3300049578 | Unclassified | 2328 |
| 775 | Ga0501043_0000866 | 3300049579 | Bacteria | 26823 |
| 776 | Ga0501043_0007870 | 3300049579 | Bacteria | 8430 |
| 777 | Ga0501047_0002697 | 3300049581 | Bacteria | 16895 |
| 778 | Ga0501047_0006312 | 3300049581 | Bacteria | 11150 |
| 779 | Ga0501047_0076774 | 3300049581 | Bacteria | 3215 |
| 780 | Ga0501047_0574831 | 3300049581 | Bacteria | 950 |
| 781 | Ga0501048_0001538 | 3300049582 | Bacteria | 17507 |
| 782 | Ga0501048_0003280 | 3300049582 | Bacteria | 12333 |
| 783 | Ga0501073_0015818 | 3300049589 | Bacteria | 5467 |
| 784 | Ga0501073_0027049 | 3300049589 | Bacteria | 4105 |
| 785 | Ga0501074_0001528 | 3300049590 | Bacteria | 15658 |
| 786 | Ga0501074_0001673 | 3300049590 | Bacteria | 15081 |
| 787 | Ga0501035_0007966 | 3300049822 | Bacteria | 9882 |
| 788 | Ga0501035_0019914 | 3300049822 | Bacteria | 6163 |
| 789 | Ga0501044_0018809 | 3300049823 | Bacteria | 7399 |
| 790 | Ga0501044_0192161 | 3300049823 | Bacteria | 2003 |
| 791 | Ga0501044_0278345 | 3300049823 | Bacteria | 1607 |
| 792 | nmdc:mga06z11_205501_c1 | 3300050494 | Bacteria | 1145 |
| 793 | nmdc:mga07m45_191881_c1 | 3300050496 | Unclassified | 1188 |
| 794 | nmdc:mga07m45_414698_c1 | 3300050496 | Unclassified | 781 |
| 795 | nmdc:mga05p37_31168_c1 | 3300050507 | Bacteria | 6513 |
| 796 | nmdc:mga09592_115698_c1 | 3300050508 | Bacteria | 2301 |
| 797 | nmdc:mga08y16_181875_c1 | 3300050511 | Bacteria | 2183 |
| 798 | nmdc:mga0n895_241896_c1 | 3300050512 | Bacteria | 1832 |
| 799 | nmdc:mga0n895_291452_c1 | 3300050512 | Bacteria | 1655 |
| 800 | nmdc:mga0rr50_131326_c1 | 3300050513 | Bacteria | 2006 |
| 801 | nmdc:mga0rr50_15046_c1 | 3300050513 | Bacteria | 5098 |
| 802 | nmdc:mga0rr50_55526_c1 | 3300050513 | Bacteria | 2955 |
| 803 | nmdc:mga08x19_136839_c1 | 3300050514 | Bacteria | 1652 |
| 804 | nmdc:mga08x19_162650_c1 | 3300050514 | Bacteria | 1517 |
| 805 | nmdc:mga0a205_112376_c1 | 3300050515 | Bacteria | 2623 |
| 806 | nmdc:mga0a205_69748_c1 | 3300050515 | Bacteria | 3394 |
| 807 | Ga0495601_0176533 | 3300053077 | Bacteria | 1396 |
| 808 | Ga0495601_0214108 | 3300053077 | Bacteria | 1258 |
| 809 | Ga0495612_0014247 | 3300053078 | Bacteria | 3198 |
| 810 | Ga0495612_0016713 | 3300053078 | Bacteria | 2939 |
| 811 | Ga0495612_0034327 | 3300053078 | Bacteria | 2054 |
| 812 | Ga0495595_0001201 | 3300053084 | Bacteria | 10066 |
| 813 | Ga0495595_0040092 | 3300053084 | Bacteria | 2139 |
| 814 | Ga0495619_0006722 | 3300053085 | Bacteria | 7275 |
| 815 | Ga0495619_0028350 | 3300053085 | Bacteria | 3611 |
| 816 | Ga0500621_000001 | 3300053126 | Bacteria | 1049698 |
| 817 | Ga0500559_0143431 | 3300053136 | Bacteria | 1119 |
| 818 | Ga0500616_0128529 | 3300053153 | Bacteria | 1200 |
| 819 | Ga0500622_0009263 | 3300053156 | Bacteria | 5459 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046455 | Ga0495603_0089124 | Ga0495603_0089124_11_796 | 184 |
| 2 | 3300046681 | Ga0495647_0259251 | Ga0495647_0259251_23_694 | 184 |
| 3 | 3300046477 | Ga0495664_0221419 | Ga0495664_0221419_26_979 | 194 |
| 4 | 3300046459 | Ga0495629_0353274 | Ga0495629_0353274_168_986 | 201 |
| 5 | 3300005437 | Ga0070710_10100036 | Ga0070710_101000364 | 207 |
| 6 | 3300025898 | Ga0207692_10095128 | Ga0207692_100951281 | 207 |
| 7 | 3300046475 | Ga0495639_0026037 | Ga0495639_0026037_1549_2553 | 210 |
| 8 | 3300046476 | Ga0495662_0022474 | Ga0495662_0022474_1727_2695 | 210 |
| 9 | 3300046533 | Ga0495640_0015708 | Ga0495640_0015708_2179_3183 | 210 |
| 10 | 3300046642 | Ga0495634_0019228 | Ga0495634_0019228_3809_4813 | 210 |
| 11 | 3300046678 | Ga0495599_0020373 | Ga0495599_0020373_2287_3291 | 210 |
| 12 | 3300047673 | Ga0495593_0043384 | Ga0495593_0043384_11_979 | 210 |
| 13 | 3300053077 | Ga0495601_0214108 | Ga0495601_0214108_243_1211 | 210 |
| 14 | 3300005983 | Ga0081540_1000607 | Ga0081540_10006075 | 211 |
| 15 | 3300035172 | Ga0373955_0035832 | Ga0373955_0035832_1551_2555 | 211 |
| 16 | 3300035692 | Ga0373935_0016503 | Ga0373935_0016503_1803_2807 | 211 |
| 17 | 3300036401 | Ga0373937_0003979 | Ga0373937_0003979_8912_9916 | 211 |
| 18 | 3300046463 | Ga0495653_0034825 | Ga0495653_0034825_1682_2686 | 211 |
| 19 | 3300046517 | Ga0495630_0014182 | Ga0495630_0014182_2278_3282 | 211 |
| 20 | 3300046536 | Ga0495587_0010020 | Ga0495587_0010020_2793_3797 | 211 |
| 21 | 3300046559 | Ga0495667_0006695 | Ga0495667_0006695_511_1515 | 211 |
| 22 | 3300046675 | Ga0495657_0040463 | Ga0495657_0040463_1555_2559 | 211 |
| 23 | 3300046679 | Ga0495623_0183373 | Ga0495623_0183373_114_1172 | 211 |
| 24 | 3300046680 | Ga0495646_0022432 | Ga0495646_0022432_1603_2607 | 211 |
| 25 | 3300046683 | Ga0495658_0018793 | Ga0495658_0018793_1452_2456 | 211 |
| 26 | 3300046690 | Ga0495624_0066180 | Ga0495624_0066180_1048_2052 | 211 |
| 27 | 3300047322 | Ga0495680_0115945 | Ga0495680_0115945_357_1343 | 211 |
| 28 | 3300048088 | Ga0495602_0044304 | Ga0495602_0044304_2194_3198 | 211 |
| 29 | 3300035692 | Ga0373935_0326146 | Ga0373935_0326146_35_937 | 212 |
| 30 | 3300035116 | Ga0373945_0047307 | Ga0373945_0047307_294_1175 | 213 |
| 31 | 3300048912 | Ga0496109_0055319 | Ga0496109_0055319_1705_2517 | 213 |
| 32 | 3300005434 | Ga0070709_10100478 | Ga0070709_101004782 | 214 |
| 33 | 3300005437 | Ga0070710_10078106 | Ga0070710_100781062 | 214 |
| 34 | 3300005439 | Ga0070711_100122385 | Ga0070711_1001223852 | 214 |
| 35 | 3300005614 | Ga0068856_100248806 | Ga0068856_1002488062 | 214 |
| 36 | 3300005618 | Ga0068864_100167239 | Ga0068864_1001672392 | 214 |
| 37 | 3300006163 | Ga0070715_10042184 | Ga0070715_100421843 | 214 |
| 38 | 3300006173 | Ga0070716_100099505 | Ga0070716_1000995053 | 214 |
| 39 | 3300025898 | Ga0207692_10011656 | Ga0207692_100116562 | 214 |
| 40 | 3300025906 | Ga0207699_10013024 | Ga0207699_100130242 | 214 |
| 41 | 3300025915 | Ga0207693_10146280 | Ga0207693_101462802 | 214 |
| 42 | 3300025916 | Ga0207663_10100640 | Ga0207663_101006402 | 214 |
| 43 | 3300025928 | Ga0207700_10005267 | Ga0207700_100052675 | 214 |
| 44 | 3300025929 | Ga0207664_10036478 | Ga0207664_100364782 | 214 |
| 45 | 3300025939 | Ga0207665_10116373 | Ga0207665_101163732 | 214 |
| 46 | 3300034816 | Ga0373930_0028625 | Ga0373930_0028625_67_957 | 214 |
| 47 | 3300034819 | Ga0373958_0004767 | Ga0373958_0004767_168_1058 | 214 |
| 48 | 3300034820 | Ga0373959_0015384 | Ga0373959_0015384_69_959 | 214 |
| 49 | 3300035085 | Ga0373929_0007014 | Ga0373929_0007014_289_1179 | 214 |
| 50 | 3300035088 | Ga0373940_0011546 | Ga0373940_0011546_64_954 | 214 |
| 51 | 3300035207 | Ga0373942_0046417 | Ga0373942_0046417_122_1012 | 214 |
| 52 | 3300035241 | Ga0373961_0014119 | Ga0373961_0014119_138_1028 | 214 |
| 53 | 3300035691 | Ga0373931_0076418 | Ga0373931_0076418_256_1146 | 214 |
| 54 | 3300046462 | Ga0495651_0035996 | Ga0495651_0035996_1953_2843 | 214 |
| 55 | 3300046683 | Ga0495658_0043551 | Ga0495658_0043551_1465_2343 | 214 |
| 56 | 3300047315 | Ga0495581_0015452 | Ga0495581_0015452_3411_4301 | 214 |
| 57 | 3300048903 | Ga0496100_0029777 | Ga0496100_0029777_2311_3201 | 214 |
| 58 | 3300048904 | Ga0496101_0032361 | Ga0496101_0032361_305_1195 | 214 |
| 59 | 3300048905 | Ga0496102_0209553 | Ga0496102_0209553_686_1576 | 214 |
| 60 | 3300048907 | Ga0496104_0036938 | Ga0496104_0036938_3371_4261 | 214 |
| 61 | 3300048908 | Ga0496105_0032555 | Ga0496105_0032555_3083_3973 | 214 |
| 62 | 3300048909 | Ga0496106_0118233 | Ga0496106_0118233_226_1116 | 214 |
| 63 | 3300048909 | Ga0496106_0140248 | Ga0496106_0140248_568_1458 | 214 |
| 64 | 3300048911 | Ga0496108_0069967 | Ga0496108_0069967_860_1750 | 214 |
| 65 | 3300048913 | Ga0496110_0265463 | Ga0496110_0265463_623_1513 | 214 |
| 66 | 3300048917 | Ga0496114_0022763 | Ga0496114_0022763_1818_2708 | 214 |
| 67 | 3300048918 | Ga0496115_0024609 | Ga0496115_0024609_2821_3711 | 214 |
| 68 | 3300035725 | Ga0373947_0022856 | Ga0373947_0022856_1077_1955 | 215 |
| 69 | 3300006852 | Ga0075433_10048108 | Ga0075433_100481082 | 216 |
| 70 | 3300035111 | Ga0373923_0139215 | Ga0373923_0139215_137_1015 | 216 |
| 71 | 3300046461 | Ga0495641_0105591 | Ga0495641_0105591_351_1241 | 216 |
| 72 | 3300046473 | Ga0495582_0032023 | Ga0495582_0032023_396_1286 | 216 |
| 73 | 3300047321 | Ga0495676_0084085 | Ga0495676_0084085_926_1816 | 216 |
| 74 | 3300046463 | Ga0495653_0103945 | Ga0495653_0103945_909_1799 | 217 |
| 75 | 3300046663 | Ga0495635_0043890 | Ga0495635_0043890_1601_2491 | 217 |
| 76 | 3300050512 | nmdc:mga0n895_241896_c1 | nmdc:mga0n895_241896_c1_458_1348 | 217 |
| 77 | 3300050513 | nmdc:mga0rr50_15046_c1 | nmdc:mga0rr50_15046_c1_2583_3473 | 217 |
| 78 | 3300050514 | nmdc:mga08x19_136839_c1 | nmdc:mga08x19_136839_c1_615_1505 | 217 |
| 79 | 3300050515 | nmdc:mga0a205_112376_c1 | nmdc:mga0a205_112376_c1_1194_2084 | 217 |
| 80 | 3300045976 | Ga0466967_0099778 | Ga0466967_0099778_1236_2105 | 218 |
| 81 | 3300005434 | Ga0070709_10006893 | Ga0070709_100068933 | 219 |
| 82 | 3300005437 | Ga0070710_10013641 | Ga0070710_100136413 | 219 |
| 83 | 3300006028 | Ga0070717_10038025 | Ga0070717_100380253 | 219 |
| 84 | 3300006173 | Ga0070716_100007664 | Ga0070716_1000076643 | 219 |
| 85 | 3300025928 | Ga0207700_10002700 | Ga0207700_100027003 | 219 |
| 86 | 3300025929 | Ga0207664_10009808 | Ga0207664_100098082 | 219 |
| 87 | 3300025939 | Ga0207665_10052244 | Ga0207665_100522441 | 219 |
| 88 | 3300035086 | Ga0373934_0000147 | Ga0373934_0000147_13501_14370 | 220 |
| 89 | 3300035117 | Ga0373953_0000058 | Ga0373953_0000058_20810_21679 | 220 |
| 90 | 3300035118 | Ga0373954_0019143 | Ga0373954_0019143_1008_1877 | 220 |
| 91 | 3300035119 | Ga0373956_0000532 | Ga0373956_0000532_6691_7560 | 220 |
| 92 | 3300035120 | Ga0373957_0000135 | Ga0373957_0000135_13436_14305 | 220 |
| 93 | 3300035172 | Ga0373955_0001363 | Ga0373955_0001363_4789_5658 | 220 |
| 94 | 3300035692 | Ga0373935_0390846 | Ga0373935_0390846_14_883 | 220 |
| 95 | 3300035724 | Ga0373933_0000002 | Ga0373933_0000002_13501_14370 | 220 |
| 96 | 3300036401 | Ga0373937_0000014 | Ga0373937_0000014_137416_138285 | 220 |
| 97 | 3300046454 | Ga0495592_0000133 | Ga0495592_0000133_13501_14370 | 220 |
| 98 | 3300046462 | Ga0495651_0000470 | Ga0495651_0000470_13501_14370 | 220 |
| 99 | 3300046463 | Ga0495653_0009767 | Ga0495653_0009767_3054_3923 | 220 |
| 100 | 3300046511 | Ga0495608_0000028 | Ga0495608_0000028_13493_14362 | 220 |
| 101 | 3300046516 | Ga0495628_0015201 | Ga0495628_0015201_1924_2793 | 220 |
| 102 | 3300046529 | Ga0495652_0000031 | Ga0495652_0000031_13481_14350 | 220 |
| 103 | 3300046536 | Ga0495587_0000023 | Ga0495587_0000023_137394_138263 | 220 |
| 104 | 3300046559 | Ga0495667_0000054 | Ga0495667_0000054_13493_14362 | 220 |
| 105 | 3300046663 | Ga0495635_0067471 | Ga0495635_0067471_174_1043 | 220 |
| 106 | 3300046675 | Ga0495657_0000022 | Ga0495657_0000022_13501_14370 | 220 |
| 107 | 3300046678 | Ga0495599_0000236 | Ga0495599_0000236_20305_21174 | 220 |
| 108 | 3300046679 | Ga0495623_0001119 | Ga0495623_0001119_13502_14371 | 220 |
| 109 | 3300046680 | Ga0495646_0007017 | Ga0495646_0007017_3189_4058 | 220 |
| 110 | 3300046809 | Ga0495600_0065520 | Ga0495600_0065520_206_1075 | 220 |
| 111 | 3300047317 | Ga0495604_0000022 | Ga0495604_0000022_13478_14347 | 220 |
| 112 | 3300047322 | Ga0495680_0000271 | Ga0495680_0000271_43226_44095 | 220 |
| 113 | 3300047444 | Ga0495675_0002876 | Ga0495675_0002876_3771_4640 | 220 |
| 114 | 3300048088 | Ga0495602_0000390 | Ga0495602_0000390_13501_14370 | 220 |
| 115 | 3300053084 | Ga0495595_0001201 | Ga0495595_0001201_4021_4890 | 220 |
| 116 | 3300035083 | Ga0373926_0072951 | Ga0373926_0072951_233_1147 | 224 |
| 117 | 3300050496 | nmdc:mga07m45_414698_c1 | nmdc:mga07m45_414698_c1_10_699 | 224 |
| 118 | 3300005535 | Ga0070684_100187419 | Ga0070684_1001874191 | 225 |
| 119 | 3300045049 | Ga0466959_0102133 | Ga0466959_0102133_265_1095 | 227 |
| 120 | 3300046517 | Ga0495630_0360397 | Ga0495630_0360397_66_962 | 227 |
| 121 | 3300048903 | Ga0496100_0040778 | Ga0496100_0040778_1777_2667 | 227 |
| 122 | 3300048918 | Ga0496115_0149297 | Ga0496115_0149297_744_1634 | 227 |
| 123 | 3300005434 | Ga0070709_10099374 | Ga0070709_100993742 | 230 |
| 124 | 3300005435 | Ga0070714_100177646 | Ga0070714_1001776462 | 230 |
| 125 | 3300005436 | Ga0070713_100173060 | Ga0070713_1001730602 | 230 |
| 126 | 3300005437 | Ga0070710_10067800 | Ga0070710_100678002 | 230 |
| 127 | 3300005439 | Ga0070711_100276269 | Ga0070711_1002762691 | 230 |
| 128 | 3300006028 | Ga0070717_10346515 | Ga0070717_103465152 | 230 |
| 129 | 3300006163 | Ga0070715_10013346 | Ga0070715_100133462 | 230 |
| 130 | 3300006173 | Ga0070716_100081178 | Ga0070716_1000811782 | 230 |
| 131 | 3300025898 | Ga0207692_10004364 | Ga0207692_100043646 | 230 |
| 132 | 3300025905 | Ga0207685_10014795 | Ga0207685_100147952 | 230 |
| 133 | 3300025906 | Ga0207699_10090248 | Ga0207699_100902482 | 230 |
| 134 | 3300025915 | Ga0207693_10145038 | Ga0207693_101450382 | 230 |
| 135 | 3300025916 | Ga0207663_10045372 | Ga0207663_100453722 | 230 |
| 136 | 3300025928 | Ga0207700_10069497 | Ga0207700_100694972 | 230 |
| 137 | 3300025929 | Ga0207664_10023594 | Ga0207664_100235943 | 230 |
| 138 | 3300025939 | Ga0207665_10115216 | Ga0207665_101152162 | 230 |
| 139 | 3300026078 | Ga0207702_10173178 | Ga0207702_101731782 | 230 |
| 140 | 3300026121 | Ga0207683_10371498 | Ga0207683_103714982 | 230 |
| 141 | 3300035086 | Ga0373934_0053865 | Ga0373934_0053865_378_1229 | 230 |
| 142 | 3300035120 | Ga0373957_0058451 | Ga0373957_0058451_172_1023 | 230 |
| 143 | 3300035172 | Ga0373955_0010380 | Ga0373955_0010380_2292_3143 | 230 |
| 144 | 3300046462 | Ga0495651_0040835 | Ga0495651_0040835_843_1694 | 230 |
| 145 | 3300046463 | Ga0495653_0068709 | Ga0495653_0068709_1286_2137 | 230 |
| 146 | 3300046536 | Ga0495587_0095139 | Ga0495587_0095139_31_882 | 230 |
| 147 | 3300046559 | Ga0495667_0033362 | Ga0495667_0033362_786_1637 | 230 |
| 148 | 3300047322 | Ga0495680_0034344 | Ga0495680_0034344_2667_3518 | 230 |
| 149 | 3300047444 | Ga0495675_0107570 | Ga0495675_0107570_180_1031 | 230 |
| 150 | 3300047471 | Ga0495684_0097573 | Ga0495684_0097573_199_1050 | 230 |
| 151 | 3300048088 | Ga0495602_0024707 | Ga0495602_0024707_1111_1962 | 230 |
| 152 | 3300048907 | Ga0496104_0224506 | Ga0496104_0224506_316_1206 | 230 |
| 153 | 3300048908 | Ga0496105_0189835 | Ga0496105_0189835_316_1206 | 230 |
| 154 | 3300048911 | Ga0496108_0105500 | Ga0496108_0105500_301_1191 | 230 |
| 155 | 3300048912 | Ga0496109_0335198 | Ga0496109_0335198_244_1134 | 230 |
| 156 | 3300048915 | Ga0496112_0036188 | Ga0496112_0036188_3444_4334 | 230 |
| 157 | 3300048917 | Ga0496114_0285599 | Ga0496114_0285599_299_1189 | 230 |
| 158 | 3300005434 | Ga0070709_10013984 | Ga0070709_100139842 | 232 |
| 159 | 3300005437 | Ga0070710_10010458 | Ga0070710_100104583 | 232 |
| 160 | 3300005439 | Ga0070711_100012223 | Ga0070711_1000122232 | 232 |
| 161 | 3300006173 | Ga0070716_100069817 | Ga0070716_1000698172 | 232 |
| 162 | 3300025906 | Ga0207699_10002013 | Ga0207699_100020137 | 232 |
| 163 | 3300025916 | Ga0207663_10011449 | Ga0207663_100114492 | 232 |
| 164 | 3300025928 | Ga0207700_10122255 | Ga0207700_101222552 | 232 |
| 165 | 3300025929 | Ga0207664_10069961 | Ga0207664_100699612 | 232 |
| 166 | 3300025939 | Ga0207665_10070146 | Ga0207665_100701463 | 232 |
| 167 | 3300035119 | Ga0373956_0002843 | Ga0373956_0002843_1668_2519 | 232 |
| 168 | 3300035172 | Ga0373955_0196758 | Ga0373955_0196758_298_1149 | 232 |
| 169 | 3300036401 | Ga0373937_0006593 | Ga0373937_0006593_4039_4890 | 232 |
| 170 | 3300046462 | Ga0495651_0207439 | Ga0495651_0207439_356_1207 | 232 |
| 171 | 3300046511 | Ga0495608_0083617 | Ga0495608_0083617_70_921 | 232 |
| 172 | 3300048088 | Ga0495602_0168912 | Ga0495602_0168912_59_910 | 232 |
| 173 | 3300005355 | Ga0070671_100090724 | Ga0070671_1000907243 | 233 |
| 174 | 3300005434 | Ga0070709_10087492 | Ga0070709_100874922 | 233 |
| 175 | 3300005435 | Ga0070714_100326359 | Ga0070714_1003263592 | 233 |
| 176 | 3300025915 | Ga0207693_10202479 | Ga0207693_102024792 | 233 |
| 177 | 3300035724 | Ga0373933_0063035 | Ga0373933_0063035_1206_2024 | 233 |
| 178 | 3300036401 | Ga0373937_0021178 | Ga0373937_0021178_4618_5436 | 233 |
| 179 | 3300046463 | Ga0495653_0102003 | Ga0495653_0102003_943_1761 | 233 |
| 180 | 3300046473 | Ga0495582_0338028 | Ga0495582_0338028_69_815 | 233 |
| 181 | 3300046477 | Ga0495664_0118957 | Ga0495664_0118957_401_1219 | 233 |
| 182 | 3300046516 | Ga0495628_0330766 | Ga0495628_0330766_169_1011 | 233 |
| 183 | 3300046529 | Ga0495652_0040118 | Ga0495652_0040118_2393_3211 | 233 |
| 184 | 3300046675 | Ga0495657_0156406 | Ga0495657_0156406_327_1145 | 233 |
| 185 | 3300047322 | Ga0495680_0209314 | Ga0495680_0209314_387_1205 | 233 |
| 186 | 3300048088 | Ga0495602_0042039 | Ga0495602_0042039_458_1276 | 233 |
| 187 | 3300048917 | Ga0496114_0303938 | Ga0496114_0303938_164_982 | 233 |
| 188 | 3300005841 | Ga0068863_100692142 | Ga0068863_1006921421 | 234 |
| 189 | 3300048915 | Ga0496112_0459529 | Ga0496112_0459529_110_979 | 234 |
| 190 | 3300005327 | Ga0070658_10246953 | Ga0070658_102469531 | 235 |
| 191 | 3300005330 | Ga0070690_100163860 | Ga0070690_1001638602 | 235 |
| 192 | 3300005333 | Ga0070677_10190406 | Ga0070677_101904061 | 235 |
| 193 | 3300005335 | Ga0070666_10073526 | Ga0070666_100735263 | 235 |
| 194 | 3300005339 | Ga0070660_100183977 | Ga0070660_1001839771 | 235 |
| 195 | 3300005340 | Ga0070689_100090525 | Ga0070689_1000905251 | 235 |
| 196 | 3300005343 | Ga0070687_100018464 | Ga0070687_1000184642 | 235 |
| 197 | 3300005356 | Ga0070674_100161998 | Ga0070674_1001619982 | 235 |
| 198 | 3300005364 | Ga0070673_100047481 | Ga0070673_1000474812 | 235 |
| 199 | 3300005365 | Ga0070688_100224395 | Ga0070688_1002243951 | 235 |
| 200 | 3300005366 | Ga0070659_100130011 | Ga0070659_1001300113 | 235 |
| 201 | 3300005441 | Ga0070700_100041611 | Ga0070700_1000416111 | 235 |
| 202 | 3300005444 | Ga0070694_100117670 | Ga0070694_1001176702 | 235 |
| 203 | 3300005455 | Ga0070663_100079030 | Ga0070663_1000790302 | 235 |
| 204 | 3300005457 | Ga0070662_100058765 | Ga0070662_1000587653 | 235 |
| 205 | 3300005458 | Ga0070681_10035795 | Ga0070681_100357952 | 235 |
| 206 | 3300005467 | Ga0070706_100491012 | Ga0070706_1004910121 | 235 |
| 207 | 3300005535 | Ga0070684_100277689 | Ga0070684_1002776892 | 235 |
| 208 | 3300005539 | Ga0068853_100059551 | Ga0068853_1000595512 | 235 |
| 209 | 3300005544 | Ga0070686_100099316 | Ga0070686_1000993162 | 235 |
| 210 | 3300005545 | Ga0070695_100133801 | Ga0070695_1001338012 | 235 |
| 211 | 3300005546 | Ga0070696_100036096 | Ga0070696_1000360963 | 235 |
| 212 | 3300005547 | Ga0070693_100045748 | Ga0070693_1000457481 | 235 |
| 213 | 3300005563 | Ga0068855_100442921 | Ga0068855_1004429212 | 235 |
| 214 | 3300005564 | Ga0070664_100107971 | Ga0070664_1001079712 | 235 |
| 215 | 3300005578 | Ga0068854_100325682 | Ga0068854_1003256822 | 235 |
| 216 | 3300005615 | Ga0070702_100007313 | Ga0070702_1000073132 | 235 |
| 217 | 3300005617 | Ga0068859_100265256 | Ga0068859_1002652562 | 235 |
| 218 | 3300005719 | Ga0068861_100186722 | Ga0068861_1001867222 | 235 |
| 219 | 3300005841 | Ga0068863_100140133 | Ga0068863_1001401332 | 235 |
| 220 | 3300005842 | Ga0068858_100394263 | Ga0068858_1003942632 | 235 |
| 221 | 3300005843 | Ga0068860_100038155 | Ga0068860_1000381553 | 235 |
| 222 | 3300006871 | Ga0075434_100128530 | Ga0075434_1001285302 | 235 |
| 223 | 3300006931 | Ga0097620_100265239 | Ga0097620_1002652392 | 235 |
| 224 | 3300007788 | Ga0099795_10034876 | Ga0099795_100348763 | 235 |
| 225 | 3300009011 | Ga0105251_10030726 | Ga0105251_100307262 | 235 |
| 226 | 3300009093 | Ga0105240_10293906 | Ga0105240_102939062 | 235 |
| 227 | 3300009101 | Ga0105247_10074403 | Ga0105247_100744032 | 235 |
| 228 | 3300009148 | Ga0105243_10185776 | Ga0105243_101857762 | 235 |
| 229 | 3300009176 | Ga0105242_10191874 | Ga0105242_101918742 | 235 |
| 230 | 3300009177 | Ga0105248_10206676 | Ga0105248_102066761 | 235 |
| 231 | 3300009545 | Ga0105237_10076284 | Ga0105237_100762842 | 235 |
| 232 | 3300012476 | Ga0157344_1001748 | Ga0157344_10017482 | 235 |
| 233 | 3300013102 | Ga0157371_10098415 | Ga0157371_100984152 | 235 |
| 234 | 3300013104 | Ga0157370_10202944 | Ga0157370_102029443 | 235 |
| 235 | 3300013308 | Ga0157375_10761197 | Ga0157375_107611972 | 235 |
| 236 | 3300025885 | Ga0207653_10016699 | Ga0207653_100166993 | 235 |
| 237 | 3300025898 | Ga0207692_10026070 | Ga0207692_100260702 | 235 |
| 238 | 3300025901 | Ga0207688_10010495 | Ga0207688_100104955 | 235 |
| 239 | 3300025903 | Ga0207680_10320191 | Ga0207680_103201912 | 235 |
| 240 | 3300025904 | Ga0207647_10112645 | Ga0207647_101126452 | 235 |
| 241 | 3300025906 | Ga0207699_10008123 | Ga0207699_100081232 | 235 |
| 242 | 3300025909 | Ga0207705_10250942 | Ga0207705_102509422 | 235 |
| 243 | 3300025912 | Ga0207707_10098726 | Ga0207707_100987262 | 235 |
| 244 | 3300025914 | Ga0207671_10292723 | Ga0207671_102927232 | 235 |
| 245 | 3300025915 | Ga0207693_10089790 | Ga0207693_100897902 | 235 |
| 246 | 3300025918 | Ga0207662_10015130 | Ga0207662_100151304 | 235 |
| 247 | 3300025919 | Ga0207657_10003200 | Ga0207657_100032005 | 235 |
| 248 | 3300025920 | Ga0207649_10016696 | Ga0207649_100166962 | 235 |
| 249 | 3300025928 | Ga0207700_10028659 | Ga0207700_100286592 | 235 |
| 250 | 3300025932 | Ga0207690_10019520 | Ga0207690_100195202 | 235 |
| 251 | 3300025933 | Ga0207706_10012201 | Ga0207706_100122013 | 235 |
| 252 | 3300025936 | Ga0207670_10112011 | Ga0207670_101120111 | 235 |
| 253 | 3300025939 | Ga0207665_10034619 | Ga0207665_100346192 | 235 |
| 254 | 3300025986 | Ga0207658_10116540 | Ga0207658_101165402 | 235 |
| 255 | 3300026041 | Ga0207639_10230458 | Ga0207639_102304582 | 235 |
| 256 | 3300026075 | Ga0207708_10032974 | Ga0207708_100329743 | 235 |
| 257 | 3300026078 | Ga0207702_10221506 | Ga0207702_102215062 | 235 |
| 258 | 3300026116 | Ga0207674_10004694 | Ga0207674_100046945 | 235 |
| 259 | 3300026118 | Ga0207675_100074065 | Ga0207675_1000740653 | 235 |
| 260 | 3300026121 | Ga0207683_10003826 | Ga0207683_100038267 | 235 |
| 261 | 3300034817 | Ga0373948_0039466 | Ga0373948_0039466_88_912 | 235 |
| 262 | 3300034820 | Ga0373959_0016178 | Ga0373959_0016178_89_913 | 235 |
| 263 | 3300035086 | Ga0373934_0057480 | Ga0373934_0057480_76_900 | 235 |
| 264 | 3300035089 | Ga0373944_0000478 | Ga0373944_0000478_4799_5623 | 235 |
| 265 | 3300035089 | Ga0373944_0077381 | Ga0373944_0077381_281_1033 | 235 |
| 266 | 3300035091 | Ga0373951_0025536 | Ga0373951_0025536_17_841 | 235 |
| 267 | 3300035111 | Ga0373923_0002363 | Ga0373923_0002363_1202_2026 | 235 |
| 268 | 3300035113 | Ga0373936_0001389 | Ga0373936_0001389_2289_3113 | 235 |
| 269 | 3300035116 | Ga0373945_0025351 | Ga0373945_0025351_30_854 | 235 |
| 270 | 3300035117 | Ga0373953_0028495 | Ga0373953_0028495_781_1605 | 235 |
| 271 | 3300035118 | Ga0373954_0015678 | Ga0373954_0015678_416_1240 | 235 |
| 272 | 3300035120 | Ga0373957_0003564 | Ga0373957_0003564_2967_3791 | 235 |
| 273 | 3300035170 | Ga0373943_0032741 | Ga0373943_0032741_1590_2414 | 235 |
| 274 | 3300035171 | Ga0373946_0007296 | Ga0373946_0007296_1690_2514 | 235 |
| 275 | 3300035241 | Ga0373961_0068093 | Ga0373961_0068093_109_933 | 235 |
| 276 | 3300035410 | Ga0373924_0015077 | Ga0373924_0015077_708_1532 | 235 |
| 277 | 3300035691 | Ga0373931_0119194 | Ga0373931_0119194_508_1332 | 235 |
| 278 | 3300035692 | Ga0373935_0056401 | Ga0373935_0056401_708_1532 | 235 |
| 279 | 3300035695 | Ga0373927_0063242 | Ga0373927_0063242_267_1091 | 235 |
| 280 | 3300035725 | Ga0373947_0009158 | Ga0373947_0009158_521_1345 | 235 |
| 281 | 3300046454 | Ga0495592_0010718 | Ga0495592_0010718_833_1657 | 235 |
| 282 | 3300046459 | Ga0495629_0008393 | Ga0495629_0008393_5071_5895 | 235 |
| 283 | 3300046461 | Ga0495641_0007980 | Ga0495641_0007980_2175_2999 | 235 |
| 284 | 3300046472 | Ga0495580_0027686 | Ga0495580_0027686_3181_4005 | 235 |
| 285 | 3300046475 | Ga0495639_0000320 | Ga0495639_0000320_20737_21561 | 235 |
| 286 | 3300046476 | Ga0495662_0002566 | Ga0495662_0002566_7899_8723 | 235 |
| 287 | 3300046477 | Ga0495664_0006281 | Ga0495664_0006281_3028_3852 | 235 |
| 288 | 3300046499 | Ga0495594_0051741 | Ga0495594_0051741_338_1162 | 235 |
| 289 | 3300046526 | Ga0495666_0001809 | Ga0495666_0001809_596_1420 | 235 |
| 290 | 3300046531 | Ga0495665_0004183 | Ga0495665_0004183_2188_3012 | 235 |
| 291 | 3300046533 | Ga0495640_0007267 | Ga0495640_0007267_7828_8652 | 235 |
| 292 | 3300046536 | Ga0495587_0031703 | Ga0495587_0031703_2126_2950 | 235 |
| 293 | 3300046557 | Ga0495622_0096476 | Ga0495622_0096476_521_1345 | 235 |
| 294 | 3300046642 | Ga0495634_0013714 | Ga0495634_0013714_2710_3534 | 235 |
| 295 | 3300046663 | Ga0495635_0008781 | Ga0495635_0008781_1189_2013 | 235 |
| 296 | 3300046675 | Ga0495657_0030011 | Ga0495657_0030011_1933_2757 | 235 |
| 297 | 3300046681 | Ga0495647_0003056 | Ga0495647_0003056_3493_4317 | 235 |
| 298 | 3300046690 | Ga0495624_0009799 | Ga0495624_0009799_3971_4795 | 235 |
| 299 | 3300046809 | Ga0495600_0004245 | Ga0495600_0004245_3366_4190 | 235 |
| 300 | 3300047321 | Ga0495676_0052961 | Ga0495676_0052961_708_1532 | 235 |
| 301 | 3300047471 | Ga0495684_0037960 | Ga0495684_0037960_1817_2641 | 235 |
| 302 | 3300047673 | Ga0495593_0007205 | Ga0495593_0007205_5073_5897 | 235 |
| 303 | 3300048089 | Ga0495614_0023362 | Ga0495614_0023362_18_842 | 235 |
| 304 | 3300048903 | Ga0496100_0222597 | Ga0496100_0222597_19_843 | 235 |
| 305 | 3300048904 | Ga0496101_0154937 | Ga0496101_0154937_693_1517 | 235 |
| 306 | 3300048905 | Ga0496102_0150527 | Ga0496102_0150527_593_1417 | 235 |
| 307 | 3300048906 | Ga0496103_0027084 | Ga0496103_0027084_2376_3200 | 235 |
| 308 | 3300048907 | Ga0496104_0035650 | Ga0496104_0035650_388_1212 | 235 |
| 309 | 3300048908 | Ga0496105_0054596 | Ga0496105_0054596_2176_3000 | 235 |
| 310 | 3300048909 | Ga0496106_0250942 | Ga0496106_0250942_82_906 | 235 |
| 311 | 3300048918 | Ga0496115_0234054 | Ga0496115_0234054_202_1026 | 235 |
| 312 | 3300050512 | nmdc:mga0n895_291452_c1 | nmdc:mga0n895_291452_c1_18_842 | 235 |
| 313 | 3300050513 | nmdc:mga0rr50_55526_c1 | nmdc:mga0rr50_55526_c1_169_993 | 235 |
| 314 | 3300053078 | Ga0495612_0016713 | Ga0495612_0016713_1143_1967 | 235 |
| 315 | 3300053085 | Ga0495619_0006722 | Ga0495619_0006722_1394_2218 | 235 |
| 316 | 3300005367 | Ga0070667_100267977 | Ga0070667_1002679772 | 236 |
| 317 | 3300005468 | Ga0070707_100000127 | Ga0070707_10000012735 | 236 |
| 318 | 3300005471 | Ga0070698_100001111 | Ga0070698_10000111117 | 236 |
| 319 | 3300020082 | Ga0206353_11457304 | Ga0206353_114573041 | 236 |
| 320 | 3300025910 | Ga0207684_10001704 | Ga0207684_1000170419 | 236 |
| 321 | 3300025922 | Ga0207646_10000264 | Ga0207646_1000026431 | 236 |
| 322 | 3300005467 | Ga0070706_100098000 | Ga0070706_1000980004 | 238 |
| 323 | 3300005719 | Ga0068861_100235500 | Ga0068861_1002355002 | 238 |
| 324 | 3300013102 | Ga0157371_10133227 | Ga0157371_101332273 | 238 |
| 325 | 3300013105 | Ga0157369_10011430 | Ga0157369_1001143010 | 238 |
| 326 | 3300013307 | Ga0157372_10000880 | Ga0157372_1000088036 | 238 |
| 327 | 3300026118 | Ga0207675_100287896 | Ga0207675_1002878962 | 238 |
| 328 | 3300042006 | Ga0439432_108905 | Ga0439432_108905_27_743 | 238 |
| 329 | 3300042010 | Ga0439452_000029 | Ga0439452_000029_68402_69118 | 238 |
| 330 | 3300048905 | Ga0496102_0048291 | Ga0496102_0048291_2183_2899 | 238 |
| 331 | 3300048907 | Ga0496104_0624739 | Ga0496104_0624739_250_966 | 238 |
| 332 | 3300048919 | Ga0496116_0048578 | Ga0496116_0048578_1275_1991 | 238 |
| 333 | 3300048920 | Ga0496117_0008147 | Ga0496117_0008147_8108_8824 | 238 |
| 334 | 3300048920 | Ga0496117_0132910 | Ga0496117_0132910_686_1402 | 238 |
| 335 | 3300048921 | Ga0496118_0009235 | Ga0496118_0009235_8108_8824 | 238 |
| 336 | 3300048921 | Ga0496118_0146260 | Ga0496118_0146260_30_746 | 238 |
| 337 | 3300048922 | Ga0496119_0000045 | Ga0496119_0000045_132653_133369 | 238 |
| 338 | 3300048923 | Ga0496120_0019025 | Ga0496120_0019025_3332_4048 | 238 |
| 339 | 3300048925 | Ga0496122_0068741 | Ga0496122_0068741_586_1302 | 238 |
| 340 | 3300048926 | Ga0496123_0058663 | Ga0496123_0058663_209_925 | 238 |
| 341 | 3300048927 | Ga0496124_0005426 | Ga0496124_0005426_4510_5226 | 238 |
| 342 | 3300048928 | Ga0496125_0048738 | Ga0496125_0048738_2266_2982 | 238 |
| 343 | 3300049459 | Ga0495678_011026 | Ga0495678_011026_3610_4326 | 238 |
| 344 | 3300046511 | Ga0495608_0050926 | Ga0495608_0050926_995_1846 | 239 |
| 345 | 3300025942 | Ga0207689_10003777 | Ga0207689_100037777 | 240 |
| 346 | 3300035725 | Ga0373947_0046020 | Ga0373947_0046020_1705_2520 | 240 |
| 347 | 3300046514 | Ga0495618_0226890 | Ga0495618_0226890_105_1025 | 240 |
| 348 | 3300046533 | Ga0495640_0093850 | Ga0495640_0093850_466_1281 | 240 |
| 349 | 3300046663 | Ga0495635_0171289 | Ga0495635_0171289_605_1420 | 240 |
| 350 | 3300046690 | Ga0495624_0049025 | Ga0495624_0049025_555_1475 | 240 |
| 351 | 3300047319 | Ga0495674_0010705 | Ga0495674_0010705_5912_6832 | 240 |
| 352 | 3300050513 | nmdc:mga0rr50_131326_c1 | nmdc:mga0rr50_131326_c1_21_866 | 240 |
| 353 | 3300044683 | Ga0466965_0107561 | Ga0466965_0107561_62_808 | 241 |
| 354 | 3300047317 | Ga0495604_0023576 | Ga0495604_0023576_2726_3577 | 241 |
| 355 | 3300049823 | Ga0501044_0278345 | Ga0501044_0278345_146_883 | 241 |
| 356 | 3300053156 | Ga0500622_0009263 | Ga0500622_0009263_1275_2003 | 241 |
| 357 | 3300005434 | Ga0070709_10226095 | Ga0070709_102260951 | 243 |
| 358 | 3300005439 | Ga0070711_100018699 | Ga0070711_1000186992 | 246 |
| 359 | 3300049571 | Ga0501034_0004181 | Ga0501034_0004181_11316_12110 | 251 |
| 360 | 3300049572 | Ga0501036_0000170 | Ga0501036_0000170_32090_32884 | 251 |
| 361 | 3300049573 | Ga0501037_0004187 | Ga0501037_0004187_4526_5320 | 251 |
| 362 | 3300049574 | Ga0501038_0006542 | Ga0501038_0006542_8725_9519 | 251 |
| 363 | 3300049575 | Ga0501039_0188459 | Ga0501039_0188459_717_1511 | 251 |
| 364 | 3300049578 | Ga0501042_0002573 | Ga0501042_0002573_3689_4483 | 251 |
| 365 | 3300049579 | Ga0501043_0000866 | Ga0501043_0000866_8167_8961 | 251 |
| 366 | 3300049581 | Ga0501047_0002697 | Ga0501047_0002697_11658_12452 | 251 |
| 367 | 3300049582 | Ga0501048_0001538 | Ga0501048_0001538_14663_15457 | 251 |
| 368 | 3300049589 | Ga0501073_0027049 | Ga0501073_0027049_1261_2055 | 251 |
| 369 | 3300049590 | Ga0501074_0001528 | Ga0501074_0001528_8245_9039 | 251 |
| 370 | 3300049823 | Ga0501044_0192161 | Ga0501044_0192161_526_1320 | 251 |
| 371 | 3300025924 | Ga0207694_10146342 | Ga0207694_101463422 | 252 |
| 372 | 3300005327 | Ga0070658_10000228 | Ga0070658_1000022829 | 253 |
| 373 | 3300005338 | Ga0068868_100040999 | Ga0068868_1000409992 | 253 |
| 374 | 3300005366 | Ga0070659_100382883 | Ga0070659_1003828832 | 253 |
| 375 | 3300005434 | Ga0070709_10141140 | Ga0070709_101411402 | 253 |
| 376 | 3300005435 | Ga0070714_100013140 | Ga0070714_1000131406 | 253 |
| 377 | 3300005436 | Ga0070713_100023274 | Ga0070713_1000232744 | 253 |
| 378 | 3300005437 | Ga0070710_10003256 | Ga0070710_100032566 | 253 |
| 379 | 3300005445 | Ga0070708_100002499 | Ga0070708_1000024999 | 253 |
| 380 | 3300005445 | Ga0070708_100122769 | Ga0070708_1001227692 | 253 |
| 381 | 3300005467 | Ga0070706_100012251 | Ga0070706_1000122518 | 253 |
| 382 | 3300005468 | Ga0070707_100005476 | Ga0070707_1000054768 | 253 |
| 383 | 3300005468 | Ga0070707_100105675 | Ga0070707_1001056753 | 253 |
| 384 | 3300005468 | Ga0070707_100197599 | Ga0070707_1001975992 | 253 |
| 385 | 3300005468 | Ga0070707_100238481 | Ga0070707_1002384812 | 253 |
| 386 | 3300005471 | Ga0070698_100000597 | Ga0070698_10000059738 | 253 |
| 387 | 3300005471 | Ga0070698_100015856 | Ga0070698_1000158563 | 253 |
| 388 | 3300005518 | Ga0070699_100211551 | Ga0070699_1002115511 | 253 |
| 389 | 3300005535 | Ga0070684_100257898 | Ga0070684_1002578981 | 253 |
| 390 | 3300005536 | Ga0070697_100160824 | Ga0070697_1001608241 | 253 |
| 391 | 3300005547 | Ga0070693_100267772 | Ga0070693_1002677721 | 253 |
| 392 | 3300005563 | Ga0068855_100151405 | Ga0068855_1001514052 | 253 |
| 393 | 3300005577 | Ga0068857_100295364 | Ga0068857_1002953641 | 253 |
| 394 | 3300005578 | Ga0068854_100375522 | Ga0068854_1003755221 | 253 |
| 395 | 3300005614 | Ga0068856_100143534 | Ga0068856_1001435342 | 253 |
| 396 | 3300005618 | Ga0068864_100239190 | Ga0068864_1002391902 | 253 |
| 397 | 3300005841 | Ga0068863_100174675 | Ga0068863_1001746752 | 253 |
| 398 | 3300006028 | Ga0070717_10035786 | Ga0070717_100357863 | 253 |
| 399 | 3300006028 | Ga0070717_10089211 | Ga0070717_100892112 | 253 |
| 400 | 3300006028 | Ga0070717_10120059 | Ga0070717_101200592 | 253 |
| 401 | 3300006173 | Ga0070716_100000033 | Ga0070716_10000003313 | 253 |
| 402 | 3300006173 | Ga0070716_100003740 | Ga0070716_1000037403 | 253 |
| 403 | 3300006175 | Ga0070712_100013295 | Ga0070712_1000132952 | 253 |
| 404 | 3300006358 | Ga0068871_100055167 | Ga0068871_1000551673 | 253 |
| 405 | 3300006871 | Ga0075434_100124282 | Ga0075434_1001242822 | 253 |
| 406 | 3300007076 | Ga0075435_100080504 | Ga0075435_1000805042 | 253 |
| 407 | 3300007265 | Ga0099794_10154508 | Ga0099794_101545082 | 253 |
| 408 | 3300010375 | Ga0105239_10044658 | Ga0105239_100446582 | 253 |
| 409 | 3300013296 | Ga0157374_10052816 | Ga0157374_100528164 | 253 |
| 410 | 3300014325 | Ga0163163_10112678 | Ga0163163_101126782 | 253 |
| 411 | 3300014968 | Ga0157379_10259662 | Ga0157379_102596621 | 253 |
| 412 | 3300020069 | Ga0197907_11138267 | Ga0197907_111382671 | 253 |
| 413 | 3300020070 | Ga0206356_11018721 | Ga0206356_110187212 | 253 |
| 414 | 3300020080 | Ga0206350_11235534 | Ga0206350_112355342 | 253 |
| 415 | 3300021388 | Ga0213875_10000678 | Ga0213875_100006783 | 253 |
| 416 | 3300022467 | Ga0224712_10068754 | Ga0224712_100687542 | 253 |
| 417 | 3300025898 | Ga0207692_10012684 | Ga0207692_100126843 | 253 |
| 418 | 3300025905 | Ga0207685_10058066 | Ga0207685_100580662 | 253 |
| 419 | 3300025906 | Ga0207699_10001401 | Ga0207699_100014012 | 253 |
| 420 | 3300025906 | Ga0207699_10044260 | Ga0207699_100442602 | 253 |
| 421 | 3300025909 | Ga0207705_10000534 | Ga0207705_1000053414 | 253 |
| 422 | 3300025910 | Ga0207684_10094283 | Ga0207684_100942831 | 253 |
| 423 | 3300025910 | Ga0207684_10160837 | Ga0207684_101608373 | 253 |
| 424 | 3300025914 | Ga0207671_10102092 | Ga0207671_101020922 | 253 |
| 425 | 3300025915 | Ga0207693_10010158 | Ga0207693_100101583 | 253 |
| 426 | 3300025916 | Ga0207663_10055787 | Ga0207663_100557872 | 253 |
| 427 | 3300025916 | Ga0207663_10072922 | Ga0207663_100729222 | 253 |
| 428 | 3300025916 | Ga0207663_10166551 | Ga0207663_101665512 | 253 |
| 429 | 3300025922 | Ga0207646_10007362 | Ga0207646_100073628 | 253 |
| 430 | 3300025922 | Ga0207646_10044705 | Ga0207646_100447053 | 253 |
| 431 | 3300025922 | Ga0207646_10127942 | Ga0207646_101279422 | 253 |
| 432 | 3300025922 | Ga0207646_10533187 | Ga0207646_105331872 | 253 |
| 433 | 3300025928 | Ga0207700_10031683 | Ga0207700_100316832 | 253 |
| 434 | 3300025928 | Ga0207700_10092498 | Ga0207700_100924982 | 253 |
| 435 | 3300025928 | Ga0207700_10093082 | Ga0207700_100930822 | 253 |
| 436 | 3300025929 | Ga0207664_10000276 | Ga0207664_1000027636 | 253 |
| 437 | 3300025929 | Ga0207664_10121916 | Ga0207664_101219162 | 253 |
| 438 | 3300025929 | Ga0207664_10123763 | Ga0207664_101237632 | 253 |
| 439 | 3300025939 | Ga0207665_10000079 | Ga0207665_1000007913 | 253 |
| 440 | 3300025939 | Ga0207665_10002232 | Ga0207665_100022326 | 253 |
| 441 | 3300025945 | Ga0207679_10187016 | Ga0207679_101870162 | 253 |
| 442 | 3300026023 | Ga0207677_10051214 | Ga0207677_100512143 | 253 |
| 443 | 3300026035 | Ga0207703_10061543 | Ga0207703_100615432 | 253 |
| 444 | 3300026078 | Ga0207702_10082246 | Ga0207702_100822462 | 253 |
| 445 | 3300026088 | Ga0207641_10192970 | Ga0207641_101929702 | 253 |
| 446 | 3300026116 | Ga0207674_10016544 | Ga0207674_100165442 | 253 |
| 447 | 3300035083 | Ga0373926_0063968 | Ga0373926_0063968_249_1064 | 253 |
| 448 | 3300035086 | Ga0373934_0005724 | Ga0373934_0005724_2378_3184 | 253 |
| 449 | 3300035086 | Ga0373934_0109020 | Ga0373934_0109020_271_1086 | 253 |
| 450 | 3300035089 | Ga0373944_0010279 | Ga0373944_0010279_499_1314 | 253 |
| 451 | 3300035111 | Ga0373923_0032811 | Ga0373923_0032811_373_1179 | 253 |
| 452 | 3300035113 | Ga0373936_0045778 | Ga0373936_0045778_926_1741 | 253 |
| 453 | 3300035113 | Ga0373936_0076511 | Ga0373936_0076511_517_1323 | 253 |
| 454 | 3300035117 | Ga0373953_0044206 | Ga0373953_0044206_873_1679 | 253 |
| 455 | 3300035118 | Ga0373954_0002851 | Ga0373954_0002851_3738_4544 | 253 |
| 456 | 3300035118 | Ga0373954_0020254 | Ga0373954_0020254_213_1028 | 253 |
| 457 | 3300035119 | Ga0373956_0052098 | Ga0373956_0052098_122_928 | 253 |
| 458 | 3300035120 | Ga0373957_0012480 | Ga0373957_0012480_1705_2511 | 253 |
| 459 | 3300035172 | Ga0373955_0007242 | Ga0373955_0007242_1021_1827 | 253 |
| 460 | 3300035410 | Ga0373924_0004968 | Ga0373924_0004968_2329_3135 | 253 |
| 461 | 3300035410 | Ga0373924_0047522 | Ga0373924_0047522_938_1753 | 253 |
| 462 | 3300035692 | Ga0373935_0000168 | Ga0373935_0000168_17353_18159 | 253 |
| 463 | 3300035692 | Ga0373935_0025642 | Ga0373935_0025642_2060_2866 | 253 |
| 464 | 3300035692 | Ga0373935_0056603 | Ga0373935_0056603_1171_1986 | 253 |
| 465 | 3300035695 | Ga0373927_0164218 | Ga0373927_0164218_39_854 | 253 |
| 466 | 3300035724 | Ga0373933_0013496 | Ga0373933_0013496_3186_3992 | 253 |
| 467 | 3300035725 | Ga0373947_0000007 | Ga0373947_0000007_94554_95360 | 253 |
| 468 | 3300035725 | Ga0373947_0081182 | Ga0373947_0081182_789_1604 | 253 |
| 469 | 3300035725 | Ga0373947_0107054 | Ga0373947_0107054_122_946 | 253 |
| 470 | 3300035725 | Ga0373947_0125306 | Ga0373947_0125306_183_989 | 253 |
| 471 | 3300036401 | Ga0373937_0142412 | Ga0373937_0142412_454_1260 | 253 |
| 472 | 3300037068 | Ga0373925_0074817 | Ga0373925_0074817_347_1153 | 253 |
| 473 | 3300037068 | Ga0373925_0124218 | Ga0373925_0124218_389_1204 | 253 |
| 474 | 3300037853 | Ga0436364_0287407 | Ga0436364_0287407_1749_2549 | 253 |
| 475 | 3300039438 | Ga0436360_1239965 | Ga0436360_1239965_381_1187 | 253 |
| 476 | 3300045976 | Ga0466967_0410293 | Ga0466967_0410293_111_917 | 253 |
| 477 | 3300046454 | Ga0495592_0059770 | Ga0495592_0059770_1340_2146 | 253 |
| 478 | 3300046455 | Ga0495603_0112658 | Ga0495603_0112658_322_1137 | 253 |
| 479 | 3300046459 | Ga0495629_0333247 | Ga0495629_0333247_167_982 | 253 |
| 480 | 3300046462 | Ga0495651_0051289 | Ga0495651_0051289_1979_2794 | 253 |
| 481 | 3300046463 | Ga0495653_0049781 | Ga0495653_0049781_353_1159 | 253 |
| 482 | 3300046475 | Ga0495639_0203579 | Ga0495639_0203579_115_930 | 253 |
| 483 | 3300046476 | Ga0495662_0040446 | Ga0495662_0040446_502_1308 | 253 |
| 484 | 3300046477 | Ga0495664_0028833 | Ga0495664_0028833_1354_2160 | 253 |
| 485 | 3300046477 | Ga0495664_0077031 | Ga0495664_0077031_664_1479 | 253 |
| 486 | 3300046511 | Ga0495608_0029188 | Ga0495608_0029188_2888_3703 | 253 |
| 487 | 3300046514 | Ga0495618_0034967 | Ga0495618_0034967_1644_2459 | 253 |
| 488 | 3300046517 | Ga0495630_0046772 | Ga0495630_0046772_393_1199 | 253 |
| 489 | 3300046529 | Ga0495652_0069590 | Ga0495652_0069590_1229_2044 | 253 |
| 490 | 3300046529 | Ga0495652_0106238 | Ga0495652_0106238_1002_1808 | 253 |
| 491 | 3300046531 | Ga0495665_0061954 | Ga0495665_0061954_793_1608 | 253 |
| 492 | 3300046533 | Ga0495640_0028735 | Ga0495640_0028735_1607_2422 | 253 |
| 493 | 3300046536 | Ga0495587_0005276 | Ga0495587_0005276_7239_8054 | 253 |
| 494 | 3300046536 | Ga0495587_0015949 | Ga0495587_0015949_457_1263 | 253 |
| 495 | 3300046543 | Ga0495645_0019460 | Ga0495645_0019460_1753_2559 | 253 |
| 496 | 3300046559 | Ga0495667_0019274 | Ga0495667_0019274_502_1308 | 253 |
| 497 | 3300046559 | Ga0495667_0031395 | Ga0495667_0031395_834_1649 | 253 |
| 498 | 3300046642 | Ga0495634_0040494 | Ga0495634_0040494_1324_2130 | 253 |
| 499 | 3300046663 | Ga0495635_0028828 | Ga0495635_0028828_2063_2869 | 253 |
| 500 | 3300046663 | Ga0495635_0049874 | Ga0495635_0049874_1536_2351 | 253 |
| 501 | 3300046675 | Ga0495657_0031045 | Ga0495657_0031045_2352_3158 | 253 |
| 502 | 3300046678 | Ga0495599_0016837 | Ga0495599_0016837_1990_2796 | 253 |
| 503 | 3300046678 | Ga0495599_0056496 | Ga0495599_0056496_1312_2127 | 253 |
| 504 | 3300046680 | Ga0495646_0010149 | Ga0495646_0010149_3986_4801 | 253 |
| 505 | 3300046680 | Ga0495646_0023398 | Ga0495646_0023398_2021_2827 | 253 |
| 506 | 3300046689 | Ga0495613_0283285 | Ga0495613_0283285_242_1057 | 253 |
| 507 | 3300046690 | Ga0495624_0154202 | Ga0495624_0154202_128_934 | 253 |
| 508 | 3300046809 | Ga0495600_0027973 | Ga0495600_0027973_686_1501 | 253 |
| 509 | 3300046809 | Ga0495600_0138543 | Ga0495600_0138543_271_1077 | 253 |
| 510 | 3300047315 | Ga0495581_0063933 | Ga0495581_0063933_907_1713 | 253 |
| 511 | 3300047317 | Ga0495604_0013825 | Ga0495604_0013825_4286_5092 | 253 |
| 512 | 3300047322 | Ga0495680_0057442 | Ga0495680_0057442_1926_2732 | 253 |
| 513 | 3300047444 | Ga0495675_0134404 | Ga0495675_0134404_352_1158 | 253 |
| 514 | 3300047471 | Ga0495684_0018097 | Ga0495684_0018097_3436_4242 | 253 |
| 515 | 3300047471 | Ga0495684_0050488 | Ga0495684_0050488_1049_1864 | 253 |
| 516 | 3300047673 | Ga0495593_0177028 | Ga0495593_0177028_15_830 | 253 |
| 517 | 3300048088 | Ga0495602_0101537 | Ga0495602_0101537_233_1039 | 253 |
| 518 | 3300048905 | Ga0496102_0212587 | Ga0496102_0212587_351_1166 | 253 |
| 519 | 3300048907 | Ga0496104_0130924 | Ga0496104_0130924_796_1611 | 253 |
| 520 | 3300048911 | Ga0496108_0008888 | Ga0496108_0008888_6453_7268 | 253 |
| 521 | 3300048912 | Ga0496109_0082488 | Ga0496109_0082488_559_1374 | 253 |
| 522 | 3300048913 | Ga0496110_0036536 | Ga0496110_0036536_1773_2588 | 253 |
| 523 | 3300048915 | Ga0496112_0111966 | Ga0496112_0111966_1870_2685 | 253 |
| 524 | 3300048916 | Ga0496113_0328017 | Ga0496113_0328017_141_956 | 253 |
| 525 | 3300049578 | Ga0501042_0080873 | Ga0501042_0080873_1429_2253 | 253 |
| 526 | 3300049581 | Ga0501047_0574831 | Ga0501047_0574831_11_817 | 253 |
| 527 | 3300053077 | Ga0495601_0176533 | Ga0495601_0176533_150_965 | 253 |
| 528 | 3300053078 | Ga0495612_0014247 | Ga0495612_0014247_2067_2882 | 253 |
| 529 | 3300053078 | Ga0495612_0034327 | Ga0495612_0034327_957_1763 | 253 |
| 530 | 3300053084 | Ga0495595_0040092 | Ga0495595_0040092_385_1200 | 253 |
| 531 | 3300053085 | Ga0495619_0028350 | Ga0495619_0028350_2405_3211 | 253 |
| 532 | 3300005467 | Ga0070706_100045554 | Ga0070706_1000455543 | 255 |
| 533 | 3300005468 | Ga0070707_100047143 | Ga0070707_1000471433 | 255 |
| 534 | 3300005471 | Ga0070698_100070265 | Ga0070698_1000702653 | 255 |
| 535 | 3300025910 | Ga0207684_10051640 | Ga0207684_100516402 | 255 |
| 536 | 3300025922 | Ga0207646_10101971 | Ga0207646_101019712 | 255 |
| 537 | iso_pu_bacteria | 2858868258 | 2858874598 | 255 |
| 538 | 3300005435 | Ga0070714_100006364 | Ga0070714_1000063644 | 256 |
| 539 | 3300005436 | Ga0070713_100012739 | Ga0070713_1000127394 | 256 |
| 540 | 3300025912 | Ga0207707_10271126 | Ga0207707_102711261 | 256 |
| 541 | 3300025928 | Ga0207700_10376132 | Ga0207700_103761321 | 256 |
| 542 | 3300025929 | Ga0207664_10009308 | Ga0207664_100093083 | 256 |
| 543 | 3300036401 | Ga0373937_0303881 | Ga0373937_0303881_601_1422 | 256 |
| 544 | 3300046543 | Ga0495645_0027114 | Ga0495645_0027114_817_1749 | 256 |
| 545 | 3300006173 | Ga0070716_100014428 | Ga0070716_1000144282 | 257 |
| 546 | 3300006852 | Ga0075433_10056908 | Ga0075433_100569085 | 257 |
| 547 | 3300009094 | Ga0111539_10020866 | Ga0111539_100208662 | 257 |
| 548 | 3300009147 | Ga0114129_10002251 | Ga0114129_1000225120 | 257 |
| 549 | 3300025939 | Ga0207665_10032301 | Ga0207665_100323012 | 257 |
| 550 | 3300027907 | Ga0207428_10026486 | Ga0207428_100264865 | 257 |
| 551 | 3300035691 | Ga0373931_0110009 | Ga0373931_0110009_468_1364 | 257 |
| 552 | 3300037853 | Ga0436364_0416023 | Ga0436364_0416023_363_1226 | 257 |
| 553 | 3300046463 | Ga0495653_0061641 | Ga0495653_0061641_1047_1865 | 257 |
| 554 | 3300047471 | Ga0495684_0021015 | Ga0495684_0021015_1846_2664 | 257 |
| 555 | 3300050507 | nmdc:mga05p37_31168_c1 | nmdc:mga05p37_31168_c1_424_1320 | 257 |
| 556 | 3300050508 | nmdc:mga09592_115698_c1 | nmdc:mga09592_115698_c1_517_1413 | 257 |
| 557 | 3300050511 | nmdc:mga08y16_181875_c1 | nmdc:mga08y16_181875_c1_413_1309 | 257 |
| 558 | 3300050514 | nmdc:mga08x19_162650_c1 | nmdc:mga08x19_162650_c1_529_1425 | 257 |
| 559 | 3300050515 | nmdc:mga0a205_69748_c1 | nmdc:mga0a205_69748_c1_1930_2826 | 257 |
| 560 | 3300005435 | Ga0070714_100034525 | Ga0070714_1000345253 | 258 |
| 561 | 3300025928 | Ga0207700_10189293 | Ga0207700_101892931 | 258 |
| 562 | 3300025929 | Ga0207664_10069685 | Ga0207664_100696853 | 258 |
| 563 | 3300037853 | Ga0436364_1093265 | Ga0436364_1093265_4714_5547 | 258 |
| 564 | iso_pu_bacteria | 2599185169 | 2599410420 | 258 |
| 565 | iso_pu_bacteria | 2600255254 | 2601523944 | 258 |
| 566 | iso_pu_bacteria | 2600255255 | 2601529097 | 258 |
| 567 | iso_pu_bacteria | 2600255280 | 2601615932 | 258 |
| 568 | iso_pu_bacteria | 2600255281 | 2601620341 | 258 |
| 569 | iso_pu_bacteria | 2600255287 | 2601645791 | 258 |
| 570 | iso_pu_bacteria | 2600255288 | 2601648743 | 258 |
| 571 | iso_pu_bacteria | 2600255289 | 2601653981 | 258 |
| 572 | iso_pu_bacteria | 2600255290 | 2601659403 | 258 |
| 573 | iso_pu_bacteria | 2600255291 | 2601665399 | 258 |
| 574 | iso_pu_bacteria | 2600255298 | 2601698258 | 258 |
| 575 | iso_pu_bacteria | 2600255299 | 2601703408 | 258 |
| 576 | iso_pu_bacteria | 2600255300 | 2601708435 | 258 |
| 577 | iso_pu_bacteria | 2600255301 | 2601713712 | 258 |
| 578 | iso_pu_bacteria | 2600255302 | 2601717242 | 258 |
| 579 | iso_pu_bacteria | 2600255303 | 2601721974 | 258 |
| 580 | iso_pu_bacteria | 2600255304 | 2601724599 | 258 |
| 581 | iso_pu_bacteria | 2600255305 | 2601731879 | 258 |
| 582 | iso_pu_bacteria | 2600255306 | 2601738489 | 258 |
| 583 | iso_pu_bacteria | 2600255307 | 2601742819 | 258 |
| 584 | iso_pu_bacteria | 2600255309 | 2601751807 | 258 |
| 585 | iso_pu_bacteria | 2600255392 | 2602020297 | 258 |
| 586 | iso_pu_bacteria | 2602042052 | 2603663521 | 258 |
| 587 | iso_pu_bacteria | 2602042053 | 2603668133 | 258 |
| 588 | iso_pu_bacteria | 2602042103 | 2603839594 | 258 |
| 589 | iso_pu_bacteria | 2602042104 | 2603844357 | 258 |
| 590 | iso_pu_bacteria | 2602042105 | 2603849743 | 258 |
| 591 | iso_pu_bacteria | 2602042106 | 2603854811 | 258 |
| 592 | iso_pu_bacteria | 2602042110 | 2603869776 | 258 |
| 593 | iso_pu_bacteria | 2602042111 | 2603878886 | 258 |
| 594 | iso_pu_bacteria | 2603880178 | 2606046961 | 258 |
| 595 | iso_pu_bacteria | 2603880184 | 2606072555 | 258 |
| 596 | iso_pu_bacteria | 2603880202 | 2606146531 | 258 |
| 597 | iso_pu_bacteria | 2603880211 | 2606177459 | 258 |
| 598 | iso_pu_bacteria | 2675903046 | 2676407359 | 258 |
| 599 | iso_pu_bacteria | 2895427314 | 2895430933 | 258 |
| 600 | iso_pu_bacteria | 2904504865 | 2904505563 | 258 |
| 601 | 3300005435 | Ga0070714_100189200 | Ga0070714_1001892002 | 259 |
| 602 | 3300005435 | Ga0070714_100250862 | Ga0070714_1002508622 | 259 |
| 603 | 3300005435 | Ga0070714_100373752 | Ga0070714_1003737521 | 259 |
| 604 | 3300006028 | Ga0070717_10280615 | Ga0070717_102806152 | 259 |
| 605 | 3300009098 | Ga0105245_10341041 | Ga0105245_103410412 | 259 |
| 606 | 3300009551 | Ga0105238_10337601 | Ga0105238_103376011 | 259 |
| 607 | 3300021388 | Ga0213875_10007236 | Ga0213875_100072363 | 259 |
| 608 | 3300025898 | Ga0207692_10130167 | Ga0207692_101301672 | 259 |
| 609 | 3300025929 | Ga0207664_10053935 | Ga0207664_100539351 | 259 |
| 610 | 3300025929 | Ga0207664_10069729 | Ga0207664_100697292 | 259 |
| 611 | 3300035086 | Ga0373934_0013165 | Ga0373934_0013165_1749_2573 | 259 |
| 612 | 3300035113 | Ga0373936_0021800 | Ga0373936_0021800_1063_1887 | 259 |
| 613 | 3300035116 | Ga0373945_0002843 | Ga0373945_0002843_1902_2771 | 259 |
| 614 | 3300035118 | Ga0373954_0064136 | Ga0373954_0064136_761_1585 | 259 |
| 615 | 3300035170 | Ga0373943_0001717 | Ga0373943_0001717_291_1160 | 259 |
| 616 | 3300035171 | Ga0373946_0001997 | Ga0373946_0001997_6099_6968 | 259 |
| 617 | 3300035172 | Ga0373955_0126639 | Ga0373955_0126639_191_1060 | 259 |
| 618 | 3300035692 | Ga0373935_0008796 | Ga0373935_0008796_4633_5502 | 259 |
| 619 | 3300035695 | Ga0373927_0005960 | Ga0373927_0005960_2353_3222 | 259 |
| 620 | 3300035724 | Ga0373933_0165734 | Ga0373933_0165734_296_1120 | 259 |
| 621 | 3300035725 | Ga0373947_0000631 | Ga0373947_0000631_8836_9705 | 259 |
| 622 | 3300036401 | Ga0373937_0360588 | Ga0373937_0360588_501_1325 | 259 |
| 623 | 3300036401 | Ga0373937_0465673 | Ga0373937_0465673_137_1006 | 259 |
| 624 | 3300037068 | Ga0373925_0029398 | Ga0373925_0029398_2914_3783 | 259 |
| 625 | 3300037068 | Ga0373925_0256210 | Ga0373925_0256210_338_1162 | 259 |
| 626 | 3300037853 | Ga0436364_0645051 | Ga0436364_0645051_6405_7229 | 259 |
| 627 | 3300039450 | Ga0436363_1047826 | Ga0436363_1047826_656_1480 | 259 |
| 628 | 3300046454 | Ga0495592_0166426 | Ga0495592_0166426_653_1477 | 259 |
| 629 | 3300046461 | Ga0495641_0060568 | Ga0495641_0060568_709_1578 | 259 |
| 630 | 3300046462 | Ga0495651_0064398 | Ga0495651_0064398_1142_1966 | 259 |
| 631 | 3300046462 | Ga0495651_0235536 | Ga0495651_0235536_162_1031 | 259 |
| 632 | 3300046463 | Ga0495653_0009353 | Ga0495653_0009353_1415_2284 | 259 |
| 633 | 3300046463 | Ga0495653_0016076 | Ga0495653_0016076_4187_5011 | 259 |
| 634 | 3300046476 | Ga0495662_0004176 | Ga0495662_0004176_6121_6990 | 259 |
| 635 | 3300046477 | Ga0495664_0000448 | Ga0495664_0000448_11265_12134 | 259 |
| 636 | 3300046511 | Ga0495608_0096678 | Ga0495608_0096678_807_1676 | 259 |
| 637 | 3300046511 | Ga0495608_0224496 | Ga0495608_0224496_234_1058 | 259 |
| 638 | 3300046517 | Ga0495630_0003650 | Ga0495630_0003650_7029_7898 | 259 |
| 639 | 3300046529 | Ga0495652_0033870 | Ga0495652_0033870_401_1270 | 259 |
| 640 | 3300046533 | Ga0495640_0051727 | Ga0495640_0051727_1769_2638 | 259 |
| 641 | 3300046559 | Ga0495667_0013554 | Ga0495667_0013554_2771_3640 | 259 |
| 642 | 3300046559 | Ga0495667_0017159 | Ga0495667_0017159_2166_2990 | 259 |
| 643 | 3300046642 | Ga0495634_0093688 | Ga0495634_0093688_616_1485 | 259 |
| 644 | 3300046663 | Ga0495635_0007650 | Ga0495635_0007650_3486_4310 | 259 |
| 645 | 3300046663 | Ga0495635_0027823 | Ga0495635_0027823_263_1132 | 259 |
| 646 | 3300046675 | Ga0495657_0031256 | Ga0495657_0031256_2787_3656 | 259 |
| 647 | 3300046675 | Ga0495657_0038661 | Ga0495657_0038661_167_991 | 259 |
| 648 | 3300046678 | Ga0495599_0022142 | Ga0495599_0022142_1343_2212 | 259 |
| 649 | 3300046690 | Ga0495624_0001756 | Ga0495624_0001756_14673_15542 | 259 |
| 650 | 3300047315 | Ga0495581_0159974 | Ga0495581_0159974_85_954 | 259 |
| 651 | 3300047319 | Ga0495674_0007792 | Ga0495674_0007792_9121_9990 | 259 |
| 652 | 3300047321 | Ga0495676_0021929 | Ga0495676_0021929_3853_4722 | 259 |
| 653 | 3300047322 | Ga0495680_0006193 | Ga0495680_0006193_2897_3721 | 259 |
| 654 | 3300047322 | Ga0495680_0023422 | Ga0495680_0023422_4061_4930 | 259 |
| 655 | 3300047444 | Ga0495675_0312110 | Ga0495675_0312110_60_884 | 259 |
| 656 | 3300047471 | Ga0495684_0012825 | Ga0495684_0012825_5345_6214 | 259 |
| 657 | 3300047471 | Ga0495684_0161727 | Ga0495684_0161727_631_1455 | 259 |
| 658 | 3300048088 | Ga0495602_0022179 | Ga0495602_0022179_5088_5912 | 259 |
| 659 | iso_pu_bacteria | 2844528606 | 2844532108 | 259 |
| 660 | iso_pu_bacteria | 2847085930 | 2847088581 | 259 |
| 661 | iso_pu_bacteria | 2865014394 | 2865017795 | 259 |
| 662 | iso_pu_bacteria | 2945951305 | 2945953870 | 259 |
| 663 | iso_pu_bacteria | 2990088156 | 2990091522 | 259 |
| 664 | 3300013307 | Ga0157372_10367631 | Ga0157372_103676311 | 260 |
| 665 | 3300028563 | Ga0265319_1001112 | Ga0265319_10011124 | 260 |
| 666 | 3300028573 | Ga0265334_10001022 | Ga0265334_100010224 | 260 |
| 667 | 3300028577 | Ga0265318_10008929 | Ga0265318_100089293 | 260 |
| 668 | 3300028666 | Ga0265336_10007499 | Ga0265336_100074993 | 260 |
| 669 | 3300028800 | Ga0265338_10000315 | Ga0265338_1000031570 | 260 |
| 670 | 3300029957 | Ga0265324_10001954 | Ga0265324_1000195413 | 260 |
| 671 | 3300031238 | Ga0265332_10001756 | Ga0265332_100017562 | 260 |
| 672 | 3300031240 | Ga0265320_10001056 | Ga0265320_1000105612 | 260 |
| 673 | 3300031247 | Ga0265340_10002199 | Ga0265340_100021993 | 260 |
| 674 | 3300031344 | Ga0265316_10007428 | Ga0265316_100074287 | 260 |
| 675 | 3300031711 | Ga0265314_10006818 | Ga0265314_100068182 | 260 |
| 676 | 3300031712 | Ga0265342_10000413 | Ga0265342_1000041321 | 260 |
| 677 | 3300048919 | Ga0496116_0024816 | Ga0496116_0024816_2169_2951 | 260 |
| 678 | 3300048922 | Ga0496119_0023253 | Ga0496119_0023253_2529_3311 | 260 |
| 679 | 3300048923 | Ga0496120_0000407 | Ga0496120_0000407_11103_11885 | 260 |
| 680 | 3300048927 | Ga0496124_0001570 | Ga0496124_0001570_10914_11696 | 260 |
| 681 | iso_pu_bacteria | 2511231025 | 2511379298 | 260 |
| 682 | iso_pu_bacteria | 2511231035 | 2511436166 | 260 |
| 683 | iso_pu_bacteria | 2802429637 | 2806073408 | 260 |
| 684 | iso_pu_bacteria | 2876601092 | 2876602782 | 260 |
| 685 | iso_pu_bacteria | 2939602548 | 2939602944 | 260 |
| 686 | iso_pu_bacteria | 8016733728 | 8016736774 | 260 |
| 687 | iso_pu_bacteria | 8019499862 | 8019502008 | 260 |
| 688 | iso_pu_bacteria | 2537561728 | 2538426419 | 261 |
| 689 | iso_pu_bacteria | 2599185299 | 2599927209 | 261 |
| 690 | iso_pu_bacteria | 2648501693 | 2650896277 | 261 |
| 691 | iso_pu_bacteria | 2684622997 | 2686352549 | 261 |
| 692 | iso_pu_bacteria | 2808606414 | 2809124748 | 261 |
| 693 | iso_pu_bacteria | 2847797336 | 2847800774 | 261 |
| 694 | iso_pu_bacteria | 2855195626 | 2855198057 | 261 |
| 695 | iso_pu_bacteria | 2858466076 | 2858466618 | 261 |
| 696 | iso_pu_bacteria | 2871272651 | 2871273391 | 261 |
| 697 | iso_pu_bacteria | 2871282230 | 2871282966 | 261 |
| 698 | iso_pu_bacteria | 2881609920 | 2881614096 | 261 |
| 699 | iso_pu_bacteria | 2900051742 | 2900054616 | 261 |
| 700 | iso_pu_bacteria | 2904434214 | 2904437318 | 261 |
| 701 | iso_pu_bacteria | 2905926851 | 2905930677 | 261 |
| 702 | iso_pu_bacteria | 2908669403 | 2908671053 | 261 |
| 703 | iso_pu_bacteria | 2912757875 | 2912760075 | 261 |
| 704 | iso_pu_bacteria | 2946003308 | 2946006799 | 261 |
| 705 | iso_pu_bacteria | 2984494565 | 2984495766 | 261 |
| 706 | iso_pu_bacteria | 2990261002 | 2990262455 | 261 |
| 707 | iso_pu_bacteria | 8004021418 | 8004022637 | 261 |
| 708 | iso_pu_bacteria | 8004025490 | 8004026350 | 261 |
| 709 | 3300003763 | Ga0055529_1002427 | Ga0055529_10024274 | 262 |
| 710 | 3300003781 | Ga0055536_1011284 | Ga0055536_10112843 | 262 |
| 711 | 3300005347 | Ga0070668_100010302 | Ga0070668_1000103023 | 262 |
| 712 | 3300005457 | Ga0070662_100029335 | Ga0070662_1000293352 | 262 |
| 713 | 3300009036 | Ga0105244_10009637 | Ga0105244_100096375 | 262 |
| 714 | 3300009092 | Ga0105250_10000003 | Ga0105250_10000003365 | 262 |
| 715 | 3300009092 | Ga0105250_10000255 | Ga0105250_1000025535 | 262 |
| 716 | 3300009148 | Ga0105243_10015921 | Ga0105243_100159215 | 262 |
| 717 | 3300015261 | Ga0182006_1004488 | Ga0182006_10044883 | 262 |
| 718 | 3300015262 | Ga0182007_10011714 | Ga0182007_100117142 | 262 |
| 719 | 3300017792 | Ga0163161_10358412 | Ga0163161_103584122 | 262 |
| 720 | 3300025272 | Ga0209455_1000688 | Ga0209455_100068813 | 262 |
| 721 | 3300025292 | Ga0209676_1000026 | Ga0209676_1000026406 | 262 |
| 722 | 3300025298 | Ga0209050_1004960 | Ga0209050_100496010 | 262 |
| 723 | 3300025711 | Ga0207696_1000004 | Ga0207696_1000004268 | 262 |
| 724 | 3300025711 | Ga0207696_1000007 | Ga0207696_100000764 | 262 |
| 725 | 3300025711 | Ga0207696_1000749 | Ga0207696_10007499 | 262 |
| 726 | 3300025728 | Ga0207655_1011312 | Ga0207655_10113124 | 262 |
| 727 | 3300025735 | Ga0207713_1066086 | Ga0207713_10660862 | 262 |
| 728 | 3300025933 | Ga0207706_10015746 | Ga0207706_100157462 | 262 |
| 729 | 3300025935 | Ga0207709_10014250 | Ga0207709_100142504 | 262 |
| 730 | 3300025972 | Ga0207668_10152931 | Ga0207668_101529312 | 262 |
| 731 | 3300030500 | Ga0268256_1003310 | Ga0268256_10033105 | 262 |
| 732 | 3300041405 | Ga0439438_012054 | Ga0439438_012054_80_871 | 262 |
| 733 | 3300041407 | Ga0439447_007745 | Ga0439447_007745_2201_2992 | 262 |
| 734 | 3300041411 | Ga0439466_0000003 | Ga0439466_0000003_470167_470958 | 262 |
| 735 | 3300042439 | Ga0439464_0000630 | Ga0439464_0000630_5032_5823 | 262 |
| 736 | 3300046492 | Ga0495585_0010040 | Ga0495585_0010040_3918_4709 | 262 |
| 737 | 3300046500 | Ga0495596_0049964 | Ga0495596_0049964_57_848 | 262 |
| 738 | 3300046810 | Ga0495660_0010971 | Ga0495660_0010971_121_912 | 262 |
| 739 | 3300047320 | Ga0495672_0000012 | Ga0495672_0000012_51029_51820 | 262 |
| 740 | 3300047446 | Ga0495679_007102 | Ga0495679_007102_3308_4099 | 262 |
| 741 | 3300047470 | Ga0495681_0010484 | Ga0495681_0010484_2012_2800 | 262 |
| 742 | 3300048908 | Ga0496105_0000685 | Ga0496105_0000685_228_1019 | 262 |
| 743 | 3300048919 | Ga0496116_0252864 | Ga0496116_0252864_71_862 | 262 |
| 744 | 3300048920 | Ga0496117_0000180 | Ga0496117_0000180_86657_87448 | 262 |
| 745 | 3300048921 | Ga0496118_0000247 | Ga0496118_0000247_38927_39718 | 262 |
| 746 | 3300048921 | Ga0496118_0002990 | Ga0496118_0002990_5218_6006 | 262 |
| 747 | 3300048921 | Ga0496118_0016504 | Ga0496118_0016504_2907_3698 | 262 |
| 748 | 3300048922 | Ga0496119_0000043 | Ga0496119_0000043_165052_165840 | 262 |
| 749 | 3300048922 | Ga0496119_0000178 | Ga0496119_0000178_59988_60779 | 262 |
| 750 | 3300048922 | Ga0496119_0000650 | Ga0496119_0000650_8473_9264 | 262 |
| 751 | 3300048923 | Ga0496120_0000459 | Ga0496120_0000459_35068_35859 | 262 |
| 752 | 3300048923 | Ga0496120_0000894 | Ga0496120_0000894_37156_37947 | 262 |
| 753 | 3300048924 | Ga0496121_0000967 | Ga0496121_0000967_1697_2488 | 262 |
| 754 | 3300048925 | Ga0496122_0112495 | Ga0496122_0112495_700_1491 | 262 |
| 755 | 3300048926 | Ga0496123_0051276 | Ga0496123_0051276_602_1393 | 262 |
| 756 | 3300048927 | Ga0496124_0000463 | Ga0496124_0000463_7428_8219 | 262 |
| 757 | 3300048927 | Ga0496124_0022087 | Ga0496124_0022087_3188_3979 | 262 |
| 758 | 3300048928 | Ga0496125_0094002 | Ga0496125_0094002_71_862 | 262 |
| 759 | 3300048928 | Ga0496125_0149596 | Ga0496125_0149596_61_849 | 262 |
| 760 | 3300048929 | Ga0496126_0084761 | Ga0496126_0084761_789_1577 | 262 |
| 761 | 3300048929 | Ga0496126_0202904 | Ga0496126_0202904_334_1125 | 262 |
| 762 | 3300049822 | Ga0501035_0007966 | Ga0501035_0007966_1389_2180 | 262 |
| 763 | 3300049822 | Ga0501035_0019914 | Ga0501035_0019914_3761_4591 | 262 |
| 764 | 3300049823 | Ga0501044_0018809 | Ga0501044_0018809_277_1107 | 262 |
| 765 | 3300053136 | Ga0500559_0143431 | Ga0500559_0143431_148_936 | 262 |
| 766 | 3300031616 | Ga0307508_10203997 | Ga0307508_102039972 | 263 |
| 767 | 3300044842 | Ga0466957_0120956 | Ga0466957_0120956_202_1014 | 263 |
| 768 | 3300049571 | Ga0501034_0521419 | Ga0501034_0521419_101_904 | 263 |
| 769 | 3300053153 | Ga0500616_0128529 | Ga0500616_0128529_363_1163 | 263 |
| 770 | iso_pu_bacteria | 2990088156 | 2990090323 | 263 |
| 771 | 3300002739 | JGI25158J39367_1002551 | JGI25158J39367_10025512 | 264 |
| 772 | 3300002987 | JGI25159J45721_1000026 | JGI25159J45721_100002631 | 264 |
| 773 | 3300003354 | JGI25160J50197_1000013 | JGI25160J50197_100001333 | 264 |
| 774 | 3300003374 | JGI25161J50226_1000926 | JGI25161J50226_100092611 | 264 |
| 775 | 3300003856 | Ga0058692_1001321 | Ga0058692_10013217 | 264 |
| 776 | 3300003856 | Ga0058692_1003259 | Ga0058692_10032595 | 264 |
| 777 | 3300003856 | Ga0058692_1005996 | Ga0058692_10059964 | 264 |
| 778 | 3300004625 | Ga0055543_1000132 | Ga0055543_100013232 | 264 |
| 779 | 3300005262 | Ga0065165_1000021 | Ga0065165_100002133 | 264 |
| 780 | 3300005548 | Ga0070665_100800828 | Ga0070665_1008008281 | 264 |
| 781 | 3300006353 | Ga0075370_10196546 | Ga0075370_101965461 | 264 |
| 782 | 3300009036 | Ga0105244_10003529 | Ga0105244_1000352911 | 264 |
| 783 | 3300009036 | Ga0105244_10007132 | Ga0105244_100071326 | 264 |
| 784 | 3300009036 | Ga0105244_10058879 | Ga0105244_100588792 | 264 |
| 785 | 3300009092 | Ga0105250_10008174 | Ga0105250_100081743 | 264 |
| 786 | 3300011119 | Ga0105246_10056693 | Ga0105246_100566932 | 264 |
| 787 | 3300013100 | Ga0157373_10001089 | Ga0157373_1000108917 | 264 |
| 788 | 3300013102 | Ga0157371_10044825 | Ga0157371_100448252 | 264 |
| 789 | 3300013307 | Ga0157372_10144281 | Ga0157372_101442813 | 264 |
| 790 | 3300025208 | Ga0209436_100024 | Ga0209436_10002476 | 264 |
| 791 | 3300025284 | Ga0209130_1000039 | Ga0209130_1000039225 | 264 |
| 792 | 3300025302 | Ga0207426_1000099 | Ga0207426_1000099225 | 264 |
| 793 | 3300025711 | Ga0207696_1000525 | Ga0207696_10005256 | 264 |
| 794 | 3300025728 | Ga0207655_1000023 | Ga0207655_1000023238 | 264 |
| 795 | 3300025728 | Ga0207655_1002562 | Ga0207655_100256212 | 264 |
| 796 | 3300027312 | Ga0209371_1000010 | Ga0209371_1000010602 | 264 |
| 797 | 3300027312 | Ga0209371_1000270 | Ga0209371_10002705 | 264 |
| 798 | 3300027312 | Ga0209371_1000273 | Ga0209371_100027340 | 264 |
| 799 | 3300027312 | Ga0209371_1003951 | Ga0209371_10039516 | 264 |
| 800 | 3300027312 | Ga0209371_1004826 | Ga0209371_10048262 | 264 |
| 801 | 3300030500 | Ga0268256_1000022 | Ga0268256_1000022262 | 264 |
| 802 | 3300030500 | Ga0268256_1000229 | Ga0268256_100022940 | 264 |
| 803 | 3300030500 | Ga0268256_1003665 | Ga0268256_10036656 | 264 |
| 804 | 3300030500 | Ga0268256_1005127 | Ga0268256_10051275 | 264 |
| 805 | 3300046452 | Ga0495617_010813 | Ga0495617_010813_2034_2828 | 264 |
| 806 | 3300046458 | Ga0495591_000094 | Ga0495591_000094_46414_47208 | 264 |
| 807 | 3300046458 | Ga0495591_003750 | Ga0495591_003750_6363_7157 | 264 |
| 808 | 3300046471 | Ga0495650_0000033 | Ga0495650_0000033_82593_83387 | 264 |
| 809 | 3300046491 | Ga0495584_0016303 | Ga0495584_0016303_1596_2390 | 264 |
| 810 | 3300046501 | Ga0495607_0007504 | Ga0495607_0007504_4629_5423 | 264 |
| 811 | 3300046507 | Ga0495606_0000619 | Ga0495606_0000619_38195_38989 | 264 |
| 812 | 3300046513 | Ga0495616_0009885 | Ga0495616_0009885_501_1295 | 264 |
| 813 | 3300046523 | Ga0495644_0001575 | Ga0495644_0001575_1576_2370 | 264 |
| 814 | 3300046524 | Ga0495648_0001078 | Ga0495648_0001078_20918_21712 | 264 |
| 815 | 3300046530 | Ga0495654_0000078 | Ga0495654_0000078_68176_68970 | 264 |
| 816 | 3300046530 | Ga0495654_0000572 | Ga0495654_0000572_24853_25647 | 264 |
| 817 | 3300046694 | Ga0495649_0003646 | Ga0495649_0003646_2271_3065 | 264 |
| 818 | 3300046810 | Ga0495660_0000011 | Ga0495660_0000011_343588_344382 | 264 |
| 819 | 3300047320 | Ga0495672_0000004 | Ga0495672_0000004_237575_238369 | 264 |
| 820 | 3300047321 | Ga0495676_0168764 | Ga0495676_0168764_226_1020 | 264 |
| 821 | 3300047323 | Ga0495683_0012720 | Ga0495683_0012720_602_1396 | 264 |
| 822 | 3300047323 | Ga0495683_0046086 | Ga0495683_0046086_481_1275 | 264 |
| 823 | 3300047469 | Ga0495673_0000023 | Ga0495673_0000023_153580_154374 | 264 |
| 824 | 3300048904 | Ga0496101_0000029 | Ga0496101_0000029_127422_128216 | 264 |
| 825 | 3300048923 | Ga0496120_0000346 | Ga0496120_0000346_6838_7632 | 264 |
| 826 | 3300048924 | Ga0496121_0009019 | Ga0496121_0009019_5217_6026 | 264 |
| 827 | 3300048925 | Ga0496122_0006878 | Ga0496122_0006878_2014_2808 | 264 |
| 828 | 3300048926 | Ga0496123_0003607 | Ga0496123_0003607_14340_15134 | 264 |
| 829 | 3300048927 | Ga0496124_0050436 | Ga0496124_0050436_336_1130 | 264 |
| 830 | 3300048927 | Ga0496124_0060607 | Ga0496124_0060607_1291_2085 | 264 |
| 831 | 3300048927 | Ga0496124_0148026 | Ga0496124_0148026_525_1334 | 264 |
| 832 | 3300048929 | Ga0496126_0002412 | Ga0496126_0002412_12959_13768 | 264 |
| 833 | 3300048929 | Ga0496126_0099670 | Ga0496126_0099670_1021_1815 | 264 |
| 834 | 3300049459 | Ga0495678_000415 | Ga0495678_000415_15207_16001 | 264 |
| 835 | 3300049460 | Ga0495682_0000004 | Ga0495682_0000004_339347_340141 | 264 |
| 836 | 3300050494 | nmdc:mga06z11_205501_c1 | nmdc:mga06z11_205501_c1_299_1108 | 264 |
| 837 | 3300050496 | nmdc:mga07m45_191881_c1 | nmdc:mga07m45_191881_c1_33_842 | 264 |
| 838 | 3300053126 | Ga0500621_000001 | Ga0500621_000001_427630_428424 | 264 |
| 839 | 2010549000 | RicEn_C7199 | RicEn_127190 | 265 |
| 840 | 3300001989 | JGI24739J22299_10003841 | JGI24739J22299_100038417 | 265 |
| 841 | 3300003856 | Ga0058692_1000074 | Ga0058692_100007482 | 265 |
| 842 | 3300005563 | Ga0068855_100012535 | Ga0068855_1000125353 | 265 |
| 843 | 3300005578 | Ga0068854_100258875 | Ga0068854_1002588752 | 265 |
| 844 | 3300006163 | Ga0070715_10019017 | Ga0070715_100190173 | 265 |
| 845 | 3300009036 | Ga0105244_10000006 | Ga0105244_10000006206 | 265 |
| 846 | 3300009036 | Ga0105244_10000289 | Ga0105244_1000028953 | 265 |
| 847 | 3300009093 | Ga0105240_10062261 | Ga0105240_100622611 | 265 |
| 848 | 3300013100 | Ga0157373_10009629 | Ga0157373_100096298 | 265 |
| 849 | 3300013100 | Ga0157373_10033991 | Ga0157373_100339914 | 265 |
| 850 | 3300013102 | Ga0157371_10002939 | Ga0157371_100029394 | 265 |
| 851 | 3300013104 | Ga0157370_10000320 | Ga0157370_1000032018 | 265 |
| 852 | 3300013104 | Ga0157370_10002483 | Ga0157370_100024831 | 265 |
| 853 | 3300013104 | Ga0157370_10012210 | Ga0157370_100122105 | 265 |
| 854 | 3300015261 | Ga0182006_1027933 | Ga0182006_10279331 | 265 |
| 855 | 3300021384 | Ga0213876_10006391 | Ga0213876_100063911 | 265 |
| 856 | 3300025728 | Ga0207655_1000040 | Ga0207655_1000040243 | 265 |
| 857 | 3300025728 | Ga0207655_1013688 | Ga0207655_10136882 | 265 |
| 858 | 3300025905 | Ga0207685_10010853 | Ga0207685_100108533 | 265 |
| 859 | 3300025913 | Ga0207695_10017654 | Ga0207695_100176545 | 265 |
| 860 | 3300027312 | Ga0209371_1000170 | Ga0209371_10001703 | 265 |
| 861 | 3300030500 | Ga0268256_1000142 | Ga0268256_1000142104 | 265 |
| 862 | 3300033545 | Ga0316214_1002703 | Ga0316214_10027033 | 265 |
| 863 | 3300033547 | Ga0316212_1001409 | Ga0316212_10014093 | 265 |
| 864 | 3300036459 | Ga0372808_005086 | Ga0372808_005086_819_1676 | 265 |
| 865 | 3300037853 | Ga0436364_1549559 | Ga0436364_1549559_6689_7510 | 265 |
| 866 | 3300038443 | Ga0395901_0070679 | Ga0395901_0070679_2046_2948 | 265 |
| 867 | 3300039437 | Ga0436365_0528481 | Ga0436365_0528481_26529_27350 | 265 |
| 868 | 3300041405 | Ga0439438_000001 | Ga0439438_000001_62118_62915 | 265 |
| 869 | 3300041407 | Ga0439447_001587 | Ga0439447_001587_2500_3297 | 265 |
| 870 | 3300042006 | Ga0439432_006224 | Ga0439432_006224_1466_2263 | 265 |
| 871 | 3300042010 | Ga0439452_000001 | Ga0439452_000001_2289_3086 | 265 |
| 872 | 3300044735 | Ga0466968_0130979 | Ga0466968_0130979_21_827 | 265 |
| 873 | 3300044765 | Ga0466970_0214549 | Ga0466970_0214549_75_884 | 265 |
| 874 | 3300048919 | Ga0496116_0000579 | Ga0496116_0000579_15685_16488 | 265 |
| 875 | 3300048919 | Ga0496116_0001066 | Ga0496116_0001066_25707_26504 | 265 |
| 876 | 3300048920 | Ga0496117_0000644 | Ga0496117_0000644_2282_3079 | 265 |
| 877 | 3300048921 | Ga0496118_0014808 | Ga0496118_0014808_4189_4986 | 265 |
| 878 | 3300048922 | Ga0496119_0001482 | Ga0496119_0001482_24336_25139 | 265 |
| 879 | 3300048923 | Ga0496120_0000043 | Ga0496120_0000043_77112_77915 | 265 |
| 880 | 3300048927 | Ga0496124_0070201 | Ga0496124_0070201_1800_2597 | 265 |
| 881 | 3300049571 | Ga0501034_0023236 | Ga0501034_0023236_2371_3180 | 265 |
| 882 | 3300049572 | Ga0501036_0007170 | Ga0501036_0007170_3625_4434 | 265 |
| 883 | 3300049573 | Ga0501037_0027151 | Ga0501037_0027151_2988_3797 | 265 |
| 884 | 3300049574 | Ga0501038_0034960 | Ga0501038_0034960_1591_2400 | 265 |
| 885 | 3300049575 | Ga0501039_0078463 | Ga0501039_0078463_1251_2060 | 265 |
| 886 | 3300049579 | Ga0501043_0007870 | Ga0501043_0007870_6525_7334 | 265 |
| 887 | 3300049581 | Ga0501047_0006312 | Ga0501047_0006312_5058_5867 | 265 |
| 888 | 3300049581 | Ga0501047_0076774 | Ga0501047_0076774_577_1386 | 265 |
| 889 | 3300049582 | Ga0501048_0003280 | Ga0501048_0003280_433_1242 | 265 |
| 890 | 3300049589 | Ga0501073_0015818 | Ga0501073_0015818_387_1196 | 265 |
| 891 | 3300049590 | Ga0501074_0001673 | Ga0501074_0001673_5201_6010 | 265 |
| 892 | iso_pu_bacteria | 2852103415 | 2852103728 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hg3-assembly2.cif.gz_D | structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate | 0.9415 | 2 | 255 |
| 4hg5-assembly1.cif.gz_C | structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate | 0.9401 | 2 | 255 |
| 4hgd-assembly1.cif.gz_D | structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand | 0.9397 | 2 | 255 |
| 1ems-assembly1.cif.gz_A | crystal structure of the c. elegans nitfhit protein | 0.9388 | 2 | 255 |
| 4h5u-assembly2.cif.gz_B | structural insights into yeast nit2: wild-type yeast nit2 | 0.9382 | 2 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0DP64_2_182_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.986 | 77 | 257 | 3.60.110.10 |
| af_P0DP64_2_182_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9806 | 77 | 257 | 3.60.110.10 |
| af_O94660_4_273_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9594 | 4 | 250 | 3.60.110.10 |
| af_O76463_1_291_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9563 | 2 | 255 | 3.60.110.10 |
| af_Q557J5_4_291_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9522 | 2 | 254 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7H4NNH8-F1-model_v4 | deleted | 0.998 | 140 | 261 |
|
| AF-A0A348HH99-F1-model_v4 | Predicted amidohydrolase | 0.9973 | 1 | 262 |
GO:0016787
|
| AF-A0A378DIL0-F1-model_v4 | deleted | 0.9941 | 126 | 261 |
|
| AF-A0A847KSQ6-F1-model_v4 | deleted | 0.9937 | 1 | 237 |
|
| AF-A0A317PXZ4-F1-model_v4 | Putative amidohydrolase | 0.9927 | 1 | 262 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar