F484932

General Info

Members Datasets Scaffolds Average Seq Length
894 309 893 102

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_102022094|Ga0070674_1020220941
Length 104
Sequence MRSLVWLFRAAVFFVLFAFALNNREEATIHWFFDQAWRAPMVLIVLAAFGLGCAFGIFAMVPSWWRQRRLSRNRMRRASDKAAVSTPLAPVSGNAELHPPRDGL

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
212 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
213 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
216 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
217 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
218 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
264 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
270 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
271 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
272 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
273 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
276 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
277 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
292 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
293 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
294 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
295 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
296 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
297 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
298 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
301 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
302 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
303 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
304 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
305 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
306 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
309 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.03
Nodule 0
Rhizoplane 4.14
Rhizosphere 87.36
Stem 0
Stem Tuber 0
Unclassified 4.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10058793 3300005327 Bacteria 3130
2 Ga0070658_10336488 3300005327 Bacteria 1291
3 Ga0070676_10019591 3300005328 Bacteria 3767
4 Ga0070676_10047823 3300005328 Bacteria 2499
5 Ga0070676_10065683 3300005328 Bacteria 2167
6 Ga0070676_10184425 3300005328 Bacteria 1359
7 Ga0070676_10498903 3300005328 Bacteria 864
8 Ga0070683_100033736 3300005329 Bacteria 4669
9 Ga0070690_100054342 3300005330 Bacteria 2563
10 Ga0070690_100133536 3300005330 Bacteria 1678
11 Ga0070690_100321216 3300005330 Bacteria 1115
12 Ga0070670_100002048 3300005331 Bacteria 16500
13 Ga0070670_100027077 3300005331 Bacteria 4930
14 Ga0070670_100048945 3300005331 Bacteria 3636
15 Ga0070670_100056760 3300005331 Bacteria 3361
16 Ga0070670_100069450 3300005331 Bacteria 3024
17 Ga0070670_100088528 3300005331 Bacteria 2661
18 Ga0070670_100112972 3300005331 Bacteria 2341
19 Ga0070670_100579613 3300005331 Bacteria 1002
20 Ga0070670_100597115 3300005331 Bacteria 988
21 Ga0070670_100774365 3300005331 Bacteria 865
22 Ga0070670_100832159 3300005331 Bacteria 835
23 Ga0070670_100892644 3300005331 Bacteria 805
24 Ga0070677_10010108 3300005333 Bacteria 3217
25 Ga0070677_10026730 3300005333 Bacteria 2166
26 Ga0070677_10031430 3300005333 Bacteria 2029
27 Ga0070677_10084808 3300005333 Bacteria 1364
28 Ga0070677_10243698 3300005333 Bacteria 888
29 Ga0070677_10299493 3300005333 Bacteria 817
30 Ga0070677_10482866 3300005333 Bacteria 669
31 Ga0070677_10503645 3300005333 Bacteria 657
32 Ga0068869_100012173 3300005334 Bacteria 5674
33 Ga0068869_100017070 3300005334 Bacteria 4911
34 Ga0068869_100025577 3300005334 Bacteria 4100
35 Ga0068869_100091609 3300005334 Bacteria 2287
36 Ga0070666_10074189 3300005335 Bacteria 2318
37 Ga0070666_10129261 3300005335 Bacteria 1754
38 Ga0070666_10277513 3300005335 Bacteria 1191
39 Ga0070666_10300236 3300005335 Bacteria 1143
40 Ga0070666_10827474 3300005335 Bacteria 683
41 Ga0070680_100009759 3300005336 Bacteria 7389
42 Ga0070682_100199716 3300005337 Bacteria 1410
43 Ga0068868_100010644 3300005338 Bacteria 6666
44 Ga0068868_100018750 3300005338 Bacteria 5176
45 Ga0068868_100031049 3300005338 Bacteria 4100
46 Ga0068868_100053087 3300005338 Bacteria 3193
47 Ga0068868_100627762 3300005338 Bacteria 954
48 Ga0068868_100680352 3300005338 Bacteria 919
49 Ga0070660_100832667 3300005339 Bacteria 777
50 Ga0070660_100857877 3300005339 Bacteria 765
51 Ga0070689_100242167 3300005340 Bacteria 1486
52 Ga0070689_100284221 3300005340 Bacteria 1373
53 Ga0070689_100525160 3300005340 Bacteria 1017
54 Ga0070689_101049450 3300005340 Bacteria 727
55 Ga0070689_101116316 3300005340 Bacteria 705
56 Ga0070687_100045771 3300005343 Bacteria 2236
57 Ga0070687_100258931 3300005343 Bacteria 1085
58 Ga0070687_100426997 3300005343 Bacteria 876
59 Ga0070687_100975239 3300005343 Bacteria 613
60 Ga0070661_100627784 3300005344 Bacteria 870
61 Ga0070661_101243292 3300005344 Bacteria 624
62 Ga0070692_10958293 3300005345 Bacteria 595
63 Ga0070692_10964935 3300005345 Bacteria 594
64 Ga0070668_100007413 3300005347 Bacteria 8142
65 Ga0070668_100509589 3300005347 Bacteria 1043
66 Ga0070668_100520932 3300005347 Bacteria 1032
67 Ga0070668_101221492 3300005347 Bacteria 681
68 Ga0070669_100005073 3300005353 Bacteria 9516
69 Ga0070669_100033288 3300005353 Bacteria 3727
70 Ga0070669_100037703 3300005353 Bacteria 3507
71 Ga0070669_101159185 3300005353 Bacteria 667
72 Ga0070669_101206703 3300005353 Bacteria 654
73 Ga0070669_101818049 3300005353 Bacteria 532
74 Ga0070675_100003224 3300005354 Bacteria 12360
75 Ga0070675_100012448 3300005354 Bacteria 6665
76 Ga0070675_100031950 3300005354 Bacteria 4257
77 Ga0070675_100037552 3300005354 Bacteria 3946
78 Ga0070675_100060803 3300005354 Bacteria 3118
79 Ga0070675_100086553 3300005354 Bacteria 2619
80 Ga0070675_100299381 3300005354 Bacteria 1417
81 Ga0070675_100477909 3300005354 Bacteria 1120
82 Ga0070675_100499962 3300005354 Bacteria 1095
83 Ga0070675_100734153 3300005354 Bacteria 900
84 Ga0070675_100782719 3300005354 Bacteria 871
85 Ga0070671_100006025 3300005355 Bacteria 9662
86 Ga0070671_100058539 3300005355 Bacteria 3207
87 Ga0070671_100075668 3300005355 Bacteria 2813
88 Ga0070671_100191660 3300005355 Bacteria 1732
89 Ga0070671_100694176 3300005355 Bacteria 883
90 Ga0070671_100816398 3300005355 Bacteria 812
91 Ga0070671_101027924 3300005355 Bacteria 722
92 Ga0070674_100012726 3300005356 Bacteria 5175
93 Ga0070674_100013607 3300005356 Bacteria 5035
94 Ga0070674_100018236 3300005356 Bacteria 4433
95 Ga0070674_100198471 3300005356 Bacteria 1548
96 Ga0070674_100807553 3300005356 Bacteria 810
97 Ga0070674_101080575 3300005356 Bacteria 708
98 Ga0070674_101352197 3300005356 Bacteria 636
99 Ga0070674_102022094 3300005356 Bacteria 525
100 Ga0070673_100003072 3300005364 Bacteria 10332
101 Ga0070673_100019451 3300005364 Bacteria 4873
102 Ga0070673_100131219 3300005364 Bacteria 2102
103 Ga0070673_100145026 3300005364 Bacteria 2006
104 Ga0070673_100410431 3300005364 Bacteria 1212
105 Ga0070673_100543674 3300005364 Bacteria 1055
106 Ga0070673_100762300 3300005364 Bacteria 892
107 Ga0070673_100820450 3300005364 Bacteria 860
108 Ga0070673_100957642 3300005364 Bacteria 795
109 Ga0070673_101372576 3300005364 Bacteria 665
110 Ga0070688_100532432 3300005365 Bacteria 891
111 Ga0070659_100011889 3300005366 Bacteria 6444
112 Ga0070659_100018169 3300005366 Bacteria 5305
113 Ga0070659_100203882 3300005366 Bacteria 1629
114 Ga0070667_100008961 3300005367 Bacteria 8283
115 Ga0070667_100026069 3300005367 Bacteria 4861
116 Ga0070667_100035293 3300005367 Bacteria 4188
117 Ga0070667_100095130 3300005367 Bacteria 2568
118 Ga0070667_100251054 3300005367 Bacteria 1581
119 Ga0070667_100331751 3300005367 Bacteria 1374
120 Ga0070667_101573398 3300005367 Bacteria 618
121 Ga0070667_101688766 3300005367 Bacteria 596
122 Ga0070701_10246032 3300005438 Bacteria 1078
123 Ga0070700_100076306 3300005441 Bacteria 2152
124 Ga0070700_100409423 3300005441 Bacteria 1022
125 Ga0070708_100678062 3300005445 Bacteria 971
126 Ga0070663_100001309 3300005455 Bacteria 13616
127 Ga0070663_100015103 3300005455 Bacteria 4972
128 Ga0070663_100077979 3300005455 Bacteria 2427
129 Ga0070663_100422419 3300005455 Bacteria 1094
130 Ga0070678_100001895 3300005456 Bacteria 11266
131 Ga0070678_100007671 3300005456 Bacteria 6414
132 Ga0070678_100073477 3300005456 Bacteria 2566
133 Ga0070678_100080791 3300005456 Bacteria 2463
134 Ga0070678_100173436 3300005456 Bacteria 1759
135 Ga0070678_100563879 3300005456 Bacteria 1012
136 Ga0070678_100630850 3300005456 Bacteria 959
137 Ga0070678_101761916 3300005456 Bacteria 583
138 Ga0070678_102273122 3300005456 Bacteria 515
139 Ga0070662_100028876 3300005457 Bacteria 3865
140 Ga0070662_100141047 3300005457 Bacteria 1867
141 Ga0070662_100347539 3300005457 Bacteria 1214
142 Ga0070662_100430677 3300005457 Bacteria 1092
143 Ga0070662_100497571 3300005457 Bacteria 1016
144 Ga0070662_100539438 3300005457 Bacteria 976
145 Ga0070662_100717437 3300005457 Bacteria 847
146 Ga0070662_101122899 3300005457 Bacteria 675
147 Ga0070681_10338724 3300005458 Bacteria 1414
148 Ga0070681_10571099 3300005458 Bacteria 1045
149 Ga0068867_100000642 3300005459 Bacteria 23127
150 Ga0068867_100018743 3300005459 Bacteria 4922
151 Ga0068867_100021533 3300005459 Bacteria 4600
152 Ga0068867_100058810 3300005459 Bacteria 2848
153 Ga0068867_100120849 3300005459 Bacteria 2024
154 Ga0068867_100612940 3300005459 Bacteria 951
155 Ga0068867_101641707 3300005459 Bacteria 602
156 Ga0070685_10761647 3300005466 Bacteria 711
157 Ga0070706_101296912 3300005467 Bacteria 668
158 Ga0070707_101602619 3300005468 Bacteria 618
159 Ga0070679_100005910 3300005530 Bacteria 11370
160 Ga0070679_101204174 3300005530 Bacteria 703
161 Ga0070679_101216217 3300005530 Bacteria 699
162 Ga0070679_101560032 3300005530 Bacteria 608
163 Ga0070684_100344415 3300005535 Bacteria 1370
164 Ga0068853_100024777 3300005539 Bacteria 5034
165 Ga0068853_100056675 3300005539 Bacteria 3380
166 Ga0068853_101035323 3300005539 Bacteria 791
167 Ga0068853_101532422 3300005539 Bacteria 645
168 Ga0068853_102092931 3300005539 Bacteria 549
169 Ga0070672_100000556 3300005543 Bacteria 21828
170 Ga0070672_100031086 3300005543 Bacteria 4016
171 Ga0070672_100035268 3300005543 Bacteria 3802
172 Ga0070672_100046034 3300005543 Bacteria 3378
173 Ga0070672_100074936 3300005543 Bacteria 2700
174 Ga0070672_100084451 3300005543 Bacteria 2549
175 Ga0070672_100103215 3300005543 Bacteria 2315
176 Ga0070672_100117126 3300005543 Bacteria 2177
177 Ga0070672_100123155 3300005543 Bacteria 2125
178 Ga0070672_100371159 3300005543 Bacteria 1222
179 Ga0070686_100112647 3300005544 Bacteria 1856
180 Ga0070686_101485202 3300005544 Bacteria 571
181 Ga0070695_100356570 3300005545 Bacteria 1097
182 Ga0070693_100932884 3300005547 Bacteria 652
183 Ga0070665_100349546 3300005548 Bacteria 1484
184 Ga0070665_100405384 3300005548 Bacteria 1371
185 Ga0070665_100690840 3300005548 Bacteria 1033
186 Ga0070665_100752282 3300005548 Bacteria 988
187 Ga0070665_102045678 3300005548 Bacteria 578
188 Ga0070704_100508124 3300005549 Bacteria 1047
189 Ga0068855_100066039 3300005563 Bacteria 4217
190 Ga0068855_100412939 3300005563 Bacteria 1477
191 Ga0070664_100111426 3300005564 Bacteria 2389
192 Ga0070664_100145261 3300005564 Bacteria 2091
193 Ga0070664_100178886 3300005564 Bacteria 1885
194 Ga0070664_100233075 3300005564 Bacteria 1651
195 Ga0070664_100276244 3300005564 Bacteria 1514
196 Ga0070664_100674737 3300005564 Bacteria 961
197 Ga0070664_100834392 3300005564 Bacteria 863
198 Ga0070664_101008498 3300005564 Bacteria 783
199 Ga0070664_101357878 3300005564 Bacteria 671
200 Ga0070664_101365466 3300005564 Bacteria 670
201 Ga0070664_101444025 3300005564 Bacteria 651
202 Ga0068857_100094200 3300005577 Bacteria 2681
203 Ga0068857_100202074 3300005577 Bacteria 1812
204 Ga0068854_100016864 3300005578 Bacteria 4877
205 Ga0068854_100391481 3300005578 Bacteria 1148
206 Ga0068856_100117837 3300005614 Bacteria 2656
207 Ga0068856_100129957 3300005614 Bacteria 2523
208 Ga0068856_100136686 3300005614 Bacteria 2456
209 Ga0068856_100414739 3300005614 Bacteria 1367
210 Ga0070702_100531188 3300005615 Bacteria 870
211 Ga0068852_100014893 3300005616 Bacteria 6010
212 Ga0068852_100016636 3300005616 Bacteria 5745
213 Ga0068852_100062538 3300005616 Bacteria 3238
214 Ga0068852_100090637 3300005616 Bacteria 2734
215 Ga0068852_100094656 3300005616 Bacteria 2680
216 Ga0068852_100261225 3300005616 Bacteria 1663
217 Ga0068852_100400678 3300005616 Bacteria 1350
218 Ga0068852_100552013 3300005616 Bacteria 1152
219 Ga0068852_100865932 3300005616 Bacteria 919
220 Ga0068852_101483298 3300005616 Bacteria 700
221 Ga0068852_102078317 3300005616 Bacteria 590
222 Ga0068852_102535526 3300005616 Bacteria 533
223 Ga0068859_100006084 3300005617 Bacteria 12255
224 Ga0068859_100070397 3300005617 Bacteria 3533
225 Ga0068859_100403071 3300005617 Bacteria 1464
226 Ga0068859_101908909 3300005617 Bacteria 656
227 Ga0068864_100016650 3300005618 Bacteria 6124
228 Ga0068864_100031659 3300005618 Bacteria 4489
229 Ga0068864_100065319 3300005618 Bacteria 3157
230 Ga0068864_100080246 3300005618 Bacteria 2858
231 Ga0068864_100407935 3300005618 Bacteria 1292
232 Ga0068864_100535381 3300005618 Bacteria 1131
233 Ga0068864_100551872 3300005618 Bacteria 1114
234 Ga0068864_100560329 3300005618 Bacteria 1105
235 Ga0068864_101251714 3300005618 Bacteria 741
236 Ga0068866_10205713 3300005718 Bacteria 1179
237 Ga0068866_10424953 3300005718 Bacteria 863
238 Ga0068866_10425006 3300005718 Bacteria 863
239 Ga0068866_10457995 3300005718 Bacteria 836
240 Ga0068866_10709988 3300005718 Bacteria 690
241 Ga0068866_10801482 3300005718 Bacteria 655
242 Ga0068861_100011424 3300005719 Bacteria 6174
243 Ga0068861_100023590 3300005719 Bacteria 4439
244 Ga0068861_100327840 3300005719 Bacteria 1335
245 Ga0068861_100398616 3300005719 Bacteria 1220
246 Ga0068861_100558116 3300005719 Bacteria 1045
247 Ga0068861_101503614 3300005719 Bacteria 661
248 Ga0068861_101943021 3300005719 Bacteria 586
249 Ga0068851_10022932 3300005834 Bacteria 3047
250 Ga0068851_10076090 3300005834 Bacteria 1745
251 Ga0068851_10227290 3300005834 Bacteria 1051
252 Ga0068851_10283165 3300005834 Bacteria 948
253 Ga0068851_10437783 3300005834 Bacteria 775
254 Ga0068851_10912409 3300005834 Bacteria 551
255 Ga0068870_10748004 3300005840 Bacteria 679
256 Ga0068870_10882354 3300005840 Bacteria 630
257 Ga0068863_100017253 3300005841 Bacteria 6924
258 Ga0068863_100024199 3300005841 Bacteria 5792
259 Ga0068863_100246333 3300005841 Bacteria 1725
260 Ga0068863_100335406 3300005841 Bacteria 1470
261 Ga0068863_100371030 3300005841 Bacteria 1396
262 Ga0068863_100516454 3300005841 Bacteria 1177
263 Ga0068863_101160718 3300005841 Bacteria 778
264 Ga0068858_100018855 3300005842 Bacteria 6456
265 Ga0068858_100024676 3300005842 Bacteria 5599
266 Ga0068858_100073309 3300005842 Bacteria 3178
267 Ga0068858_100075568 3300005842 Bacteria 3129
268 Ga0068858_100489250 3300005842 Bacteria 1188
269 Ga0068860_100005841 3300005843 Bacteria 12387
270 Ga0068860_100116688 3300005843 Bacteria 2554
271 Ga0068860_100851194 3300005843 Bacteria 926
272 Ga0068860_100969429 3300005843 Bacteria 868
273 Ga0068862_101024243 3300005844 Bacteria 817
274 Ga0068862_101878111 3300005844 Bacteria 609
275 Ga0070716_100266048 3300006173 Bacteria 1176
276 Ga0075362_10371837 3300006177 Bacteria 718
277 Ga0075366_10023190 3300006195 Bacteria 3615
278 Ga0075366_10023780 3300006195 Bacteria 3570
279 Ga0075366_10179258 3300006195 Bacteria 1287
280 Ga0075366_10234084 3300006195 Bacteria 1119
281 Ga0097621_100032745 3300006237 Bacteria 4134
282 Ga0097621_100065895 3300006237 Bacteria 2982
283 Ga0097621_100079659 3300006237 Bacteria 2723
284 Ga0097621_100107483 3300006237 Bacteria 2354
285 Ga0097621_100148369 3300006237 Bacteria 2010
286 Ga0097621_100204467 3300006237 Bacteria 1716
287 Ga0097621_100614509 3300006237 Bacteria 995
288 Ga0068871_100093997 3300006358 Bacteria 2502
289 Ga0068871_100114047 3300006358 Bacteria 2276
290 Ga0068871_100130403 3300006358 Bacteria 2131
291 Ga0068871_100213588 3300006358 Bacteria 1669
292 Ga0068871_100216933 3300006358 Bacteria 1656
293 Ga0068871_100305890 3300006358 Bacteria 1396
294 Ga0068871_100335356 3300006358 Bacteria 1334
295 Ga0068871_100342524 3300006358 Bacteria 1320
296 Ga0075430_100145784 3300006846 Bacteria 1972
297 Ga0075434_100450734 3300006871 Bacteria 1308
298 Ga0075429_100128059 3300006880 Bacteria 2220
299 Ga0075429_101359730 3300006880 Bacteria 619
300 Ga0068865_100027153 3300006881 Bacteria 3778
301 Ga0068865_100106466 3300006881 Bacteria 2061
302 Ga0068865_100204575 3300006881 Bacteria 1535
303 Ga0068865_100378676 3300006881 Bacteria 1154
304 Ga0075436_100665807 3300006914 Bacteria 770
305 Ga0097620_100006084 3300006931 Bacteria 12255
306 Ga0097620_100070394 3300006931 Bacteria 3533
307 Ga0097620_100403075 3300006931 Bacteria 1464
308 Ga0097620_101909298 3300006931 Bacteria 656
309 Ga0075435_100744455 3300007076 Bacteria 853
310 Ga0105244_10324843 3300009036 Bacteria 710
311 Ga0105240_10015269 3300009093 Bacteria 10451
312 Ga0105240_10283164 3300009093 Bacteria 1903
313 Ga0111539_10267976 3300009094 Bacteria 1988
314 Ga0111539_10289122 3300009094 Bacteria 1907
315 Ga0111539_10424034 3300009094 Bacteria 1549
316 Ga0105245_10108671 3300009098 Bacteria 2576
317 Ga0105245_10639337 3300009098 Bacteria 1093
318 Ga0105245_10870356 3300009098 Bacteria 942
319 Ga0105245_12862586 3300009098 Bacteria 535
320 Ga0105247_10773101 3300009101 Bacteria 730
321 Ga0105243_10023684 3300009148 Bacteria 4678
322 Ga0105243_10027612 3300009148 Bacteria 4350
323 Ga0105243_10168213 3300009148 Bacteria 1896
324 Ga0105243_10487973 3300009148 Bacteria 1164
325 Ga0105243_11404104 3300009148 Bacteria 719
326 Ga0105243_11435905 3300009148 Bacteria 712
327 Ga0105241_11019532 3300009174 Bacteria 775
328 Ga0105242_10143125 3300009176 Bacteria 2077
329 Ga0105242_10638069 3300009176 Bacteria 1034
330 Ga0105248_10066287 3300009177 Bacteria 4054
331 Ga0105248_10121531 3300009177 Bacteria 2946
332 Ga0105248_10193409 3300009177 Bacteria 2292
333 Ga0105248_10271747 3300009177 Bacteria 1909
334 Ga0105248_10484692 3300009177 Bacteria 1394
335 Ga0105237_10001569 3300009545 Bacteria 29799
336 Ga0105237_10096291 3300009545 Bacteria 2950
337 Ga0105238_10011025 3300009551 Bacteria 9088
338 Ga0105238_10124517 3300009551 Bacteria 2557
339 Ga0105249_10137749 3300009553 Bacteria 2338
340 Ga0105249_11749942 3300009553 Bacteria 694
341 Ga0105239_10000486 3300010375 Bacteria 57901
342 Ga0105239_10295005 3300010375 Bacteria 1826
343 Ga0105239_10954720 3300010375 Bacteria 985
344 Ga0105246_11393175 3300011119 Bacteria 654
345 Ga0105246_11972286 3300011119 Bacteria 562
346 Ga0157327_1077805 3300012512 Bacteria 528
347 Ga0157373_10024144 3300013100 Bacteria 4407
348 Ga0157373_10814614 3300013100 Unclassified 689
349 Ga0157371_10138859 3300013102 Bacteria 1731
350 Ga0157369_10062981 3300013105 Bacteria 3996
351 Ga0157374_10020861 3300013296 Bacteria 5820
352 Ga0157374_10031304 3300013296 Bacteria 4834
353 Ga0157374_10321419 3300013296 Bacteria 1533
354 Ga0157374_10463718 3300013296 Bacteria 1269
355 Ga0157374_11757986 3300013296 Bacteria 645
356 Ga0157378_10250530 3300013297 Bacteria 1695
357 Ga0157378_10352979 3300013297 Bacteria 1437
358 Ga0157378_10394325 3300013297 Bacteria 1362
359 Ga0157378_10990661 3300013297 Bacteria 874
360 Ga0157378_11158758 3300013297 Bacteria 812
361 Ga0157378_11194890 3300013297 Bacteria 800
362 Ga0157378_11799559 3300013297 Bacteria 661
363 Ga0163162_10001541 3300013306 Bacteria 21513
364 Ga0163162_10070367 3300013306 Bacteria 3550
365 Ga0163162_10183218 3300013306 Bacteria 2220
366 Ga0163162_10305079 3300013306 Bacteria 1724
367 Ga0163162_10382224 3300013306 Bacteria 1541
368 Ga0163162_10499622 3300013306 Bacteria 1347
369 Ga0163162_11364280 3300013306 Bacteria 806
370 Ga0157372_10073108 3300013307 Bacteria 3864
371 Ga0157372_10093451 3300013307 Bacteria 3423
372 Ga0157375_10075696 3300013308 Bacteria 3391
373 Ga0157375_10079558 3300013308 Bacteria 3314
374 Ga0157375_10092138 3300013308 Bacteria 3094
375 Ga0157375_10260662 3300013308 Bacteria 1895
376 Ga0157375_10612496 3300013308 Bacteria 1247
377 Ga0157375_10788862 3300013308 Bacteria 1099
378 Ga0163163_10148503 3300014325 Bacteria 2388
379 Ga0163163_10259237 3300014325 Bacteria 1789
380 Ga0163163_11031335 3300014325 Bacteria 886
381 Ga0163163_11367113 3300014325 Bacteria 770
382 Ga0163163_11486655 3300014325 Bacteria 739
383 Ga0157380_10133171 3300014326 Bacteria 2124
384 Ga0157380_10252016 3300014326 Bacteria 1598
385 Ga0157380_10548647 3300014326 Bacteria 1133
386 Ga0157377_10000052 3300014745 Bacteria 89846
387 Ga0157377_10001746 3300014745 Bacteria 9477
388 Ga0157377_10134587 3300014745 Bacteria 1513
389 Ga0157377_10165481 3300014745 Bacteria 1379
390 Ga0157379_10010120 3300014968 Bacteria 8223
391 Ga0157379_10018961 3300014968 Bacteria 6073
392 Ga0157379_10032422 3300014968 Bacteria 4658
393 Ga0157379_10124526 3300014968 Bacteria 2319
394 Ga0157379_10157361 3300014968 Bacteria 2050
395 Ga0157379_11095155 3300014968 Bacteria 763
396 Ga0157379_11266112 3300014968 Bacteria 711
397 Ga0157376_10049664 3300014969 Bacteria 3476
398 Ga0157376_10311588 3300014969 Bacteria 1493
399 Ga0157376_10882528 3300014969 Bacteria 911
400 Ga0157376_11018245 3300014969 Bacteria 851
401 Ga0157376_11018690 3300014969 Bacteria 851
402 Ga0157376_11062436 3300014969 Bacteria 834
403 Ga0157376_11231925 3300014969 Bacteria 777
404 Ga0182006_1278431 3300015261 Bacteria 549
405 Ga0182005_1128173 3300015265 Bacteria 726
406 Ga0163161_10175056 3300017792 Bacteria 1642
407 Ga0163161_10263539 3300017792 Bacteria 1346
408 Ga0163161_10267244 3300017792 Bacteria 1337
409 Ga0163161_10436226 3300017792 Bacteria 1056
410 Ga0163161_10510577 3300017792 Bacteria 980
411 Ga0163161_10779967 3300017792 Bacteria 802
412 Ga0163161_11017028 3300017792 Bacteria 708
413 Ga0213876_10165029 3300021384 Bacteria 1178
414 Ga0207666_1044135 3300025271 Bacteria 700
415 Ga0207656_10018712 3300025321 Bacteria 2730
416 Ga0207656_10030751 3300025321 Bacteria 2220
417 Ga0207656_10060820 3300025321 Bacteria 1656
418 Ga0207656_10087605 3300025321 Bacteria 1408
419 Ga0207656_10391007 3300025321 Bacteria 698
420 Ga0207656_10435054 3300025321 Bacteria 662
421 Ga0207653_10259647 3300025885 Bacteria 667
422 Ga0207682_10002798 3300025893 Bacteria 7716
423 Ga0207682_10006323 3300025893 Bacteria 4779
424 Ga0207682_10049842 3300025893 Bacteria 1730
425 Ga0207682_10050056 3300025893 Bacteria 1726
426 Ga0207682_10174224 3300025893 Bacteria 980
427 Ga0207682_10418431 3300025893 Bacteria 634
428 Ga0207642_10217890 3300025899 Bacteria 1065
429 Ga0207642_10284648 3300025899 Bacteria 952
430 Ga0207688_10047915 3300025901 Bacteria 2387
431 Ga0207688_10051580 3300025901 Bacteria 2304
432 Ga0207688_10316967 3300025901 Bacteria 956
433 Ga0207688_10413580 3300025901 Bacteria 837
434 Ga0207680_10007478 3300025903 Bacteria 5330
435 Ga0207680_10193932 3300025903 Bacteria 1380
436 Ga0207680_10524368 3300025903 Bacteria 845
437 Ga0207647_10399755 3300025904 Bacteria 774
438 Ga0207645_10007554 3300025907 Bacteria 7668
439 Ga0207645_10025382 3300025907 Bacteria 3835
440 Ga0207645_10034917 3300025907 Bacteria 3229
441 Ga0207645_10036225 3300025907 Bacteria 3168
442 Ga0207645_10078905 3300025907 Bacteria 2110
443 Ga0207645_10138024 3300025907 Bacteria 1588
444 Ga0207645_10193925 3300025907 Bacteria 1335
445 Ga0207705_10133962 3300025909 Bacteria 1846
446 Ga0207705_10367801 3300025909 Bacteria 1109
447 Ga0207705_10834683 3300025909 Bacteria 715
448 Ga0207707_10315027 3300025912 Bacteria 1351
449 Ga0207695_10203848 3300025913 Bacteria 1891
450 Ga0207671_10006936 3300025914 Bacteria 9975
451 Ga0207671_10306590 3300025914 Bacteria 1255
452 Ga0207660_10009668 3300025917 Bacteria 6241
453 Ga0207662_10208925 3300025918 Bacteria 1267
454 Ga0207657_10473941 3300025919 Bacteria 982
455 Ga0207657_10620415 3300025919 Bacteria 843
456 Ga0207649_10089105 3300025920 Bacteria 2016
457 Ga0207649_10518660 3300025920 Bacteria 908
458 Ga0207652_10013674 3300025921 Bacteria 6563
459 Ga0207646_10916814 3300025922 Bacteria 777
460 Ga0207681_10021768 3300025923 Bacteria 4080
461 Ga0207681_10033049 3300025923 Bacteria 3390
462 Ga0207681_10061183 3300025923 Bacteria 2587
463 Ga0207681_10457546 3300025923 Bacteria 1039
464 Ga0207681_10686797 3300025923 Bacteria 850
465 Ga0207681_10699743 3300025923 Bacteria 842
466 Ga0207681_10713234 3300025923 Bacteria 834
467 Ga0207681_10742925 3300025923 Bacteria 817
468 Ga0207681_11361911 3300025923 Bacteria 596
469 Ga0207694_10017774 3300025924 Bacteria 5374
470 Ga0207694_10167559 3300025924 Bacteria 1777
471 Ga0207694_10700091 3300025924 Bacteria 854
472 Ga0207650_10000348 3300025925 Bacteria 44624
473 Ga0207650_10006455 3300025925 Bacteria 7988
474 Ga0207650_10038591 3300025925 Bacteria 3489
475 Ga0207650_10092424 3300025925 Bacteria 2314
476 Ga0207650_10100288 3300025925 Bacteria 2227
477 Ga0207650_10115135 3300025925 Bacteria 2086
478 Ga0207650_10181055 3300025925 Bacteria 1679
479 Ga0207650_10284044 3300025925 Bacteria 1348
480 Ga0207650_10428009 3300025925 Bacteria 1099
481 Ga0207650_10481654 3300025925 Bacteria 1035
482 Ga0207650_10888675 3300025925 Bacteria 756
483 Ga0207650_11804990 3300025925 Bacteria 517
484 Ga0207659_10000583 3300025926 Bacteria 21821
485 Ga0207659_10009948 3300025926 Bacteria 5955
486 Ga0207659_10010917 3300025926 Bacteria 5721
487 Ga0207659_10014232 3300025926 Bacteria 5121
488 Ga0207659_10041819 3300025926 Bacteria 3211
489 Ga0207659_10069861 3300025926 Bacteria 2560
490 Ga0207659_10419995 3300025926 Bacteria 1121
491 Ga0207659_11800545 3300025926 Bacteria 520
492 Ga0207687_10056250 3300025927 Bacteria 2759
493 Ga0207687_10211632 3300025927 Bacteria 1521
494 Ga0207687_10775581 3300025927 Bacteria 817
495 Ga0207644_10005232 3300025931 Bacteria 8469
496 Ga0207644_10034321 3300025931 Bacteria 3549
497 Ga0207644_10041754 3300025931 Bacteria 3247
498 Ga0207644_10052986 3300025931 Bacteria 2918
499 Ga0207644_10216505 3300025931 Bacteria 1516
500 Ga0207644_10256651 3300025931 Bacteria 1396
501 Ga0207644_11364647 3300025931 Bacteria 595
502 Ga0207644_11880628 3300025931 Bacteria 500
503 Ga0207690_10050834 3300025932 Bacteria 2769
504 Ga0207690_10055305 3300025932 Bacteria 2672
505 Ga0207690_10189841 3300025932 Bacteria 1553
506 Ga0207706_10051645 3300025933 Bacteria 3630
507 Ga0207706_10080651 3300025933 Bacteria 2861
508 Ga0207706_10150655 3300025933 Bacteria 2045
509 Ga0207706_10411722 3300025933 Bacteria 1172
510 Ga0207706_10467903 3300025933 Bacteria 1090
511 Ga0207706_10831125 3300025933 Bacteria 783
512 Ga0207686_10803521 3300025934 Bacteria 754
513 Ga0207709_10007425 3300025935 Bacteria 6108
514 Ga0207709_10081126 3300025935 Bacteria 2091
515 Ga0207709_10229502 3300025935 Bacteria 1344
516 Ga0207709_10813349 3300025935 Bacteria 755
517 Ga0207709_10901308 3300025935 Bacteria 719
518 Ga0207670_10231615 3300025936 Bacteria 1419
519 Ga0207670_10238795 3300025936 Bacteria 1399
520 Ga0207670_10343637 3300025936 Bacteria 1180
521 Ga0207669_10008088 3300025937 Bacteria 4918
522 Ga0207669_10121165 3300025937 Bacteria 1776
523 Ga0207669_10123273 3300025937 Bacteria 1764
524 Ga0207669_10782080 3300025937 Bacteria 790
525 Ga0207704_10050252 3300025938 Bacteria 2514
526 Ga0207704_10494722 3300025938 Bacteria 984
527 Ga0207704_10500872 3300025938 Bacteria 979
528 Ga0207704_11006129 3300025938 Bacteria 705
529 Ga0207665_10452007 3300025939 Bacteria 986
530 Ga0207691_10029127 3300025940 Bacteria 5165
531 Ga0207691_10040440 3300025940 Bacteria 4307
532 Ga0207691_10052613 3300025940 Bacteria 3719
533 Ga0207691_10055017 3300025940 Bacteria 3628
534 Ga0207691_10122157 3300025940 Bacteria 2307
535 Ga0207691_10199532 3300025940 Bacteria 1742
536 Ga0207691_10324178 3300025940 Bacteria 1320
537 Ga0207691_10446283 3300025940 Bacteria 1101
538 Ga0207691_10480642 3300025940 Bacteria 1056
539 Ga0207691_10522681 3300025940 Bacteria 1007
540 Ga0207711_10021079 3300025941 Bacteria 5443
541 Ga0207711_10025658 3300025941 Bacteria 4942
542 Ga0207711_10186248 3300025941 Bacteria 1890
543 Ga0207711_10207381 3300025941 Bacteria 1790
544 Ga0207689_10010535 3300025942 Bacteria 7959
545 Ga0207689_10013874 3300025942 Bacteria 6864
546 Ga0207689_10031595 3300025942 Bacteria 4406
547 Ga0207689_10095823 3300025942 Bacteria 2437
548 Ga0207661_10176600 3300025944 Bacteria 1862
549 Ga0207661_10888849 3300025944 Bacteria 820
550 Ga0207661_11379629 3300025944 Bacteria 647
551 Ga0207679_10039737 3300025945 Bacteria 3362
552 Ga0207679_10096341 3300025945 Bacteria 2302
553 Ga0207679_10195046 3300025945 Bacteria 1687
554 Ga0207679_10321562 3300025945 Bacteria 1340
555 Ga0207679_10598961 3300025945 Bacteria 993
556 Ga0207679_11137874 3300025945 Bacteria 716
557 Ga0207679_11267132 3300025945 Bacteria 677
558 Ga0207679_11686370 3300025945 Bacteria 580
559 Ga0207667_10394009 3300025949 Bacteria 1410
560 Ga0207667_11147727 3300025949 Bacteria 758
561 Ga0207651_10004673 3300025960 Bacteria 6942
562 Ga0207651_10039338 3300025960 Bacteria 3118
563 Ga0207651_10045993 3300025960 Bacteria 2931
564 Ga0207651_10121226 3300025960 Bacteria 1983
565 Ga0207651_10280292 3300025960 Bacteria 1377
566 Ga0207651_10332864 3300025960 Bacteria 1273
567 Ga0207651_10532558 3300025960 Bacteria 1019
568 Ga0207651_10754146 3300025960 Bacteria 860
569 Ga0207651_10860525 3300025960 Bacteria 806
570 Ga0207651_11116435 3300025960 Bacteria 707
571 Ga0207651_11966971 3300025960 Bacteria 525
572 Ga0207712_10168668 3300025961 Bacteria 1709
573 Ga0207668_10085291 3300025972 Bacteria 2304
574 Ga0207668_10153059 3300025972 Bacteria 1788
575 Ga0207668_10335248 3300025972 Bacteria 1260
576 Ga0207668_10356237 3300025972 Bacteria 1225
577 Ga0207668_11173781 3300025972 Bacteria 689
578 Ga0207640_10035795 3300025981 Bacteria 3110
579 Ga0207640_10162658 3300025981 Bacteria 1653
580 Ga0207640_10525867 3300025981 Bacteria 989
581 Ga0207640_10761489 3300025981 Bacteria 836
582 Ga0207658_10020571 3300025986 Bacteria 4569
583 Ga0207658_10068722 3300025986 Bacteria 2674
584 Ga0207658_10070079 3300025986 Bacteria 2652
585 Ga0207658_10115289 3300025986 Bacteria 2132
586 Ga0207658_10329291 3300025986 Bacteria 1324
587 Ga0207658_10975899 3300025986 Bacteria 773
588 Ga0207677_10003814 3300026023 Bacteria 8012
589 Ga0207677_10027411 3300026023 Bacteria 3587
590 Ga0207677_10375101 3300026023 Bacteria 1199
591 Ga0207677_10869853 3300026023 Bacteria 811
592 Ga0207677_11692881 3300026023 Bacteria 586
593 Ga0207703_10001562 3300026035 Bacteria 20760
594 Ga0207703_10008849 3300026035 Bacteria 7936
595 Ga0207703_10020445 3300026035 Bacteria 5178
596 Ga0207703_10178481 3300026035 Bacteria 1873
597 Ga0207639_10010593 3300026041 Bacteria 6388
598 Ga0207639_11028147 3300026041 Bacteria 772
599 Ga0207678_10003783 3300026067 Bacteria 13608
600 Ga0207678_10012734 3300026067 Bacteria 7386
601 Ga0207678_10045136 3300026067 Bacteria 3811
602 Ga0207678_11490600 3300026067 Bacteria 597
603 Ga0207708_10075077 3300026075 Bacteria 2592
604 Ga0207708_10160831 3300026075 Bacteria 1773
605 Ga0207708_11203673 3300026075 Bacteria 662
606 Ga0207702_10072573 3300026078 Bacteria 2967
607 Ga0207702_10108822 3300026078 Bacteria 2460
608 Ga0207702_10186497 3300026078 Bacteria 1913
609 Ga0207702_12043531 3300026078 Bacteria 563
610 Ga0207641_10000655 3300026088 Bacteria 37743
611 Ga0207641_10002300 3300026088 Bacteria 17770
612 Ga0207641_10234396 3300026088 Bacteria 1707
613 Ga0207641_10412113 3300026088 Bacteria 1299
614 Ga0207641_10436561 3300026088 Bacteria 1263
615 Ga0207641_11035074 3300026088 Bacteria 818
616 Ga0207641_11113301 3300026088 Bacteria 788
617 Ga0207641_11697814 3300026088 Bacteria 633
618 Ga0207648_10001074 3300026089 Bacteria 30606
619 Ga0207648_10014921 3300026089 Bacteria 7161
620 Ga0207648_10016497 3300026089 Bacteria 6745
621 Ga0207648_10075240 3300026089 Bacteria 2944
622 Ga0207648_10186283 3300026089 Bacteria 1839
623 Ga0207648_10202928 3300026089 Bacteria 1759
624 Ga0207648_11261935 3300026089 Bacteria 694
625 Ga0207648_11488458 3300026089 Bacteria 636
626 Ga0207676_10032242 3300026095 Bacteria 3946
627 Ga0207676_10038292 3300026095 Bacteria 3658
628 Ga0207676_10058595 3300026095 Bacteria 3038
629 Ga0207676_10315699 3300026095 Bacteria 1432
630 Ga0207676_12085534 3300026095 Bacteria 565
631 Ga0207674_10096614 3300026116 Bacteria 2939
632 Ga0207674_10101334 3300026116 Bacteria 2860
633 Ga0207674_10662448 3300026116 Bacteria 1008
634 Ga0207675_100004707 3300026118 Bacteria 13136
635 Ga0207675_100017601 3300026118 Bacteria 6666
636 Ga0207675_100182078 3300026118 Bacteria 2012
637 Ga0207675_100522179 3300026118 Bacteria 1184
638 Ga0207675_100664677 3300026118 Bacteria 1049
639 Ga0207675_100864109 3300026118 Bacteria 920
640 Ga0207675_102337014 3300026118 Bacteria 548
641 Ga0207675_102649171 3300026118 Unclassified 510
642 Ga0207683_10009924 3300026121 Bacteria 8121
643 Ga0207683_10022883 3300026121 Bacteria 5369
644 Ga0207683_10050891 3300026121 Bacteria 3629
645 Ga0207683_10087698 3300026121 Bacteria 2768
646 Ga0207683_10141670 3300026121 Bacteria 2167
647 Ga0207683_10278360 3300026121 Bacteria 1529
648 Ga0207683_10567821 3300026121 Bacteria 1049
649 Ga0207683_10683211 3300026121 Bacteria 951
650 Ga0207683_11521922 3300026121 Bacteria 618
651 Ga0207683_11704337 3300026121 Bacteria 580
652 Ga0207683_12119983 3300026121 Bacteria 510
653 Ga0207698_10004331 3300026142 Bacteria 8639
654 Ga0207698_10026032 3300026142 Bacteria 4133
655 Ga0207698_10039973 3300026142 Bacteria 3479
656 Ga0207698_10042642 3300026142 Bacteria 3392
657 Ga0207698_10121702 3300026142 Bacteria 2210
658 Ga0207698_10341159 3300026142 Bacteria 1411
659 Ga0207698_10659331 3300026142 Bacteria 1037
660 Ga0207698_11258709 3300026142 Bacteria 754
661 Ga0207698_12600978 3300026142 Bacteria 515
662 Ga0268266_10758396 3300028379 Bacteria 937
663 Ga0268266_10869988 3300028379 Bacteria 871
664 Ga0268266_10897402 3300028379 Bacteria 857
665 Ga0268266_10971025 3300028379 Bacteria 822
666 Ga0268266_12193883 3300028379 Bacteria 524
667 Ga0268265_10422181 3300028380 Bacteria 1238
668 Ga0268265_11089431 3300028380 Bacteria 793
669 Ga0268265_11101237 3300028380 Bacteria 788
670 Ga0268264_10172460 3300028381 Bacteria 1957
671 Ga0268264_10549120 3300028381 Bacteria 1133
672 Ga0307517_10000173 3300028786 Bacteria 105751
673 Ga0307515_10089385 3300028794 Bacteria 3879
674 Ga0307515_10162825 3300028794 Bacteria 2265
675 Ga0307515_10291152 3300028794 Bacteria 1328
676 Ga0307515_10331801 3300028794 Bacteria 1179
677 Ga0307512_10049347 3300030522 Bacteria 3395
678 Ga0307512_10059848 3300030522 Bacteria 2951
679 Ga0307513_10030756 3300031456 Bacteria 6095
680 Ga0307513_10109519 3300031456 Bacteria 2759
681 Ga0307513_10146635 3300031456 Bacteria 2277
682 Ga0307509_10000181 3300031507 Bacteria 98346
683 Ga0307509_10050392 3300031507 Bacteria 4458
684 Ga0307509_10053814 3300031507 Bacteria 4288
685 Ga0307509_10160049 3300031507 Bacteria 2151
686 Ga0307509_10175044 3300031507 Bacteria 2019
687 Ga0307509_10839467 3300031507 Bacteria 583
688 Ga0307408_100120697 3300031548 Bacteria 2030
689 Ga0307408_100207826 3300031548 Bacteria 1589
690 Ga0307408_100449412 3300031548 Bacteria 1117
691 Ga0307408_101612929 3300031548 Bacteria 616
692 Ga0307508_10000738 3300031616 Bacteria 38723
693 Ga0307508_10340777 3300031616 Bacteria 1090
694 Ga0307514_10073480 3300031649 Bacteria 2557
695 Ga0307516_10010101 3300031730 Bacteria 10436
696 Ga0307516_10136356 3300031730 Bacteria 2228
697 Ga0307405_10002174 3300031731 Bacteria 8565
698 Ga0307405_10063724 3300031731 Bacteria 2339
699 Ga0307405_10886948 3300031731 Bacteria 753
700 Ga0307413_10733549 3300031824 Bacteria 824
701 Ga0307518_10375560 3300031838 Bacteria 810
702 Ga0307518_10426021 3300031838 Bacteria 725
703 Ga0307410_10457974 3300031852 Bacteria 1042
704 Ga0307406_10119880 3300031901 Bacteria 1827
705 Ga0307406_10160694 3300031901 Bacteria 1614
706 Ga0307406_11170277 3300031901 Bacteria 666
707 Ga0307406_11579764 3300031901 Bacteria 579
708 Ga0307407_10016152 3300031903 Bacteria 3710
709 Ga0307407_10142732 3300031903 Bacteria 1547
710 Ga0307407_10584081 3300031903 Bacteria 830
711 Ga0307407_11283278 3300031903 Bacteria 574
712 Ga0307412_10055698 3300031911 Bacteria 2631
713 Ga0307412_10280350 3300031911 Bacteria 1308
714 Ga0307409_100000998 3300031995 Bacteria 13235
715 Ga0307409_100176604 3300031995 Bacteria 1886
716 Ga0307409_100965120 3300031995 Bacteria 869
717 Ga0307409_101452959 3300031995 Bacteria 712
718 Ga0307409_101876405 3300031995 Bacteria 629
719 Ga0307416_100002959 3300032002 Bacteria 9907
720 Ga0307416_100020663 3300032002 Bacteria 4705
721 Ga0307416_101035753 3300032002 Bacteria 924
722 Ga0307414_10174618 3300032004 Bacteria 1722
723 Ga0307414_10393865 3300032004 Bacteria 1201
724 Ga0307411_10118014 3300032005 Bacteria 1913
725 Ga0307411_10347968 3300032005 Bacteria 1207
726 Ga0307411_10623965 3300032005 Bacteria 930
727 Ga0307411_10737774 3300032005 Bacteria 861
728 Ga0307411_11056610 3300032005 Bacteria 730
729 Ga0307415_100018265 3300032126 Bacteria 4230
730 Ga0307415_101336537 3300032126 Bacteria 680
731 Ga0307507_10195459 3300033179 Bacteria 1412
732 Ga0307507_10247572 3300033179 Bacteria 1156
733 Ga0307510_10001034 3300033180 Bacteria 29497
734 Ga0307510_10115919 3300033180 Bacteria 2402
735 Ga0307510_10197173 3300033180 Bacteria 1553
736 Ga0307510_10662132 3300033180 Bacteria 503
737 Ga0373938_0048547 3300034957 Bacteria 963
738 Ga0373928_0039245 3300035084 Bacteria 1081
739 Ga0373928_0048659 3300035084 Bacteria 995
740 Ga0373932_0034803 3300035112 Bacteria 1421
741 Ga0373939_0019235 3300035114 Bacteria 1840
742 Ga0373943_0095824 3300035170 Bacteria 1544
743 Ga0373946_0263875 3300035171 Bacteria 843
744 Ga0373962_0265784 3300035242 Bacteria 599
745 Ga0373931_0030179 3300035691 Bacteria 2789
746 Ga0373931_0891642 3300035691 Bacteria 597
747 Ga0373947_1097154 3300035725 Bacteria 543
748 Ga0373937_0955671 3300036401 Bacteria 806
749 Ga0395905_0030862 3300037471 Bacteria 5047
750 Ga0436364_0872711 3300037853 Unclassified 756
751 Ga0436365_0830380 3300039437 Bacteria 931
752 Ga0436365_1729666 3300039437 Bacteria 4109
753 Ga0436363_1353996 3300039450 Bacteria 1993
754 Ga0451793_0301768 3300041452 Bacteria 503
755 Ga0451797_0590806 3300041453 Bacteria 568
756 Ga0451798_0746032 3300041458 Bacteria 677
757 Ga0451800_0691674 3300041459 Bacteria 527
758 Ga0451802_1535241 3300041460 Bacteria 1034
759 Ga0451807_0244690 3300041486 Bacteria 643
760 Ga0451847_0322153 3300041503 Bacteria 581
761 Ga0451851_1352704 3300041507 Bacteria 824
762 Ga0451843_1166635 3300041509 Bacteria 572
763 Ga0451853_2191125 3300041512 Bacteria 736
764 Ga0439455_0161594 3300042012 Bacteria 641
765 Ga0450913_021465 3300042117 Bacteria 595
766 Ga0450898_084372 3300042134 Bacteria 649
767 Ga0439464_0096006 3300042439 Bacteria 897
768 Ga0439460_0174247 3300042461 Bacteria 725
769 Ga0451576_0386825 3300045051 Bacteria 1466
770 Ga0451576_0577456 3300045051 Bacteria 1181
771 Ga0495592_0000234 3300046454 Bacteria 47791
772 Ga0495592_0183951 3300046454 Bacteria 1421
773 Ga0495638_0129775 3300046460 Bacteria 1482
774 Ga0495582_0363670 3300046473 Bacteria 833
775 Ga0495582_0562783 3300046473 Bacteria 660
776 Ga0495608_0380208 3300046511 Bacteria 866
777 Ga0495610_0055804 3300046512 Bacteria 1902
778 Ga0495620_0280138 3300046515 Bacteria 634
779 Ga0495628_0541018 3300046516 Bacteria 837
780 Ga0495630_0095573 3300046517 Bacteria 2247
781 Ga0495632_0071188 3300046519 Bacteria 1671
782 Ga0495632_0159626 3300046519 Bacteria 1039
783 Ga0495648_0083206 3300046524 Bacteria 1814
784 Ga0495654_0246427 3300046530 Bacteria 746
785 Ga0495586_0249774 3300046535 Bacteria 1012
786 Ga0495586_0460853 3300046535 Bacteria 733
787 Ga0495598_0166716 3300046537 Bacteria 778
788 Ga0495621_0140935 3300046539 Bacteria 943
789 Ga0495622_0142242 3300046557 Bacteria 1089
790 Ga0495668_0115134 3300046616 Bacteria 1471
791 Ga0495611_0341401 3300046648 Bacteria 688
792 Ga0495625_0323826 3300046660 Bacteria 981
793 Ga0495646_0207646 3300046680 Bacteria 1064
794 Ga0495647_0056914 3300046681 Bacteria 1534
795 Ga0495658_0028770 3300046683 Bacteria 3002
796 Ga0495658_0098601 3300046683 Bacteria 1741
797 Ga0495658_0311390 3300046683 Bacteria 997
798 Ga0495658_0539703 3300046683 Bacteria 747
799 Ga0495624_0017157 3300046690 Bacteria 4867
800 Ga0495636_0663588 3300047318 Bacteria 513
801 Ga0495676_0114566 3300047321 Bacteria 1972
802 Ga0495683_0296305 3300047323 Bacteria 696
803 Ga0495675_0223797 3300047444 Bacteria 1138
804 Ga0495615_0159241 3300048090 Bacteria 677
805 Ga0496100_0135463 3300048903 Bacteria 1739
806 Ga0496101_0151451 3300048904 Bacteria 1774
807 Ga0496101_0180669 3300048904 Bacteria 1625
808 Ga0496102_0365076 3300048905 Bacteria 1359
809 Ga0496104_0026264 3300048907 Bacteria 5375
810 Ga0496104_0677349 3300048907 Bacteria 939
811 Ga0496104_1294369 3300048907 Bacteria 632
812 Ga0496105_0453340 3300048908 Bacteria 1012
813 Ga0496105_0722096 3300048908 Bacteria 763
814 Ga0496106_0053191 3300048909 Bacteria 3057
815 Ga0496106_0169444 3300048909 Bacteria 1730
816 Ga0496107_0059091 3300048910 Bacteria 2774
817 Ga0496107_1245042 3300048910 Bacteria 534
818 Ga0496108_0123130 3300048911 Bacteria 2225
819 Ga0496108_0167208 3300048911 Bacteria 1902
820 Ga0496108_0900308 3300048911 Bacteria 759
821 Ga0496109_0085339 3300048912 Bacteria 2914
822 Ga0496110_0239621 3300048913 Bacteria 1650
823 Ga0496110_0305532 3300048913 Bacteria 1449
824 Ga0496110_0406612 3300048913 Bacteria 1241
825 Ga0496110_0816931 3300048913 Bacteria 837
826 Ga0496110_0853512 3300048913 Bacteria 816
827 Ga0496111_0170347 3300048914 Bacteria 1618
828 Ga0496111_0207295 3300048914 Bacteria 1457
829 Ga0496113_0304954 3300048916 Bacteria 1275
830 Ga0496114_0218567 3300048917 Bacteria 1672
831 Ga0496114_0478741 3300048917 Bacteria 1101
832 Ga0496114_0549530 3300048917 Bacteria 1020
833 Ga0496114_0630345 3300048917 Bacteria 944
834 Ga0496114_0987976 3300048917 Bacteria 725
835 Ga0496115_0108476 3300048918 Bacteria 2279
836 Ga0496121_0366734 3300048924 Bacteria 954
837 Ga0495678_223737 3300049459 Bacteria 570
838 Ga0501300_025195 3300049523 Bacteria 872
839 Ga0501043_0000038 3300049579 Bacteria 128656
840 Ga0501046_0000049 3300049580 Bacteria 135088
841 Ga0501047_0000039 3300049581 Bacteria 187849
842 Ga0501048_0011326 3300049582 Bacteria 6651
843 Ga0501198_000058 3300049649 Bacteria 31939
844 Ga0501206_034761 3300049653 Bacteria 760
845 Ga0501222_000066 3300049662 Bacteria 32105
846 Ga0501253_130541 3300049683 Bacteria 617
847 Ga0501257_021230 3300049686 Bacteria 1530
848 Ga0501083_0505031 3300049744 Bacteria 787
849 Ga0501262_009888 3300049759 Bacteria 1186
850 Ga0501265_003351 3300049762 Bacteria 1821
851 Ga0501273_091386 3300049770 Bacteria 518
852 Ga0501044_0175870 3300049823 Bacteria 2110
853 Ga0501045_0007021 3300049824 Bacteria 7809
854 nmdc:mga03683_55825_c1 3300050489 Bacteria 1659
855 nmdc:mga0k408_147931_c1 3300050493 Bacteria 1398
856 nmdc:mga0k408_286076_c1 3300050493 Bacteria 984
857 nmdc:mga0k408_521054_c1 3300050493 Bacteria 704
858 nmdc:mga0k408_5343_c1 3300050493 Bacteria 6826
859 nmdc:mga0k408_873488_c1 3300050493 Bacteria 522
860 nmdc:mga07m45_417047_c1 3300050496 Bacteria 779
861 nmdc:mga09592_2954_c1 3300050508 Bacteria 13781
862 nmdc:mga0qj67_37390_c1 3300050509 Bacteria 3802
863 nmdc:mga08y16_863607_c1 3300050511 Bacteria 893
864 nmdc:mga08y16_899569_c1 3300050511 Bacteria 871
865 nmdc:mga0n895_480444_c1 3300050512 Bacteria 1253
866 nmdc:mga08x19_858063_c1 3300050514 Bacteria 645
867 nmdc:mga0sz30_352752_c1 3300050516 Bacteria 657
868 Ga0495601_0930788 3300053077 Bacteria 548
869 Ga0495595_0599681 3300053084 Bacteria 563
870 Ga0495595_0718807 3300053084 Bacteria 512
871 Ga0500644_0008644 3300053088 Bacteria 2693
872 Ga0500647_0294610 3300053091 Bacteria 696
873 Ga0500583_0067135 3300053092 Bacteria 1708
874 Ga0500651_0040675 3300053093 Bacteria 2929
875 Ga0500651_0271594 3300053093 Bacteria 980
876 Ga0500650_0112775 3300053098 Bacteria 1269
877 Ga0500650_0355014 3300053098 Bacteria 640
878 Ga0500594_0023894 3300053118 Bacteria 1553
879 Ga0500607_232469 3300053121 Bacteria 754
880 Ga0500652_248080 3300053131 Bacteria 706
881 Ga0500559_0000262 3300053136 Bacteria 41173
882 Ga0500564_121366 3300053138 Bacteria 1138
883 Ga0500573_0160143 3300053140 Bacteria 1226
884 Ga0500590_210174 3300053148 Bacteria 813
885 Ga0500604_0311153 3300053151 Bacteria 546
886 Ga0500616_0192579 3300053153 Bacteria 909
887 Ga0500619_014471 3300053154 Bacteria 2121
888 Ga0500619_267121 3300053154 Bacteria 559
889 Ga0500622_0002641 3300053156 Bacteria 12735
890 Ga0500636_0355069 3300053177 Bacteria 698
891 Ga0500636_0390505 3300053177 Bacteria 649
892 Ga0500599_011466 3300053736 Bacteria 1182
893 Ga0500587_009905 3300053739 Bacteria 1212

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005343 Ga0070687_100975239 Ga0070687_1009752392 82
2 3300031507 Ga0307509_10000181 Ga0307509_10000181100 83
3 3300031649 Ga0307514_10073480 Ga0307514_100734803 83
4 3300031838 Ga0307518_10375560 Ga0307518_103755602 83
5 3300032005 Ga0307411_10623965 Ga0307411_106239652 83
6 3300033180 Ga0307510_10115919 Ga0307510_101159193 83
7 3300053093 Ga0500651_0271594 Ga0500651_0271594_573_884 83
8 3300031730 Ga0307516_10010101 Ga0307516_100101018 84
9 3300047318 Ga0495636_0663588 Ga0495636_0663588_51_362 84
10 3300005614 Ga0068856_100117837 Ga0068856_1001178373 87
11 3300025885 Ga0207653_10259647 Ga0207653_102596472 87
12 3300026078 Ga0207702_10108822 Ga0207702_101088223 87
13 3300005367 Ga0070667_101688766 Ga0070667_1016887662 88
14 3300005617 Ga0068859_101908909 Ga0068859_1019089092 88
15 3300005841 Ga0068863_100371030 Ga0068863_1003710303 88
16 3300006358 Ga0068871_100216933 Ga0068871_1002169333 88
17 3300006931 Ga0097620_101909298 Ga0097620_1019092982 88
18 3300012512 Ga0157327_1077805 Ga0157327_10778051 89
19 3300041509 Ga0451843_1166635 Ga0451843_1166635_263_550 89
20 3300046454 Ga0495592_0183951 Ga0495592_0183951_963_1274 89
21 3300053148 Ga0500590_210174 Ga0500590_210174_423_734 89
22 3300026088 Ga0207641_10436561 Ga0207641_104365612 91
23 3300031507 Ga0307509_10160049 Ga0307509_101600492 91
24 3300046511 Ga0495608_0380208 Ga0495608_0380208_501_812 91
25 3300048917 Ga0496114_0549530 Ga0496114_0549530_266_577 91
26 3300053091 Ga0500647_0294610 Ga0500647_0294610_142_453 91
27 3300053140 Ga0500573_0160143 Ga0500573_0160143_260_571 91
28 3300053177 Ga0500636_0390505 Ga0500636_0390505_55_366 91
29 3300005364 Ga0070673_100145026 Ga0070673_1001450263 93
30 3300005456 Ga0070678_100630850 Ga0070678_1006308502 93
31 3300005543 Ga0070672_100074936 Ga0070672_1000749363 93
32 3300005616 Ga0068852_100552013 Ga0068852_1005520132 93
33 3300005618 Ga0068864_100407935 Ga0068864_1004079352 93
34 3300005718 Ga0068866_10205713 Ga0068866_102057132 93
35 3300005841 Ga0068863_100246333 Ga0068863_1002463333 93
36 3300005841 Ga0068863_100516454 Ga0068863_1005164543 93
37 3300006237 Ga0097621_100107483 Ga0097621_1001074833 93
38 3300013297 Ga0157378_11158758 Ga0157378_111587582 93
39 3300014325 Ga0163163_11031335 Ga0163163_110313351 93
40 3300014968 Ga0157379_11266112 Ga0157379_112661121 93
41 3300014969 Ga0157376_11018690 Ga0157376_110186901 93
42 3300048907 Ga0496104_1294369 Ga0496104_1294369_107_421 93
43 iso_pu_bacteria 2643221654 2644304091 93
44 3300005328 Ga0070676_10184425 Ga0070676_101844252 94
45 3300005330 Ga0070690_100133536 Ga0070690_1001335361 94
46 3300005331 Ga0070670_100597115 Ga0070670_1005971152 94
47 3300005333 Ga0070677_10299493 Ga0070677_102994932 94
48 3300005334 Ga0068869_100017070 Ga0068869_1000170703 94
49 3300005335 Ga0070666_10074189 Ga0070666_100741892 94
50 3300005338 Ga0068868_100018750 Ga0068868_1000187503 94
51 3300005340 Ga0070689_100284221 Ga0070689_1002842212 94
52 3300005343 Ga0070687_100426997 Ga0070687_1004269972 94
53 3300005354 Ga0070675_100031950 Ga0070675_1000319504 94
54 3300005355 Ga0070671_100058539 Ga0070671_1000585393 94
55 3300005356 Ga0070674_100807553 Ga0070674_1008075532 94
56 3300005364 Ga0070673_100003072 Ga0070673_1000030728 94
57 3300005365 Ga0070688_100532432 Ga0070688_1005324322 94
58 3300005367 Ga0070667_100026069 Ga0070667_1000260693 94
59 3300005441 Ga0070700_100409423 Ga0070700_1004094232 94
60 3300005456 Ga0070678_100001895 Ga0070678_1000018953 94
61 3300005457 Ga0070662_100497571 Ga0070662_1004975712 94
62 3300005459 Ga0068867_100612940 Ga0068867_1006129402 94
63 3300005539 Ga0068853_102092931 Ga0068853_1020929312 94
64 3300005544 Ga0070686_101485202 Ga0070686_1014852022 94
65 3300005564 Ga0070664_101365466 Ga0070664_1013654662 94
66 3300005578 Ga0068854_100391481 Ga0068854_1003914812 94
67 3300005616 Ga0068852_100016636 Ga0068852_1000166366 94
68 3300005617 Ga0068859_100006084 Ga0068859_1000060843 94
69 3300005618 Ga0068864_100016650 Ga0068864_1000166503 94
70 3300005718 Ga0068866_10425006 Ga0068866_104250062 94
71 3300005719 Ga0068861_100327840 Ga0068861_1003278402 94
72 3300005834 Ga0068851_10022932 Ga0068851_100229322 94
73 3300005841 Ga0068863_100017253 Ga0068863_1000172532 94
74 3300005842 Ga0068858_100018855 Ga0068858_1000188553 94
75 3300005843 Ga0068860_100969429 Ga0068860_1009694292 94
76 3300006237 Ga0097621_100032745 Ga0097621_1000327453 94
77 3300006358 Ga0068871_100213588 Ga0068871_1002135882 94
78 3300006931 Ga0097620_100006084 Ga0097620_1000060843 94
79 3300009098 Ga0105245_12862586 Ga0105245_128625861 94
80 3300009177 Ga0105248_10121531 Ga0105248_101215313 94
81 3300013296 Ga0157374_10020861 Ga0157374_100208616 94
82 3300013297 Ga0157378_10394325 Ga0157378_103943253 94
83 3300013306 Ga0163162_10382224 Ga0163162_103822243 94
84 3300014325 Ga0163163_10148503 Ga0163163_101485033 94
85 3300014745 Ga0157377_10165481 Ga0157377_101654812 94
86 3300014968 Ga0157379_10010120 Ga0157379_100101203 94
87 3300014969 Ga0157376_10311588 Ga0157376_103115883 94
88 3300017792 Ga0163161_10436226 Ga0163161_104362262 94
89 3300017792 Ga0163161_10779967 Ga0163161_107799672 94
90 3300025321 Ga0207656_10030751 Ga0207656_100307512 94
91 3300025893 Ga0207682_10049842 Ga0207682_100498422 94
92 3300025903 Ga0207680_10007478 Ga0207680_100074783 94
93 3300025907 Ga0207645_10193925 Ga0207645_101939252 94
94 3300025918 Ga0207662_10208925 Ga0207662_102089252 94
95 3300025923 Ga0207681_10699743 Ga0207681_106997432 94
96 3300025925 Ga0207650_10481654 Ga0207650_104816542 94
97 3300025926 Ga0207659_10014232 Ga0207659_100142323 94
98 3300025931 Ga0207644_10052986 Ga0207644_100529863 94
99 3300025933 Ga0207706_10411722 Ga0207706_104117223 94
100 3300025936 Ga0207670_10231615 Ga0207670_102316152 94
101 3300025937 Ga0207669_10121165 Ga0207669_101211652 94
102 3300025940 Ga0207691_10052613 Ga0207691_100526132 94
103 3300025941 Ga0207711_10021079 Ga0207711_100210796 94
104 3300025942 Ga0207689_10031595 Ga0207689_100315952 94
105 3300025945 Ga0207679_10598961 Ga0207679_105989612 94
106 3300025960 Ga0207651_10004673 Ga0207651_100046737 94
107 3300025960 Ga0207651_10039338 Ga0207651_100393382 94
108 3300025981 Ga0207640_10162658 Ga0207640_101626582 94
109 3300025986 Ga0207658_10020571 Ga0207658_100205713 94
110 3300026023 Ga0207677_10003814 Ga0207677_100038143 94
111 3300026035 Ga0207703_10008849 Ga0207703_100088493 94
112 3300026075 Ga0207708_10160831 Ga0207708_101608313 94
113 3300026088 Ga0207641_10002300 Ga0207641_1000230015 94
114 3300026088 Ga0207641_10234396 Ga0207641_102343962 94
115 3300026089 Ga0207648_10202928 Ga0207648_102029283 94
116 3300026095 Ga0207676_10032242 Ga0207676_100322423 94
117 3300026095 Ga0207676_10315699 Ga0207676_103156992 94
118 3300026118 Ga0207675_100182078 Ga0207675_1001820782 94
119 3300026121 Ga0207683_10009924 Ga0207683_100099247 94
120 3300026142 Ga0207698_10659331 Ga0207698_106593313 94
121 3300028381 Ga0268264_10549120 Ga0268264_105491202 94
122 3300048904 Ga0496101_0180669 Ga0496101_0180669_1149_1463 94
123 3300048908 Ga0496105_0722096 Ga0496105_0722096_200_514 94
124 3300048909 Ga0496106_0169444 Ga0496106_0169444_872_1186 94
125 3300048911 Ga0496108_0167208 Ga0496108_0167208_973_1287 94
126 3300048913 Ga0496110_0816931 Ga0496110_0816931_90_404 94
127 3300048914 Ga0496111_0207295 Ga0496111_0207295_400_714 94
128 3300048917 Ga0496114_0987976 Ga0496114_0987976_161_472 94
129 3300005333 Ga0070677_10503645 Ga0070677_105036452 95
130 3300005356 Ga0070674_100198471 Ga0070674_1001984712 95
131 3300005564 Ga0070664_101008498 Ga0070664_1010084982 95
132 3300005719 Ga0068861_100558116 Ga0068861_1005581162 95
133 3300014326 Ga0157380_10252016 Ga0157380_102520162 95
134 3300025893 Ga0207682_10418431 Ga0207682_104184312 95
135 3300025937 Ga0207669_10123273 Ga0207669_101232732 95
136 3300026118 Ga0207675_100664677 Ga0207675_1006646772 95
137 3300026121 Ga0207683_11704337 Ga0207683_117043372 95
138 3300032004 Ga0307414_10174618 Ga0307414_101746183 95
139 3300035725 Ga0373947_1097154 Ga0373947_1097154_61_363 95
140 3300036401 Ga0373937_0955671 Ga0373937_0955671_304_618 95
141 3300026121 Ga0207683_11521922 Ga0207683_115219222 96
142 3300046535 Ga0495586_0460853 Ga0495586_0460853_138_446 96
143 3300046681 Ga0495647_0056914 Ga0495647_0056914_359_667 96
144 3300046683 Ga0495658_0539703 Ga0495658_0539703_347_655 96
145 3300053077 Ga0495601_0930788 Ga0495601_0930788_122_430 96
146 3300053084 Ga0495595_0599681 Ga0495595_0599681_190_498 96
147 3300005331 Ga0070670_100002048 Ga0070670_1000020487 97
148 3300005331 Ga0070670_100048945 Ga0070670_1000489452 97
149 3300005331 Ga0070670_100088528 Ga0070670_1000885283 97
150 3300005331 Ga0070670_100832159 Ga0070670_1008321592 97
151 3300005333 Ga0070677_10010108 Ga0070677_100101084 97
152 3300005333 Ga0070677_10026730 Ga0070677_100267302 97
153 3300005334 Ga0068869_100091609 Ga0068869_1000916092 97
154 3300005338 Ga0068868_100010644 Ga0068868_1000106446 97
155 3300005338 Ga0068868_100053087 Ga0068868_1000530873 97
156 3300005340 Ga0070689_100525160 Ga0070689_1005251601 97
157 3300005340 Ga0070689_101049450 Ga0070689_1010494501 97
158 3300005345 Ga0070692_10964935 Ga0070692_109649352 97
159 3300005347 Ga0070668_100509589 Ga0070668_1005095893 97
160 3300005347 Ga0070668_100520932 Ga0070668_1005209322 97
161 3300005353 Ga0070669_100037703 Ga0070669_1000377034 97
162 3300005353 Ga0070669_101159185 Ga0070669_1011591852 97
163 3300005354 Ga0070675_100012448 Ga0070675_1000124486 97
164 3300005354 Ga0070675_100037552 Ga0070675_1000375524 97
165 3300005355 Ga0070671_100006025 Ga0070671_1000060253 97
166 3300005355 Ga0070671_100191660 Ga0070671_1001916603 97
167 3300005356 Ga0070674_100012726 Ga0070674_1000127263 97
168 3300005356 Ga0070674_100018236 Ga0070674_1000182363 97
169 3300005364 Ga0070673_100019451 Ga0070673_1000194514 97
170 3300005364 Ga0070673_101372576 Ga0070673_1013725761 97
171 3300005367 Ga0070667_100035293 Ga0070667_1000352933 97
172 3300005456 Ga0070678_100007671 Ga0070678_1000076716 97
173 3300005457 Ga0070662_100717437 Ga0070662_1007174372 97
174 3300005459 Ga0068867_100018743 Ga0068867_1000187434 97
175 3300005459 Ga0068867_100021533 Ga0068867_1000215332 97
176 3300005530 Ga0070679_101216217 Ga0070679_1012162172 97
177 3300005543 Ga0070672_100000556 Ga0070672_1000005563 97
178 3300005543 Ga0070672_100084451 Ga0070672_1000844513 97
179 3300005548 Ga0070665_100349546 Ga0070665_1003495462 97
180 3300005564 Ga0070664_100111426 Ga0070664_1001114262 97
181 3300005564 Ga0070664_100233075 Ga0070664_1002330752 97
182 3300005577 Ga0068857_100202074 Ga0068857_1002020743 97
183 3300005616 Ga0068852_100400678 Ga0068852_1004006782 97
184 3300005617 Ga0068859_100403071 Ga0068859_1004030712 97
185 3300005618 Ga0068864_100535381 Ga0068864_1005353812 97
186 3300005718 Ga0068866_10424953 Ga0068866_104249532 97
187 3300005719 Ga0068861_101503614 Ga0068861_1015036142 97
188 3300005719 Ga0068861_101943021 Ga0068861_1019430212 97
189 3300005834 Ga0068851_10912409 Ga0068851_109124091 97
190 3300005844 Ga0068862_101878111 Ga0068862_1018781111 97
191 3300006195 Ga0075366_10023190 Ga0075366_100231903 97
192 3300006195 Ga0075366_10179258 Ga0075366_101792582 97
193 3300006237 Ga0097621_100148369 Ga0097621_1001483693 97
194 3300006237 Ga0097621_100204467 Ga0097621_1002044672 97
195 3300006358 Ga0068871_100093997 Ga0068871_1000939973 97
196 3300006881 Ga0068865_100106466 Ga0068865_1001064663 97
197 3300006931 Ga0097620_100403075 Ga0097620_1004030752 97
198 3300009036 Ga0105244_10324843 Ga0105244_103248432 97
199 3300009094 Ga0111539_10424034 Ga0111539_104240343 97
200 3300009098 Ga0105245_10639337 Ga0105245_106393372 97
201 3300009148 Ga0105243_10168213 Ga0105243_101682132 97
202 3300009553 Ga0105249_11749942 Ga0105249_117499422 97
203 3300011119 Ga0105246_11393175 Ga0105246_113931752 97
204 3300013296 Ga0157374_10463718 Ga0157374_104637182 97
205 3300013297 Ga0157378_10250530 Ga0157378_102505302 97
206 3300013306 Ga0163162_10183218 Ga0163162_101832183 97
207 3300013308 Ga0157375_10075696 Ga0157375_100756964 97
208 3300013308 Ga0157375_10260662 Ga0157375_102606622 97
209 3300014325 Ga0163163_11367113 Ga0163163_113671131 97
210 3300014968 Ga0157379_11095155 Ga0157379_110951552 97
211 3300014969 Ga0157376_11062436 Ga0157376_110624362 97
212 3300017792 Ga0163161_10263539 Ga0163161_102635392 97
213 3300017792 Ga0163161_10267244 Ga0163161_102672442 97
214 3300025321 Ga0207656_10435054 Ga0207656_104350542 97
215 3300025893 Ga0207682_10002798 Ga0207682_100027983 97
216 3300025899 Ga0207642_10217890 Ga0207642_102178902 97
217 3300025901 Ga0207688_10051580 Ga0207688_100515802 97
218 3300025901 Ga0207688_10413580 Ga0207688_104135802 97
219 3300025907 Ga0207645_10007554 Ga0207645_100075547 97
220 3300025907 Ga0207645_10034917 Ga0207645_100349173 97
221 3300025923 Ga0207681_10033049 Ga0207681_100330493 97
222 3300025923 Ga0207681_10686797 Ga0207681_106867972 97
223 3300025925 Ga0207650_10000348 Ga0207650_1000034812 97
224 3300025925 Ga0207650_10284044 Ga0207650_102840442 97
225 3300025925 Ga0207650_10428009 Ga0207650_104280092 97
226 3300025925 Ga0207650_11804990 Ga0207650_118049902 97
227 3300025926 Ga0207659_10000583 Ga0207659_100005839 97
228 3300025926 Ga0207659_11800545 Ga0207659_118005452 97
229 3300025927 Ga0207687_10211632 Ga0207687_102116322 97
230 3300025931 Ga0207644_10005232 Ga0207644_100052323 97
231 3300025931 Ga0207644_10034321 Ga0207644_100343214 97
232 3300025933 Ga0207706_10831125 Ga0207706_108311252 97
233 3300025935 Ga0207709_10229502 Ga0207709_102295022 97
234 3300025936 Ga0207670_10238795 Ga0207670_102387951 97
235 3300025937 Ga0207669_10008088 Ga0207669_100080886 97
236 3300025938 Ga0207704_10050252 Ga0207704_100502522 97
237 3300025938 Ga0207704_10494722 Ga0207704_104947222 97
238 3300025940 Ga0207691_10040440 Ga0207691_100404404 97
239 3300025940 Ga0207691_10324178 Ga0207691_103241782 97
240 3300025942 Ga0207689_10095823 Ga0207689_100958233 97
241 3300025945 Ga0207679_10321562 Ga0207679_103215622 97
242 3300025960 Ga0207651_10280292 Ga0207651_102802923 97
243 3300025960 Ga0207651_11966971 Ga0207651_119669712 97
244 3300025972 Ga0207668_10153059 Ga0207668_101530592 97
245 3300025972 Ga0207668_10356237 Ga0207668_103562373 97
246 3300025981 Ga0207640_10525867 Ga0207640_105258672 97
247 3300025986 Ga0207658_10070079 Ga0207658_100700792 97
248 3300026023 Ga0207677_10375101 Ga0207677_103751013 97
249 3300026067 Ga0207678_11490600 Ga0207678_114906002 97
250 3300026075 Ga0207708_11203673 Ga0207708_112036732 97
251 3300026089 Ga0207648_10014921 Ga0207648_100149213 97
252 3300026089 Ga0207648_10016497 Ga0207648_100164973 97
253 3300026089 Ga0207648_10075240 Ga0207648_100752403 97
254 3300026116 Ga0207674_10101334 Ga0207674_101013343 97
255 3300026118 Ga0207675_102337014 Ga0207675_1023370141 97
256 3300026121 Ga0207683_10141670 Ga0207683_101416702 97
257 3300026121 Ga0207683_10278360 Ga0207683_102783602 97
258 3300028380 Ga0268265_11089431 Ga0268265_110894312 97
259 3300028786 Ga0307517_10000173 Ga0307517_100001733 97
260 3300028794 Ga0307515_10089385 Ga0307515_100893854 97
261 3300028794 Ga0307515_10162825 Ga0307515_101628253 97
262 3300028794 Ga0307515_10291152 Ga0307515_102911522 97
263 3300028794 Ga0307515_10331801 Ga0307515_103318013 97
264 3300030522 Ga0307512_10049347 Ga0307512_100493472 97
265 3300030522 Ga0307512_10059848 Ga0307512_100598482 97
266 3300031456 Ga0307513_10030756 Ga0307513_100307563 97
267 3300031456 Ga0307513_10109519 Ga0307513_101095192 97
268 3300031507 Ga0307509_10050392 Ga0307509_100503924 97
269 3300031507 Ga0307509_10053814 Ga0307509_100538144 97
270 3300031507 Ga0307509_10175044 Ga0307509_101750441 97
271 3300031507 Ga0307509_10839467 Ga0307509_108394672 97
272 3300031616 Ga0307508_10000738 Ga0307508_100007387 97
273 3300031616 Ga0307508_10340777 Ga0307508_103407772 97
274 3300031730 Ga0307516_10136356 Ga0307516_101363563 97
275 3300031731 Ga0307405_10002174 Ga0307405_100021747 97
276 3300031731 Ga0307405_10886948 Ga0307405_108869482 97
277 3300031838 Ga0307518_10426021 Ga0307518_104260212 97
278 3300031901 Ga0307406_10160694 Ga0307406_101606942 97
279 3300031903 Ga0307407_10016152 Ga0307407_100161523 97
280 3300031911 Ga0307412_10055698 Ga0307412_100556983 97
281 3300031995 Ga0307409_101452959 Ga0307409_1014529592 97
282 3300031995 Ga0307409_101876405 Ga0307409_1018764052 97
283 3300032002 Ga0307416_100002959 Ga0307416_1000029598 97
284 3300032002 Ga0307416_101035753 Ga0307416_1010357532 97
285 3300032004 Ga0307414_10393865 Ga0307414_103938652 97
286 3300032005 Ga0307411_10118014 Ga0307411_101180143 97
287 3300032005 Ga0307411_10737774 Ga0307411_107377742 97
288 3300032126 Ga0307415_101336537 Ga0307415_1013365372 97
289 3300033179 Ga0307507_10195459 Ga0307507_101954592 97
290 3300033179 Ga0307507_10247572 Ga0307507_102475721 97
291 3300033180 Ga0307510_10001034 Ga0307510_1000103427 97
292 3300033180 Ga0307510_10197173 Ga0307510_101971733 97
293 3300033180 Ga0307510_10662132 Ga0307510_106621322 97
294 3300035084 Ga0373928_0039245 Ga0373928_0039245_527_838 97
295 3300035691 Ga0373931_0891642 Ga0373931_0891642_48_359 97
296 3300041452 Ga0451793_0301768 Ga0451793_0301768_52_363 97
297 3300041458 Ga0451798_0746032 Ga0451798_0746032_284_595 97
298 3300041486 Ga0451807_0244690 Ga0451807_0244690_114_425 97
299 3300041507 Ga0451851_1352704 Ga0451851_1352704_63_374 97
300 3300046454 Ga0495592_0000234 Ga0495592_0000234_45820_46131 97
301 3300046460 Ga0495638_0129775 Ga0495638_0129775_417_728 97
302 3300046473 Ga0495582_0363670 Ga0495582_0363670_435_746 97
303 3300046512 Ga0495610_0055804 Ga0495610_0055804_447_758 97
304 3300046516 Ga0495628_0541018 Ga0495628_0541018_91_402 97
305 3300046517 Ga0495630_0095573 Ga0495630_0095573_49_360 97
306 3300046519 Ga0495632_0071188 Ga0495632_0071188_521_832 97
307 3300046519 Ga0495632_0159626 Ga0495632_0159626_571_882 97
308 3300046524 Ga0495648_0083206 Ga0495648_0083206_1414_1725 97
309 3300046535 Ga0495586_0249774 Ga0495586_0249774_497_808 97
310 3300046557 Ga0495622_0142242 Ga0495622_0142242_132_443 97
311 3300046616 Ga0495668_0115134 Ga0495668_0115134_1071_1382 97
312 3300046648 Ga0495611_0341401 Ga0495611_0341401_176_487 97
313 3300046660 Ga0495625_0323826 Ga0495625_0323826_72_383 97
314 3300046680 Ga0495646_0207646 Ga0495646_0207646_99_410 97
315 3300046683 Ga0495658_0028770 Ga0495658_0028770_806_1117 97
316 3300046683 Ga0495658_0311390 Ga0495658_0311390_546_857 97
317 3300046690 Ga0495624_0017157 Ga0495624_0017157_747_1058 97
318 3300047321 Ga0495676_0114566 Ga0495676_0114566_940_1251 97
319 3300047323 Ga0495683_0296305 Ga0495683_0296305_348_659 97
320 3300047444 Ga0495675_0223797 Ga0495675_0223797_408_719 97
321 3300048924 Ga0496121_0366734 Ga0496121_0366734_185_499 97
322 3300049459 Ga0495678_223737 Ga0495678_223737_234_545 97
323 3300050489 nmdc:mga03683_55825_c1 nmdc:mga03683_55825_c1_1277_1588 97
324 3300050493 nmdc:mga0k408_147931_c1 nmdc:mga0k408_147931_c1_806_1126 97
325 3300050493 nmdc:mga0k408_521054_c1 nmdc:mga0k408_521054_c1_167_481 97
326 3300050493 nmdc:mga0k408_5343_c1 nmdc:mga0k408_5343_c1_621_932 97
327 3300050496 nmdc:mga07m45_417047_c1 nmdc:mga07m45_417047_c1_82_393 97
328 3300050511 nmdc:mga08y16_899569_c1 nmdc:mga08y16_899569_c1_311_622 97
329 3300050516 nmdc:mga0sz30_352752_c1 nmdc:mga0sz30_352752_c1_116_430 97
330 3300053088 Ga0500644_0008644 Ga0500644_0008644_166_477 97
331 3300053092 Ga0500583_0067135 Ga0500583_0067135_605_916 97
332 3300053093 Ga0500651_0040675 Ga0500651_0040675_557_868 97
333 3300053098 Ga0500650_0112775 Ga0500650_0112775_112_423 97
334 3300053098 Ga0500650_0355014 Ga0500650_0355014_132_443 97
335 3300053118 Ga0500594_0023894 Ga0500594_0023894_1109_1420 97
336 3300053121 Ga0500607_232469 Ga0500607_232469_318_632 97
337 3300053131 Ga0500652_248080 Ga0500652_248080_20_334 97
338 3300053136 Ga0500559_0000262 Ga0500559_0000262_7002_7313 97
339 3300053138 Ga0500564_121366 Ga0500564_121366_157_468 97
340 3300053151 Ga0500604_0311153 Ga0500604_0311153_63_374 97
341 3300053153 Ga0500616_0192579 Ga0500616_0192579_362_673 97
342 3300053154 Ga0500619_014471 Ga0500619_014471_1244_1555 97
343 3300053154 Ga0500619_267121 Ga0500619_267121_121_435 97
344 3300053156 Ga0500622_0002641 Ga0500622_0002641_1163_1474 97
345 3300053177 Ga0500636_0355069 Ga0500636_0355069_70_381 97
346 3300053736 Ga0500599_011466 Ga0500599_011466_211_522 97
347 3300053739 Ga0500587_009905 Ga0500587_009905_686_997 97
348 3300005456 Ga0070678_100173436 Ga0070678_1001734363 98
349 3300005539 Ga0068853_100056675 Ga0068853_1000566753 98
350 3300005616 Ga0068852_100062538 Ga0068852_1000625382 98
351 3300005834 Ga0068851_10437783 Ga0068851_104377832 98
352 3300006846 Ga0075430_100145784 Ga0075430_1001457843 98
353 3300006880 Ga0075429_100128059 Ga0075429_1001280593 98
354 3300009093 Ga0105240_10015269 Ga0105240_100152694 98
355 3300009174 Ga0105241_11019532 Ga0105241_110195322 98
356 3300009545 Ga0105237_10001569 Ga0105237_1000156921 98
357 3300009551 Ga0105238_10011025 Ga0105238_100110257 98
358 3300010375 Ga0105239_10000486 Ga0105239_1000048627 98
359 3300025914 Ga0207671_10006936 Ga0207671_100069367 98
360 3300025924 Ga0207694_10017774 Ga0207694_100177744 98
361 3300026121 Ga0207683_10050891 Ga0207683_100508912 98
362 3300026142 Ga0207698_10004331 Ga0207698_100043316 98
363 3300028379 Ga0268266_10971025 Ga0268266_109710252 98
364 3300032005 Ga0307411_11056610 Ga0307411_110566101 98
365 3300041503 Ga0451847_0322153 Ga0451847_0322153_37_357 98
366 3300050508 nmdc:mga09592_2954_c1 nmdc:mga09592_2954_c1_1153_1467 98
367 3300050509 nmdc:mga0qj67_37390_c1 nmdc:mga0qj67_37390_c1_2891_3205 98
368 3300005445 Ga0070708_100678062 Ga0070708_1006780622 99
369 3300005455 Ga0070663_100001309 Ga0070663_1000013098 99
370 3300005467 Ga0070706_101296912 Ga0070706_1012969122 99
371 3300005718 Ga0068866_10801482 Ga0068866_108014822 99
372 3300006177 Ga0075362_10371837 Ga0075362_103718372 99
373 3300006195 Ga0075366_10023780 Ga0075366_100237803 99
374 3300006195 Ga0075366_10234084 Ga0075366_102340842 99
375 3300011119 Ga0105246_11972286 Ga0105246_119722862 99
376 3300013100 Ga0157373_10814614 Ga0157373_108146142 99
377 3300013297 Ga0157378_11194890 Ga0157378_111948902 99
378 3300014325 Ga0163163_11486655 Ga0163163_114866552 99
379 3300014969 Ga0157376_11231925 Ga0157376_112319251 99
380 3300025922 Ga0207646_10916814 Ga0207646_109168142 99
381 3300025972 Ga0207668_10335248 Ga0207668_103352482 99
382 3300026067 Ga0207678_10003783 Ga0207678_100037834 99
383 3300026121 Ga0207683_10567821 Ga0207683_105678212 99
384 3300028379 Ga0268266_10758396 Ga0268266_107583962 99
385 3300031548 Ga0307408_100120697 Ga0307408_1001206973 99
386 3300031548 Ga0307408_100449412 Ga0307408_1004494122 99
387 3300031548 Ga0307408_101612929 Ga0307408_1016129291 99
388 3300031824 Ga0307413_10733549 Ga0307413_107335492 99
389 3300031852 Ga0307410_10457974 Ga0307410_104579742 99
390 3300031901 Ga0307406_11170277 Ga0307406_111702772 99
391 3300031901 Ga0307406_11579764 Ga0307406_115797642 99
392 3300031903 Ga0307407_10142732 Ga0307407_101427322 99
393 3300031995 Ga0307409_100176604 Ga0307409_1001766042 99
394 3300031995 Ga0307409_100965120 Ga0307409_1009651201 99
395 3300032005 Ga0307411_10347968 Ga0307411_103479682 99
396 3300034957 Ga0373938_0048547 Ga0373938_0048547_492_809 99
397 3300035114 Ga0373939_0019235 Ga0373939_0019235_771_1088 99
398 3300037471 Ga0395905_0030862 Ga0395905_0030862_2669_2986 99
399 3300042134 Ga0450898_084372 Ga0450898_084372_143_457 99
400 3300049523 Ga0501300_025195 Ga0501300_025195_527_841 99
401 3300049579 Ga0501043_0000038 Ga0501043_0000038_1205_1522 99
402 3300049580 Ga0501046_0000049 Ga0501046_0000049_127158_127475 99
403 3300049581 Ga0501047_0000039 Ga0501047_0000039_60398_60715 99
404 3300049582 Ga0501048_0011326 Ga0501048_0011326_5255_5572 99
405 3300049649 Ga0501198_000058 Ga0501198_000058_1272_1589 99
406 3300049653 Ga0501206_034761 Ga0501206_034761_347_661 99
407 3300049662 Ga0501222_000066 Ga0501222_000066_1413_1730 99
408 3300049686 Ga0501257_021230 Ga0501257_021230_834_1148 99
409 3300049744 Ga0501083_0505031 Ga0501083_0505031_167_484 99
410 3300049759 Ga0501262_009888 Ga0501262_009888_324_638 99
411 3300049762 Ga0501265_003351 Ga0501265_003351_990_1304 99
412 3300049770 Ga0501273_091386 Ga0501273_091386_54_368 99
413 3300049823 Ga0501044_0175870 Ga0501044_0175870_626_943 99
414 3300049824 Ga0501045_0007021 Ga0501045_0007021_1255_1572 99
415 3300050493 nmdc:mga0k408_286076_c1 nmdc:mga0k408_286076_c1_542_856 99
416 3300005340 Ga0070689_101116316 Ga0070689_1011163162 100
417 3300005354 Ga0070675_100299381 Ga0070675_1002993812 100
418 3300005459 Ga0068867_100000642 Ga0068867_10000064214 100
419 3300005543 Ga0070672_100123155 Ga0070672_1001231552 100
420 3300009148 Ga0105243_10027612 Ga0105243_100276124 100
421 3300013297 Ga0157378_10352979 Ga0157378_103529792 100
422 3300014745 Ga0157377_10000052 Ga0157377_1000005211 100
423 3300014745 Ga0157377_10134587 Ga0157377_101345872 100
424 3300025923 Ga0207681_11361911 Ga0207681_113619112 100
425 3300025926 Ga0207659_10069861 Ga0207659_100698613 100
426 3300025935 Ga0207709_10007425 Ga0207709_100074257 100
427 3300025986 Ga0207658_10975899 Ga0207658_109758992 100
428 3300026089 Ga0207648_10001074 Ga0207648_100010743 100
429 3300031456 Ga0307513_10146635 Ga0307513_101466352 100
430 3300049683 Ga0501253_130541 Ga0501253_130541_175_498 100
431 3300050493 nmdc:mga0k408_873488_c1 nmdc:mga0k408_873488_c1_110_430 100
432 3300005466 Ga0070685_10761647 Ga0070685_107616472 101
433 3300005327 Ga0070658_10058793 Ga0070658_100587932 102
434 3300005327 Ga0070658_10336488 Ga0070658_103364882 102
435 3300005328 Ga0070676_10019591 Ga0070676_100195914 102
436 3300005328 Ga0070676_10047823 Ga0070676_100478233 102
437 3300005328 Ga0070676_10065683 Ga0070676_100656833 102
438 3300005328 Ga0070676_10498903 Ga0070676_104989032 102
439 3300005329 Ga0070683_100033736 Ga0070683_1000337363 102
440 3300005330 Ga0070690_100054342 Ga0070690_1000543422 102
441 3300005330 Ga0070690_100321216 Ga0070690_1003212162 102
442 3300005331 Ga0070670_100027077 Ga0070670_1000270773 102
443 3300005331 Ga0070670_100056760 Ga0070670_1000567603 102
444 3300005331 Ga0070670_100069450 Ga0070670_1000694503 102
445 3300005331 Ga0070670_100112972 Ga0070670_1001129723 102
446 3300005331 Ga0070670_100579613 Ga0070670_1005796132 102
447 3300005331 Ga0070670_100774365 Ga0070670_1007743652 102
448 3300005331 Ga0070670_100892644 Ga0070670_1008926442 102
449 3300005333 Ga0070677_10031430 Ga0070677_100314303 102
450 3300005333 Ga0070677_10084808 Ga0070677_100848082 102
451 3300005333 Ga0070677_10243698 Ga0070677_102436981 102
452 3300005333 Ga0070677_10482866 Ga0070677_104828662 102
453 3300005334 Ga0068869_100012173 Ga0068869_1000121735 102
454 3300005334 Ga0068869_100025577 Ga0068869_1000255773 102
455 3300005335 Ga0070666_10129261 Ga0070666_101292612 102
456 3300005335 Ga0070666_10277513 Ga0070666_102775132 102
457 3300005335 Ga0070666_10300236 Ga0070666_103002361 102
458 3300005335 Ga0070666_10827474 Ga0070666_108274742 102
459 3300005336 Ga0070680_100009759 Ga0070680_1000097597 102
460 3300005337 Ga0070682_100199716 Ga0070682_1001997161 102
461 3300005338 Ga0068868_100031049 Ga0068868_1000310494 102
462 3300005338 Ga0068868_100627762 Ga0068868_1006277621 102
463 3300005338 Ga0068868_100680352 Ga0068868_1006803521 102
464 3300005339 Ga0070660_100832667 Ga0070660_1008326672 102
465 3300005339 Ga0070660_100857877 Ga0070660_1008578772 102
466 3300005340 Ga0070689_100242167 Ga0070689_1002421672 102
467 3300005343 Ga0070687_100045771 Ga0070687_1000457712 102
468 3300005343 Ga0070687_100258931 Ga0070687_1002589313 102
469 3300005344 Ga0070661_100627784 Ga0070661_1006277842 102
470 3300005344 Ga0070661_101243292 Ga0070661_1012432922 102
471 3300005345 Ga0070692_10958293 Ga0070692_109582931 102
472 3300005347 Ga0070668_100007413 Ga0070668_1000074132 102
473 3300005347 Ga0070668_101221492 Ga0070668_1012214922 102
474 3300005353 Ga0070669_100005073 Ga0070669_1000050733 102
475 3300005353 Ga0070669_100033288 Ga0070669_1000332883 102
476 3300005353 Ga0070669_101206703 Ga0070669_1012067032 102
477 3300005353 Ga0070669_101818049 Ga0070669_1018180492 102
478 3300005354 Ga0070675_100003224 Ga0070675_1000032244 102
479 3300005354 Ga0070675_100060803 Ga0070675_1000608033 102
480 3300005354 Ga0070675_100086553 Ga0070675_1000865533 102
481 3300005354 Ga0070675_100477909 Ga0070675_1004779093 102
482 3300005354 Ga0070675_100499962 Ga0070675_1004999622 102
483 3300005354 Ga0070675_100734153 Ga0070675_1007341531 102
484 3300005354 Ga0070675_100782719 Ga0070675_1007827192 102
485 3300005355 Ga0070671_100075668 Ga0070671_1000756684 102
486 3300005355 Ga0070671_100694176 Ga0070671_1006941762 102
487 3300005355 Ga0070671_100816398 Ga0070671_1008163982 102
488 3300005355 Ga0070671_101027924 Ga0070671_1010279241 102
489 3300005356 Ga0070674_100013607 Ga0070674_1000136076 102
490 3300005356 Ga0070674_101080575 Ga0070674_1010805752 102
491 3300005356 Ga0070674_101352197 Ga0070674_1013521972 102
492 3300005356 Ga0070674_102022094 Ga0070674_1020220941 102
493 3300005364 Ga0070673_100131219 Ga0070673_1001312192 102
494 3300005364 Ga0070673_100410431 Ga0070673_1004104312 102
495 3300005364 Ga0070673_100543674 Ga0070673_1005436743 102
496 3300005364 Ga0070673_100762300 Ga0070673_1007623002 102
497 3300005364 Ga0070673_100820450 Ga0070673_1008204501 102
498 3300005364 Ga0070673_100957642 Ga0070673_1009576422 102
499 3300005366 Ga0070659_100011889 Ga0070659_1000118897 102
500 3300005366 Ga0070659_100018169 Ga0070659_1000181693 102
501 3300005366 Ga0070659_100203882 Ga0070659_1002038822 102
502 3300005367 Ga0070667_100008961 Ga0070667_1000089613 102
503 3300005367 Ga0070667_100095130 Ga0070667_1000951303 102
504 3300005367 Ga0070667_100251054 Ga0070667_1002510543 102
505 3300005367 Ga0070667_100331751 Ga0070667_1003317512 102
506 3300005367 Ga0070667_101573398 Ga0070667_1015733982 102
507 3300005438 Ga0070701_10246032 Ga0070701_102460323 102
508 3300005441 Ga0070700_100076306 Ga0070700_1000763063 102
509 3300005455 Ga0070663_100015103 Ga0070663_1000151034 102
510 3300005455 Ga0070663_100077979 Ga0070663_1000779792 102
511 3300005455 Ga0070663_100422419 Ga0070663_1004224192 102
512 3300005456 Ga0070678_100073477 Ga0070678_1000734773 102
513 3300005456 Ga0070678_100080791 Ga0070678_1000807912 102
514 3300005456 Ga0070678_100563879 Ga0070678_1005638792 102
515 3300005456 Ga0070678_101761916 Ga0070678_1017619162 102
516 3300005456 Ga0070678_102273122 Ga0070678_1022731221 102
517 3300005457 Ga0070662_100028876 Ga0070662_1000288763 102
518 3300005457 Ga0070662_100141047 Ga0070662_1001410473 102
519 3300005457 Ga0070662_100347539 Ga0070662_1003475393 102
520 3300005457 Ga0070662_100430677 Ga0070662_1004306772 102
521 3300005457 Ga0070662_100539438 Ga0070662_1005394381 102
522 3300005457 Ga0070662_101122899 Ga0070662_1011228992 102
523 3300005458 Ga0070681_10338724 Ga0070681_103387242 102
524 3300005458 Ga0070681_10571099 Ga0070681_105710992 102
525 3300005459 Ga0068867_100058810 Ga0068867_1000588103 102
526 3300005459 Ga0068867_100120849 Ga0068867_1001208492 102
527 3300005459 Ga0068867_101641707 Ga0068867_1016417071 102
528 3300005468 Ga0070707_101602619 Ga0070707_1016026192 102
529 3300005530 Ga0070679_100005910 Ga0070679_1000059104 102
530 3300005530 Ga0070679_101204174 Ga0070679_1012041741 102
531 3300005530 Ga0070679_101560032 Ga0070679_1015600322 102
532 3300005535 Ga0070684_100344415 Ga0070684_1003444153 102
533 3300005539 Ga0068853_100024777 Ga0068853_1000247774 102
534 3300005539 Ga0068853_101035323 Ga0068853_1010353232 102
535 3300005539 Ga0068853_101532422 Ga0068853_1015324222 102
536 3300005543 Ga0070672_100031086 Ga0070672_1000310864 102
537 3300005543 Ga0070672_100035268 Ga0070672_1000352683 102
538 3300005543 Ga0070672_100046034 Ga0070672_1000460342 102
539 3300005543 Ga0070672_100103215 Ga0070672_1001032153 102
540 3300005543 Ga0070672_100117126 Ga0070672_1001171263 102
541 3300005543 Ga0070672_100371159 Ga0070672_1003711592 102
542 3300005544 Ga0070686_100112647 Ga0070686_1001126472 102
543 3300005545 Ga0070695_100356570 Ga0070695_1003565702 102
544 3300005547 Ga0070693_100932884 Ga0070693_1009328842 102
545 3300005548 Ga0070665_100405384 Ga0070665_1004053842 102
546 3300005548 Ga0070665_100690840 Ga0070665_1006908402 102
547 3300005548 Ga0070665_100752282 Ga0070665_1007522822 102
548 3300005548 Ga0070665_102045678 Ga0070665_1020456781 102
549 3300005549 Ga0070704_100508124 Ga0070704_1005081242 102
550 3300005563 Ga0068855_100066039 Ga0068855_1000660394 102
551 3300005563 Ga0068855_100412939 Ga0068855_1004129392 102
552 3300005564 Ga0070664_100145261 Ga0070664_1001452612 102
553 3300005564 Ga0070664_100178886 Ga0070664_1001788863 102
554 3300005564 Ga0070664_100276244 Ga0070664_1002762442 102
555 3300005564 Ga0070664_100674737 Ga0070664_1006747372 102
556 3300005564 Ga0070664_100834392 Ga0070664_1008343922 102
557 3300005564 Ga0070664_101357878 Ga0070664_1013578782 102
558 3300005564 Ga0070664_101444025 Ga0070664_1014440252 102
559 3300005577 Ga0068857_100094200 Ga0068857_1000942003 102
560 3300005578 Ga0068854_100016864 Ga0068854_1000168644 102
561 3300005614 Ga0068856_100129957 Ga0068856_1001299573 102
562 3300005614 Ga0068856_100136686 Ga0068856_1001366863 102
563 3300005614 Ga0068856_100414739 Ga0068856_1004147393 102
564 3300005615 Ga0070702_100531188 Ga0070702_1005311881 102
565 3300005616 Ga0068852_100014893 Ga0068852_1000148933 102
566 3300005616 Ga0068852_100090637 Ga0068852_1000906373 102
567 3300005616 Ga0068852_100094656 Ga0068852_1000946563 102
568 3300005616 Ga0068852_100261225 Ga0068852_1002612252 102
569 3300005616 Ga0068852_100865932 Ga0068852_1008659322 102
570 3300005616 Ga0068852_101483298 Ga0068852_1014832982 102
571 3300005616 Ga0068852_102078317 Ga0068852_1020783172 102
572 3300005616 Ga0068852_102535526 Ga0068852_1025355262 102
573 3300005617 Ga0068859_100070397 Ga0068859_1000703973 102
574 3300005618 Ga0068864_100031659 Ga0068864_1000316593 102
575 3300005618 Ga0068864_100065319 Ga0068864_1000653193 102
576 3300005618 Ga0068864_100080246 Ga0068864_1000802463 102
577 3300005618 Ga0068864_100551872 Ga0068864_1005518722 102
578 3300005618 Ga0068864_100560329 Ga0068864_1005603293 102
579 3300005618 Ga0068864_101251714 Ga0068864_1012517141 102
580 3300005718 Ga0068866_10457995 Ga0068866_104579953 102
581 3300005718 Ga0068866_10709988 Ga0068866_107099882 102
582 3300005719 Ga0068861_100011424 Ga0068861_1000114243 102
583 3300005719 Ga0068861_100023590 Ga0068861_1000235903 102
584 3300005719 Ga0068861_100398616 Ga0068861_1003986162 102
585 3300005834 Ga0068851_10076090 Ga0068851_100760903 102
586 3300005834 Ga0068851_10227290 Ga0068851_102272902 102
587 3300005834 Ga0068851_10283165 Ga0068851_102831652 102
588 3300005840 Ga0068870_10748004 Ga0068870_107480042 102
589 3300005840 Ga0068870_10882354 Ga0068870_108823542 102
590 3300005841 Ga0068863_100024199 Ga0068863_1000241993 102
591 3300005841 Ga0068863_100335406 Ga0068863_1003354062 102
592 3300005841 Ga0068863_101160718 Ga0068863_1011607181 102
593 3300005842 Ga0068858_100024676 Ga0068858_1000246766 102
594 3300005842 Ga0068858_100073309 Ga0068858_1000733093 102
595 3300005842 Ga0068858_100075568 Ga0068858_1000755683 102
596 3300005842 Ga0068858_100489250 Ga0068858_1004892502 102
597 3300005843 Ga0068860_100005841 Ga0068860_10000584110 102
598 3300005843 Ga0068860_100116688 Ga0068860_1001166883 102
599 3300005843 Ga0068860_100851194 Ga0068860_1008511942 102
600 3300005844 Ga0068862_101024243 Ga0068862_1010242432 102
601 3300006173 Ga0070716_100266048 Ga0070716_1002660483 102
602 3300006237 Ga0097621_100065895 Ga0097621_1000658953 102
603 3300006237 Ga0097621_100079659 Ga0097621_1000796592 102
604 3300006237 Ga0097621_100614509 Ga0097621_1006145092 102
605 3300006358 Ga0068871_100114047 Ga0068871_1001140473 102
606 3300006358 Ga0068871_100130403 Ga0068871_1001304032 102
607 3300006358 Ga0068871_100305890 Ga0068871_1003058902 102
608 3300006358 Ga0068871_100335356 Ga0068871_1003353562 102
609 3300006358 Ga0068871_100342524 Ga0068871_1003425242 102
610 3300006871 Ga0075434_100450734 Ga0075434_1004507343 102
611 3300006880 Ga0075429_101359730 Ga0075429_1013597302 102
612 3300006881 Ga0068865_100027153 Ga0068865_1000271534 102
613 3300006881 Ga0068865_100204575 Ga0068865_1002045752 102
614 3300006881 Ga0068865_100378676 Ga0068865_1003786763 102
615 3300006914 Ga0075436_100665807 Ga0075436_1006658072 102
616 3300006931 Ga0097620_100070394 Ga0097620_1000703943 102
617 3300007076 Ga0075435_100744455 Ga0075435_1007444552 102
618 3300009093 Ga0105240_10283164 Ga0105240_102831643 102
619 3300009094 Ga0111539_10267976 Ga0111539_102679763 102
620 3300009094 Ga0111539_10289122 Ga0111539_102891223 102
621 3300009098 Ga0105245_10108671 Ga0105245_101086713 102
622 3300009098 Ga0105245_10870356 Ga0105245_108703562 102
623 3300009101 Ga0105247_10773101 Ga0105247_107731011 102
624 3300009148 Ga0105243_10023684 Ga0105243_100236846 102
625 3300009148 Ga0105243_10487973 Ga0105243_104879732 102
626 3300009148 Ga0105243_11404104 Ga0105243_114041042 102
627 3300009148 Ga0105243_11435905 Ga0105243_114359051 102
628 3300009176 Ga0105242_10143125 Ga0105242_101431253 102
629 3300009176 Ga0105242_10638069 Ga0105242_106380692 102
630 3300009177 Ga0105248_10066287 Ga0105248_100662874 102
631 3300009177 Ga0105248_10193409 Ga0105248_101934092 102
632 3300009177 Ga0105248_10271747 Ga0105248_102717472 102
633 3300009177 Ga0105248_10484692 Ga0105248_104846922 102
634 3300009545 Ga0105237_10096291 Ga0105237_100962912 102
635 3300009551 Ga0105238_10124517 Ga0105238_101245173 102
636 3300009553 Ga0105249_10137749 Ga0105249_101377492 102
637 3300010375 Ga0105239_10295005 Ga0105239_102950053 102
638 3300010375 Ga0105239_10954720 Ga0105239_109547202 102
639 3300013100 Ga0157373_10024144 Ga0157373_100241443 102
640 3300013102 Ga0157371_10138859 Ga0157371_101388592 102
641 3300013105 Ga0157369_10062981 Ga0157369_100629813 102
642 3300013296 Ga0157374_10031304 Ga0157374_100313043 102
643 3300013296 Ga0157374_10321419 Ga0157374_103214192 102
644 3300013296 Ga0157374_11757986 Ga0157374_117579862 102
645 3300013297 Ga0157378_10990661 Ga0157378_109906612 102
646 3300013297 Ga0157378_11799559 Ga0157378_117995592 102
647 3300013306 Ga0163162_10001541 Ga0163162_1000154120 102
648 3300013306 Ga0163162_10070367 Ga0163162_100703673 102
649 3300013306 Ga0163162_10305079 Ga0163162_103050793 102
650 3300013306 Ga0163162_10499622 Ga0163162_104996223 102
651 3300013306 Ga0163162_11364280 Ga0163162_113642802 102
652 3300013307 Ga0157372_10073108 Ga0157372_100731084 102
653 3300013307 Ga0157372_10093451 Ga0157372_100934513 102
654 3300013308 Ga0157375_10079558 Ga0157375_100795584 102
655 3300013308 Ga0157375_10092138 Ga0157375_100921382 102
656 3300013308 Ga0157375_10612496 Ga0157375_106124963 102
657 3300013308 Ga0157375_10788862 Ga0157375_107888621 102
658 3300014325 Ga0163163_10259237 Ga0163163_102592372 102
659 3300014326 Ga0157380_10133171 Ga0157380_101331712 102
660 3300014326 Ga0157380_10548647 Ga0157380_105486472 102
661 3300014745 Ga0157377_10001746 Ga0157377_100017468 102
662 3300014968 Ga0157379_10018961 Ga0157379_100189617 102
663 3300014968 Ga0157379_10032422 Ga0157379_100324225 102
664 3300014968 Ga0157379_10124526 Ga0157379_101245263 102
665 3300014968 Ga0157379_10157361 Ga0157379_101573613 102
666 3300014969 Ga0157376_10049664 Ga0157376_100496644 102
667 3300014969 Ga0157376_10882528 Ga0157376_108825282 102
668 3300014969 Ga0157376_11018245 Ga0157376_110182451 102
669 3300015261 Ga0182006_1278431 Ga0182006_12784312 102
670 3300015265 Ga0182005_1128173 Ga0182005_11281732 102
671 3300017792 Ga0163161_10175056 Ga0163161_101750562 102
672 3300017792 Ga0163161_10510577 Ga0163161_105105772 102
673 3300017792 Ga0163161_11017028 Ga0163161_110170282 102
674 3300021384 Ga0213876_10165029 Ga0213876_101650292 102
675 3300025271 Ga0207666_1044135 Ga0207666_10441352 102
676 3300025321 Ga0207656_10018712 Ga0207656_100187123 102
677 3300025321 Ga0207656_10060820 Ga0207656_100608202 102
678 3300025321 Ga0207656_10087605 Ga0207656_100876053 102
679 3300025321 Ga0207656_10391007 Ga0207656_103910072 102
680 3300025893 Ga0207682_10006323 Ga0207682_100063234 102
681 3300025893 Ga0207682_10050056 Ga0207682_100500562 102
682 3300025893 Ga0207682_10174224 Ga0207682_101742241 102
683 3300025899 Ga0207642_10284648 Ga0207642_102846482 102
684 3300025901 Ga0207688_10047915 Ga0207688_100479153 102
685 3300025901 Ga0207688_10316967 Ga0207688_103169672 102
686 3300025903 Ga0207680_10193932 Ga0207680_101939321 102
687 3300025903 Ga0207680_10524368 Ga0207680_105243682 102
688 3300025904 Ga0207647_10399755 Ga0207647_103997552 102
689 3300025907 Ga0207645_10025382 Ga0207645_100253824 102
690 3300025907 Ga0207645_10036225 Ga0207645_100362253 102
691 3300025907 Ga0207645_10078905 Ga0207645_100789053 102
692 3300025907 Ga0207645_10138024 Ga0207645_101380242 102
693 3300025909 Ga0207705_10133962 Ga0207705_101339623 102
694 3300025909 Ga0207705_10367801 Ga0207705_103678012 102
695 3300025909 Ga0207705_10834683 Ga0207705_108346831 102
696 3300025912 Ga0207707_10315027 Ga0207707_103150272 102
697 3300025913 Ga0207695_10203848 Ga0207695_102038482 102
698 3300025914 Ga0207671_10306590 Ga0207671_103065903 102
699 3300025917 Ga0207660_10009668 Ga0207660_100096686 102
700 3300025919 Ga0207657_10473941 Ga0207657_104739412 102
701 3300025919 Ga0207657_10620415 Ga0207657_106204151 102
702 3300025920 Ga0207649_10089105 Ga0207649_100891052 102
703 3300025920 Ga0207649_10518660 Ga0207649_105186602 102
704 3300025921 Ga0207652_10013674 Ga0207652_100136743 102
705 3300025923 Ga0207681_10021768 Ga0207681_100217684 102
706 3300025923 Ga0207681_10061183 Ga0207681_100611833 102
707 3300025923 Ga0207681_10457546 Ga0207681_104575463 102
708 3300025923 Ga0207681_10713234 Ga0207681_107132342 102
709 3300025923 Ga0207681_10742925 Ga0207681_107429252 102
710 3300025924 Ga0207694_10167559 Ga0207694_101675593 102
711 3300025924 Ga0207694_10700091 Ga0207694_107000912 102
712 3300025925 Ga0207650_10006455 Ga0207650_100064552 102
713 3300025925 Ga0207650_10038591 Ga0207650_100385913 102
714 3300025925 Ga0207650_10092424 Ga0207650_100924242 102
715 3300025925 Ga0207650_10100288 Ga0207650_101002882 102
716 3300025925 Ga0207650_10115135 Ga0207650_101151352 102
717 3300025925 Ga0207650_10181055 Ga0207650_101810553 102
718 3300025925 Ga0207650_10888675 Ga0207650_108886752 102
719 3300025926 Ga0207659_10009948 Ga0207659_100099486 102
720 3300025926 Ga0207659_10010917 Ga0207659_100109174 102
721 3300025926 Ga0207659_10041819 Ga0207659_100418193 102
722 3300025926 Ga0207659_10419995 Ga0207659_104199952 102
723 3300025927 Ga0207687_10056250 Ga0207687_100562503 102
724 3300025927 Ga0207687_10775581 Ga0207687_107755812 102
725 3300025931 Ga0207644_10041754 Ga0207644_100417543 102
726 3300025931 Ga0207644_10216505 Ga0207644_102165053 102
727 3300025931 Ga0207644_10256651 Ga0207644_102566512 102
728 3300025931 Ga0207644_11364647 Ga0207644_113646472 102
729 3300025931 Ga0207644_11880628 Ga0207644_118806282 102
730 3300025932 Ga0207690_10050834 Ga0207690_100508343 102
731 3300025932 Ga0207690_10055305 Ga0207690_100553053 102
732 3300025932 Ga0207690_10189841 Ga0207690_101898412 102
733 3300025933 Ga0207706_10051645 Ga0207706_100516453 102
734 3300025933 Ga0207706_10080651 Ga0207706_100806513 102
735 3300025933 Ga0207706_10150655 Ga0207706_101506553 102
736 3300025933 Ga0207706_10467903 Ga0207706_104679033 102
737 3300025934 Ga0207686_10803521 Ga0207686_108035212 102
738 3300025935 Ga0207709_10081126 Ga0207709_100811263 102
739 3300025935 Ga0207709_10813349 Ga0207709_108133492 102
740 3300025935 Ga0207709_10901308 Ga0207709_109013082 102
741 3300025936 Ga0207670_10343637 Ga0207670_103436372 102
742 3300025937 Ga0207669_10782080 Ga0207669_107820802 102
743 3300025938 Ga0207704_10500872 Ga0207704_105008723 102
744 3300025938 Ga0207704_11006129 Ga0207704_110061292 102
745 3300025939 Ga0207665_10452007 Ga0207665_104520072 102
746 3300025940 Ga0207691_10029127 Ga0207691_100291276 102
747 3300025940 Ga0207691_10055017 Ga0207691_100550174 102
748 3300025940 Ga0207691_10122157 Ga0207691_101221572 102
749 3300025940 Ga0207691_10199532 Ga0207691_101995322 102
750 3300025940 Ga0207691_10446283 Ga0207691_104462832 102
751 3300025940 Ga0207691_10480642 Ga0207691_104806422 102
752 3300025940 Ga0207691_10522681 Ga0207691_105226812 102
753 3300025941 Ga0207711_10025658 Ga0207711_100256584 102
754 3300025941 Ga0207711_10186248 Ga0207711_101862483 102
755 3300025941 Ga0207711_10207381 Ga0207711_102073812 102
756 3300025942 Ga0207689_10010535 Ga0207689_100105358 102
757 3300025942 Ga0207689_10013874 Ga0207689_100138743 102
758 3300025944 Ga0207661_10176600 Ga0207661_101766003 102
759 3300025944 Ga0207661_10888849 Ga0207661_108888492 102
760 3300025944 Ga0207661_11379629 Ga0207661_113796292 102
761 3300025945 Ga0207679_10039737 Ga0207679_100397373 102
762 3300025945 Ga0207679_10096341 Ga0207679_100963413 102
763 3300025945 Ga0207679_10195046 Ga0207679_101950462 102
764 3300025945 Ga0207679_11137874 Ga0207679_111378742 102
765 3300025945 Ga0207679_11267132 Ga0207679_112671322 102
766 3300025945 Ga0207679_11686370 Ga0207679_116863702 102
767 3300025949 Ga0207667_10394009 Ga0207667_103940092 102
768 3300025949 Ga0207667_11147727 Ga0207667_111477272 102
769 3300025960 Ga0207651_10045993 Ga0207651_100459933 102
770 3300025960 Ga0207651_10121226 Ga0207651_101212263 102
771 3300025960 Ga0207651_10332864 Ga0207651_103328642 102
772 3300025960 Ga0207651_10532558 Ga0207651_105325582 102
773 3300025960 Ga0207651_10754146 Ga0207651_107541462 102
774 3300025960 Ga0207651_10860525 Ga0207651_108605252 102
775 3300025960 Ga0207651_11116435 Ga0207651_111164352 102
776 3300025961 Ga0207712_10168668 Ga0207712_101686682 102
777 3300025972 Ga0207668_10085291 Ga0207668_100852913 102
778 3300025972 Ga0207668_11173781 Ga0207668_111737811 102
779 3300025981 Ga0207640_10035795 Ga0207640_100357954 102
780 3300025981 Ga0207640_10761489 Ga0207640_107614892 102
781 3300025986 Ga0207658_10068722 Ga0207658_100687222 102
782 3300025986 Ga0207658_10115289 Ga0207658_101152893 102
783 3300025986 Ga0207658_10329291 Ga0207658_103292913 102
784 3300026023 Ga0207677_10027411 Ga0207677_100274113 102
785 3300026023 Ga0207677_10869853 Ga0207677_108698532 102
786 3300026023 Ga0207677_11692881 Ga0207677_116928811 102
787 3300026035 Ga0207703_10001562 Ga0207703_100015624 102
788 3300026035 Ga0207703_10020445 Ga0207703_100204456 102
789 3300026035 Ga0207703_10178481 Ga0207703_101784813 102
790 3300026041 Ga0207639_10010593 Ga0207639_100105937 102
791 3300026041 Ga0207639_11028147 Ga0207639_110281472 102
792 3300026067 Ga0207678_10012734 Ga0207678_100127348 102
793 3300026067 Ga0207678_10045136 Ga0207678_100451363 102
794 3300026075 Ga0207708_10075077 Ga0207708_100750773 102
795 3300026078 Ga0207702_10072573 Ga0207702_100725733 102
796 3300026078 Ga0207702_10186497 Ga0207702_101864973 102
797 3300026078 Ga0207702_12043531 Ga0207702_120435312 102
798 3300026088 Ga0207641_10000655 Ga0207641_100006553 102
799 3300026088 Ga0207641_10412113 Ga0207641_104121132 102
800 3300026088 Ga0207641_11035074 Ga0207641_110350741 102
801 3300026088 Ga0207641_11113301 Ga0207641_111133011 102
802 3300026088 Ga0207641_11697814 Ga0207641_116978142 102
803 3300026089 Ga0207648_10186283 Ga0207648_101862832 102
804 3300026089 Ga0207648_11261935 Ga0207648_112619351 102
805 3300026089 Ga0207648_11488458 Ga0207648_114884582 102
806 3300026095 Ga0207676_10038292 Ga0207676_100382924 102
807 3300026095 Ga0207676_10058595 Ga0207676_100585953 102
808 3300026095 Ga0207676_12085534 Ga0207676_120855342 102
809 3300026116 Ga0207674_10096614 Ga0207674_100966143 102
810 3300026116 Ga0207674_10662448 Ga0207674_106624482 102
811 3300026118 Ga0207675_100004707 Ga0207675_1000047076 102
812 3300026118 Ga0207675_100017601 Ga0207675_1000176013 102
813 3300026118 Ga0207675_100522179 Ga0207675_1005221792 102
814 3300026118 Ga0207675_100864109 Ga0207675_1008641092 102
815 3300026118 Ga0207675_102649171 Ga0207675_1026491712 102
816 3300026121 Ga0207683_10022883 Ga0207683_100228833 102
817 3300026121 Ga0207683_10087698 Ga0207683_100876983 102
818 3300026121 Ga0207683_10683211 Ga0207683_106832112 102
819 3300026121 Ga0207683_12119983 Ga0207683_121199832 102
820 3300026142 Ga0207698_10026032 Ga0207698_100260323 102
821 3300026142 Ga0207698_10039973 Ga0207698_100399733 102
822 3300026142 Ga0207698_10042642 Ga0207698_100426424 102
823 3300026142 Ga0207698_10121702 Ga0207698_101217023 102
824 3300026142 Ga0207698_10341159 Ga0207698_103411592 102
825 3300026142 Ga0207698_11258709 Ga0207698_112587092 102
826 3300026142 Ga0207698_12600978 Ga0207698_126009781 102
827 3300028379 Ga0268266_10869988 Ga0268266_108699882 102
828 3300028379 Ga0268266_10897402 Ga0268266_108974022 102
829 3300028379 Ga0268266_12193883 Ga0268266_121938831 102
830 3300028380 Ga0268265_10422181 Ga0268265_104221813 102
831 3300028380 Ga0268265_11101237 Ga0268265_111012372 102
832 3300028381 Ga0268264_10172460 Ga0268264_101724603 102
833 3300031548 Ga0307408_100207826 Ga0307408_1002078262 102
834 3300031731 Ga0307405_10063724 Ga0307405_100637243 102
835 3300031901 Ga0307406_10119880 Ga0307406_101198802 102
836 3300031903 Ga0307407_10584081 Ga0307407_105840812 102
837 3300031903 Ga0307407_11283278 Ga0307407_112832782 102
838 3300031911 Ga0307412_10280350 Ga0307412_102803502 102
839 3300031995 Ga0307409_100000998 Ga0307409_1000009986 102
840 3300032002 Ga0307416_100020663 Ga0307416_1000206634 102
841 3300032126 Ga0307415_100018265 Ga0307415_1000182652 102
842 3300035084 Ga0373928_0048659 Ga0373928_0048659_350_658 102
843 3300035112 Ga0373932_0034803 Ga0373932_0034803_840_1148 102
844 3300035170 Ga0373943_0095824 Ga0373943_0095824_302_616 102
845 3300035171 Ga0373946_0263875 Ga0373946_0263875_486_800 102
846 3300035242 Ga0373962_0265784 Ga0373962_0265784_63_371 102
847 3300035691 Ga0373931_0030179 Ga0373931_0030179_1517_1825 102
848 3300037853 Ga0436364_0872711 Ga0436364_0872711_17_334 102
849 3300039437 Ga0436365_0830380 Ga0436365_0830380_172_480 102
850 3300039437 Ga0436365_1729666 Ga0436365_1729666_1895_2209 102
851 3300039450 Ga0436363_1353996 Ga0436363_1353996_1297_1611 102
852 3300041453 Ga0451797_0590806 Ga0451797_0590806_166_480 102
853 3300041459 Ga0451800_0691674 Ga0451800_0691674_122_430 102
854 3300041460 Ga0451802_1535241 Ga0451802_1535241_150_458 102
855 3300041512 Ga0451853_2191125 Ga0451853_2191125_298_606 102
856 3300042012 Ga0439455_0161594 Ga0439455_0161594_230_544 102
857 3300042117 Ga0450913_021465 Ga0450913_021465_199_513 102
858 3300042439 Ga0439464_0096006 Ga0439464_0096006_394_708 102
859 3300042461 Ga0439460_0174247 Ga0439460_0174247_274_588 102
860 3300045051 Ga0451576_0386825 Ga0451576_0386825_257_565 102
861 3300045051 Ga0451576_0577456 Ga0451576_0577456_614_928 102
862 3300046473 Ga0495582_0562783 Ga0495582_0562783_183_497 102
863 3300046515 Ga0495620_0280138 Ga0495620_0280138_306_620 102
864 3300046530 Ga0495654_0246427 Ga0495654_0246427_188_496 102
865 3300046537 Ga0495598_0166716 Ga0495598_0166716_192_506 102
866 3300046539 Ga0495621_0140935 Ga0495621_0140935_247_561 102
867 3300046683 Ga0495658_0098601 Ga0495658_0098601_665_979 102
868 3300048090 Ga0495615_0159241 Ga0495615_0159241_35_349 102
869 3300048903 Ga0496100_0135463 Ga0496100_0135463_797_1105 102
870 3300048904 Ga0496101_0151451 Ga0496101_0151451_808_1116 102
871 3300048905 Ga0496102_0365076 Ga0496102_0365076_808_1116 102
872 3300048907 Ga0496104_0026264 Ga0496104_0026264_163_477 102
873 3300048907 Ga0496104_0677349 Ga0496104_0677349_591_899 102
874 3300048908 Ga0496105_0453340 Ga0496105_0453340_51_359 102
875 3300048909 Ga0496106_0053191 Ga0496106_0053191_808_1116 102
876 3300048910 Ga0496107_0059091 Ga0496107_0059091_1486_1794 102
877 3300048910 Ga0496107_1245042 Ga0496107_1245042_39_353 102
878 3300048911 Ga0496108_0123130 Ga0496108_0123130_784_1092 102
879 3300048911 Ga0496108_0900308 Ga0496108_0900308_61_369 102
880 3300048912 Ga0496109_0085339 Ga0496109_0085339_1265_1573 102
881 3300048913 Ga0496110_0239621 Ga0496110_0239621_1034_1342 102
882 3300048913 Ga0496110_0305532 Ga0496110_0305532_523_831 102
883 3300048913 Ga0496110_0406612 Ga0496110_0406612_531_845 102
884 3300048913 Ga0496110_0853512 Ga0496110_0853512_347_655 102
885 3300048914 Ga0496111_0170347 Ga0496111_0170347_621_929 102
886 3300048916 Ga0496113_0304954 Ga0496113_0304954_635_943 102
887 3300048917 Ga0496114_0218567 Ga0496114_0218567_638_952 102
888 3300048917 Ga0496114_0478741 Ga0496114_0478741_765_1073 102
889 3300048917 Ga0496114_0630345 Ga0496114_0630345_118_432 102
890 3300048918 Ga0496115_0108476 Ga0496115_0108476_1556_1864 102
891 3300050511 nmdc:mga08y16_863607_c1 nmdc:mga08y16_863607_c1_311_619 102
892 3300050512 nmdc:mga0n895_480444_c1 nmdc:mga0n895_480444_c1_32_340 102
893 3300050514 nmdc:mga08x19_858063_c1 nmdc:mga08x19_858063_c1_123_431 102
894 3300053084 Ga0495595_0718807 Ga0495595_0718807_133_447 102

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06305

LapA_dom

Lipopolysaccharide assembly protein A domain

22

83

0.89

Feature Viewer

pLDDT pTM Quality
66.43 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map