F484896

General Info

Members Datasets Scaffolds Average Seq Length
892 416 819 261

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0027114|Ga0495645_0027114_817_1749
Length 310
Sequence MVGPPRHQITRRGQPALARRPLLRPDPVVYAAHMGMPRRIALGQLPVSPDPAVNLTRVQVALADAAAGGASLAVFPEATQARFGTDLQAVAEPLDGPFGAGLAGAARGTGVALVAGVFEPAPDGRVYNTAVGYDAAGQRVAAYRKIHLFDSLGETESKVVAPGSAPVLADLAGLRVGLLTCYDIRFPELARSLVAQGADLLVVPAAWAAGLFKEEHWVTLVRARAIENTVWVAAAGQVPDPASPRTRAPTGIGRSMLVDPMGTVRLDLGPFPGMAVGEIDTALTARVRDALPCLEHRREDVFGPAAGHGA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
3 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
4 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
5 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
6 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
7 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
8 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
9 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
10 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
11 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
12 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
13 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
14 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
15 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
16 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
17 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
18 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
19 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
20 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
21 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
22 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
23 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
24 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
25 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
26 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
27 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
28 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
29 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
30 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
31 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
32 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
33 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
34 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
35 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
36 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
37 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
38 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
39 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
40 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
41 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
42 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
43 2802429637 Rhizobium anhuiense C15 Isolate Nodule
44 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
45 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
46 2847085930 Erwinia persicina B64 Isolate Bulb
47 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
48 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
49 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
50 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
51 2858868258 Micromonospora sp. MH33 Isolate Unclassified
52 2865014394 Pantoea sp. R-71966 Isolate Unclassified
53 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
54 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
55 2876601092 Pantoea endophytica 596 Isolate Unclassified
56 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
57 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
58 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
59 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
60 2904504865 Serratia marcescens 1822 Isolate Unclassified
61 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
62 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
63 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
64 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
65 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
66 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
67 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
68 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
69 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
70 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
71 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
72 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
73 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
74 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
75 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
76 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
77 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
78 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
82 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
83 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
84 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
85 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
86 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
87 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
90 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
93 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
96 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
97 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
98 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
99 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
100 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
101 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
102 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
105 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
106 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
107 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
108 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
109 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
110 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
111 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
112 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
113 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
114 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
115 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
116 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
124 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
125 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
128 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
129 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
130 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
131 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
132 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
133 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
134 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
138 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
139 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
141 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
142 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
143 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
144 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
145 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
158 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
168 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
169 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
176 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
177 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
228 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
229 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
230 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
231 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
232 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
233 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
234 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
235 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
236 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
237 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
242 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
243 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
244 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
245 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
246 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
247 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
248 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
249 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
257 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
258 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
259 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
260 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
261 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
262 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
265 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
281 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
282 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
283 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
284 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
285 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
288 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
289 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
293 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
300 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
301 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
302 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
303 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
304 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
305 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
306 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
307 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
308 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
309 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
310 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
314 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
318 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
319 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
320 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
321 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
322 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
323 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
324 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
331 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
332 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
333 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
334 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
335 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
345 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
346 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
347 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
348 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
349 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
350 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
351 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
352 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
353 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
354 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
355 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
356 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
357 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
360 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
361 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
362 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
363 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
367 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
368 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
369 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
370 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
371 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
372 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
373 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
374 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
375 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
376 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
377 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
378 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
379 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
380 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
381 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
382 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
393 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
394 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
398 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
399 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
400 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
401 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
402 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
403 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
404 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
405 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
406 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
407 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
408 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
409 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
410 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
411 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
412 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
413 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
414 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
415 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
416 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.14
Metatranscriptomes 0.67
Isolates 8.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0.11
Endosphere 2.58
Nodule 0.11
Rhizoplane 8.86
Rhizosphere 79.26
Stem 0
Stem Tuber 0.56
Unclassified 8.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C7199 2010549000 Bacteria 2551
2 JGI24739J22299_10003841 3300001989 Bacteria 5732
3 JGI25158J39367_1002551 3300002739 Bacteria 2941
4 JGI25159J45721_1000026 3300002987 Bacteria 114104
5 JGI25160J50197_1000013 3300003354 Bacteria 263367
6 JGI25161J50226_1000926 3300003374 Bacteria 10521
7 Ga0055529_1002427 3300003763 Bacteria 3622
8 Ga0055536_1011284 3300003781 Bacteria 3443
9 Ga0058692_1000074 3300003856 Bacteria 75738
10 Ga0058692_1001321 3300003856 Bacteria 9300
11 Ga0058692_1003259 3300003856 Bacteria 5078
12 Ga0058692_1005996 3300003856 Bacteria 3391
13 Ga0055543_1000132 3300004625 Bacteria 61786
14 Ga0065165_1000021 3300005262 Bacteria 262983
15 Ga0070658_10000228 3300005327 Bacteria 49676
16 Ga0070658_10246953 3300005327 Bacteria 1514
17 Ga0070690_100163860 3300005330 Bacteria 1525
18 Ga0070677_10190406 3300005333 Bacteria 983
19 Ga0070666_10073526 3300005335 Bacteria 2328
20 Ga0068868_100040999 3300005338 Bacteria 3605
21 Ga0070660_100183977 3300005339 Bacteria 1691
22 Ga0070689_100090525 3300005340 Bacteria 2411
23 Ga0070687_100018464 3300005343 Bacteria 3227
24 Ga0070668_100010302 3300005347 Bacteria 6941
25 Ga0070671_100090724 3300005355 Bacteria 2558
26 Ga0070674_100161998 3300005356 Bacteria 1698
27 Ga0070673_100047481 3300005364 Bacteria 3341
28 Ga0070688_100224395 3300005365 Bacteria 1326
29 Ga0070659_100130011 3300005366 Bacteria 2044
30 Ga0070659_100382883 3300005366 Bacteria 1185
31 Ga0070667_100267977 3300005367 Bacteria 1531
32 Ga0070709_10006893 3300005434 Bacteria 6204
33 Ga0070709_10013984 3300005434 Bacteria 4528
34 Ga0070709_10087492 3300005434 Bacteria 2047
35 Ga0070709_10099374 3300005434 Bacteria 1935
36 Ga0070709_10100478 3300005434 Bacteria 1926
37 Ga0070709_10141140 3300005434 Bacteria 1655
38 Ga0070709_10226095 3300005434 Bacteria 1337
39 Ga0070714_100006364 3300005435 Bacteria 9109
40 Ga0070714_100013140 3300005435 Bacteria 6629
41 Ga0070714_100034525 3300005435 Bacteria 4235
42 Ga0070714_100177646 3300005435 Bacteria 1935
43 Ga0070714_100189200 3300005435 Bacteria 1877
44 Ga0070714_100250862 3300005435 Bacteria 1636
45 Ga0070714_100326359 3300005435 Bacteria 1436
46 Ga0070714_100373752 3300005435 Bacteria 1342
47 Ga0070713_100012739 3300005436 Bacteria 6179
48 Ga0070713_100023274 3300005436 Bacteria 4804
49 Ga0070713_100173060 3300005436 Bacteria 1935
50 Ga0070710_10003256 3300005437 Bacteria 7698
51 Ga0070710_10010458 3300005437 Bacteria 4560
52 Ga0070710_10013641 3300005437 Bacteria 4076
53 Ga0070710_10067800 3300005437 Bacteria 2048
54 Ga0070710_10078106 3300005437 Bacteria 1925
55 Ga0070710_10100036 3300005437 Bacteria 1725
56 Ga0070711_100012223 3300005439 Bacteria 5358
57 Ga0070711_100018699 3300005439 Bacteria 4429
58 Ga0070711_100122385 3300005439 Bacteria 1926
59 Ga0070711_100276269 3300005439 Bacteria 1327
60 Ga0070700_100041611 3300005441 Bacteria 2817
61 Ga0070694_100117670 3300005444 Bacteria 1902
62 Ga0070708_100002499 3300005445 Bacteria 14189
63 Ga0070708_100122769 3300005445 Bacteria 2398
64 Ga0070663_100079030 3300005455 Bacteria 2412
65 Ga0070662_100029335 3300005457 Bacteria 3839
66 Ga0070662_100058765 3300005457 Bacteria 2799
67 Ga0070681_10035795 3300005458 Bacteria 4986
68 Ga0070706_100012251 3300005467 Bacteria 7947
69 Ga0070706_100045554 3300005467 Bacteria 4051
70 Ga0070706_100098000 3300005467 Bacteria 2723
71 Ga0070706_100491012 3300005467 Bacteria 1142
72 Ga0070707_100000127 3300005468 Bacteria 71273
73 Ga0070707_100005476 3300005468 Bacteria 11869
74 Ga0070707_100047143 3300005468 Bacteria 4125
75 Ga0070707_100105675 3300005468 Bacteria 2730
76 Ga0070707_100197599 3300005468 Bacteria 1960
77 Ga0070707_100238481 3300005468 Bacteria 1770
78 Ga0070698_100000597 3300005471 Bacteria 38839
79 Ga0070698_100001111 3300005471 Bacteria 29683
80 Ga0070698_100015856 3300005471 Bacteria 7958
81 Ga0070698_100070265 3300005471 Bacteria 3513
82 Ga0070699_100211551 3300005518 Bacteria 1726
83 Ga0070684_100187419 3300005535 Bacteria 1882
84 Ga0070684_100257898 3300005535 Bacteria 1594
85 Ga0070684_100277689 3300005535 Bacteria 1534
86 Ga0070697_100160824 3300005536 Bacteria 1897
87 Ga0068853_100059551 3300005539 Bacteria 3299
88 Ga0070686_100099316 3300005544 Bacteria 1963
89 Ga0070695_100133801 3300005545 Bacteria 1711
90 Ga0070696_100036096 3300005546 Bacteria 3406
91 Ga0070693_100045748 3300005547 Bacteria 2482
92 Ga0070693_100267772 3300005547 Bacteria 1139
93 Ga0070665_100800828 3300005548 Unclassified 955
94 Ga0068855_100012535 3300005563 Bacteria 10230
95 Ga0068855_100151405 3300005563 Bacteria 2638
96 Ga0068855_100442921 3300005563 Bacteria 1418
97 Ga0070664_100107971 3300005564 Bacteria 2426
98 Ga0068857_100295364 3300005577 Bacteria 1493
99 Ga0068854_100258875 3300005578 Bacteria 1392
100 Ga0068854_100325682 3300005578 Bacteria 1250
101 Ga0068854_100375522 3300005578 Bacteria 1170
102 Ga0068856_100143534 3300005614 Bacteria 2395
103 Ga0068856_100248806 3300005614 Bacteria 1793
104 Ga0070702_100007313 3300005615 Bacteria 5282
105 Ga0068859_100265256 3300005617 Bacteria 1809
106 Ga0068864_100167239 3300005618 Bacteria 2003
107 Ga0068864_100239190 3300005618 Bacteria 1682
108 Ga0068861_100186722 3300005719 Bacteria 1729
109 Ga0068861_100235500 3300005719 Bacteria 1555
110 Ga0068863_100140133 3300005841 Bacteria 2311
111 Ga0068863_100174675 3300005841 Bacteria 2061
112 Ga0068863_100692142 3300005841 Bacteria 1013
113 Ga0068858_100394263 3300005842 Bacteria 1329
114 Ga0068860_100038155 3300005843 Bacteria 4596
115 Ga0081540_1000607 3300005983 Bacteria 34146
116 Ga0070717_10035786 3300006028 Bacteria 4023
117 Ga0070717_10038025 3300006028 Bacteria 3910
118 Ga0070717_10089211 3300006028 Bacteria 2600
119 Ga0070717_10120059 3300006028 Bacteria 2251
120 Ga0070717_10280615 3300006028 Bacteria 1477
121 Ga0070717_10346515 3300006028 Bacteria 1327
122 Ga0070715_10013346 3300006163 Bacteria 3015
123 Ga0070715_10019017 3300006163 Bacteria 2627
124 Ga0070715_10042184 3300006163 Bacteria 1916
125 Ga0070716_100000033 3300006173 Bacteria 57092
126 Ga0070716_100003740 3300006173 Bacteria 7203
127 Ga0070716_100007664 3300006173 Bacteria 5326
128 Ga0070716_100014428 3300006173 Bacteria 4046
129 Ga0070716_100069817 3300006173 Bacteria 2060
130 Ga0070716_100081178 3300006173 Bacteria 1935
131 Ga0070716_100099505 3300006173 Bacteria 1779
132 Ga0070712_100013295 3300006175 Bacteria 5257
133 Ga0075370_10196546 3300006353 Unclassified 1189
134 Ga0068871_100055167 3300006358 Bacteria 3225
135 Ga0075433_10048108 3300006852 Bacteria 3708
136 Ga0075433_10056908 3300006852 Bacteria 3417
137 Ga0075434_100124282 3300006871 Bacteria 2597
138 Ga0075434_100128530 3300006871 Bacteria 2551
139 Ga0097620_100265239 3300006931 Bacteria 1809
140 Ga0075435_100080504 3300007076 Bacteria 2674
141 Ga0099794_10154508 3300007265 Bacteria 1165
142 Ga0099795_10034876 3300007788 Bacteria 1756
143 Ga0105251_10030726 3300009011 Bacteria 2694
144 Ga0105244_10000006 3300009036 Bacteria 357997
145 Ga0105244_10000289 3300009036 Bacteria 49668
146 Ga0105244_10003529 3300009036 Bacteria 11115
147 Ga0105244_10007132 3300009036 Bacteria 7142
148 Ga0105244_10009637 3300009036 Bacteria 5917
149 Ga0105244_10058879 3300009036 Bacteria 1937
150 Ga0105250_10000003 3300009092 Bacteria 547770
151 Ga0105250_10000255 3300009092 Bacteria 44136
152 Ga0105250_10008174 3300009092 Bacteria 4456
153 Ga0105240_10062261 3300009093 Bacteria 4646
154 Ga0105240_10293906 3300009093 Bacteria 1861
155 Ga0111539_10020866 3300009094 Bacteria 8067
156 Ga0105245_10341041 3300009098 Bacteria 1482
157 Ga0105247_10074403 3300009101 Bacteria 2130
158 Ga0114129_10002251 3300009147 Bacteria 26657
159 Ga0105243_10015921 3300009148 Bacteria 5688
160 Ga0105243_10185776 3300009148 Bacteria 1811
161 Ga0105242_10191874 3300009176 Bacteria 1809
162 Ga0105248_10206676 3300009177 Bacteria 2212
163 Ga0105237_10076284 3300009545 Bacteria 3343
164 Ga0105238_10337601 3300009551 Bacteria 1494
165 Ga0105239_10044658 3300010375 Bacteria 4857
166 Ga0105246_10056693 3300011119 Bacteria 2709
167 Ga0157344_1001748 3300012476 Bacteria 1076
168 Ga0157373_10001089 3300013100 Bacteria 20928
169 Ga0157373_10009629 3300013100 Bacteria 7130
170 Ga0157373_10033991 3300013100 Bacteria 3663
171 Ga0157371_10002939 3300013102 Bacteria 15892
172 Ga0157371_10044825 3300013102 Bacteria 3149
173 Ga0157371_10098415 3300013102 Bacteria 2074
174 Ga0157371_10133227 3300013102 Bacteria 1768
175 Ga0157370_10000320 3300013104 Bacteria 60398
176 Ga0157370_10002483 3300013104 Bacteria 22235
177 Ga0157370_10012210 3300013104 Bacteria 8928
178 Ga0157370_10202944 3300013104 Bacteria 1839
179 Ga0157369_10011430 3300013105 Bacteria 10083
180 Ga0157374_10052816 3300013296 Bacteria 3787
181 Ga0157372_10000880 3300013307 Bacteria 32652
182 Ga0157372_10144281 3300013307 Bacteria 2745
183 Ga0157372_10367631 3300013307 Bacteria 1676
184 Ga0157375_10761197 3300013308 Bacteria 1119
185 Ga0163163_10112678 3300014325 Bacteria 2750
186 Ga0157379_10259662 3300014968 Bacteria 1578
187 Ga0182006_1004488 3300015261 Bacteria 6872
188 Ga0182006_1027933 3300015261 Bacteria 2299
189 Ga0182007_10011714 3300015262 Bacteria 3404
190 Ga0163161_10358412 3300017792 Bacteria 1161
191 Ga0197907_11138267 3300020069 Bacteria 1183
192 Ga0206356_11018721 3300020070 Bacteria 1476
193 Ga0206350_11235534 3300020080 Bacteria 1305
194 Ga0206353_11457304 3300020082 Bacteria 1183
195 Ga0213876_10006391 3300021384 Bacteria 6426
196 Ga0213875_10000678 3300021388 Bacteria 26732
197 Ga0213875_10007236 3300021388 Bacteria 5755
198 Ga0224712_10068754 3300022467 Bacteria 1432
199 Ga0209436_100024 3300025208 Bacteria 95606
200 Ga0209455_1000688 3300025272 Bacteria 19945
201 Ga0209130_1000039 3300025284 Bacteria 263493
202 Ga0209676_1000026 3300025292 Bacteria 574599
203 Ga0209050_1004960 3300025298 Bacteria 8671
204 Ga0207426_1000099 3300025302 Bacteria 263493
205 Ga0207696_1000004 3300025711 Bacteria 671626
206 Ga0207696_1000007 3300025711 Bacteria 578417
207 Ga0207696_1000525 3300025711 Bacteria 31632
208 Ga0207696_1000749 3300025711 Bacteria 21617
209 Ga0207655_1000023 3300025728 Bacteria 467070
210 Ga0207655_1000040 3300025728 Bacteria 335311
211 Ga0207655_1002562 3300025728 Bacteria 14546
212 Ga0207655_1011312 3300025728 Bacteria 5322
213 Ga0207655_1013688 3300025728 Bacteria 4638
214 Ga0207713_1066086 3300025735 Bacteria 1355
215 Ga0207653_10016699 3300025885 Bacteria 2306
216 Ga0207692_10004364 3300025898 Bacteria 5600
217 Ga0207692_10011656 3300025898 Bacteria 3750
218 Ga0207692_10012684 3300025898 Bacteria 3627
219 Ga0207692_10026070 3300025898 Bacteria 2739
220 Ga0207692_10095128 3300025898 Bacteria 1624
221 Ga0207692_10130167 3300025898 Bacteria 1420
222 Ga0207688_10010495 3300025901 Bacteria 5038
223 Ga0207680_10320191 3300025903 Bacteria 1084
224 Ga0207647_10112645 3300025904 Bacteria 1608
225 Ga0207685_10010853 3300025905 Bacteria 2711
226 Ga0207685_10014795 3300025905 Bacteria 2452
227 Ga0207685_10058066 3300025905 Bacteria 1521
228 Ga0207699_10001401 3300025906 Bacteria 11443
229 Ga0207699_10002013 3300025906 Bacteria 9599
230 Ga0207699_10008123 3300025906 Bacteria 5164
231 Ga0207699_10013024 3300025906 Bacteria 4242
232 Ga0207699_10044260 3300025906 Bacteria 2591
233 Ga0207699_10090248 3300025906 Bacteria 1922
234 Ga0207705_10000534 3300025909 Bacteria 32117
235 Ga0207705_10250942 3300025909 Bacteria 1349
236 Ga0207684_10001704 3300025910 Bacteria 23348
237 Ga0207684_10051640 3300025910 Bacteria 3488
238 Ga0207684_10094283 3300025910 Bacteria 2553
239 Ga0207684_10160837 3300025910 Bacteria 1934
240 Ga0207707_10098726 3300025912 Bacteria 2552
241 Ga0207707_10271126 3300025912 Bacteria 1471
242 Ga0207695_10017654 3300025913 Bacteria 8290
243 Ga0207671_10102092 3300025914 Bacteria 2174
244 Ga0207671_10292723 3300025914 Bacteria 1286
245 Ga0207693_10010158 3300025915 Bacteria 7647
246 Ga0207693_10089790 3300025915 Bacteria 2408
247 Ga0207693_10145038 3300025915 Bacteria 1867
248 Ga0207693_10146280 3300025915 Bacteria 1858
249 Ga0207693_10202479 3300025915 Bacteria 1561
250 Ga0207663_10011449 3300025916 Bacteria 4760
251 Ga0207663_10045372 3300025916 Bacteria 2703
252 Ga0207663_10055787 3300025916 Bacteria 2481
253 Ga0207663_10072922 3300025916 Bacteria 2220
254 Ga0207663_10100640 3300025916 Bacteria 1940
255 Ga0207663_10166551 3300025916 Bacteria 1561
256 Ga0207662_10015130 3300025918 Bacteria 4336
257 Ga0207657_10003200 3300025919 Bacteria 17524
258 Ga0207649_10016696 3300025920 Bacteria 4148
259 Ga0207646_10000264 3300025922 Bacteria 71299
260 Ga0207646_10007362 3300025922 Bacteria 11210
261 Ga0207646_10044705 3300025922 Bacteria 3975
262 Ga0207646_10101971 3300025922 Bacteria 2573
263 Ga0207646_10127942 3300025922 Bacteria 2284
264 Ga0207646_10533187 3300025922 Bacteria 1056
265 Ga0207694_10146342 3300025924 Bacteria 1902
266 Ga0207700_10002700 3300025928 Bacteria 10223
267 Ga0207700_10005267 3300025928 Bacteria 7713
268 Ga0207700_10028659 3300025928 Bacteria 3919
269 Ga0207700_10031683 3300025928 Bacteria 3760
270 Ga0207700_10069497 3300025928 Bacteria 2703
271 Ga0207700_10092498 3300025928 Bacteria 2391
272 Ga0207700_10093082 3300025928 Bacteria 2384
273 Ga0207700_10122255 3300025928 Bacteria 2113
274 Ga0207700_10189293 3300025928 Bacteria 1728
275 Ga0207700_10376132 3300025928 Bacteria 1241
276 Ga0207664_10000276 3300025929 Bacteria 38889
277 Ga0207664_10009308 3300025929 Bacteria 6887
278 Ga0207664_10009808 3300025929 Bacteria 6740
279 Ga0207664_10023594 3300025929 Bacteria 4611
280 Ga0207664_10036478 3300025929 Bacteria 3800
281 Ga0207664_10053935 3300025929 Bacteria 3184
282 Ga0207664_10069685 3300025929 Bacteria 2828
283 Ga0207664_10069729 3300025929 Bacteria 2827
284 Ga0207664_10069961 3300025929 Bacteria 2823
285 Ga0207664_10121916 3300025929 Bacteria 2183
286 Ga0207664_10123763 3300025929 Bacteria 2168
287 Ga0207690_10019520 3300025932 Bacteria 4177
288 Ga0207706_10012201 3300025933 Bacteria 7831
289 Ga0207706_10015746 3300025933 Bacteria 6835
290 Ga0207709_10014250 3300025935 Bacteria 4387
291 Ga0207670_10112011 3300025936 Bacteria 1968
292 Ga0207665_10000079 3300025939 Bacteria 62721
293 Ga0207665_10002232 3300025939 Bacteria 13066
294 Ga0207665_10032301 3300025939 Bacteria 3466
295 Ga0207665_10034619 3300025939 Bacteria 3351
296 Ga0207665_10052244 3300025939 Bacteria 2753
297 Ga0207665_10070146 3300025939 Bacteria 2390
298 Ga0207665_10115216 3300025939 Bacteria 1893
299 Ga0207665_10116373 3300025939 Bacteria 1884
300 Ga0207689_10003777 3300025942 Bacteria 13797
301 Ga0207679_10187016 3300025945 Bacteria 1718
302 Ga0207668_10152931 3300025972 Bacteria 1788
303 Ga0207658_10116540 3300025986 Bacteria 2122
304 Ga0207677_10051214 3300026023 Bacteria 2798
305 Ga0207703_10061543 3300026035 Bacteria 3073
306 Ga0207639_10230458 3300026041 Bacteria 1605
307 Ga0207708_10032974 3300026075 Bacteria 3933
308 Ga0207702_10082246 3300026078 Bacteria 2799
309 Ga0207702_10173178 3300026078 Bacteria 1981
310 Ga0207702_10221506 3300026078 Bacteria 1763
311 Ga0207641_10192970 3300026088 Bacteria 1873
312 Ga0207674_10004694 3300026116 Bacteria 16395
313 Ga0207674_10016544 3300026116 Bacteria 8068
314 Ga0207675_100074065 3300026118 Bacteria 3186
315 Ga0207675_100287896 3300026118 Bacteria 1597
316 Ga0207683_10003826 3300026121 Bacteria 13035
317 Ga0207683_10371498 3300026121 Bacteria 1314
318 Ga0209371_1000010 3300027312 Bacteria 922021
319 Ga0209371_1000170 3300027312 Bacteria 97312
320 Ga0209371_1000270 3300027312 Bacteria 60585
321 Ga0209371_1000273 3300027312 Bacteria 60163
322 Ga0209371_1003951 3300027312 Bacteria 6787
323 Ga0209371_1004826 3300027312 Bacteria 5658
324 Ga0207428_10026486 3300027907 Bacteria 4840
325 Ga0265319_1001112 3300028563 Bacteria 16720
326 Ga0265334_10001022 3300028573 Bacteria 13779
327 Ga0265318_10008929 3300028577 Bacteria 4439
328 Ga0265336_10007499 3300028666 Bacteria 3876
329 Ga0265338_10000315 3300028800 Bacteria 87685
330 Ga0265324_10001954 3300029957 Bacteria 11051
331 Ga0268256_1000022 3300030500 Bacteria 531115
332 Ga0268256_1000142 3300030500 Bacteria 97311
333 Ga0268256_1000229 3300030500 Bacteria 60064
334 Ga0268256_1003310 3300030500 Bacteria 7396
335 Ga0268256_1003665 3300030500 Bacteria 6787
336 Ga0268256_1005127 3300030500 Bacteria 5216
337 Ga0265332_10001756 3300031238 Bacteria 11737
338 Ga0265320_10001056 3300031240 Bacteria 20465
339 Ga0265340_10002199 3300031247 Bacteria 11160
340 Ga0265316_10007428 3300031344 Bacteria 10327
341 Ga0307508_10203997 3300031616 Bacteria 1578
342 Ga0265314_10006818 3300031711 Bacteria 10009
343 Ga0265342_10000413 3300031712 Bacteria 46857
344 Ga0316214_1002703 3300033545 Bacteria 2194
345 Ga0316212_1001409 3300033547 Bacteria 3269
346 Ga0373930_0028625 3300034816 Bacteria 1135
347 Ga0373948_0039466 3300034817 Bacteria 982
348 Ga0373958_0004767 3300034819 Bacteria 2023
349 Ga0373959_0015384 3300034820 Bacteria 1405
350 Ga0373959_0016178 3300034820 Bacteria 1379
351 Ga0373926_0063968 3300035083 Bacteria 1344
352 Ga0373926_0072951 3300035083 Bacteria 1263
353 Ga0373929_0007014 3300035085 Bacteria 2049
354 Ga0373934_0000147 3300035086 Bacteria 25688
355 Ga0373934_0005724 3300035086 Bacteria 4602
356 Ga0373934_0013165 3300035086 Bacteria 3124
357 Ga0373934_0053865 3300035086 Bacteria 1596
358 Ga0373934_0057480 3300035086 Bacteria 1547
359 Ga0373934_0109020 3300035086 Bacteria 1122
360 Ga0373940_0011546 3300035088 Bacteria 2099
361 Ga0373944_0000478 3300035089 Bacteria 9285
362 Ga0373944_0010279 3300035089 Bacteria 2549
363 Ga0373944_0077381 3300035089 Bacteria 1093
364 Ga0373951_0025536 3300035091 Bacteria 1373
365 Ga0373923_0002363 3300035111 Bacteria 5788
366 Ga0373923_0032811 3300035111 Bacteria 2099
367 Ga0373923_0139215 3300035111 Bacteria 1096
368 Ga0373936_0001389 3300035113 Bacteria 8784
369 Ga0373936_0021800 3300035113 Bacteria 2492
370 Ga0373936_0045778 3300035113 Bacteria 1762
371 Ga0373936_0076511 3300035113 Bacteria 1387
372 Ga0373945_0002843 3300035116 Bacteria 5442
373 Ga0373945_0025351 3300035116 Bacteria 2059
374 Ga0373945_0047307 3300035116 Bacteria 1572
375 Ga0373953_0000058 3300035117 Bacteria 28394
376 Ga0373953_0028495 3300035117 Bacteria 2153
377 Ga0373953_0044206 3300035117 Bacteria 1780
378 Ga0373954_0002851 3300035118 Bacteria 7288
379 Ga0373954_0015678 3300035118 Bacteria 3389
380 Ga0373954_0019143 3300035118 Bacteria 3086
381 Ga0373954_0020254 3300035118 Bacteria 3007
382 Ga0373954_0064136 3300035118 Bacteria 1737
383 Ga0373956_0000532 3300035119 Bacteria 15593
384 Ga0373956_0002843 3300035119 Bacteria 7006
385 Ga0373956_0052098 3300035119 Bacteria 1840
386 Ga0373957_0000135 3300035120 Bacteria 18273
387 Ga0373957_0003564 3300035120 Bacteria 4622
388 Ga0373957_0012480 3300035120 Bacteria 2862
389 Ga0373957_0058451 3300035120 Bacteria 1490
390 Ga0373943_0001717 3300035170 Bacteria 9929
391 Ga0373943_0032741 3300035170 Bacteria 2472
392 Ga0373946_0001997 3300035171 Bacteria 7141
393 Ga0373946_0007296 3300035171 Bacteria 4035
394 Ga0373955_0001363 3300035172 Bacteria 10382
395 Ga0373955_0007242 3300035172 Bacteria 5090
396 Ga0373955_0010380 3300035172 Bacteria 4397
397 Ga0373955_0035832 3300035172 Bacteria 2630
398 Ga0373955_0126639 3300035172 Bacteria 1488
399 Ga0373955_0196758 3300035172 Bacteria 1199
400 Ga0373942_0046417 3300035207 Bacteria 1203
401 Ga0373961_0014119 3300035241 Bacteria 2025
402 Ga0373961_0068093 3300035241 Bacteria 1095
403 Ga0373924_0004968 3300035410 Bacteria 4681
404 Ga0373924_0015077 3300035410 Bacteria 2930
405 Ga0373924_0047522 3300035410 Bacteria 1770
406 Ga0373931_0076418 3300035691 Bacteria 1839
407 Ga0373931_0110009 3300035691 Bacteria 1562
408 Ga0373931_0119194 3300035691 Bacteria 1506
409 Ga0373935_0000168 3300035692 Bacteria 30620
410 Ga0373935_0008796 3300035692 Bacteria 6047
411 Ga0373935_0016503 3300035692 Bacteria 4467
412 Ga0373935_0025642 3300035692 Bacteria 3633
413 Ga0373935_0056401 3300035692 Bacteria 2504
414 Ga0373935_0056603 3300035692 Bacteria 2500
415 Ga0373935_0326146 3300035692 Bacteria 1090
416 Ga0373935_0390846 3300035692 Bacteria 997
417 Ga0373927_0005960 3300035695 Bacteria 8348
418 Ga0373927_0063242 3300035695 Bacteria 2393
419 Ga0373927_0164218 3300035695 Bacteria 1455
420 Ga0373933_0000002 3300035724 Bacteria 151785
421 Ga0373933_0013496 3300035724 Bacteria 4529
422 Ga0373933_0063035 3300035724 Bacteria 2240
423 Ga0373933_0165734 3300035724 Bacteria 1404
424 Ga0373947_0000007 3300035725 Bacteria 192259
425 Ga0373947_0000631 3300035725 Bacteria 20809
426 Ga0373947_0009158 3300035725 Bacteria 5691
427 Ga0373947_0022856 3300035725 Bacteria 3629
428 Ga0373947_0046020 3300035725 Bacteria 2612
429 Ga0373947_0081182 3300035725 Bacteria 2007
430 Ga0373947_0107054 3300035725 Bacteria 1763
431 Ga0373947_0125306 3300035725 Bacteria 1635
432 Ga0373937_0000014 3300036401 Bacteria 151785
433 Ga0373937_0003979 3300036401 Bacteria 12502
434 Ga0373937_0006593 3300036401 Bacteria 10025
435 Ga0373937_0021178 3300036401 Bacteria 5835
436 Ga0373937_0142412 3300036401 Bacteria 2243
437 Ga0373937_0303881 3300036401 Bacteria 1508
438 Ga0373937_0360588 3300036401 Bacteria 1377
439 Ga0373937_0465673 3300036401 Bacteria 1200
440 Ga0372808_005086 3300036459 Bacteria 1716
441 Ga0373925_0029398 3300037068 Bacteria 4032
442 Ga0373925_0074817 3300037068 Bacteria 2566
443 Ga0373925_0124218 3300037068 Bacteria 2006
444 Ga0373925_0256210 3300037068 Bacteria 1404
445 Ga0436364_0287407 3300037853 Bacteria 132611
446 Ga0436364_0416023 3300037853 Bacteria 2325
447 Ga0436364_0645051 3300037853 Bacteria 7687
448 Ga0436364_1093265 3300037853 Bacteria 12190
449 Ga0436364_1549559 3300037853 Bacteria 7764
450 Ga0395901_0070679 3300038443 Bacteria 3637
451 Ga0436365_0528481 3300039437 Bacteria 36434
452 Ga0436360_1239965 3300039438 Bacteria 1481
453 Ga0436363_1047826 3300039450 Bacteria 2588
454 Ga0439438_000001 3300041405 Bacteria 1263568
455 Ga0439438_012054 3300041405 Bacteria 2665
456 Ga0439447_001587 3300041407 Bacteria 8320
457 Ga0439447_007745 3300041407 Bacteria 3380
458 Ga0439466_0000003 3300041411 Bacteria 486229
459 Ga0439432_006224 3300042006 Bacteria 4272
460 Ga0439432_108905 3300042006 Bacteria 825
461 Ga0439452_000001 3300042010 Bacteria 1725439
462 Ga0439452_000029 3300042010 Bacteria 197977
463 Ga0439464_0000630 3300042439 Bacteria 7485
464 Ga0466965_0107561 3300044683 Bacteria 1431
465 Ga0466968_0130979 3300044735 Bacteria 1141
466 Ga0466970_0214549 3300044765 Bacteria 1073
467 Ga0466957_0120956 3300044842 Bacteria 1669
468 Ga0466959_0102133 3300045049 Bacteria 2052
469 Ga0466967_0099778 3300045976 Bacteria 2652
470 Ga0466967_0410293 3300045976 Bacteria 1319
471 Ga0495617_010813 3300046452 Bacteria 3125
472 Ga0495592_0000133 3300046454 Bacteria 66075
473 Ga0495592_0010718 3300046454 Bacteria 6911
474 Ga0495592_0059770 3300046454 Bacteria 2805
475 Ga0495592_0166426 3300046454 Bacteria 1513
476 Ga0495603_0089124 3300046455 Bacteria 1805
477 Ga0495603_0112658 3300046455 Bacteria 1586
478 Ga0495591_000094 3300046458 Bacteria 101106
479 Ga0495591_003750 3300046458 Bacteria 7681
480 Ga0495629_0008393 3300046459 Bacteria 7599
481 Ga0495629_0333247 3300046459 Bacteria 1037
482 Ga0495629_0353274 3300046459 Bacteria 1002
483 Ga0495641_0007980 3300046461 Bacteria 6524
484 Ga0495641_0060568 3300046461 Bacteria 1710
485 Ga0495641_0105591 3300046461 Bacteria 1256
486 Ga0495651_0000470 3300046462 Bacteria 30998
487 Ga0495651_0035996 3300046462 Bacteria 3853
488 Ga0495651_0040835 3300046462 Bacteria 3604
489 Ga0495651_0051289 3300046462 Bacteria 3181
490 Ga0495651_0064398 3300046462 Bacteria 2801
491 Ga0495651_0207439 3300046462 Bacteria 1366
492 Ga0495651_0235536 3300046462 Bacteria 1258
493 Ga0495653_0009353 3300046463 Bacteria 8018
494 Ga0495653_0009767 3300046463 Bacteria 7845
495 Ga0495653_0016076 3300046463 Bacteria 6099
496 Ga0495653_0034825 3300046463 Bacteria 3977
497 Ga0495653_0049781 3300046463 Bacteria 3225
498 Ga0495653_0061641 3300046463 Bacteria 2837
499 Ga0495653_0068709 3300046463 Bacteria 2657
500 Ga0495653_0102003 3300046463 Bacteria 2077
501 Ga0495653_0103945 3300046463 Bacteria 2053
502 Ga0495650_0000033 3300046471 Bacteria 412188
503 Ga0495580_0027686 3300046472 Bacteria 4123
504 Ga0495582_0032023 3300046473 Bacteria 2892
505 Ga0495582_0338028 3300046473 Bacteria 867
506 Ga0495639_0000320 3300046475 Bacteria 23322
507 Ga0495639_0026037 3300046475 Bacteria 2583
508 Ga0495639_0203579 3300046475 Bacteria 969
509 Ga0495662_0002566 3300046476 Bacteria 9168
510 Ga0495662_0004176 3300046476 Bacteria 7275
511 Ga0495662_0022474 3300046476 Bacteria 3045
512 Ga0495662_0040446 3300046476 Bacteria 2252
513 Ga0495664_0000448 3300046477 Bacteria 20228
514 Ga0495664_0006281 3300046477 Bacteria 6561
515 Ga0495664_0028833 3300046477 Bacteria 3243
516 Ga0495664_0077031 3300046477 Bacteria 1996
517 Ga0495664_0118957 3300046477 Bacteria 1597
518 Ga0495664_0221419 3300046477 Bacteria 1145
519 Ga0495584_0016303 3300046491 Bacteria 3789
520 Ga0495585_0010040 3300046492 Bacteria 5656
521 Ga0495594_0051741 3300046499 Bacteria 2260
522 Ga0495596_0049964 3300046500 Bacteria 1639
523 Ga0495607_0007504 3300046501 Bacteria 7533
524 Ga0495606_0000619 3300046507 Bacteria 55941
525 Ga0495608_0000028 3300046511 Bacteria 151829
526 Ga0495608_0029188 3300046511 Bacteria 3744
527 Ga0495608_0050926 3300046511 Bacteria 2746
528 Ga0495608_0083617 3300046511 Unclassified 2072
529 Ga0495608_0096678 3300046511 Bacteria 1907
530 Ga0495608_0224496 3300046511 Bacteria 1177
531 Ga0495616_0009885 3300046513 Bacteria 5548
532 Ga0495618_0034967 3300046514 Bacteria 3152
533 Ga0495618_0226890 3300046514 Bacteria 1177
534 Ga0495628_0015201 3300046516 Bacteria 6430
535 Ga0495628_0330766 3300046516 Bacteria 1123
536 Ga0495630_0003650 3300046517 Bacteria 10727
537 Ga0495630_0014182 3300046517 Bacteria 5801
538 Ga0495630_0046772 3300046517 Bacteria 3235
539 Ga0495630_0360397 3300046517 Bacteria 1113
540 Ga0495644_0001575 3300046523 Bacteria 9299
541 Ga0495648_0001078 3300046524 Bacteria 27737
542 Ga0495666_0001809 3300046526 Bacteria 10565
543 Ga0495652_0000031 3300046529 Bacteria 151765
544 Ga0495652_0033870 3300046529 Bacteria 4455
545 Ga0495652_0040118 3300046529 Bacteria 4046
546 Ga0495652_0069590 3300046529 Bacteria 2945
547 Ga0495652_0106238 3300046529 Bacteria 2267
548 Ga0495654_0000078 3300046530 Bacteria 110443
549 Ga0495654_0000572 3300046530 Bacteria 29558
550 Ga0495665_0004183 3300046531 Bacteria 7786
551 Ga0495665_0061954 3300046531 Bacteria 1975
552 Ga0495640_0007267 3300046533 Bacteria 8726
553 Ga0495640_0015708 3300046533 Bacteria 5686
554 Ga0495640_0028735 3300046533 Bacteria 4000
555 Ga0495640_0051727 3300046533 Bacteria 2823
556 Ga0495640_0093850 3300046533 Bacteria 1977
557 Ga0495587_0000023 3300046536 Bacteria 151763
558 Ga0495587_0005276 3300046536 Bacteria 8446
559 Ga0495587_0010020 3300046536 Bacteria 6051
560 Ga0495587_0015949 3300046536 Bacteria 4677
561 Ga0495587_0031703 3300046536 Bacteria 3198
562 Ga0495587_0095139 3300046536 Bacteria 1719
563 Ga0495645_0019460 3300046543 Bacteria 4887
564 Ga0495645_0027114 3300046543 Bacteria 4161
565 Ga0495622_0096476 3300046557 Bacteria 1357
566 Ga0495667_0000054 3300046559 Bacteria 105009
567 Ga0495667_0006695 3300046559 Bacteria 7818
568 Ga0495667_0013554 3300046559 Bacteria 5514
569 Ga0495667_0017159 3300046559 Bacteria 4889
570 Ga0495667_0019274 3300046559 Bacteria 4603
571 Ga0495667_0031395 3300046559 Bacteria 3566
572 Ga0495667_0033362 3300046559 Bacteria 3446
573 Ga0495634_0013714 3300046642 Bacteria 5851
574 Ga0495634_0019228 3300046642 Bacteria 4855
575 Ga0495634_0040494 3300046642 Bacteria 3168
576 Ga0495634_0093688 3300046642 Bacteria 1947
577 Ga0495635_0007650 3300046663 Bacteria 7539
578 Ga0495635_0008781 3300046663 Bacteria 7055
579 Ga0495635_0027823 3300046663 Bacteria 3931
580 Ga0495635_0028828 3300046663 Bacteria 3858
581 Ga0495635_0043890 3300046663 Bacteria 3084
582 Ga0495635_0049874 3300046663 Bacteria 2885
583 Ga0495635_0067471 3300046663 Bacteria 2454
584 Ga0495635_0171289 3300046663 Bacteria 1476
585 Ga0495657_0000022 3300046675 Bacteria 151837
586 Ga0495657_0030011 3300046675 Bacteria 3810
587 Ga0495657_0031045 3300046675 Bacteria 3737
588 Ga0495657_0031256 3300046675 Bacteria 3722
589 Ga0495657_0038661 3300046675 Bacteria 3282
590 Ga0495657_0040463 3300046675 Bacteria 3197
591 Ga0495657_0156406 3300046675 Bacteria 1412
592 Ga0495599_0000236 3300046678 Bacteria 34674
593 Ga0495599_0016837 3300046678 Bacteria 4540
594 Ga0495599_0020373 3300046678 Bacteria 4130
595 Ga0495599_0022142 3300046678 Bacteria 3966
596 Ga0495599_0056496 3300046678 Bacteria 2456
597 Ga0495623_0001119 3300046679 Bacteria 18089
598 Ga0495623_0183373 3300046679 Bacteria 1214
599 Ga0495646_0007017 3300046680 Bacteria 7152
600 Ga0495646_0010149 3300046680 Bacteria 5988
601 Ga0495646_0022432 3300046680 Bacteria 3983
602 Ga0495646_0023398 3300046680 Bacteria 3890
603 Ga0495647_0003056 3300046681 Bacteria 5336
604 Ga0495647_0259251 3300046681 Bacteria 775
605 Ga0495658_0018793 3300046683 Bacteria 3599
606 Ga0495658_0043551 3300046683 Bacteria 2511
607 Ga0495613_0283285 3300046689 Bacteria 1150
608 Ga0495624_0001756 3300046690 Bacteria 16592
609 Ga0495624_0009799 3300046690 Bacteria 6626
610 Ga0495624_0049025 3300046690 Bacteria 2679
611 Ga0495624_0066180 3300046690 Bacteria 2256
612 Ga0495624_0154202 3300046690 Bacteria 1404
613 Ga0495649_0003646 3300046694 Bacteria 10274
614 Ga0495600_0004245 3300046809 Bacteria 8559
615 Ga0495600_0027973 3300046809 Bacteria 3646
616 Ga0495600_0065520 3300046809 Bacteria 2375
617 Ga0495600_0138543 3300046809 Bacteria 1579
618 Ga0495660_0000011 3300046810 Bacteria 361397
619 Ga0495660_0010971 3300046810 Bacteria 5264
620 Ga0495581_0015452 3300047315 Bacteria 4432
621 Ga0495581_0063933 3300047315 Bacteria 2126
622 Ga0495581_0159974 3300047315 Bacteria 1316
623 Ga0495604_0000022 3300047317 Bacteria 151744
624 Ga0495604_0013825 3300047317 Bacteria 6438
625 Ga0495604_0023576 3300047317 Bacteria 4910
626 Ga0495674_0007792 3300047319 Bacteria 10224
627 Ga0495674_0010705 3300047319 Bacteria 8677
628 Ga0495672_0000004 3300047320 Bacteria 631810
629 Ga0495672_0000012 3300047320 Bacteria 519975
630 Ga0495676_0021929 3300047321 Bacteria 5567
631 Ga0495676_0052961 3300047321 Bacteria 3236
632 Ga0495676_0084085 3300047321 Bacteria 2402
633 Ga0495676_0168764 3300047321 Bacteria 1542
634 Ga0495680_0000271 3300047322 Bacteria 57595
635 Ga0495680_0006193 3300047322 Bacteria 11151
636 Ga0495680_0023422 3300047322 Bacteria 5134
637 Ga0495680_0034344 3300047322 Bacteria 4096
638 Ga0495680_0057442 3300047322 Bacteria 3009
639 Ga0495680_0115945 3300047322 Bacteria 1981
640 Ga0495680_0209314 3300047322 Bacteria 1396
641 Ga0495683_0012720 3300047323 Bacteria 4415
642 Ga0495683_0046086 3300047323 Bacteria 2189
643 Ga0495675_0002876 3300047444 Bacteria 10327
644 Ga0495675_0107570 3300047444 Bacteria 1742
645 Ga0495675_0134404 3300047444 Bacteria 1536
646 Ga0495675_0312110 3300047444 Bacteria 932
647 Ga0495679_007102 3300047446 Bacteria 4722
648 Ga0495673_0000023 3300047469 Bacteria 539904
649 Ga0495681_0010484 3300047470 Bacteria 5607
650 Ga0495684_0012825 3300047471 Bacteria 6468
651 Ga0495684_0018097 3300047471 Bacteria 5430
652 Ga0495684_0021015 3300047471 Bacteria 5028
653 Ga0495684_0037960 3300047471 Bacteria 3694
654 Ga0495684_0050488 3300047471 Bacteria 3175
655 Ga0495684_0097573 3300047471 Bacteria 2223
656 Ga0495684_0161727 3300047471 Bacteria 1669
657 Ga0495593_0007205 3300047673 Bacteria 6519
658 Ga0495593_0043384 3300047673 Bacteria 2410
659 Ga0495593_0177028 3300047673 Bacteria 1074
660 Ga0495602_0000390 3300048088 Bacteria 41015
661 Ga0495602_0022179 3300048088 Bacteria 6223
662 Ga0495602_0024707 3300048088 Bacteria 5827
663 Ga0495602_0042039 3300048088 Bacteria 4167
664 Ga0495602_0044304 3300048088 Bacteria 4037
665 Ga0495602_0101537 3300048088 Bacteria 2359
666 Ga0495602_0168912 3300048088 Bacteria 1699
667 Ga0495614_0023362 3300048089 Bacteria 2667
668 Ga0496100_0029777 3300048903 Bacteria 3380
669 Ga0496100_0040778 3300048903 Bacteria 2956
670 Ga0496100_0222597 3300048903 Bacteria 1385
671 Ga0496101_0000029 3300048904 Bacteria 198515
672 Ga0496101_0032361 3300048904 Bacteria 3681
673 Ga0496101_0154937 3300048904 Bacteria 1754
674 Ga0496102_0048291 3300048905 Bacteria 3870
675 Ga0496102_0150527 3300048905 Bacteria 2186
676 Ga0496102_0209553 3300048905 Bacteria 1838
677 Ga0496102_0212587 3300048905 Bacteria 1823
678 Ga0496103_0027084 3300048906 Bacteria 3471
679 Ga0496104_0035650 3300048907 Bacteria 4645
680 Ga0496104_0036938 3300048907 Bacteria 4567
681 Ga0496104_0130924 3300048907 Bacteria 2409
682 Ga0496104_0224506 3300048907 Bacteria 1790
683 Ga0496104_0624739 3300048907 Bacteria 987
684 Ga0496105_0000685 3300048908 Bacteria 22794
685 Ga0496105_0032555 3300048908 Bacteria 4279
686 Ga0496105_0054596 3300048908 Bacteria 3298
687 Ga0496105_0189835 3300048908 Bacteria 1680
688 Ga0496106_0118233 3300048909 Bacteria 2069
689 Ga0496106_0140248 3300048909 Bacteria 1901
690 Ga0496106_0250942 3300048909 Bacteria 1414
691 Ga0496108_0008888 3300048911 Bacteria 8144
692 Ga0496108_0069967 3300048911 Bacteria 2961
693 Ga0496108_0105500 3300048911 Bacteria 2406
694 Ga0496109_0055319 3300048912 Bacteria 3620
695 Ga0496109_0082488 3300048912 Bacteria 2963
696 Ga0496109_0335198 3300048912 Bacteria 1428
697 Ga0496110_0036536 3300048913 Bacteria 4266
698 Ga0496110_0265463 3300048913 Bacteria 1563
699 Ga0496112_0036188 3300048915 Bacteria 4814
700 Ga0496112_0111966 3300048915 Bacteria 2699
701 Ga0496112_0459529 3300048915 Bacteria 1211
702 Ga0496113_0328017 3300048916 Bacteria 1227
703 Ga0496114_0022763 3300048917 Bacteria 5107
704 Ga0496114_0285599 3300048917 Bacteria 1455
705 Ga0496114_0303938 3300048917 Bacteria 1408
706 Ga0496115_0024609 3300048918 Bacteria 4682
707 Ga0496115_0149297 3300048918 Bacteria 1929
708 Ga0496115_0234054 3300048918 Bacteria 1514
709 Ga0496116_0000579 3300048919 Bacteria 48897
710 Ga0496116_0001066 3300048919 Bacteria 33115
711 Ga0496116_0024816 3300048919 Bacteria 4422
712 Ga0496116_0048578 3300048919 Bacteria 2846
713 Ga0496116_0252864 3300048919 Bacteria 875
714 Ga0496117_0000180 3300048920 Bacteria 128746
715 Ga0496117_0000644 3300048920 Bacteria 56210
716 Ga0496117_0008147 3300048920 Bacteria 10014
717 Ga0496117_0132910 3300048920 Bacteria 1504
718 Ga0496118_0000247 3300048921 Bacteria 95745
719 Ga0496118_0002990 3300048921 Bacteria 21862
720 Ga0496118_0009235 3300048921 Bacteria 10014
721 Ga0496118_0014808 3300048921 Bacteria 7274
722 Ga0496118_0016504 3300048921 Bacteria 6773
723 Ga0496118_0146260 3300048921 Bacteria 1487
724 Ga0496119_0000043 3300048922 Bacteria 192373
725 Ga0496119_0000045 3300048922 Bacteria 191361
726 Ga0496119_0000178 3300048922 Bacteria 89153
727 Ga0496119_0000650 3300048922 Bacteria 46907
728 Ga0496119_0001482 3300048922 Bacteria 28129
729 Ga0496119_0023253 3300048922 Bacteria 4405
730 Ga0496120_0000043 3300048923 Bacteria 195584
731 Ga0496120_0000346 3300048923 Bacteria 76271
732 Ga0496120_0000407 3300048923 Bacteria 69144
733 Ga0496120_0000459 3300048923 Bacteria 64233
734 Ga0496120_0000894 3300048923 Bacteria 41926
735 Ga0496120_0019025 3300048923 Bacteria 4407
736 Ga0496121_0000967 3300048924 Bacteria 51547
737 Ga0496121_0009019 3300048924 Bacteria 11558
738 Ga0496122_0006878 3300048925 Bacteria 12874
739 Ga0496122_0068741 3300048925 Bacteria 2541
740 Ga0496122_0112495 3300048925 Bacteria 1782
741 Ga0496123_0003607 3300048926 Bacteria 17147
742 Ga0496123_0051276 3300048926 Bacteria 2748
743 Ga0496123_0058663 3300048926 Bacteria 2494
744 Ga0496124_0000463 3300048927 Bacteria 70325
745 Ga0496124_0001570 3300048927 Bacteria 33020
746 Ga0496124_0005426 3300048927 Bacteria 14353
747 Ga0496124_0022087 3300048927 Bacteria 5844
748 Ga0496124_0050436 3300048927 Bacteria 3547
749 Ga0496124_0060607 3300048927 Bacteria 3174
750 Ga0496124_0070201 3300048927 Bacteria 2906
751 Ga0496124_0148026 3300048927 Unclassified 1845
752 Ga0496125_0048738 3300048928 Bacteria 3528
753 Ga0496125_0094002 3300048928 Bacteria 2236
754 Ga0496125_0149596 3300048928 Bacteria 1606
755 Ga0496126_0002412 3300048929 Bacteria 25320
756 Ga0496126_0084761 3300048929 Bacteria 2794
757 Ga0496126_0099670 3300048929 Bacteria 2544
758 Ga0496126_0202904 3300048929 Bacteria 1673
759 Ga0495678_000415 3300049459 Bacteria 43047
760 Ga0495678_011026 3300049459 Bacteria 4348
761 Ga0495682_0000004 3300049460 Bacteria 378337
762 Ga0501034_0004181 3300049571 Bacteria 16111
763 Ga0501034_0023236 3300049571 Bacteria 6318
764 Ga0501034_0521419 3300049571 Bacteria 1100
765 Ga0501036_0000170 3300049572 Bacteria 42985
766 Ga0501036_0007170 3300049572 Bacteria 9079
767 Ga0501037_0004187 3300049573 Bacteria 10460
768 Ga0501037_0027151 3300049573 Bacteria 4229
769 Ga0501038_0006542 3300049574 Bacteria 10780
770 Ga0501038_0034960 3300049574 Bacteria 4416
771 Ga0501039_0078463 3300049575 Bacteria 2569
772 Ga0501039_0188459 3300049575 Bacteria 1622
773 Ga0501042_0002573 3300049578 Bacteria 11151
774 Ga0501042_0080873 3300049578 Unclassified 2328
775 Ga0501043_0000866 3300049579 Bacteria 26823
776 Ga0501043_0007870 3300049579 Bacteria 8430
777 Ga0501047_0002697 3300049581 Bacteria 16895
778 Ga0501047_0006312 3300049581 Bacteria 11150
779 Ga0501047_0076774 3300049581 Bacteria 3215
780 Ga0501047_0574831 3300049581 Bacteria 950
781 Ga0501048_0001538 3300049582 Bacteria 17507
782 Ga0501048_0003280 3300049582 Bacteria 12333
783 Ga0501073_0015818 3300049589 Bacteria 5467
784 Ga0501073_0027049 3300049589 Bacteria 4105
785 Ga0501074_0001528 3300049590 Bacteria 15658
786 Ga0501074_0001673 3300049590 Bacteria 15081
787 Ga0501035_0007966 3300049822 Bacteria 9882
788 Ga0501035_0019914 3300049822 Bacteria 6163
789 Ga0501044_0018809 3300049823 Bacteria 7399
790 Ga0501044_0192161 3300049823 Bacteria 2003
791 Ga0501044_0278345 3300049823 Bacteria 1607
792 nmdc:mga06z11_205501_c1 3300050494 Bacteria 1145
793 nmdc:mga07m45_191881_c1 3300050496 Unclassified 1188
794 nmdc:mga07m45_414698_c1 3300050496 Unclassified 781
795 nmdc:mga05p37_31168_c1 3300050507 Bacteria 6513
796 nmdc:mga09592_115698_c1 3300050508 Bacteria 2301
797 nmdc:mga08y16_181875_c1 3300050511 Bacteria 2183
798 nmdc:mga0n895_241896_c1 3300050512 Bacteria 1832
799 nmdc:mga0n895_291452_c1 3300050512 Bacteria 1655
800 nmdc:mga0rr50_131326_c1 3300050513 Bacteria 2006
801 nmdc:mga0rr50_15046_c1 3300050513 Bacteria 5098
802 nmdc:mga0rr50_55526_c1 3300050513 Bacteria 2955
803 nmdc:mga08x19_136839_c1 3300050514 Bacteria 1652
804 nmdc:mga08x19_162650_c1 3300050514 Bacteria 1517
805 nmdc:mga0a205_112376_c1 3300050515 Bacteria 2623
806 nmdc:mga0a205_69748_c1 3300050515 Bacteria 3394
807 Ga0495601_0176533 3300053077 Bacteria 1396
808 Ga0495601_0214108 3300053077 Bacteria 1258
809 Ga0495612_0014247 3300053078 Bacteria 3198
810 Ga0495612_0016713 3300053078 Bacteria 2939
811 Ga0495612_0034327 3300053078 Bacteria 2054
812 Ga0495595_0001201 3300053084 Bacteria 10066
813 Ga0495595_0040092 3300053084 Bacteria 2139
814 Ga0495619_0006722 3300053085 Bacteria 7275
815 Ga0495619_0028350 3300053085 Bacteria 3611
816 Ga0500621_000001 3300053126 Bacteria 1049698
817 Ga0500559_0143431 3300053136 Bacteria 1119
818 Ga0500616_0128529 3300053153 Bacteria 1200
819 Ga0500622_0009263 3300053156 Bacteria 5459

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046455 Ga0495603_0089124 Ga0495603_0089124_11_796 184
2 3300046681 Ga0495647_0259251 Ga0495647_0259251_23_694 184
3 3300046477 Ga0495664_0221419 Ga0495664_0221419_26_979 194
4 3300046459 Ga0495629_0353274 Ga0495629_0353274_168_986 201
5 3300005437 Ga0070710_10100036 Ga0070710_101000364 207
6 3300025898 Ga0207692_10095128 Ga0207692_100951281 207
7 3300046475 Ga0495639_0026037 Ga0495639_0026037_1549_2553 210
8 3300046476 Ga0495662_0022474 Ga0495662_0022474_1727_2695 210
9 3300046533 Ga0495640_0015708 Ga0495640_0015708_2179_3183 210
10 3300046642 Ga0495634_0019228 Ga0495634_0019228_3809_4813 210
11 3300046678 Ga0495599_0020373 Ga0495599_0020373_2287_3291 210
12 3300047673 Ga0495593_0043384 Ga0495593_0043384_11_979 210
13 3300053077 Ga0495601_0214108 Ga0495601_0214108_243_1211 210
14 3300005983 Ga0081540_1000607 Ga0081540_10006075 211
15 3300035172 Ga0373955_0035832 Ga0373955_0035832_1551_2555 211
16 3300035692 Ga0373935_0016503 Ga0373935_0016503_1803_2807 211
17 3300036401 Ga0373937_0003979 Ga0373937_0003979_8912_9916 211
18 3300046463 Ga0495653_0034825 Ga0495653_0034825_1682_2686 211
19 3300046517 Ga0495630_0014182 Ga0495630_0014182_2278_3282 211
20 3300046536 Ga0495587_0010020 Ga0495587_0010020_2793_3797 211
21 3300046559 Ga0495667_0006695 Ga0495667_0006695_511_1515 211
22 3300046675 Ga0495657_0040463 Ga0495657_0040463_1555_2559 211
23 3300046679 Ga0495623_0183373 Ga0495623_0183373_114_1172 211
24 3300046680 Ga0495646_0022432 Ga0495646_0022432_1603_2607 211
25 3300046683 Ga0495658_0018793 Ga0495658_0018793_1452_2456 211
26 3300046690 Ga0495624_0066180 Ga0495624_0066180_1048_2052 211
27 3300047322 Ga0495680_0115945 Ga0495680_0115945_357_1343 211
28 3300048088 Ga0495602_0044304 Ga0495602_0044304_2194_3198 211
29 3300035692 Ga0373935_0326146 Ga0373935_0326146_35_937 212
30 3300035116 Ga0373945_0047307 Ga0373945_0047307_294_1175 213
31 3300048912 Ga0496109_0055319 Ga0496109_0055319_1705_2517 213
32 3300005434 Ga0070709_10100478 Ga0070709_101004782 214
33 3300005437 Ga0070710_10078106 Ga0070710_100781062 214
34 3300005439 Ga0070711_100122385 Ga0070711_1001223852 214
35 3300005614 Ga0068856_100248806 Ga0068856_1002488062 214
36 3300005618 Ga0068864_100167239 Ga0068864_1001672392 214
37 3300006163 Ga0070715_10042184 Ga0070715_100421843 214
38 3300006173 Ga0070716_100099505 Ga0070716_1000995053 214
39 3300025898 Ga0207692_10011656 Ga0207692_100116562 214
40 3300025906 Ga0207699_10013024 Ga0207699_100130242 214
41 3300025915 Ga0207693_10146280 Ga0207693_101462802 214
42 3300025916 Ga0207663_10100640 Ga0207663_101006402 214
43 3300025928 Ga0207700_10005267 Ga0207700_100052675 214
44 3300025929 Ga0207664_10036478 Ga0207664_100364782 214
45 3300025939 Ga0207665_10116373 Ga0207665_101163732 214
46 3300034816 Ga0373930_0028625 Ga0373930_0028625_67_957 214
47 3300034819 Ga0373958_0004767 Ga0373958_0004767_168_1058 214
48 3300034820 Ga0373959_0015384 Ga0373959_0015384_69_959 214
49 3300035085 Ga0373929_0007014 Ga0373929_0007014_289_1179 214
50 3300035088 Ga0373940_0011546 Ga0373940_0011546_64_954 214
51 3300035207 Ga0373942_0046417 Ga0373942_0046417_122_1012 214
52 3300035241 Ga0373961_0014119 Ga0373961_0014119_138_1028 214
53 3300035691 Ga0373931_0076418 Ga0373931_0076418_256_1146 214
54 3300046462 Ga0495651_0035996 Ga0495651_0035996_1953_2843 214
55 3300046683 Ga0495658_0043551 Ga0495658_0043551_1465_2343 214
56 3300047315 Ga0495581_0015452 Ga0495581_0015452_3411_4301 214
57 3300048903 Ga0496100_0029777 Ga0496100_0029777_2311_3201 214
58 3300048904 Ga0496101_0032361 Ga0496101_0032361_305_1195 214
59 3300048905 Ga0496102_0209553 Ga0496102_0209553_686_1576 214
60 3300048907 Ga0496104_0036938 Ga0496104_0036938_3371_4261 214
61 3300048908 Ga0496105_0032555 Ga0496105_0032555_3083_3973 214
62 3300048909 Ga0496106_0118233 Ga0496106_0118233_226_1116 214
63 3300048909 Ga0496106_0140248 Ga0496106_0140248_568_1458 214
64 3300048911 Ga0496108_0069967 Ga0496108_0069967_860_1750 214
65 3300048913 Ga0496110_0265463 Ga0496110_0265463_623_1513 214
66 3300048917 Ga0496114_0022763 Ga0496114_0022763_1818_2708 214
67 3300048918 Ga0496115_0024609 Ga0496115_0024609_2821_3711 214
68 3300035725 Ga0373947_0022856 Ga0373947_0022856_1077_1955 215
69 3300006852 Ga0075433_10048108 Ga0075433_100481082 216
70 3300035111 Ga0373923_0139215 Ga0373923_0139215_137_1015 216
71 3300046461 Ga0495641_0105591 Ga0495641_0105591_351_1241 216
72 3300046473 Ga0495582_0032023 Ga0495582_0032023_396_1286 216
73 3300047321 Ga0495676_0084085 Ga0495676_0084085_926_1816 216
74 3300046463 Ga0495653_0103945 Ga0495653_0103945_909_1799 217
75 3300046663 Ga0495635_0043890 Ga0495635_0043890_1601_2491 217
76 3300050512 nmdc:mga0n895_241896_c1 nmdc:mga0n895_241896_c1_458_1348 217
77 3300050513 nmdc:mga0rr50_15046_c1 nmdc:mga0rr50_15046_c1_2583_3473 217
78 3300050514 nmdc:mga08x19_136839_c1 nmdc:mga08x19_136839_c1_615_1505 217
79 3300050515 nmdc:mga0a205_112376_c1 nmdc:mga0a205_112376_c1_1194_2084 217
80 3300045976 Ga0466967_0099778 Ga0466967_0099778_1236_2105 218
81 3300005434 Ga0070709_10006893 Ga0070709_100068933 219
82 3300005437 Ga0070710_10013641 Ga0070710_100136413 219
83 3300006028 Ga0070717_10038025 Ga0070717_100380253 219
84 3300006173 Ga0070716_100007664 Ga0070716_1000076643 219
85 3300025928 Ga0207700_10002700 Ga0207700_100027003 219
86 3300025929 Ga0207664_10009808 Ga0207664_100098082 219
87 3300025939 Ga0207665_10052244 Ga0207665_100522441 219
88 3300035086 Ga0373934_0000147 Ga0373934_0000147_13501_14370 220
89 3300035117 Ga0373953_0000058 Ga0373953_0000058_20810_21679 220
90 3300035118 Ga0373954_0019143 Ga0373954_0019143_1008_1877 220
91 3300035119 Ga0373956_0000532 Ga0373956_0000532_6691_7560 220
92 3300035120 Ga0373957_0000135 Ga0373957_0000135_13436_14305 220
93 3300035172 Ga0373955_0001363 Ga0373955_0001363_4789_5658 220
94 3300035692 Ga0373935_0390846 Ga0373935_0390846_14_883 220
95 3300035724 Ga0373933_0000002 Ga0373933_0000002_13501_14370 220
96 3300036401 Ga0373937_0000014 Ga0373937_0000014_137416_138285 220
97 3300046454 Ga0495592_0000133 Ga0495592_0000133_13501_14370 220
98 3300046462 Ga0495651_0000470 Ga0495651_0000470_13501_14370 220
99 3300046463 Ga0495653_0009767 Ga0495653_0009767_3054_3923 220
100 3300046511 Ga0495608_0000028 Ga0495608_0000028_13493_14362 220
101 3300046516 Ga0495628_0015201 Ga0495628_0015201_1924_2793 220
102 3300046529 Ga0495652_0000031 Ga0495652_0000031_13481_14350 220
103 3300046536 Ga0495587_0000023 Ga0495587_0000023_137394_138263 220
104 3300046559 Ga0495667_0000054 Ga0495667_0000054_13493_14362 220
105 3300046663 Ga0495635_0067471 Ga0495635_0067471_174_1043 220
106 3300046675 Ga0495657_0000022 Ga0495657_0000022_13501_14370 220
107 3300046678 Ga0495599_0000236 Ga0495599_0000236_20305_21174 220
108 3300046679 Ga0495623_0001119 Ga0495623_0001119_13502_14371 220
109 3300046680 Ga0495646_0007017 Ga0495646_0007017_3189_4058 220
110 3300046809 Ga0495600_0065520 Ga0495600_0065520_206_1075 220
111 3300047317 Ga0495604_0000022 Ga0495604_0000022_13478_14347 220
112 3300047322 Ga0495680_0000271 Ga0495680_0000271_43226_44095 220
113 3300047444 Ga0495675_0002876 Ga0495675_0002876_3771_4640 220
114 3300048088 Ga0495602_0000390 Ga0495602_0000390_13501_14370 220
115 3300053084 Ga0495595_0001201 Ga0495595_0001201_4021_4890 220
116 3300035083 Ga0373926_0072951 Ga0373926_0072951_233_1147 224
117 3300050496 nmdc:mga07m45_414698_c1 nmdc:mga07m45_414698_c1_10_699 224
118 3300005535 Ga0070684_100187419 Ga0070684_1001874191 225
119 3300045049 Ga0466959_0102133 Ga0466959_0102133_265_1095 227
120 3300046517 Ga0495630_0360397 Ga0495630_0360397_66_962 227
121 3300048903 Ga0496100_0040778 Ga0496100_0040778_1777_2667 227
122 3300048918 Ga0496115_0149297 Ga0496115_0149297_744_1634 227
123 3300005434 Ga0070709_10099374 Ga0070709_100993742 230
124 3300005435 Ga0070714_100177646 Ga0070714_1001776462 230
125 3300005436 Ga0070713_100173060 Ga0070713_1001730602 230
126 3300005437 Ga0070710_10067800 Ga0070710_100678002 230
127 3300005439 Ga0070711_100276269 Ga0070711_1002762691 230
128 3300006028 Ga0070717_10346515 Ga0070717_103465152 230
129 3300006163 Ga0070715_10013346 Ga0070715_100133462 230
130 3300006173 Ga0070716_100081178 Ga0070716_1000811782 230
131 3300025898 Ga0207692_10004364 Ga0207692_100043646 230
132 3300025905 Ga0207685_10014795 Ga0207685_100147952 230
133 3300025906 Ga0207699_10090248 Ga0207699_100902482 230
134 3300025915 Ga0207693_10145038 Ga0207693_101450382 230
135 3300025916 Ga0207663_10045372 Ga0207663_100453722 230
136 3300025928 Ga0207700_10069497 Ga0207700_100694972 230
137 3300025929 Ga0207664_10023594 Ga0207664_100235943 230
138 3300025939 Ga0207665_10115216 Ga0207665_101152162 230
139 3300026078 Ga0207702_10173178 Ga0207702_101731782 230
140 3300026121 Ga0207683_10371498 Ga0207683_103714982 230
141 3300035086 Ga0373934_0053865 Ga0373934_0053865_378_1229 230
142 3300035120 Ga0373957_0058451 Ga0373957_0058451_172_1023 230
143 3300035172 Ga0373955_0010380 Ga0373955_0010380_2292_3143 230
144 3300046462 Ga0495651_0040835 Ga0495651_0040835_843_1694 230
145 3300046463 Ga0495653_0068709 Ga0495653_0068709_1286_2137 230
146 3300046536 Ga0495587_0095139 Ga0495587_0095139_31_882 230
147 3300046559 Ga0495667_0033362 Ga0495667_0033362_786_1637 230
148 3300047322 Ga0495680_0034344 Ga0495680_0034344_2667_3518 230
149 3300047444 Ga0495675_0107570 Ga0495675_0107570_180_1031 230
150 3300047471 Ga0495684_0097573 Ga0495684_0097573_199_1050 230
151 3300048088 Ga0495602_0024707 Ga0495602_0024707_1111_1962 230
152 3300048907 Ga0496104_0224506 Ga0496104_0224506_316_1206 230
153 3300048908 Ga0496105_0189835 Ga0496105_0189835_316_1206 230
154 3300048911 Ga0496108_0105500 Ga0496108_0105500_301_1191 230
155 3300048912 Ga0496109_0335198 Ga0496109_0335198_244_1134 230
156 3300048915 Ga0496112_0036188 Ga0496112_0036188_3444_4334 230
157 3300048917 Ga0496114_0285599 Ga0496114_0285599_299_1189 230
158 3300005434 Ga0070709_10013984 Ga0070709_100139842 232
159 3300005437 Ga0070710_10010458 Ga0070710_100104583 232
160 3300005439 Ga0070711_100012223 Ga0070711_1000122232 232
161 3300006173 Ga0070716_100069817 Ga0070716_1000698172 232
162 3300025906 Ga0207699_10002013 Ga0207699_100020137 232
163 3300025916 Ga0207663_10011449 Ga0207663_100114492 232
164 3300025928 Ga0207700_10122255 Ga0207700_101222552 232
165 3300025929 Ga0207664_10069961 Ga0207664_100699612 232
166 3300025939 Ga0207665_10070146 Ga0207665_100701463 232
167 3300035119 Ga0373956_0002843 Ga0373956_0002843_1668_2519 232
168 3300035172 Ga0373955_0196758 Ga0373955_0196758_298_1149 232
169 3300036401 Ga0373937_0006593 Ga0373937_0006593_4039_4890 232
170 3300046462 Ga0495651_0207439 Ga0495651_0207439_356_1207 232
171 3300046511 Ga0495608_0083617 Ga0495608_0083617_70_921 232
172 3300048088 Ga0495602_0168912 Ga0495602_0168912_59_910 232
173 3300005355 Ga0070671_100090724 Ga0070671_1000907243 233
174 3300005434 Ga0070709_10087492 Ga0070709_100874922 233
175 3300005435 Ga0070714_100326359 Ga0070714_1003263592 233
176 3300025915 Ga0207693_10202479 Ga0207693_102024792 233
177 3300035724 Ga0373933_0063035 Ga0373933_0063035_1206_2024 233
178 3300036401 Ga0373937_0021178 Ga0373937_0021178_4618_5436 233
179 3300046463 Ga0495653_0102003 Ga0495653_0102003_943_1761 233
180 3300046473 Ga0495582_0338028 Ga0495582_0338028_69_815 233
181 3300046477 Ga0495664_0118957 Ga0495664_0118957_401_1219 233
182 3300046516 Ga0495628_0330766 Ga0495628_0330766_169_1011 233
183 3300046529 Ga0495652_0040118 Ga0495652_0040118_2393_3211 233
184 3300046675 Ga0495657_0156406 Ga0495657_0156406_327_1145 233
185 3300047322 Ga0495680_0209314 Ga0495680_0209314_387_1205 233
186 3300048088 Ga0495602_0042039 Ga0495602_0042039_458_1276 233
187 3300048917 Ga0496114_0303938 Ga0496114_0303938_164_982 233
188 3300005841 Ga0068863_100692142 Ga0068863_1006921421 234
189 3300048915 Ga0496112_0459529 Ga0496112_0459529_110_979 234
190 3300005327 Ga0070658_10246953 Ga0070658_102469531 235
191 3300005330 Ga0070690_100163860 Ga0070690_1001638602 235
192 3300005333 Ga0070677_10190406 Ga0070677_101904061 235
193 3300005335 Ga0070666_10073526 Ga0070666_100735263 235
194 3300005339 Ga0070660_100183977 Ga0070660_1001839771 235
195 3300005340 Ga0070689_100090525 Ga0070689_1000905251 235
196 3300005343 Ga0070687_100018464 Ga0070687_1000184642 235
197 3300005356 Ga0070674_100161998 Ga0070674_1001619982 235
198 3300005364 Ga0070673_100047481 Ga0070673_1000474812 235
199 3300005365 Ga0070688_100224395 Ga0070688_1002243951 235
200 3300005366 Ga0070659_100130011 Ga0070659_1001300113 235
201 3300005441 Ga0070700_100041611 Ga0070700_1000416111 235
202 3300005444 Ga0070694_100117670 Ga0070694_1001176702 235
203 3300005455 Ga0070663_100079030 Ga0070663_1000790302 235
204 3300005457 Ga0070662_100058765 Ga0070662_1000587653 235
205 3300005458 Ga0070681_10035795 Ga0070681_100357952 235
206 3300005467 Ga0070706_100491012 Ga0070706_1004910121 235
207 3300005535 Ga0070684_100277689 Ga0070684_1002776892 235
208 3300005539 Ga0068853_100059551 Ga0068853_1000595512 235
209 3300005544 Ga0070686_100099316 Ga0070686_1000993162 235
210 3300005545 Ga0070695_100133801 Ga0070695_1001338012 235
211 3300005546 Ga0070696_100036096 Ga0070696_1000360963 235
212 3300005547 Ga0070693_100045748 Ga0070693_1000457481 235
213 3300005563 Ga0068855_100442921 Ga0068855_1004429212 235
214 3300005564 Ga0070664_100107971 Ga0070664_1001079712 235
215 3300005578 Ga0068854_100325682 Ga0068854_1003256822 235
216 3300005615 Ga0070702_100007313 Ga0070702_1000073132 235
217 3300005617 Ga0068859_100265256 Ga0068859_1002652562 235
218 3300005719 Ga0068861_100186722 Ga0068861_1001867222 235
219 3300005841 Ga0068863_100140133 Ga0068863_1001401332 235
220 3300005842 Ga0068858_100394263 Ga0068858_1003942632 235
221 3300005843 Ga0068860_100038155 Ga0068860_1000381553 235
222 3300006871 Ga0075434_100128530 Ga0075434_1001285302 235
223 3300006931 Ga0097620_100265239 Ga0097620_1002652392 235
224 3300007788 Ga0099795_10034876 Ga0099795_100348763 235
225 3300009011 Ga0105251_10030726 Ga0105251_100307262 235
226 3300009093 Ga0105240_10293906 Ga0105240_102939062 235
227 3300009101 Ga0105247_10074403 Ga0105247_100744032 235
228 3300009148 Ga0105243_10185776 Ga0105243_101857762 235
229 3300009176 Ga0105242_10191874 Ga0105242_101918742 235
230 3300009177 Ga0105248_10206676 Ga0105248_102066761 235
231 3300009545 Ga0105237_10076284 Ga0105237_100762842 235
232 3300012476 Ga0157344_1001748 Ga0157344_10017482 235
233 3300013102 Ga0157371_10098415 Ga0157371_100984152 235
234 3300013104 Ga0157370_10202944 Ga0157370_102029443 235
235 3300013308 Ga0157375_10761197 Ga0157375_107611972 235
236 3300025885 Ga0207653_10016699 Ga0207653_100166993 235
237 3300025898 Ga0207692_10026070 Ga0207692_100260702 235
238 3300025901 Ga0207688_10010495 Ga0207688_100104955 235
239 3300025903 Ga0207680_10320191 Ga0207680_103201912 235
240 3300025904 Ga0207647_10112645 Ga0207647_101126452 235
241 3300025906 Ga0207699_10008123 Ga0207699_100081232 235
242 3300025909 Ga0207705_10250942 Ga0207705_102509422 235
243 3300025912 Ga0207707_10098726 Ga0207707_100987262 235
244 3300025914 Ga0207671_10292723 Ga0207671_102927232 235
245 3300025915 Ga0207693_10089790 Ga0207693_100897902 235
246 3300025918 Ga0207662_10015130 Ga0207662_100151304 235
247 3300025919 Ga0207657_10003200 Ga0207657_100032005 235
248 3300025920 Ga0207649_10016696 Ga0207649_100166962 235
249 3300025928 Ga0207700_10028659 Ga0207700_100286592 235
250 3300025932 Ga0207690_10019520 Ga0207690_100195202 235
251 3300025933 Ga0207706_10012201 Ga0207706_100122013 235
252 3300025936 Ga0207670_10112011 Ga0207670_101120111 235
253 3300025939 Ga0207665_10034619 Ga0207665_100346192 235
254 3300025986 Ga0207658_10116540 Ga0207658_101165402 235
255 3300026041 Ga0207639_10230458 Ga0207639_102304582 235
256 3300026075 Ga0207708_10032974 Ga0207708_100329743 235
257 3300026078 Ga0207702_10221506 Ga0207702_102215062 235
258 3300026116 Ga0207674_10004694 Ga0207674_100046945 235
259 3300026118 Ga0207675_100074065 Ga0207675_1000740653 235
260 3300026121 Ga0207683_10003826 Ga0207683_100038267 235
261 3300034817 Ga0373948_0039466 Ga0373948_0039466_88_912 235
262 3300034820 Ga0373959_0016178 Ga0373959_0016178_89_913 235
263 3300035086 Ga0373934_0057480 Ga0373934_0057480_76_900 235
264 3300035089 Ga0373944_0000478 Ga0373944_0000478_4799_5623 235
265 3300035089 Ga0373944_0077381 Ga0373944_0077381_281_1033 235
266 3300035091 Ga0373951_0025536 Ga0373951_0025536_17_841 235
267 3300035111 Ga0373923_0002363 Ga0373923_0002363_1202_2026 235
268 3300035113 Ga0373936_0001389 Ga0373936_0001389_2289_3113 235
269 3300035116 Ga0373945_0025351 Ga0373945_0025351_30_854 235
270 3300035117 Ga0373953_0028495 Ga0373953_0028495_781_1605 235
271 3300035118 Ga0373954_0015678 Ga0373954_0015678_416_1240 235
272 3300035120 Ga0373957_0003564 Ga0373957_0003564_2967_3791 235
273 3300035170 Ga0373943_0032741 Ga0373943_0032741_1590_2414 235
274 3300035171 Ga0373946_0007296 Ga0373946_0007296_1690_2514 235
275 3300035241 Ga0373961_0068093 Ga0373961_0068093_109_933 235
276 3300035410 Ga0373924_0015077 Ga0373924_0015077_708_1532 235
277 3300035691 Ga0373931_0119194 Ga0373931_0119194_508_1332 235
278 3300035692 Ga0373935_0056401 Ga0373935_0056401_708_1532 235
279 3300035695 Ga0373927_0063242 Ga0373927_0063242_267_1091 235
280 3300035725 Ga0373947_0009158 Ga0373947_0009158_521_1345 235
281 3300046454 Ga0495592_0010718 Ga0495592_0010718_833_1657 235
282 3300046459 Ga0495629_0008393 Ga0495629_0008393_5071_5895 235
283 3300046461 Ga0495641_0007980 Ga0495641_0007980_2175_2999 235
284 3300046472 Ga0495580_0027686 Ga0495580_0027686_3181_4005 235
285 3300046475 Ga0495639_0000320 Ga0495639_0000320_20737_21561 235
286 3300046476 Ga0495662_0002566 Ga0495662_0002566_7899_8723 235
287 3300046477 Ga0495664_0006281 Ga0495664_0006281_3028_3852 235
288 3300046499 Ga0495594_0051741 Ga0495594_0051741_338_1162 235
289 3300046526 Ga0495666_0001809 Ga0495666_0001809_596_1420 235
290 3300046531 Ga0495665_0004183 Ga0495665_0004183_2188_3012 235
291 3300046533 Ga0495640_0007267 Ga0495640_0007267_7828_8652 235
292 3300046536 Ga0495587_0031703 Ga0495587_0031703_2126_2950 235
293 3300046557 Ga0495622_0096476 Ga0495622_0096476_521_1345 235
294 3300046642 Ga0495634_0013714 Ga0495634_0013714_2710_3534 235
295 3300046663 Ga0495635_0008781 Ga0495635_0008781_1189_2013 235
296 3300046675 Ga0495657_0030011 Ga0495657_0030011_1933_2757 235
297 3300046681 Ga0495647_0003056 Ga0495647_0003056_3493_4317 235
298 3300046690 Ga0495624_0009799 Ga0495624_0009799_3971_4795 235
299 3300046809 Ga0495600_0004245 Ga0495600_0004245_3366_4190 235
300 3300047321 Ga0495676_0052961 Ga0495676_0052961_708_1532 235
301 3300047471 Ga0495684_0037960 Ga0495684_0037960_1817_2641 235
302 3300047673 Ga0495593_0007205 Ga0495593_0007205_5073_5897 235
303 3300048089 Ga0495614_0023362 Ga0495614_0023362_18_842 235
304 3300048903 Ga0496100_0222597 Ga0496100_0222597_19_843 235
305 3300048904 Ga0496101_0154937 Ga0496101_0154937_693_1517 235
306 3300048905 Ga0496102_0150527 Ga0496102_0150527_593_1417 235
307 3300048906 Ga0496103_0027084 Ga0496103_0027084_2376_3200 235
308 3300048907 Ga0496104_0035650 Ga0496104_0035650_388_1212 235
309 3300048908 Ga0496105_0054596 Ga0496105_0054596_2176_3000 235
310 3300048909 Ga0496106_0250942 Ga0496106_0250942_82_906 235
311 3300048918 Ga0496115_0234054 Ga0496115_0234054_202_1026 235
312 3300050512 nmdc:mga0n895_291452_c1 nmdc:mga0n895_291452_c1_18_842 235
313 3300050513 nmdc:mga0rr50_55526_c1 nmdc:mga0rr50_55526_c1_169_993 235
314 3300053078 Ga0495612_0016713 Ga0495612_0016713_1143_1967 235
315 3300053085 Ga0495619_0006722 Ga0495619_0006722_1394_2218 235
316 3300005367 Ga0070667_100267977 Ga0070667_1002679772 236
317 3300005468 Ga0070707_100000127 Ga0070707_10000012735 236
318 3300005471 Ga0070698_100001111 Ga0070698_10000111117 236
319 3300020082 Ga0206353_11457304 Ga0206353_114573041 236
320 3300025910 Ga0207684_10001704 Ga0207684_1000170419 236
321 3300025922 Ga0207646_10000264 Ga0207646_1000026431 236
322 3300005467 Ga0070706_100098000 Ga0070706_1000980004 238
323 3300005719 Ga0068861_100235500 Ga0068861_1002355002 238
324 3300013102 Ga0157371_10133227 Ga0157371_101332273 238
325 3300013105 Ga0157369_10011430 Ga0157369_1001143010 238
326 3300013307 Ga0157372_10000880 Ga0157372_1000088036 238
327 3300026118 Ga0207675_100287896 Ga0207675_1002878962 238
328 3300042006 Ga0439432_108905 Ga0439432_108905_27_743 238
329 3300042010 Ga0439452_000029 Ga0439452_000029_68402_69118 238
330 3300048905 Ga0496102_0048291 Ga0496102_0048291_2183_2899 238
331 3300048907 Ga0496104_0624739 Ga0496104_0624739_250_966 238
332 3300048919 Ga0496116_0048578 Ga0496116_0048578_1275_1991 238
333 3300048920 Ga0496117_0008147 Ga0496117_0008147_8108_8824 238
334 3300048920 Ga0496117_0132910 Ga0496117_0132910_686_1402 238
335 3300048921 Ga0496118_0009235 Ga0496118_0009235_8108_8824 238
336 3300048921 Ga0496118_0146260 Ga0496118_0146260_30_746 238
337 3300048922 Ga0496119_0000045 Ga0496119_0000045_132653_133369 238
338 3300048923 Ga0496120_0019025 Ga0496120_0019025_3332_4048 238
339 3300048925 Ga0496122_0068741 Ga0496122_0068741_586_1302 238
340 3300048926 Ga0496123_0058663 Ga0496123_0058663_209_925 238
341 3300048927 Ga0496124_0005426 Ga0496124_0005426_4510_5226 238
342 3300048928 Ga0496125_0048738 Ga0496125_0048738_2266_2982 238
343 3300049459 Ga0495678_011026 Ga0495678_011026_3610_4326 238
344 3300046511 Ga0495608_0050926 Ga0495608_0050926_995_1846 239
345 3300025942 Ga0207689_10003777 Ga0207689_100037777 240
346 3300035725 Ga0373947_0046020 Ga0373947_0046020_1705_2520 240
347 3300046514 Ga0495618_0226890 Ga0495618_0226890_105_1025 240
348 3300046533 Ga0495640_0093850 Ga0495640_0093850_466_1281 240
349 3300046663 Ga0495635_0171289 Ga0495635_0171289_605_1420 240
350 3300046690 Ga0495624_0049025 Ga0495624_0049025_555_1475 240
351 3300047319 Ga0495674_0010705 Ga0495674_0010705_5912_6832 240
352 3300050513 nmdc:mga0rr50_131326_c1 nmdc:mga0rr50_131326_c1_21_866 240
353 3300044683 Ga0466965_0107561 Ga0466965_0107561_62_808 241
354 3300047317 Ga0495604_0023576 Ga0495604_0023576_2726_3577 241
355 3300049823 Ga0501044_0278345 Ga0501044_0278345_146_883 241
356 3300053156 Ga0500622_0009263 Ga0500622_0009263_1275_2003 241
357 3300005434 Ga0070709_10226095 Ga0070709_102260951 243
358 3300005439 Ga0070711_100018699 Ga0070711_1000186992 246
359 3300049571 Ga0501034_0004181 Ga0501034_0004181_11316_12110 251
360 3300049572 Ga0501036_0000170 Ga0501036_0000170_32090_32884 251
361 3300049573 Ga0501037_0004187 Ga0501037_0004187_4526_5320 251
362 3300049574 Ga0501038_0006542 Ga0501038_0006542_8725_9519 251
363 3300049575 Ga0501039_0188459 Ga0501039_0188459_717_1511 251
364 3300049578 Ga0501042_0002573 Ga0501042_0002573_3689_4483 251
365 3300049579 Ga0501043_0000866 Ga0501043_0000866_8167_8961 251
366 3300049581 Ga0501047_0002697 Ga0501047_0002697_11658_12452 251
367 3300049582 Ga0501048_0001538 Ga0501048_0001538_14663_15457 251
368 3300049589 Ga0501073_0027049 Ga0501073_0027049_1261_2055 251
369 3300049590 Ga0501074_0001528 Ga0501074_0001528_8245_9039 251
370 3300049823 Ga0501044_0192161 Ga0501044_0192161_526_1320 251
371 3300025924 Ga0207694_10146342 Ga0207694_101463422 252
372 3300005327 Ga0070658_10000228 Ga0070658_1000022829 253
373 3300005338 Ga0068868_100040999 Ga0068868_1000409992 253
374 3300005366 Ga0070659_100382883 Ga0070659_1003828832 253
375 3300005434 Ga0070709_10141140 Ga0070709_101411402 253
376 3300005435 Ga0070714_100013140 Ga0070714_1000131406 253
377 3300005436 Ga0070713_100023274 Ga0070713_1000232744 253
378 3300005437 Ga0070710_10003256 Ga0070710_100032566 253
379 3300005445 Ga0070708_100002499 Ga0070708_1000024999 253
380 3300005445 Ga0070708_100122769 Ga0070708_1001227692 253
381 3300005467 Ga0070706_100012251 Ga0070706_1000122518 253
382 3300005468 Ga0070707_100005476 Ga0070707_1000054768 253
383 3300005468 Ga0070707_100105675 Ga0070707_1001056753 253
384 3300005468 Ga0070707_100197599 Ga0070707_1001975992 253
385 3300005468 Ga0070707_100238481 Ga0070707_1002384812 253
386 3300005471 Ga0070698_100000597 Ga0070698_10000059738 253
387 3300005471 Ga0070698_100015856 Ga0070698_1000158563 253
388 3300005518 Ga0070699_100211551 Ga0070699_1002115511 253
389 3300005535 Ga0070684_100257898 Ga0070684_1002578981 253
390 3300005536 Ga0070697_100160824 Ga0070697_1001608241 253
391 3300005547 Ga0070693_100267772 Ga0070693_1002677721 253
392 3300005563 Ga0068855_100151405 Ga0068855_1001514052 253
393 3300005577 Ga0068857_100295364 Ga0068857_1002953641 253
394 3300005578 Ga0068854_100375522 Ga0068854_1003755221 253
395 3300005614 Ga0068856_100143534 Ga0068856_1001435342 253
396 3300005618 Ga0068864_100239190 Ga0068864_1002391902 253
397 3300005841 Ga0068863_100174675 Ga0068863_1001746752 253
398 3300006028 Ga0070717_10035786 Ga0070717_100357863 253
399 3300006028 Ga0070717_10089211 Ga0070717_100892112 253
400 3300006028 Ga0070717_10120059 Ga0070717_101200592 253
401 3300006173 Ga0070716_100000033 Ga0070716_10000003313 253
402 3300006173 Ga0070716_100003740 Ga0070716_1000037403 253
403 3300006175 Ga0070712_100013295 Ga0070712_1000132952 253
404 3300006358 Ga0068871_100055167 Ga0068871_1000551673 253
405 3300006871 Ga0075434_100124282 Ga0075434_1001242822 253
406 3300007076 Ga0075435_100080504 Ga0075435_1000805042 253
407 3300007265 Ga0099794_10154508 Ga0099794_101545082 253
408 3300010375 Ga0105239_10044658 Ga0105239_100446582 253
409 3300013296 Ga0157374_10052816 Ga0157374_100528164 253
410 3300014325 Ga0163163_10112678 Ga0163163_101126782 253
411 3300014968 Ga0157379_10259662 Ga0157379_102596621 253
412 3300020069 Ga0197907_11138267 Ga0197907_111382671 253
413 3300020070 Ga0206356_11018721 Ga0206356_110187212 253
414 3300020080 Ga0206350_11235534 Ga0206350_112355342 253
415 3300021388 Ga0213875_10000678 Ga0213875_100006783 253
416 3300022467 Ga0224712_10068754 Ga0224712_100687542 253
417 3300025898 Ga0207692_10012684 Ga0207692_100126843 253
418 3300025905 Ga0207685_10058066 Ga0207685_100580662 253
419 3300025906 Ga0207699_10001401 Ga0207699_100014012 253
420 3300025906 Ga0207699_10044260 Ga0207699_100442602 253
421 3300025909 Ga0207705_10000534 Ga0207705_1000053414 253
422 3300025910 Ga0207684_10094283 Ga0207684_100942831 253
423 3300025910 Ga0207684_10160837 Ga0207684_101608373 253
424 3300025914 Ga0207671_10102092 Ga0207671_101020922 253
425 3300025915 Ga0207693_10010158 Ga0207693_100101583 253
426 3300025916 Ga0207663_10055787 Ga0207663_100557872 253
427 3300025916 Ga0207663_10072922 Ga0207663_100729222 253
428 3300025916 Ga0207663_10166551 Ga0207663_101665512 253
429 3300025922 Ga0207646_10007362 Ga0207646_100073628 253
430 3300025922 Ga0207646_10044705 Ga0207646_100447053 253
431 3300025922 Ga0207646_10127942 Ga0207646_101279422 253
432 3300025922 Ga0207646_10533187 Ga0207646_105331872 253
433 3300025928 Ga0207700_10031683 Ga0207700_100316832 253
434 3300025928 Ga0207700_10092498 Ga0207700_100924982 253
435 3300025928 Ga0207700_10093082 Ga0207700_100930822 253
436 3300025929 Ga0207664_10000276 Ga0207664_1000027636 253
437 3300025929 Ga0207664_10121916 Ga0207664_101219162 253
438 3300025929 Ga0207664_10123763 Ga0207664_101237632 253
439 3300025939 Ga0207665_10000079 Ga0207665_1000007913 253
440 3300025939 Ga0207665_10002232 Ga0207665_100022326 253
441 3300025945 Ga0207679_10187016 Ga0207679_101870162 253
442 3300026023 Ga0207677_10051214 Ga0207677_100512143 253
443 3300026035 Ga0207703_10061543 Ga0207703_100615432 253
444 3300026078 Ga0207702_10082246 Ga0207702_100822462 253
445 3300026088 Ga0207641_10192970 Ga0207641_101929702 253
446 3300026116 Ga0207674_10016544 Ga0207674_100165442 253
447 3300035083 Ga0373926_0063968 Ga0373926_0063968_249_1064 253
448 3300035086 Ga0373934_0005724 Ga0373934_0005724_2378_3184 253
449 3300035086 Ga0373934_0109020 Ga0373934_0109020_271_1086 253
450 3300035089 Ga0373944_0010279 Ga0373944_0010279_499_1314 253
451 3300035111 Ga0373923_0032811 Ga0373923_0032811_373_1179 253
452 3300035113 Ga0373936_0045778 Ga0373936_0045778_926_1741 253
453 3300035113 Ga0373936_0076511 Ga0373936_0076511_517_1323 253
454 3300035117 Ga0373953_0044206 Ga0373953_0044206_873_1679 253
455 3300035118 Ga0373954_0002851 Ga0373954_0002851_3738_4544 253
456 3300035118 Ga0373954_0020254 Ga0373954_0020254_213_1028 253
457 3300035119 Ga0373956_0052098 Ga0373956_0052098_122_928 253
458 3300035120 Ga0373957_0012480 Ga0373957_0012480_1705_2511 253
459 3300035172 Ga0373955_0007242 Ga0373955_0007242_1021_1827 253
460 3300035410 Ga0373924_0004968 Ga0373924_0004968_2329_3135 253
461 3300035410 Ga0373924_0047522 Ga0373924_0047522_938_1753 253
462 3300035692 Ga0373935_0000168 Ga0373935_0000168_17353_18159 253
463 3300035692 Ga0373935_0025642 Ga0373935_0025642_2060_2866 253
464 3300035692 Ga0373935_0056603 Ga0373935_0056603_1171_1986 253
465 3300035695 Ga0373927_0164218 Ga0373927_0164218_39_854 253
466 3300035724 Ga0373933_0013496 Ga0373933_0013496_3186_3992 253
467 3300035725 Ga0373947_0000007 Ga0373947_0000007_94554_95360 253
468 3300035725 Ga0373947_0081182 Ga0373947_0081182_789_1604 253
469 3300035725 Ga0373947_0107054 Ga0373947_0107054_122_946 253
470 3300035725 Ga0373947_0125306 Ga0373947_0125306_183_989 253
471 3300036401 Ga0373937_0142412 Ga0373937_0142412_454_1260 253
472 3300037068 Ga0373925_0074817 Ga0373925_0074817_347_1153 253
473 3300037068 Ga0373925_0124218 Ga0373925_0124218_389_1204 253
474 3300037853 Ga0436364_0287407 Ga0436364_0287407_1749_2549 253
475 3300039438 Ga0436360_1239965 Ga0436360_1239965_381_1187 253
476 3300045976 Ga0466967_0410293 Ga0466967_0410293_111_917 253
477 3300046454 Ga0495592_0059770 Ga0495592_0059770_1340_2146 253
478 3300046455 Ga0495603_0112658 Ga0495603_0112658_322_1137 253
479 3300046459 Ga0495629_0333247 Ga0495629_0333247_167_982 253
480 3300046462 Ga0495651_0051289 Ga0495651_0051289_1979_2794 253
481 3300046463 Ga0495653_0049781 Ga0495653_0049781_353_1159 253
482 3300046475 Ga0495639_0203579 Ga0495639_0203579_115_930 253
483 3300046476 Ga0495662_0040446 Ga0495662_0040446_502_1308 253
484 3300046477 Ga0495664_0028833 Ga0495664_0028833_1354_2160 253
485 3300046477 Ga0495664_0077031 Ga0495664_0077031_664_1479 253
486 3300046511 Ga0495608_0029188 Ga0495608_0029188_2888_3703 253
487 3300046514 Ga0495618_0034967 Ga0495618_0034967_1644_2459 253
488 3300046517 Ga0495630_0046772 Ga0495630_0046772_393_1199 253
489 3300046529 Ga0495652_0069590 Ga0495652_0069590_1229_2044 253
490 3300046529 Ga0495652_0106238 Ga0495652_0106238_1002_1808 253
491 3300046531 Ga0495665_0061954 Ga0495665_0061954_793_1608 253
492 3300046533 Ga0495640_0028735 Ga0495640_0028735_1607_2422 253
493 3300046536 Ga0495587_0005276 Ga0495587_0005276_7239_8054 253
494 3300046536 Ga0495587_0015949 Ga0495587_0015949_457_1263 253
495 3300046543 Ga0495645_0019460 Ga0495645_0019460_1753_2559 253
496 3300046559 Ga0495667_0019274 Ga0495667_0019274_502_1308 253
497 3300046559 Ga0495667_0031395 Ga0495667_0031395_834_1649 253
498 3300046642 Ga0495634_0040494 Ga0495634_0040494_1324_2130 253
499 3300046663 Ga0495635_0028828 Ga0495635_0028828_2063_2869 253
500 3300046663 Ga0495635_0049874 Ga0495635_0049874_1536_2351 253
501 3300046675 Ga0495657_0031045 Ga0495657_0031045_2352_3158 253
502 3300046678 Ga0495599_0016837 Ga0495599_0016837_1990_2796 253
503 3300046678 Ga0495599_0056496 Ga0495599_0056496_1312_2127 253
504 3300046680 Ga0495646_0010149 Ga0495646_0010149_3986_4801 253
505 3300046680 Ga0495646_0023398 Ga0495646_0023398_2021_2827 253
506 3300046689 Ga0495613_0283285 Ga0495613_0283285_242_1057 253
507 3300046690 Ga0495624_0154202 Ga0495624_0154202_128_934 253
508 3300046809 Ga0495600_0027973 Ga0495600_0027973_686_1501 253
509 3300046809 Ga0495600_0138543 Ga0495600_0138543_271_1077 253
510 3300047315 Ga0495581_0063933 Ga0495581_0063933_907_1713 253
511 3300047317 Ga0495604_0013825 Ga0495604_0013825_4286_5092 253
512 3300047322 Ga0495680_0057442 Ga0495680_0057442_1926_2732 253
513 3300047444 Ga0495675_0134404 Ga0495675_0134404_352_1158 253
514 3300047471 Ga0495684_0018097 Ga0495684_0018097_3436_4242 253
515 3300047471 Ga0495684_0050488 Ga0495684_0050488_1049_1864 253
516 3300047673 Ga0495593_0177028 Ga0495593_0177028_15_830 253
517 3300048088 Ga0495602_0101537 Ga0495602_0101537_233_1039 253
518 3300048905 Ga0496102_0212587 Ga0496102_0212587_351_1166 253
519 3300048907 Ga0496104_0130924 Ga0496104_0130924_796_1611 253
520 3300048911 Ga0496108_0008888 Ga0496108_0008888_6453_7268 253
521 3300048912 Ga0496109_0082488 Ga0496109_0082488_559_1374 253
522 3300048913 Ga0496110_0036536 Ga0496110_0036536_1773_2588 253
523 3300048915 Ga0496112_0111966 Ga0496112_0111966_1870_2685 253
524 3300048916 Ga0496113_0328017 Ga0496113_0328017_141_956 253
525 3300049578 Ga0501042_0080873 Ga0501042_0080873_1429_2253 253
526 3300049581 Ga0501047_0574831 Ga0501047_0574831_11_817 253
527 3300053077 Ga0495601_0176533 Ga0495601_0176533_150_965 253
528 3300053078 Ga0495612_0014247 Ga0495612_0014247_2067_2882 253
529 3300053078 Ga0495612_0034327 Ga0495612_0034327_957_1763 253
530 3300053084 Ga0495595_0040092 Ga0495595_0040092_385_1200 253
531 3300053085 Ga0495619_0028350 Ga0495619_0028350_2405_3211 253
532 3300005467 Ga0070706_100045554 Ga0070706_1000455543 255
533 3300005468 Ga0070707_100047143 Ga0070707_1000471433 255
534 3300005471 Ga0070698_100070265 Ga0070698_1000702653 255
535 3300025910 Ga0207684_10051640 Ga0207684_100516402 255
536 3300025922 Ga0207646_10101971 Ga0207646_101019712 255
537 iso_pu_bacteria 2858868258 2858874598 255
538 3300005435 Ga0070714_100006364 Ga0070714_1000063644 256
539 3300005436 Ga0070713_100012739 Ga0070713_1000127394 256
540 3300025912 Ga0207707_10271126 Ga0207707_102711261 256
541 3300025928 Ga0207700_10376132 Ga0207700_103761321 256
542 3300025929 Ga0207664_10009308 Ga0207664_100093083 256
543 3300036401 Ga0373937_0303881 Ga0373937_0303881_601_1422 256
544 3300046543 Ga0495645_0027114 Ga0495645_0027114_817_1749 256
545 3300006173 Ga0070716_100014428 Ga0070716_1000144282 257
546 3300006852 Ga0075433_10056908 Ga0075433_100569085 257
547 3300009094 Ga0111539_10020866 Ga0111539_100208662 257
548 3300009147 Ga0114129_10002251 Ga0114129_1000225120 257
549 3300025939 Ga0207665_10032301 Ga0207665_100323012 257
550 3300027907 Ga0207428_10026486 Ga0207428_100264865 257
551 3300035691 Ga0373931_0110009 Ga0373931_0110009_468_1364 257
552 3300037853 Ga0436364_0416023 Ga0436364_0416023_363_1226 257
553 3300046463 Ga0495653_0061641 Ga0495653_0061641_1047_1865 257
554 3300047471 Ga0495684_0021015 Ga0495684_0021015_1846_2664 257
555 3300050507 nmdc:mga05p37_31168_c1 nmdc:mga05p37_31168_c1_424_1320 257
556 3300050508 nmdc:mga09592_115698_c1 nmdc:mga09592_115698_c1_517_1413 257
557 3300050511 nmdc:mga08y16_181875_c1 nmdc:mga08y16_181875_c1_413_1309 257
558 3300050514 nmdc:mga08x19_162650_c1 nmdc:mga08x19_162650_c1_529_1425 257
559 3300050515 nmdc:mga0a205_69748_c1 nmdc:mga0a205_69748_c1_1930_2826 257
560 3300005435 Ga0070714_100034525 Ga0070714_1000345253 258
561 3300025928 Ga0207700_10189293 Ga0207700_101892931 258
562 3300025929 Ga0207664_10069685 Ga0207664_100696853 258
563 3300037853 Ga0436364_1093265 Ga0436364_1093265_4714_5547 258
564 iso_pu_bacteria 2599185169 2599410420 258
565 iso_pu_bacteria 2600255254 2601523944 258
566 iso_pu_bacteria 2600255255 2601529097 258
567 iso_pu_bacteria 2600255280 2601615932 258
568 iso_pu_bacteria 2600255281 2601620341 258
569 iso_pu_bacteria 2600255287 2601645791 258
570 iso_pu_bacteria 2600255288 2601648743 258
571 iso_pu_bacteria 2600255289 2601653981 258
572 iso_pu_bacteria 2600255290 2601659403 258
573 iso_pu_bacteria 2600255291 2601665399 258
574 iso_pu_bacteria 2600255298 2601698258 258
575 iso_pu_bacteria 2600255299 2601703408 258
576 iso_pu_bacteria 2600255300 2601708435 258
577 iso_pu_bacteria 2600255301 2601713712 258
578 iso_pu_bacteria 2600255302 2601717242 258
579 iso_pu_bacteria 2600255303 2601721974 258
580 iso_pu_bacteria 2600255304 2601724599 258
581 iso_pu_bacteria 2600255305 2601731879 258
582 iso_pu_bacteria 2600255306 2601738489 258
583 iso_pu_bacteria 2600255307 2601742819 258
584 iso_pu_bacteria 2600255309 2601751807 258
585 iso_pu_bacteria 2600255392 2602020297 258
586 iso_pu_bacteria 2602042052 2603663521 258
587 iso_pu_bacteria 2602042053 2603668133 258
588 iso_pu_bacteria 2602042103 2603839594 258
589 iso_pu_bacteria 2602042104 2603844357 258
590 iso_pu_bacteria 2602042105 2603849743 258
591 iso_pu_bacteria 2602042106 2603854811 258
592 iso_pu_bacteria 2602042110 2603869776 258
593 iso_pu_bacteria 2602042111 2603878886 258
594 iso_pu_bacteria 2603880178 2606046961 258
595 iso_pu_bacteria 2603880184 2606072555 258
596 iso_pu_bacteria 2603880202 2606146531 258
597 iso_pu_bacteria 2603880211 2606177459 258
598 iso_pu_bacteria 2675903046 2676407359 258
599 iso_pu_bacteria 2895427314 2895430933 258
600 iso_pu_bacteria 2904504865 2904505563 258
601 3300005435 Ga0070714_100189200 Ga0070714_1001892002 259
602 3300005435 Ga0070714_100250862 Ga0070714_1002508622 259
603 3300005435 Ga0070714_100373752 Ga0070714_1003737521 259
604 3300006028 Ga0070717_10280615 Ga0070717_102806152 259
605 3300009098 Ga0105245_10341041 Ga0105245_103410412 259
606 3300009551 Ga0105238_10337601 Ga0105238_103376011 259
607 3300021388 Ga0213875_10007236 Ga0213875_100072363 259
608 3300025898 Ga0207692_10130167 Ga0207692_101301672 259
609 3300025929 Ga0207664_10053935 Ga0207664_100539351 259
610 3300025929 Ga0207664_10069729 Ga0207664_100697292 259
611 3300035086 Ga0373934_0013165 Ga0373934_0013165_1749_2573 259
612 3300035113 Ga0373936_0021800 Ga0373936_0021800_1063_1887 259
613 3300035116 Ga0373945_0002843 Ga0373945_0002843_1902_2771 259
614 3300035118 Ga0373954_0064136 Ga0373954_0064136_761_1585 259
615 3300035170 Ga0373943_0001717 Ga0373943_0001717_291_1160 259
616 3300035171 Ga0373946_0001997 Ga0373946_0001997_6099_6968 259
617 3300035172 Ga0373955_0126639 Ga0373955_0126639_191_1060 259
618 3300035692 Ga0373935_0008796 Ga0373935_0008796_4633_5502 259
619 3300035695 Ga0373927_0005960 Ga0373927_0005960_2353_3222 259
620 3300035724 Ga0373933_0165734 Ga0373933_0165734_296_1120 259
621 3300035725 Ga0373947_0000631 Ga0373947_0000631_8836_9705 259
622 3300036401 Ga0373937_0360588 Ga0373937_0360588_501_1325 259
623 3300036401 Ga0373937_0465673 Ga0373937_0465673_137_1006 259
624 3300037068 Ga0373925_0029398 Ga0373925_0029398_2914_3783 259
625 3300037068 Ga0373925_0256210 Ga0373925_0256210_338_1162 259
626 3300037853 Ga0436364_0645051 Ga0436364_0645051_6405_7229 259
627 3300039450 Ga0436363_1047826 Ga0436363_1047826_656_1480 259
628 3300046454 Ga0495592_0166426 Ga0495592_0166426_653_1477 259
629 3300046461 Ga0495641_0060568 Ga0495641_0060568_709_1578 259
630 3300046462 Ga0495651_0064398 Ga0495651_0064398_1142_1966 259
631 3300046462 Ga0495651_0235536 Ga0495651_0235536_162_1031 259
632 3300046463 Ga0495653_0009353 Ga0495653_0009353_1415_2284 259
633 3300046463 Ga0495653_0016076 Ga0495653_0016076_4187_5011 259
634 3300046476 Ga0495662_0004176 Ga0495662_0004176_6121_6990 259
635 3300046477 Ga0495664_0000448 Ga0495664_0000448_11265_12134 259
636 3300046511 Ga0495608_0096678 Ga0495608_0096678_807_1676 259
637 3300046511 Ga0495608_0224496 Ga0495608_0224496_234_1058 259
638 3300046517 Ga0495630_0003650 Ga0495630_0003650_7029_7898 259
639 3300046529 Ga0495652_0033870 Ga0495652_0033870_401_1270 259
640 3300046533 Ga0495640_0051727 Ga0495640_0051727_1769_2638 259
641 3300046559 Ga0495667_0013554 Ga0495667_0013554_2771_3640 259
642 3300046559 Ga0495667_0017159 Ga0495667_0017159_2166_2990 259
643 3300046642 Ga0495634_0093688 Ga0495634_0093688_616_1485 259
644 3300046663 Ga0495635_0007650 Ga0495635_0007650_3486_4310 259
645 3300046663 Ga0495635_0027823 Ga0495635_0027823_263_1132 259
646 3300046675 Ga0495657_0031256 Ga0495657_0031256_2787_3656 259
647 3300046675 Ga0495657_0038661 Ga0495657_0038661_167_991 259
648 3300046678 Ga0495599_0022142 Ga0495599_0022142_1343_2212 259
649 3300046690 Ga0495624_0001756 Ga0495624_0001756_14673_15542 259
650 3300047315 Ga0495581_0159974 Ga0495581_0159974_85_954 259
651 3300047319 Ga0495674_0007792 Ga0495674_0007792_9121_9990 259
652 3300047321 Ga0495676_0021929 Ga0495676_0021929_3853_4722 259
653 3300047322 Ga0495680_0006193 Ga0495680_0006193_2897_3721 259
654 3300047322 Ga0495680_0023422 Ga0495680_0023422_4061_4930 259
655 3300047444 Ga0495675_0312110 Ga0495675_0312110_60_884 259
656 3300047471 Ga0495684_0012825 Ga0495684_0012825_5345_6214 259
657 3300047471 Ga0495684_0161727 Ga0495684_0161727_631_1455 259
658 3300048088 Ga0495602_0022179 Ga0495602_0022179_5088_5912 259
659 iso_pu_bacteria 2844528606 2844532108 259
660 iso_pu_bacteria 2847085930 2847088581 259
661 iso_pu_bacteria 2865014394 2865017795 259
662 iso_pu_bacteria 2945951305 2945953870 259
663 iso_pu_bacteria 2990088156 2990091522 259
664 3300013307 Ga0157372_10367631 Ga0157372_103676311 260
665 3300028563 Ga0265319_1001112 Ga0265319_10011124 260
666 3300028573 Ga0265334_10001022 Ga0265334_100010224 260
667 3300028577 Ga0265318_10008929 Ga0265318_100089293 260
668 3300028666 Ga0265336_10007499 Ga0265336_100074993 260
669 3300028800 Ga0265338_10000315 Ga0265338_1000031570 260
670 3300029957 Ga0265324_10001954 Ga0265324_1000195413 260
671 3300031238 Ga0265332_10001756 Ga0265332_100017562 260
672 3300031240 Ga0265320_10001056 Ga0265320_1000105612 260
673 3300031247 Ga0265340_10002199 Ga0265340_100021993 260
674 3300031344 Ga0265316_10007428 Ga0265316_100074287 260
675 3300031711 Ga0265314_10006818 Ga0265314_100068182 260
676 3300031712 Ga0265342_10000413 Ga0265342_1000041321 260
677 3300048919 Ga0496116_0024816 Ga0496116_0024816_2169_2951 260
678 3300048922 Ga0496119_0023253 Ga0496119_0023253_2529_3311 260
679 3300048923 Ga0496120_0000407 Ga0496120_0000407_11103_11885 260
680 3300048927 Ga0496124_0001570 Ga0496124_0001570_10914_11696 260
681 iso_pu_bacteria 2511231025 2511379298 260
682 iso_pu_bacteria 2511231035 2511436166 260
683 iso_pu_bacteria 2802429637 2806073408 260
684 iso_pu_bacteria 2876601092 2876602782 260
685 iso_pu_bacteria 2939602548 2939602944 260
686 iso_pu_bacteria 8016733728 8016736774 260
687 iso_pu_bacteria 8019499862 8019502008 260
688 iso_pu_bacteria 2537561728 2538426419 261
689 iso_pu_bacteria 2599185299 2599927209 261
690 iso_pu_bacteria 2648501693 2650896277 261
691 iso_pu_bacteria 2684622997 2686352549 261
692 iso_pu_bacteria 2808606414 2809124748 261
693 iso_pu_bacteria 2847797336 2847800774 261
694 iso_pu_bacteria 2855195626 2855198057 261
695 iso_pu_bacteria 2858466076 2858466618 261
696 iso_pu_bacteria 2871272651 2871273391 261
697 iso_pu_bacteria 2871282230 2871282966 261
698 iso_pu_bacteria 2881609920 2881614096 261
699 iso_pu_bacteria 2900051742 2900054616 261
700 iso_pu_bacteria 2904434214 2904437318 261
701 iso_pu_bacteria 2905926851 2905930677 261
702 iso_pu_bacteria 2908669403 2908671053 261
703 iso_pu_bacteria 2912757875 2912760075 261
704 iso_pu_bacteria 2946003308 2946006799 261
705 iso_pu_bacteria 2984494565 2984495766 261
706 iso_pu_bacteria 2990261002 2990262455 261
707 iso_pu_bacteria 8004021418 8004022637 261
708 iso_pu_bacteria 8004025490 8004026350 261
709 3300003763 Ga0055529_1002427 Ga0055529_10024274 262
710 3300003781 Ga0055536_1011284 Ga0055536_10112843 262
711 3300005347 Ga0070668_100010302 Ga0070668_1000103023 262
712 3300005457 Ga0070662_100029335 Ga0070662_1000293352 262
713 3300009036 Ga0105244_10009637 Ga0105244_100096375 262
714 3300009092 Ga0105250_10000003 Ga0105250_10000003365 262
715 3300009092 Ga0105250_10000255 Ga0105250_1000025535 262
716 3300009148 Ga0105243_10015921 Ga0105243_100159215 262
717 3300015261 Ga0182006_1004488 Ga0182006_10044883 262
718 3300015262 Ga0182007_10011714 Ga0182007_100117142 262
719 3300017792 Ga0163161_10358412 Ga0163161_103584122 262
720 3300025272 Ga0209455_1000688 Ga0209455_100068813 262
721 3300025292 Ga0209676_1000026 Ga0209676_1000026406 262
722 3300025298 Ga0209050_1004960 Ga0209050_100496010 262
723 3300025711 Ga0207696_1000004 Ga0207696_1000004268 262
724 3300025711 Ga0207696_1000007 Ga0207696_100000764 262
725 3300025711 Ga0207696_1000749 Ga0207696_10007499 262
726 3300025728 Ga0207655_1011312 Ga0207655_10113124 262
727 3300025735 Ga0207713_1066086 Ga0207713_10660862 262
728 3300025933 Ga0207706_10015746 Ga0207706_100157462 262
729 3300025935 Ga0207709_10014250 Ga0207709_100142504 262
730 3300025972 Ga0207668_10152931 Ga0207668_101529312 262
731 3300030500 Ga0268256_1003310 Ga0268256_10033105 262
732 3300041405 Ga0439438_012054 Ga0439438_012054_80_871 262
733 3300041407 Ga0439447_007745 Ga0439447_007745_2201_2992 262
734 3300041411 Ga0439466_0000003 Ga0439466_0000003_470167_470958 262
735 3300042439 Ga0439464_0000630 Ga0439464_0000630_5032_5823 262
736 3300046492 Ga0495585_0010040 Ga0495585_0010040_3918_4709 262
737 3300046500 Ga0495596_0049964 Ga0495596_0049964_57_848 262
738 3300046810 Ga0495660_0010971 Ga0495660_0010971_121_912 262
739 3300047320 Ga0495672_0000012 Ga0495672_0000012_51029_51820 262
740 3300047446 Ga0495679_007102 Ga0495679_007102_3308_4099 262
741 3300047470 Ga0495681_0010484 Ga0495681_0010484_2012_2800 262
742 3300048908 Ga0496105_0000685 Ga0496105_0000685_228_1019 262
743 3300048919 Ga0496116_0252864 Ga0496116_0252864_71_862 262
744 3300048920 Ga0496117_0000180 Ga0496117_0000180_86657_87448 262
745 3300048921 Ga0496118_0000247 Ga0496118_0000247_38927_39718 262
746 3300048921 Ga0496118_0002990 Ga0496118_0002990_5218_6006 262
747 3300048921 Ga0496118_0016504 Ga0496118_0016504_2907_3698 262
748 3300048922 Ga0496119_0000043 Ga0496119_0000043_165052_165840 262
749 3300048922 Ga0496119_0000178 Ga0496119_0000178_59988_60779 262
750 3300048922 Ga0496119_0000650 Ga0496119_0000650_8473_9264 262
751 3300048923 Ga0496120_0000459 Ga0496120_0000459_35068_35859 262
752 3300048923 Ga0496120_0000894 Ga0496120_0000894_37156_37947 262
753 3300048924 Ga0496121_0000967 Ga0496121_0000967_1697_2488 262
754 3300048925 Ga0496122_0112495 Ga0496122_0112495_700_1491 262
755 3300048926 Ga0496123_0051276 Ga0496123_0051276_602_1393 262
756 3300048927 Ga0496124_0000463 Ga0496124_0000463_7428_8219 262
757 3300048927 Ga0496124_0022087 Ga0496124_0022087_3188_3979 262
758 3300048928 Ga0496125_0094002 Ga0496125_0094002_71_862 262
759 3300048928 Ga0496125_0149596 Ga0496125_0149596_61_849 262
760 3300048929 Ga0496126_0084761 Ga0496126_0084761_789_1577 262
761 3300048929 Ga0496126_0202904 Ga0496126_0202904_334_1125 262
762 3300049822 Ga0501035_0007966 Ga0501035_0007966_1389_2180 262
763 3300049822 Ga0501035_0019914 Ga0501035_0019914_3761_4591 262
764 3300049823 Ga0501044_0018809 Ga0501044_0018809_277_1107 262
765 3300053136 Ga0500559_0143431 Ga0500559_0143431_148_936 262
766 3300031616 Ga0307508_10203997 Ga0307508_102039972 263
767 3300044842 Ga0466957_0120956 Ga0466957_0120956_202_1014 263
768 3300049571 Ga0501034_0521419 Ga0501034_0521419_101_904 263
769 3300053153 Ga0500616_0128529 Ga0500616_0128529_363_1163 263
770 iso_pu_bacteria 2990088156 2990090323 263
771 3300002739 JGI25158J39367_1002551 JGI25158J39367_10025512 264
772 3300002987 JGI25159J45721_1000026 JGI25159J45721_100002631 264
773 3300003354 JGI25160J50197_1000013 JGI25160J50197_100001333 264
774 3300003374 JGI25161J50226_1000926 JGI25161J50226_100092611 264
775 3300003856 Ga0058692_1001321 Ga0058692_10013217 264
776 3300003856 Ga0058692_1003259 Ga0058692_10032595 264
777 3300003856 Ga0058692_1005996 Ga0058692_10059964 264
778 3300004625 Ga0055543_1000132 Ga0055543_100013232 264
779 3300005262 Ga0065165_1000021 Ga0065165_100002133 264
780 3300005548 Ga0070665_100800828 Ga0070665_1008008281 264
781 3300006353 Ga0075370_10196546 Ga0075370_101965461 264
782 3300009036 Ga0105244_10003529 Ga0105244_1000352911 264
783 3300009036 Ga0105244_10007132 Ga0105244_100071326 264
784 3300009036 Ga0105244_10058879 Ga0105244_100588792 264
785 3300009092 Ga0105250_10008174 Ga0105250_100081743 264
786 3300011119 Ga0105246_10056693 Ga0105246_100566932 264
787 3300013100 Ga0157373_10001089 Ga0157373_1000108917 264
788 3300013102 Ga0157371_10044825 Ga0157371_100448252 264
789 3300013307 Ga0157372_10144281 Ga0157372_101442813 264
790 3300025208 Ga0209436_100024 Ga0209436_10002476 264
791 3300025284 Ga0209130_1000039 Ga0209130_1000039225 264
792 3300025302 Ga0207426_1000099 Ga0207426_1000099225 264
793 3300025711 Ga0207696_1000525 Ga0207696_10005256 264
794 3300025728 Ga0207655_1000023 Ga0207655_1000023238 264
795 3300025728 Ga0207655_1002562 Ga0207655_100256212 264
796 3300027312 Ga0209371_1000010 Ga0209371_1000010602 264
797 3300027312 Ga0209371_1000270 Ga0209371_10002705 264
798 3300027312 Ga0209371_1000273 Ga0209371_100027340 264
799 3300027312 Ga0209371_1003951 Ga0209371_10039516 264
800 3300027312 Ga0209371_1004826 Ga0209371_10048262 264
801 3300030500 Ga0268256_1000022 Ga0268256_1000022262 264
802 3300030500 Ga0268256_1000229 Ga0268256_100022940 264
803 3300030500 Ga0268256_1003665 Ga0268256_10036656 264
804 3300030500 Ga0268256_1005127 Ga0268256_10051275 264
805 3300046452 Ga0495617_010813 Ga0495617_010813_2034_2828 264
806 3300046458 Ga0495591_000094 Ga0495591_000094_46414_47208 264
807 3300046458 Ga0495591_003750 Ga0495591_003750_6363_7157 264
808 3300046471 Ga0495650_0000033 Ga0495650_0000033_82593_83387 264
809 3300046491 Ga0495584_0016303 Ga0495584_0016303_1596_2390 264
810 3300046501 Ga0495607_0007504 Ga0495607_0007504_4629_5423 264
811 3300046507 Ga0495606_0000619 Ga0495606_0000619_38195_38989 264
812 3300046513 Ga0495616_0009885 Ga0495616_0009885_501_1295 264
813 3300046523 Ga0495644_0001575 Ga0495644_0001575_1576_2370 264
814 3300046524 Ga0495648_0001078 Ga0495648_0001078_20918_21712 264
815 3300046530 Ga0495654_0000078 Ga0495654_0000078_68176_68970 264
816 3300046530 Ga0495654_0000572 Ga0495654_0000572_24853_25647 264
817 3300046694 Ga0495649_0003646 Ga0495649_0003646_2271_3065 264
818 3300046810 Ga0495660_0000011 Ga0495660_0000011_343588_344382 264
819 3300047320 Ga0495672_0000004 Ga0495672_0000004_237575_238369 264
820 3300047321 Ga0495676_0168764 Ga0495676_0168764_226_1020 264
821 3300047323 Ga0495683_0012720 Ga0495683_0012720_602_1396 264
822 3300047323 Ga0495683_0046086 Ga0495683_0046086_481_1275 264
823 3300047469 Ga0495673_0000023 Ga0495673_0000023_153580_154374 264
824 3300048904 Ga0496101_0000029 Ga0496101_0000029_127422_128216 264
825 3300048923 Ga0496120_0000346 Ga0496120_0000346_6838_7632 264
826 3300048924 Ga0496121_0009019 Ga0496121_0009019_5217_6026 264
827 3300048925 Ga0496122_0006878 Ga0496122_0006878_2014_2808 264
828 3300048926 Ga0496123_0003607 Ga0496123_0003607_14340_15134 264
829 3300048927 Ga0496124_0050436 Ga0496124_0050436_336_1130 264
830 3300048927 Ga0496124_0060607 Ga0496124_0060607_1291_2085 264
831 3300048927 Ga0496124_0148026 Ga0496124_0148026_525_1334 264
832 3300048929 Ga0496126_0002412 Ga0496126_0002412_12959_13768 264
833 3300048929 Ga0496126_0099670 Ga0496126_0099670_1021_1815 264
834 3300049459 Ga0495678_000415 Ga0495678_000415_15207_16001 264
835 3300049460 Ga0495682_0000004 Ga0495682_0000004_339347_340141 264
836 3300050494 nmdc:mga06z11_205501_c1 nmdc:mga06z11_205501_c1_299_1108 264
837 3300050496 nmdc:mga07m45_191881_c1 nmdc:mga07m45_191881_c1_33_842 264
838 3300053126 Ga0500621_000001 Ga0500621_000001_427630_428424 264
839 2010549000 RicEn_C7199 RicEn_127190 265
840 3300001989 JGI24739J22299_10003841 JGI24739J22299_100038417 265
841 3300003856 Ga0058692_1000074 Ga0058692_100007482 265
842 3300005563 Ga0068855_100012535 Ga0068855_1000125353 265
843 3300005578 Ga0068854_100258875 Ga0068854_1002588752 265
844 3300006163 Ga0070715_10019017 Ga0070715_100190173 265
845 3300009036 Ga0105244_10000006 Ga0105244_10000006206 265
846 3300009036 Ga0105244_10000289 Ga0105244_1000028953 265
847 3300009093 Ga0105240_10062261 Ga0105240_100622611 265
848 3300013100 Ga0157373_10009629 Ga0157373_100096298 265
849 3300013100 Ga0157373_10033991 Ga0157373_100339914 265
850 3300013102 Ga0157371_10002939 Ga0157371_100029394 265
851 3300013104 Ga0157370_10000320 Ga0157370_1000032018 265
852 3300013104 Ga0157370_10002483 Ga0157370_100024831 265
853 3300013104 Ga0157370_10012210 Ga0157370_100122105 265
854 3300015261 Ga0182006_1027933 Ga0182006_10279331 265
855 3300021384 Ga0213876_10006391 Ga0213876_100063911 265
856 3300025728 Ga0207655_1000040 Ga0207655_1000040243 265
857 3300025728 Ga0207655_1013688 Ga0207655_10136882 265
858 3300025905 Ga0207685_10010853 Ga0207685_100108533 265
859 3300025913 Ga0207695_10017654 Ga0207695_100176545 265
860 3300027312 Ga0209371_1000170 Ga0209371_10001703 265
861 3300030500 Ga0268256_1000142 Ga0268256_1000142104 265
862 3300033545 Ga0316214_1002703 Ga0316214_10027033 265
863 3300033547 Ga0316212_1001409 Ga0316212_10014093 265
864 3300036459 Ga0372808_005086 Ga0372808_005086_819_1676 265
865 3300037853 Ga0436364_1549559 Ga0436364_1549559_6689_7510 265
866 3300038443 Ga0395901_0070679 Ga0395901_0070679_2046_2948 265
867 3300039437 Ga0436365_0528481 Ga0436365_0528481_26529_27350 265
868 3300041405 Ga0439438_000001 Ga0439438_000001_62118_62915 265
869 3300041407 Ga0439447_001587 Ga0439447_001587_2500_3297 265
870 3300042006 Ga0439432_006224 Ga0439432_006224_1466_2263 265
871 3300042010 Ga0439452_000001 Ga0439452_000001_2289_3086 265
872 3300044735 Ga0466968_0130979 Ga0466968_0130979_21_827 265
873 3300044765 Ga0466970_0214549 Ga0466970_0214549_75_884 265
874 3300048919 Ga0496116_0000579 Ga0496116_0000579_15685_16488 265
875 3300048919 Ga0496116_0001066 Ga0496116_0001066_25707_26504 265
876 3300048920 Ga0496117_0000644 Ga0496117_0000644_2282_3079 265
877 3300048921 Ga0496118_0014808 Ga0496118_0014808_4189_4986 265
878 3300048922 Ga0496119_0001482 Ga0496119_0001482_24336_25139 265
879 3300048923 Ga0496120_0000043 Ga0496120_0000043_77112_77915 265
880 3300048927 Ga0496124_0070201 Ga0496124_0070201_1800_2597 265
881 3300049571 Ga0501034_0023236 Ga0501034_0023236_2371_3180 265
882 3300049572 Ga0501036_0007170 Ga0501036_0007170_3625_4434 265
883 3300049573 Ga0501037_0027151 Ga0501037_0027151_2988_3797 265
884 3300049574 Ga0501038_0034960 Ga0501038_0034960_1591_2400 265
885 3300049575 Ga0501039_0078463 Ga0501039_0078463_1251_2060 265
886 3300049579 Ga0501043_0007870 Ga0501043_0007870_6525_7334 265
887 3300049581 Ga0501047_0006312 Ga0501047_0006312_5058_5867 265
888 3300049581 Ga0501047_0076774 Ga0501047_0076774_577_1386 265
889 3300049582 Ga0501048_0003280 Ga0501048_0003280_433_1242 265
890 3300049589 Ga0501073_0015818 Ga0501073_0015818_387_1196 265
891 3300049590 Ga0501074_0001673 Ga0501074_0001673_5201_6010 265
892 iso_pu_bacteria 2852103415 2852103728 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

39

289

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hg3-assembly2.cif.gz_D structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate 0.9415 2 255
4hg5-assembly1.cif.gz_C structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate 0.9401 2 255
4hgd-assembly1.cif.gz_D structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand 0.9397 2 255
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.9388 2 255
4h5u-assembly2.cif.gz_B structural insights into yeast nit2: wild-type yeast nit2 0.9382 2 255
ID Description Score Start End Superfamily
af_P0DP64_2_182_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.986 77 257 3.60.110.10
af_P0DP64_2_182_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9806 77 257 3.60.110.10
af_O94660_4_273_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9594 4 250 3.60.110.10
af_O76463_1_291_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9563 2 255 3.60.110.10
af_Q557J5_4_291_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9522 2 254 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A7H4NNH8-F1-model_v4 deleted 0.998 140 261
AF-A0A348HH99-F1-model_v4 Predicted amidohydrolase 0.9973 1 262 GO:0016787
AF-A0A378DIL0-F1-model_v4 deleted 0.9941 126 261
AF-A0A847KSQ6-F1-model_v4 deleted 0.9937 1 237
AF-A0A317PXZ4-F1-model_v4 Putative amidohydrolase 0.9927 1 262 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.57 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map