F484932
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 894 | 309 | 893 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_102022094|Ga0070674_1020220941 |
| Length | 104 |
| Sequence | MRSLVWLFRAAVFFVLFAFALNNREEATIHWFFDQAWRAPMVLIVLAAFGLGCAFGIFAMVPSWWRQRRLSRNRMRRASDKAAVSTPLAPVSGNAELHPPRDGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 108 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 175 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 176 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 190 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 191 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 205 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 212 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 213 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 216 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 217 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 218 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 219 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 263 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 270 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 271 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 272 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 273 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 274 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 276 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 277 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 281 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 282 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 283 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 293 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 294 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 295 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 296 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 297 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 298 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 299 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 300 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 302 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 303 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 304 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 305 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 306 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 307 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 309 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.03 |
| Nodule | 0 |
| Rhizoplane | 4.14 |
| Rhizosphere | 87.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10058793 | 3300005327 | Bacteria | 3130 |
| 2 | Ga0070658_10336488 | 3300005327 | Bacteria | 1291 |
| 3 | Ga0070676_10019591 | 3300005328 | Bacteria | 3767 |
| 4 | Ga0070676_10047823 | 3300005328 | Bacteria | 2499 |
| 5 | Ga0070676_10065683 | 3300005328 | Bacteria | 2167 |
| 6 | Ga0070676_10184425 | 3300005328 | Bacteria | 1359 |
| 7 | Ga0070676_10498903 | 3300005328 | Bacteria | 864 |
| 8 | Ga0070683_100033736 | 3300005329 | Bacteria | 4669 |
| 9 | Ga0070690_100054342 | 3300005330 | Bacteria | 2563 |
| 10 | Ga0070690_100133536 | 3300005330 | Bacteria | 1678 |
| 11 | Ga0070690_100321216 | 3300005330 | Bacteria | 1115 |
| 12 | Ga0070670_100002048 | 3300005331 | Bacteria | 16500 |
| 13 | Ga0070670_100027077 | 3300005331 | Bacteria | 4930 |
| 14 | Ga0070670_100048945 | 3300005331 | Bacteria | 3636 |
| 15 | Ga0070670_100056760 | 3300005331 | Bacteria | 3361 |
| 16 | Ga0070670_100069450 | 3300005331 | Bacteria | 3024 |
| 17 | Ga0070670_100088528 | 3300005331 | Bacteria | 2661 |
| 18 | Ga0070670_100112972 | 3300005331 | Bacteria | 2341 |
| 19 | Ga0070670_100579613 | 3300005331 | Bacteria | 1002 |
| 20 | Ga0070670_100597115 | 3300005331 | Bacteria | 988 |
| 21 | Ga0070670_100774365 | 3300005331 | Bacteria | 865 |
| 22 | Ga0070670_100832159 | 3300005331 | Bacteria | 835 |
| 23 | Ga0070670_100892644 | 3300005331 | Bacteria | 805 |
| 24 | Ga0070677_10010108 | 3300005333 | Bacteria | 3217 |
| 25 | Ga0070677_10026730 | 3300005333 | Bacteria | 2166 |
| 26 | Ga0070677_10031430 | 3300005333 | Bacteria | 2029 |
| 27 | Ga0070677_10084808 | 3300005333 | Bacteria | 1364 |
| 28 | Ga0070677_10243698 | 3300005333 | Bacteria | 888 |
| 29 | Ga0070677_10299493 | 3300005333 | Bacteria | 817 |
| 30 | Ga0070677_10482866 | 3300005333 | Bacteria | 669 |
| 31 | Ga0070677_10503645 | 3300005333 | Bacteria | 657 |
| 32 | Ga0068869_100012173 | 3300005334 | Bacteria | 5674 |
| 33 | Ga0068869_100017070 | 3300005334 | Bacteria | 4911 |
| 34 | Ga0068869_100025577 | 3300005334 | Bacteria | 4100 |
| 35 | Ga0068869_100091609 | 3300005334 | Bacteria | 2287 |
| 36 | Ga0070666_10074189 | 3300005335 | Bacteria | 2318 |
| 37 | Ga0070666_10129261 | 3300005335 | Bacteria | 1754 |
| 38 | Ga0070666_10277513 | 3300005335 | Bacteria | 1191 |
| 39 | Ga0070666_10300236 | 3300005335 | Bacteria | 1143 |
| 40 | Ga0070666_10827474 | 3300005335 | Bacteria | 683 |
| 41 | Ga0070680_100009759 | 3300005336 | Bacteria | 7389 |
| 42 | Ga0070682_100199716 | 3300005337 | Bacteria | 1410 |
| 43 | Ga0068868_100010644 | 3300005338 | Bacteria | 6666 |
| 44 | Ga0068868_100018750 | 3300005338 | Bacteria | 5176 |
| 45 | Ga0068868_100031049 | 3300005338 | Bacteria | 4100 |
| 46 | Ga0068868_100053087 | 3300005338 | Bacteria | 3193 |
| 47 | Ga0068868_100627762 | 3300005338 | Bacteria | 954 |
| 48 | Ga0068868_100680352 | 3300005338 | Bacteria | 919 |
| 49 | Ga0070660_100832667 | 3300005339 | Bacteria | 777 |
| 50 | Ga0070660_100857877 | 3300005339 | Bacteria | 765 |
| 51 | Ga0070689_100242167 | 3300005340 | Bacteria | 1486 |
| 52 | Ga0070689_100284221 | 3300005340 | Bacteria | 1373 |
| 53 | Ga0070689_100525160 | 3300005340 | Bacteria | 1017 |
| 54 | Ga0070689_101049450 | 3300005340 | Bacteria | 727 |
| 55 | Ga0070689_101116316 | 3300005340 | Bacteria | 705 |
| 56 | Ga0070687_100045771 | 3300005343 | Bacteria | 2236 |
| 57 | Ga0070687_100258931 | 3300005343 | Bacteria | 1085 |
| 58 | Ga0070687_100426997 | 3300005343 | Bacteria | 876 |
| 59 | Ga0070687_100975239 | 3300005343 | Bacteria | 613 |
| 60 | Ga0070661_100627784 | 3300005344 | Bacteria | 870 |
| 61 | Ga0070661_101243292 | 3300005344 | Bacteria | 624 |
| 62 | Ga0070692_10958293 | 3300005345 | Bacteria | 595 |
| 63 | Ga0070692_10964935 | 3300005345 | Bacteria | 594 |
| 64 | Ga0070668_100007413 | 3300005347 | Bacteria | 8142 |
| 65 | Ga0070668_100509589 | 3300005347 | Bacteria | 1043 |
| 66 | Ga0070668_100520932 | 3300005347 | Bacteria | 1032 |
| 67 | Ga0070668_101221492 | 3300005347 | Bacteria | 681 |
| 68 | Ga0070669_100005073 | 3300005353 | Bacteria | 9516 |
| 69 | Ga0070669_100033288 | 3300005353 | Bacteria | 3727 |
| 70 | Ga0070669_100037703 | 3300005353 | Bacteria | 3507 |
| 71 | Ga0070669_101159185 | 3300005353 | Bacteria | 667 |
| 72 | Ga0070669_101206703 | 3300005353 | Bacteria | 654 |
| 73 | Ga0070669_101818049 | 3300005353 | Bacteria | 532 |
| 74 | Ga0070675_100003224 | 3300005354 | Bacteria | 12360 |
| 75 | Ga0070675_100012448 | 3300005354 | Bacteria | 6665 |
| 76 | Ga0070675_100031950 | 3300005354 | Bacteria | 4257 |
| 77 | Ga0070675_100037552 | 3300005354 | Bacteria | 3946 |
| 78 | Ga0070675_100060803 | 3300005354 | Bacteria | 3118 |
| 79 | Ga0070675_100086553 | 3300005354 | Bacteria | 2619 |
| 80 | Ga0070675_100299381 | 3300005354 | Bacteria | 1417 |
| 81 | Ga0070675_100477909 | 3300005354 | Bacteria | 1120 |
| 82 | Ga0070675_100499962 | 3300005354 | Bacteria | 1095 |
| 83 | Ga0070675_100734153 | 3300005354 | Bacteria | 900 |
| 84 | Ga0070675_100782719 | 3300005354 | Bacteria | 871 |
| 85 | Ga0070671_100006025 | 3300005355 | Bacteria | 9662 |
| 86 | Ga0070671_100058539 | 3300005355 | Bacteria | 3207 |
| 87 | Ga0070671_100075668 | 3300005355 | Bacteria | 2813 |
| 88 | Ga0070671_100191660 | 3300005355 | Bacteria | 1732 |
| 89 | Ga0070671_100694176 | 3300005355 | Bacteria | 883 |
| 90 | Ga0070671_100816398 | 3300005355 | Bacteria | 812 |
| 91 | Ga0070671_101027924 | 3300005355 | Bacteria | 722 |
| 92 | Ga0070674_100012726 | 3300005356 | Bacteria | 5175 |
| 93 | Ga0070674_100013607 | 3300005356 | Bacteria | 5035 |
| 94 | Ga0070674_100018236 | 3300005356 | Bacteria | 4433 |
| 95 | Ga0070674_100198471 | 3300005356 | Bacteria | 1548 |
| 96 | Ga0070674_100807553 | 3300005356 | Bacteria | 810 |
| 97 | Ga0070674_101080575 | 3300005356 | Bacteria | 708 |
| 98 | Ga0070674_101352197 | 3300005356 | Bacteria | 636 |
| 99 | Ga0070674_102022094 | 3300005356 | Bacteria | 525 |
| 100 | Ga0070673_100003072 | 3300005364 | Bacteria | 10332 |
| 101 | Ga0070673_100019451 | 3300005364 | Bacteria | 4873 |
| 102 | Ga0070673_100131219 | 3300005364 | Bacteria | 2102 |
| 103 | Ga0070673_100145026 | 3300005364 | Bacteria | 2006 |
| 104 | Ga0070673_100410431 | 3300005364 | Bacteria | 1212 |
| 105 | Ga0070673_100543674 | 3300005364 | Bacteria | 1055 |
| 106 | Ga0070673_100762300 | 3300005364 | Bacteria | 892 |
| 107 | Ga0070673_100820450 | 3300005364 | Bacteria | 860 |
| 108 | Ga0070673_100957642 | 3300005364 | Bacteria | 795 |
| 109 | Ga0070673_101372576 | 3300005364 | Bacteria | 665 |
| 110 | Ga0070688_100532432 | 3300005365 | Bacteria | 891 |
| 111 | Ga0070659_100011889 | 3300005366 | Bacteria | 6444 |
| 112 | Ga0070659_100018169 | 3300005366 | Bacteria | 5305 |
| 113 | Ga0070659_100203882 | 3300005366 | Bacteria | 1629 |
| 114 | Ga0070667_100008961 | 3300005367 | Bacteria | 8283 |
| 115 | Ga0070667_100026069 | 3300005367 | Bacteria | 4861 |
| 116 | Ga0070667_100035293 | 3300005367 | Bacteria | 4188 |
| 117 | Ga0070667_100095130 | 3300005367 | Bacteria | 2568 |
| 118 | Ga0070667_100251054 | 3300005367 | Bacteria | 1581 |
| 119 | Ga0070667_100331751 | 3300005367 | Bacteria | 1374 |
| 120 | Ga0070667_101573398 | 3300005367 | Bacteria | 618 |
| 121 | Ga0070667_101688766 | 3300005367 | Bacteria | 596 |
| 122 | Ga0070701_10246032 | 3300005438 | Bacteria | 1078 |
| 123 | Ga0070700_100076306 | 3300005441 | Bacteria | 2152 |
| 124 | Ga0070700_100409423 | 3300005441 | Bacteria | 1022 |
| 125 | Ga0070708_100678062 | 3300005445 | Bacteria | 971 |
| 126 | Ga0070663_100001309 | 3300005455 | Bacteria | 13616 |
| 127 | Ga0070663_100015103 | 3300005455 | Bacteria | 4972 |
| 128 | Ga0070663_100077979 | 3300005455 | Bacteria | 2427 |
| 129 | Ga0070663_100422419 | 3300005455 | Bacteria | 1094 |
| 130 | Ga0070678_100001895 | 3300005456 | Bacteria | 11266 |
| 131 | Ga0070678_100007671 | 3300005456 | Bacteria | 6414 |
| 132 | Ga0070678_100073477 | 3300005456 | Bacteria | 2566 |
| 133 | Ga0070678_100080791 | 3300005456 | Bacteria | 2463 |
| 134 | Ga0070678_100173436 | 3300005456 | Bacteria | 1759 |
| 135 | Ga0070678_100563879 | 3300005456 | Bacteria | 1012 |
| 136 | Ga0070678_100630850 | 3300005456 | Bacteria | 959 |
| 137 | Ga0070678_101761916 | 3300005456 | Bacteria | 583 |
| 138 | Ga0070678_102273122 | 3300005456 | Bacteria | 515 |
| 139 | Ga0070662_100028876 | 3300005457 | Bacteria | 3865 |
| 140 | Ga0070662_100141047 | 3300005457 | Bacteria | 1867 |
| 141 | Ga0070662_100347539 | 3300005457 | Bacteria | 1214 |
| 142 | Ga0070662_100430677 | 3300005457 | Bacteria | 1092 |
| 143 | Ga0070662_100497571 | 3300005457 | Bacteria | 1016 |
| 144 | Ga0070662_100539438 | 3300005457 | Bacteria | 976 |
| 145 | Ga0070662_100717437 | 3300005457 | Bacteria | 847 |
| 146 | Ga0070662_101122899 | 3300005457 | Bacteria | 675 |
| 147 | Ga0070681_10338724 | 3300005458 | Bacteria | 1414 |
| 148 | Ga0070681_10571099 | 3300005458 | Bacteria | 1045 |
| 149 | Ga0068867_100000642 | 3300005459 | Bacteria | 23127 |
| 150 | Ga0068867_100018743 | 3300005459 | Bacteria | 4922 |
| 151 | Ga0068867_100021533 | 3300005459 | Bacteria | 4600 |
| 152 | Ga0068867_100058810 | 3300005459 | Bacteria | 2848 |
| 153 | Ga0068867_100120849 | 3300005459 | Bacteria | 2024 |
| 154 | Ga0068867_100612940 | 3300005459 | Bacteria | 951 |
| 155 | Ga0068867_101641707 | 3300005459 | Bacteria | 602 |
| 156 | Ga0070685_10761647 | 3300005466 | Bacteria | 711 |
| 157 | Ga0070706_101296912 | 3300005467 | Bacteria | 668 |
| 158 | Ga0070707_101602619 | 3300005468 | Bacteria | 618 |
| 159 | Ga0070679_100005910 | 3300005530 | Bacteria | 11370 |
| 160 | Ga0070679_101204174 | 3300005530 | Bacteria | 703 |
| 161 | Ga0070679_101216217 | 3300005530 | Bacteria | 699 |
| 162 | Ga0070679_101560032 | 3300005530 | Bacteria | 608 |
| 163 | Ga0070684_100344415 | 3300005535 | Bacteria | 1370 |
| 164 | Ga0068853_100024777 | 3300005539 | Bacteria | 5034 |
| 165 | Ga0068853_100056675 | 3300005539 | Bacteria | 3380 |
| 166 | Ga0068853_101035323 | 3300005539 | Bacteria | 791 |
| 167 | Ga0068853_101532422 | 3300005539 | Bacteria | 645 |
| 168 | Ga0068853_102092931 | 3300005539 | Bacteria | 549 |
| 169 | Ga0070672_100000556 | 3300005543 | Bacteria | 21828 |
| 170 | Ga0070672_100031086 | 3300005543 | Bacteria | 4016 |
| 171 | Ga0070672_100035268 | 3300005543 | Bacteria | 3802 |
| 172 | Ga0070672_100046034 | 3300005543 | Bacteria | 3378 |
| 173 | Ga0070672_100074936 | 3300005543 | Bacteria | 2700 |
| 174 | Ga0070672_100084451 | 3300005543 | Bacteria | 2549 |
| 175 | Ga0070672_100103215 | 3300005543 | Bacteria | 2315 |
| 176 | Ga0070672_100117126 | 3300005543 | Bacteria | 2177 |
| 177 | Ga0070672_100123155 | 3300005543 | Bacteria | 2125 |
| 178 | Ga0070672_100371159 | 3300005543 | Bacteria | 1222 |
| 179 | Ga0070686_100112647 | 3300005544 | Bacteria | 1856 |
| 180 | Ga0070686_101485202 | 3300005544 | Bacteria | 571 |
| 181 | Ga0070695_100356570 | 3300005545 | Bacteria | 1097 |
| 182 | Ga0070693_100932884 | 3300005547 | Bacteria | 652 |
| 183 | Ga0070665_100349546 | 3300005548 | Bacteria | 1484 |
| 184 | Ga0070665_100405384 | 3300005548 | Bacteria | 1371 |
| 185 | Ga0070665_100690840 | 3300005548 | Bacteria | 1033 |
| 186 | Ga0070665_100752282 | 3300005548 | Bacteria | 988 |
| 187 | Ga0070665_102045678 | 3300005548 | Bacteria | 578 |
| 188 | Ga0070704_100508124 | 3300005549 | Bacteria | 1047 |
| 189 | Ga0068855_100066039 | 3300005563 | Bacteria | 4217 |
| 190 | Ga0068855_100412939 | 3300005563 | Bacteria | 1477 |
| 191 | Ga0070664_100111426 | 3300005564 | Bacteria | 2389 |
| 192 | Ga0070664_100145261 | 3300005564 | Bacteria | 2091 |
| 193 | Ga0070664_100178886 | 3300005564 | Bacteria | 1885 |
| 194 | Ga0070664_100233075 | 3300005564 | Bacteria | 1651 |
| 195 | Ga0070664_100276244 | 3300005564 | Bacteria | 1514 |
| 196 | Ga0070664_100674737 | 3300005564 | Bacteria | 961 |
| 197 | Ga0070664_100834392 | 3300005564 | Bacteria | 863 |
| 198 | Ga0070664_101008498 | 3300005564 | Bacteria | 783 |
| 199 | Ga0070664_101357878 | 3300005564 | Bacteria | 671 |
| 200 | Ga0070664_101365466 | 3300005564 | Bacteria | 670 |
| 201 | Ga0070664_101444025 | 3300005564 | Bacteria | 651 |
| 202 | Ga0068857_100094200 | 3300005577 | Bacteria | 2681 |
| 203 | Ga0068857_100202074 | 3300005577 | Bacteria | 1812 |
| 204 | Ga0068854_100016864 | 3300005578 | Bacteria | 4877 |
| 205 | Ga0068854_100391481 | 3300005578 | Bacteria | 1148 |
| 206 | Ga0068856_100117837 | 3300005614 | Bacteria | 2656 |
| 207 | Ga0068856_100129957 | 3300005614 | Bacteria | 2523 |
| 208 | Ga0068856_100136686 | 3300005614 | Bacteria | 2456 |
| 209 | Ga0068856_100414739 | 3300005614 | Bacteria | 1367 |
| 210 | Ga0070702_100531188 | 3300005615 | Bacteria | 870 |
| 211 | Ga0068852_100014893 | 3300005616 | Bacteria | 6010 |
| 212 | Ga0068852_100016636 | 3300005616 | Bacteria | 5745 |
| 213 | Ga0068852_100062538 | 3300005616 | Bacteria | 3238 |
| 214 | Ga0068852_100090637 | 3300005616 | Bacteria | 2734 |
| 215 | Ga0068852_100094656 | 3300005616 | Bacteria | 2680 |
| 216 | Ga0068852_100261225 | 3300005616 | Bacteria | 1663 |
| 217 | Ga0068852_100400678 | 3300005616 | Bacteria | 1350 |
| 218 | Ga0068852_100552013 | 3300005616 | Bacteria | 1152 |
| 219 | Ga0068852_100865932 | 3300005616 | Bacteria | 919 |
| 220 | Ga0068852_101483298 | 3300005616 | Bacteria | 700 |
| 221 | Ga0068852_102078317 | 3300005616 | Bacteria | 590 |
| 222 | Ga0068852_102535526 | 3300005616 | Bacteria | 533 |
| 223 | Ga0068859_100006084 | 3300005617 | Bacteria | 12255 |
| 224 | Ga0068859_100070397 | 3300005617 | Bacteria | 3533 |
| 225 | Ga0068859_100403071 | 3300005617 | Bacteria | 1464 |
| 226 | Ga0068859_101908909 | 3300005617 | Bacteria | 656 |
| 227 | Ga0068864_100016650 | 3300005618 | Bacteria | 6124 |
| 228 | Ga0068864_100031659 | 3300005618 | Bacteria | 4489 |
| 229 | Ga0068864_100065319 | 3300005618 | Bacteria | 3157 |
| 230 | Ga0068864_100080246 | 3300005618 | Bacteria | 2858 |
| 231 | Ga0068864_100407935 | 3300005618 | Bacteria | 1292 |
| 232 | Ga0068864_100535381 | 3300005618 | Bacteria | 1131 |
| 233 | Ga0068864_100551872 | 3300005618 | Bacteria | 1114 |
| 234 | Ga0068864_100560329 | 3300005618 | Bacteria | 1105 |
| 235 | Ga0068864_101251714 | 3300005618 | Bacteria | 741 |
| 236 | Ga0068866_10205713 | 3300005718 | Bacteria | 1179 |
| 237 | Ga0068866_10424953 | 3300005718 | Bacteria | 863 |
| 238 | Ga0068866_10425006 | 3300005718 | Bacteria | 863 |
| 239 | Ga0068866_10457995 | 3300005718 | Bacteria | 836 |
| 240 | Ga0068866_10709988 | 3300005718 | Bacteria | 690 |
| 241 | Ga0068866_10801482 | 3300005718 | Bacteria | 655 |
| 242 | Ga0068861_100011424 | 3300005719 | Bacteria | 6174 |
| 243 | Ga0068861_100023590 | 3300005719 | Bacteria | 4439 |
| 244 | Ga0068861_100327840 | 3300005719 | Bacteria | 1335 |
| 245 | Ga0068861_100398616 | 3300005719 | Bacteria | 1220 |
| 246 | Ga0068861_100558116 | 3300005719 | Bacteria | 1045 |
| 247 | Ga0068861_101503614 | 3300005719 | Bacteria | 661 |
| 248 | Ga0068861_101943021 | 3300005719 | Bacteria | 586 |
| 249 | Ga0068851_10022932 | 3300005834 | Bacteria | 3047 |
| 250 | Ga0068851_10076090 | 3300005834 | Bacteria | 1745 |
| 251 | Ga0068851_10227290 | 3300005834 | Bacteria | 1051 |
| 252 | Ga0068851_10283165 | 3300005834 | Bacteria | 948 |
| 253 | Ga0068851_10437783 | 3300005834 | Bacteria | 775 |
| 254 | Ga0068851_10912409 | 3300005834 | Bacteria | 551 |
| 255 | Ga0068870_10748004 | 3300005840 | Bacteria | 679 |
| 256 | Ga0068870_10882354 | 3300005840 | Bacteria | 630 |
| 257 | Ga0068863_100017253 | 3300005841 | Bacteria | 6924 |
| 258 | Ga0068863_100024199 | 3300005841 | Bacteria | 5792 |
| 259 | Ga0068863_100246333 | 3300005841 | Bacteria | 1725 |
| 260 | Ga0068863_100335406 | 3300005841 | Bacteria | 1470 |
| 261 | Ga0068863_100371030 | 3300005841 | Bacteria | 1396 |
| 262 | Ga0068863_100516454 | 3300005841 | Bacteria | 1177 |
| 263 | Ga0068863_101160718 | 3300005841 | Bacteria | 778 |
| 264 | Ga0068858_100018855 | 3300005842 | Bacteria | 6456 |
| 265 | Ga0068858_100024676 | 3300005842 | Bacteria | 5599 |
| 266 | Ga0068858_100073309 | 3300005842 | Bacteria | 3178 |
| 267 | Ga0068858_100075568 | 3300005842 | Bacteria | 3129 |
| 268 | Ga0068858_100489250 | 3300005842 | Bacteria | 1188 |
| 269 | Ga0068860_100005841 | 3300005843 | Bacteria | 12387 |
| 270 | Ga0068860_100116688 | 3300005843 | Bacteria | 2554 |
| 271 | Ga0068860_100851194 | 3300005843 | Bacteria | 926 |
| 272 | Ga0068860_100969429 | 3300005843 | Bacteria | 868 |
| 273 | Ga0068862_101024243 | 3300005844 | Bacteria | 817 |
| 274 | Ga0068862_101878111 | 3300005844 | Bacteria | 609 |
| 275 | Ga0070716_100266048 | 3300006173 | Bacteria | 1176 |
| 276 | Ga0075362_10371837 | 3300006177 | Bacteria | 718 |
| 277 | Ga0075366_10023190 | 3300006195 | Bacteria | 3615 |
| 278 | Ga0075366_10023780 | 3300006195 | Bacteria | 3570 |
| 279 | Ga0075366_10179258 | 3300006195 | Bacteria | 1287 |
| 280 | Ga0075366_10234084 | 3300006195 | Bacteria | 1119 |
| 281 | Ga0097621_100032745 | 3300006237 | Bacteria | 4134 |
| 282 | Ga0097621_100065895 | 3300006237 | Bacteria | 2982 |
| 283 | Ga0097621_100079659 | 3300006237 | Bacteria | 2723 |
| 284 | Ga0097621_100107483 | 3300006237 | Bacteria | 2354 |
| 285 | Ga0097621_100148369 | 3300006237 | Bacteria | 2010 |
| 286 | Ga0097621_100204467 | 3300006237 | Bacteria | 1716 |
| 287 | Ga0097621_100614509 | 3300006237 | Bacteria | 995 |
| 288 | Ga0068871_100093997 | 3300006358 | Bacteria | 2502 |
| 289 | Ga0068871_100114047 | 3300006358 | Bacteria | 2276 |
| 290 | Ga0068871_100130403 | 3300006358 | Bacteria | 2131 |
| 291 | Ga0068871_100213588 | 3300006358 | Bacteria | 1669 |
| 292 | Ga0068871_100216933 | 3300006358 | Bacteria | 1656 |
| 293 | Ga0068871_100305890 | 3300006358 | Bacteria | 1396 |
| 294 | Ga0068871_100335356 | 3300006358 | Bacteria | 1334 |
| 295 | Ga0068871_100342524 | 3300006358 | Bacteria | 1320 |
| 296 | Ga0075430_100145784 | 3300006846 | Bacteria | 1972 |
| 297 | Ga0075434_100450734 | 3300006871 | Bacteria | 1308 |
| 298 | Ga0075429_100128059 | 3300006880 | Bacteria | 2220 |
| 299 | Ga0075429_101359730 | 3300006880 | Bacteria | 619 |
| 300 | Ga0068865_100027153 | 3300006881 | Bacteria | 3778 |
| 301 | Ga0068865_100106466 | 3300006881 | Bacteria | 2061 |
| 302 | Ga0068865_100204575 | 3300006881 | Bacteria | 1535 |
| 303 | Ga0068865_100378676 | 3300006881 | Bacteria | 1154 |
| 304 | Ga0075436_100665807 | 3300006914 | Bacteria | 770 |
| 305 | Ga0097620_100006084 | 3300006931 | Bacteria | 12255 |
| 306 | Ga0097620_100070394 | 3300006931 | Bacteria | 3533 |
| 307 | Ga0097620_100403075 | 3300006931 | Bacteria | 1464 |
| 308 | Ga0097620_101909298 | 3300006931 | Bacteria | 656 |
| 309 | Ga0075435_100744455 | 3300007076 | Bacteria | 853 |
| 310 | Ga0105244_10324843 | 3300009036 | Bacteria | 710 |
| 311 | Ga0105240_10015269 | 3300009093 | Bacteria | 10451 |
| 312 | Ga0105240_10283164 | 3300009093 | Bacteria | 1903 |
| 313 | Ga0111539_10267976 | 3300009094 | Bacteria | 1988 |
| 314 | Ga0111539_10289122 | 3300009094 | Bacteria | 1907 |
| 315 | Ga0111539_10424034 | 3300009094 | Bacteria | 1549 |
| 316 | Ga0105245_10108671 | 3300009098 | Bacteria | 2576 |
| 317 | Ga0105245_10639337 | 3300009098 | Bacteria | 1093 |
| 318 | Ga0105245_10870356 | 3300009098 | Bacteria | 942 |
| 319 | Ga0105245_12862586 | 3300009098 | Bacteria | 535 |
| 320 | Ga0105247_10773101 | 3300009101 | Bacteria | 730 |
| 321 | Ga0105243_10023684 | 3300009148 | Bacteria | 4678 |
| 322 | Ga0105243_10027612 | 3300009148 | Bacteria | 4350 |
| 323 | Ga0105243_10168213 | 3300009148 | Bacteria | 1896 |
| 324 | Ga0105243_10487973 | 3300009148 | Bacteria | 1164 |
| 325 | Ga0105243_11404104 | 3300009148 | Bacteria | 719 |
| 326 | Ga0105243_11435905 | 3300009148 | Bacteria | 712 |
| 327 | Ga0105241_11019532 | 3300009174 | Bacteria | 775 |
| 328 | Ga0105242_10143125 | 3300009176 | Bacteria | 2077 |
| 329 | Ga0105242_10638069 | 3300009176 | Bacteria | 1034 |
| 330 | Ga0105248_10066287 | 3300009177 | Bacteria | 4054 |
| 331 | Ga0105248_10121531 | 3300009177 | Bacteria | 2946 |
| 332 | Ga0105248_10193409 | 3300009177 | Bacteria | 2292 |
| 333 | Ga0105248_10271747 | 3300009177 | Bacteria | 1909 |
| 334 | Ga0105248_10484692 | 3300009177 | Bacteria | 1394 |
| 335 | Ga0105237_10001569 | 3300009545 | Bacteria | 29799 |
| 336 | Ga0105237_10096291 | 3300009545 | Bacteria | 2950 |
| 337 | Ga0105238_10011025 | 3300009551 | Bacteria | 9088 |
| 338 | Ga0105238_10124517 | 3300009551 | Bacteria | 2557 |
| 339 | Ga0105249_10137749 | 3300009553 | Bacteria | 2338 |
| 340 | Ga0105249_11749942 | 3300009553 | Bacteria | 694 |
| 341 | Ga0105239_10000486 | 3300010375 | Bacteria | 57901 |
| 342 | Ga0105239_10295005 | 3300010375 | Bacteria | 1826 |
| 343 | Ga0105239_10954720 | 3300010375 | Bacteria | 985 |
| 344 | Ga0105246_11393175 | 3300011119 | Bacteria | 654 |
| 345 | Ga0105246_11972286 | 3300011119 | Bacteria | 562 |
| 346 | Ga0157327_1077805 | 3300012512 | Bacteria | 528 |
| 347 | Ga0157373_10024144 | 3300013100 | Bacteria | 4407 |
| 348 | Ga0157373_10814614 | 3300013100 | Unclassified | 689 |
| 349 | Ga0157371_10138859 | 3300013102 | Bacteria | 1731 |
| 350 | Ga0157369_10062981 | 3300013105 | Bacteria | 3996 |
| 351 | Ga0157374_10020861 | 3300013296 | Bacteria | 5820 |
| 352 | Ga0157374_10031304 | 3300013296 | Bacteria | 4834 |
| 353 | Ga0157374_10321419 | 3300013296 | Bacteria | 1533 |
| 354 | Ga0157374_10463718 | 3300013296 | Bacteria | 1269 |
| 355 | Ga0157374_11757986 | 3300013296 | Bacteria | 645 |
| 356 | Ga0157378_10250530 | 3300013297 | Bacteria | 1695 |
| 357 | Ga0157378_10352979 | 3300013297 | Bacteria | 1437 |
| 358 | Ga0157378_10394325 | 3300013297 | Bacteria | 1362 |
| 359 | Ga0157378_10990661 | 3300013297 | Bacteria | 874 |
| 360 | Ga0157378_11158758 | 3300013297 | Bacteria | 812 |
| 361 | Ga0157378_11194890 | 3300013297 | Bacteria | 800 |
| 362 | Ga0157378_11799559 | 3300013297 | Bacteria | 661 |
| 363 | Ga0163162_10001541 | 3300013306 | Bacteria | 21513 |
| 364 | Ga0163162_10070367 | 3300013306 | Bacteria | 3550 |
| 365 | Ga0163162_10183218 | 3300013306 | Bacteria | 2220 |
| 366 | Ga0163162_10305079 | 3300013306 | Bacteria | 1724 |
| 367 | Ga0163162_10382224 | 3300013306 | Bacteria | 1541 |
| 368 | Ga0163162_10499622 | 3300013306 | Bacteria | 1347 |
| 369 | Ga0163162_11364280 | 3300013306 | Bacteria | 806 |
| 370 | Ga0157372_10073108 | 3300013307 | Bacteria | 3864 |
| 371 | Ga0157372_10093451 | 3300013307 | Bacteria | 3423 |
| 372 | Ga0157375_10075696 | 3300013308 | Bacteria | 3391 |
| 373 | Ga0157375_10079558 | 3300013308 | Bacteria | 3314 |
| 374 | Ga0157375_10092138 | 3300013308 | Bacteria | 3094 |
| 375 | Ga0157375_10260662 | 3300013308 | Bacteria | 1895 |
| 376 | Ga0157375_10612496 | 3300013308 | Bacteria | 1247 |
| 377 | Ga0157375_10788862 | 3300013308 | Bacteria | 1099 |
| 378 | Ga0163163_10148503 | 3300014325 | Bacteria | 2388 |
| 379 | Ga0163163_10259237 | 3300014325 | Bacteria | 1789 |
| 380 | Ga0163163_11031335 | 3300014325 | Bacteria | 886 |
| 381 | Ga0163163_11367113 | 3300014325 | Bacteria | 770 |
| 382 | Ga0163163_11486655 | 3300014325 | Bacteria | 739 |
| 383 | Ga0157380_10133171 | 3300014326 | Bacteria | 2124 |
| 384 | Ga0157380_10252016 | 3300014326 | Bacteria | 1598 |
| 385 | Ga0157380_10548647 | 3300014326 | Bacteria | 1133 |
| 386 | Ga0157377_10000052 | 3300014745 | Bacteria | 89846 |
| 387 | Ga0157377_10001746 | 3300014745 | Bacteria | 9477 |
| 388 | Ga0157377_10134587 | 3300014745 | Bacteria | 1513 |
| 389 | Ga0157377_10165481 | 3300014745 | Bacteria | 1379 |
| 390 | Ga0157379_10010120 | 3300014968 | Bacteria | 8223 |
| 391 | Ga0157379_10018961 | 3300014968 | Bacteria | 6073 |
| 392 | Ga0157379_10032422 | 3300014968 | Bacteria | 4658 |
| 393 | Ga0157379_10124526 | 3300014968 | Bacteria | 2319 |
| 394 | Ga0157379_10157361 | 3300014968 | Bacteria | 2050 |
| 395 | Ga0157379_11095155 | 3300014968 | Bacteria | 763 |
| 396 | Ga0157379_11266112 | 3300014968 | Bacteria | 711 |
| 397 | Ga0157376_10049664 | 3300014969 | Bacteria | 3476 |
| 398 | Ga0157376_10311588 | 3300014969 | Bacteria | 1493 |
| 399 | Ga0157376_10882528 | 3300014969 | Bacteria | 911 |
| 400 | Ga0157376_11018245 | 3300014969 | Bacteria | 851 |
| 401 | Ga0157376_11018690 | 3300014969 | Bacteria | 851 |
| 402 | Ga0157376_11062436 | 3300014969 | Bacteria | 834 |
| 403 | Ga0157376_11231925 | 3300014969 | Bacteria | 777 |
| 404 | Ga0182006_1278431 | 3300015261 | Bacteria | 549 |
| 405 | Ga0182005_1128173 | 3300015265 | Bacteria | 726 |
| 406 | Ga0163161_10175056 | 3300017792 | Bacteria | 1642 |
| 407 | Ga0163161_10263539 | 3300017792 | Bacteria | 1346 |
| 408 | Ga0163161_10267244 | 3300017792 | Bacteria | 1337 |
| 409 | Ga0163161_10436226 | 3300017792 | Bacteria | 1056 |
| 410 | Ga0163161_10510577 | 3300017792 | Bacteria | 980 |
| 411 | Ga0163161_10779967 | 3300017792 | Bacteria | 802 |
| 412 | Ga0163161_11017028 | 3300017792 | Bacteria | 708 |
| 413 | Ga0213876_10165029 | 3300021384 | Bacteria | 1178 |
| 414 | Ga0207666_1044135 | 3300025271 | Bacteria | 700 |
| 415 | Ga0207656_10018712 | 3300025321 | Bacteria | 2730 |
| 416 | Ga0207656_10030751 | 3300025321 | Bacteria | 2220 |
| 417 | Ga0207656_10060820 | 3300025321 | Bacteria | 1656 |
| 418 | Ga0207656_10087605 | 3300025321 | Bacteria | 1408 |
| 419 | Ga0207656_10391007 | 3300025321 | Bacteria | 698 |
| 420 | Ga0207656_10435054 | 3300025321 | Bacteria | 662 |
| 421 | Ga0207653_10259647 | 3300025885 | Bacteria | 667 |
| 422 | Ga0207682_10002798 | 3300025893 | Bacteria | 7716 |
| 423 | Ga0207682_10006323 | 3300025893 | Bacteria | 4779 |
| 424 | Ga0207682_10049842 | 3300025893 | Bacteria | 1730 |
| 425 | Ga0207682_10050056 | 3300025893 | Bacteria | 1726 |
| 426 | Ga0207682_10174224 | 3300025893 | Bacteria | 980 |
| 427 | Ga0207682_10418431 | 3300025893 | Bacteria | 634 |
| 428 | Ga0207642_10217890 | 3300025899 | Bacteria | 1065 |
| 429 | Ga0207642_10284648 | 3300025899 | Bacteria | 952 |
| 430 | Ga0207688_10047915 | 3300025901 | Bacteria | 2387 |
| 431 | Ga0207688_10051580 | 3300025901 | Bacteria | 2304 |
| 432 | Ga0207688_10316967 | 3300025901 | Bacteria | 956 |
| 433 | Ga0207688_10413580 | 3300025901 | Bacteria | 837 |
| 434 | Ga0207680_10007478 | 3300025903 | Bacteria | 5330 |
| 435 | Ga0207680_10193932 | 3300025903 | Bacteria | 1380 |
| 436 | Ga0207680_10524368 | 3300025903 | Bacteria | 845 |
| 437 | Ga0207647_10399755 | 3300025904 | Bacteria | 774 |
| 438 | Ga0207645_10007554 | 3300025907 | Bacteria | 7668 |
| 439 | Ga0207645_10025382 | 3300025907 | Bacteria | 3835 |
| 440 | Ga0207645_10034917 | 3300025907 | Bacteria | 3229 |
| 441 | Ga0207645_10036225 | 3300025907 | Bacteria | 3168 |
| 442 | Ga0207645_10078905 | 3300025907 | Bacteria | 2110 |
| 443 | Ga0207645_10138024 | 3300025907 | Bacteria | 1588 |
| 444 | Ga0207645_10193925 | 3300025907 | Bacteria | 1335 |
| 445 | Ga0207705_10133962 | 3300025909 | Bacteria | 1846 |
| 446 | Ga0207705_10367801 | 3300025909 | Bacteria | 1109 |
| 447 | Ga0207705_10834683 | 3300025909 | Bacteria | 715 |
| 448 | Ga0207707_10315027 | 3300025912 | Bacteria | 1351 |
| 449 | Ga0207695_10203848 | 3300025913 | Bacteria | 1891 |
| 450 | Ga0207671_10006936 | 3300025914 | Bacteria | 9975 |
| 451 | Ga0207671_10306590 | 3300025914 | Bacteria | 1255 |
| 452 | Ga0207660_10009668 | 3300025917 | Bacteria | 6241 |
| 453 | Ga0207662_10208925 | 3300025918 | Bacteria | 1267 |
| 454 | Ga0207657_10473941 | 3300025919 | Bacteria | 982 |
| 455 | Ga0207657_10620415 | 3300025919 | Bacteria | 843 |
| 456 | Ga0207649_10089105 | 3300025920 | Bacteria | 2016 |
| 457 | Ga0207649_10518660 | 3300025920 | Bacteria | 908 |
| 458 | Ga0207652_10013674 | 3300025921 | Bacteria | 6563 |
| 459 | Ga0207646_10916814 | 3300025922 | Bacteria | 777 |
| 460 | Ga0207681_10021768 | 3300025923 | Bacteria | 4080 |
| 461 | Ga0207681_10033049 | 3300025923 | Bacteria | 3390 |
| 462 | Ga0207681_10061183 | 3300025923 | Bacteria | 2587 |
| 463 | Ga0207681_10457546 | 3300025923 | Bacteria | 1039 |
| 464 | Ga0207681_10686797 | 3300025923 | Bacteria | 850 |
| 465 | Ga0207681_10699743 | 3300025923 | Bacteria | 842 |
| 466 | Ga0207681_10713234 | 3300025923 | Bacteria | 834 |
| 467 | Ga0207681_10742925 | 3300025923 | Bacteria | 817 |
| 468 | Ga0207681_11361911 | 3300025923 | Bacteria | 596 |
| 469 | Ga0207694_10017774 | 3300025924 | Bacteria | 5374 |
| 470 | Ga0207694_10167559 | 3300025924 | Bacteria | 1777 |
| 471 | Ga0207694_10700091 | 3300025924 | Bacteria | 854 |
| 472 | Ga0207650_10000348 | 3300025925 | Bacteria | 44624 |
| 473 | Ga0207650_10006455 | 3300025925 | Bacteria | 7988 |
| 474 | Ga0207650_10038591 | 3300025925 | Bacteria | 3489 |
| 475 | Ga0207650_10092424 | 3300025925 | Bacteria | 2314 |
| 476 | Ga0207650_10100288 | 3300025925 | Bacteria | 2227 |
| 477 | Ga0207650_10115135 | 3300025925 | Bacteria | 2086 |
| 478 | Ga0207650_10181055 | 3300025925 | Bacteria | 1679 |
| 479 | Ga0207650_10284044 | 3300025925 | Bacteria | 1348 |
| 480 | Ga0207650_10428009 | 3300025925 | Bacteria | 1099 |
| 481 | Ga0207650_10481654 | 3300025925 | Bacteria | 1035 |
| 482 | Ga0207650_10888675 | 3300025925 | Bacteria | 756 |
| 483 | Ga0207650_11804990 | 3300025925 | Bacteria | 517 |
| 484 | Ga0207659_10000583 | 3300025926 | Bacteria | 21821 |
| 485 | Ga0207659_10009948 | 3300025926 | Bacteria | 5955 |
| 486 | Ga0207659_10010917 | 3300025926 | Bacteria | 5721 |
| 487 | Ga0207659_10014232 | 3300025926 | Bacteria | 5121 |
| 488 | Ga0207659_10041819 | 3300025926 | Bacteria | 3211 |
| 489 | Ga0207659_10069861 | 3300025926 | Bacteria | 2560 |
| 490 | Ga0207659_10419995 | 3300025926 | Bacteria | 1121 |
| 491 | Ga0207659_11800545 | 3300025926 | Bacteria | 520 |
| 492 | Ga0207687_10056250 | 3300025927 | Bacteria | 2759 |
| 493 | Ga0207687_10211632 | 3300025927 | Bacteria | 1521 |
| 494 | Ga0207687_10775581 | 3300025927 | Bacteria | 817 |
| 495 | Ga0207644_10005232 | 3300025931 | Bacteria | 8469 |
| 496 | Ga0207644_10034321 | 3300025931 | Bacteria | 3549 |
| 497 | Ga0207644_10041754 | 3300025931 | Bacteria | 3247 |
| 498 | Ga0207644_10052986 | 3300025931 | Bacteria | 2918 |
| 499 | Ga0207644_10216505 | 3300025931 | Bacteria | 1516 |
| 500 | Ga0207644_10256651 | 3300025931 | Bacteria | 1396 |
| 501 | Ga0207644_11364647 | 3300025931 | Bacteria | 595 |
| 502 | Ga0207644_11880628 | 3300025931 | Bacteria | 500 |
| 503 | Ga0207690_10050834 | 3300025932 | Bacteria | 2769 |
| 504 | Ga0207690_10055305 | 3300025932 | Bacteria | 2672 |
| 505 | Ga0207690_10189841 | 3300025932 | Bacteria | 1553 |
| 506 | Ga0207706_10051645 | 3300025933 | Bacteria | 3630 |
| 507 | Ga0207706_10080651 | 3300025933 | Bacteria | 2861 |
| 508 | Ga0207706_10150655 | 3300025933 | Bacteria | 2045 |
| 509 | Ga0207706_10411722 | 3300025933 | Bacteria | 1172 |
| 510 | Ga0207706_10467903 | 3300025933 | Bacteria | 1090 |
| 511 | Ga0207706_10831125 | 3300025933 | Bacteria | 783 |
| 512 | Ga0207686_10803521 | 3300025934 | Bacteria | 754 |
| 513 | Ga0207709_10007425 | 3300025935 | Bacteria | 6108 |
| 514 | Ga0207709_10081126 | 3300025935 | Bacteria | 2091 |
| 515 | Ga0207709_10229502 | 3300025935 | Bacteria | 1344 |
| 516 | Ga0207709_10813349 | 3300025935 | Bacteria | 755 |
| 517 | Ga0207709_10901308 | 3300025935 | Bacteria | 719 |
| 518 | Ga0207670_10231615 | 3300025936 | Bacteria | 1419 |
| 519 | Ga0207670_10238795 | 3300025936 | Bacteria | 1399 |
| 520 | Ga0207670_10343637 | 3300025936 | Bacteria | 1180 |
| 521 | Ga0207669_10008088 | 3300025937 | Bacteria | 4918 |
| 522 | Ga0207669_10121165 | 3300025937 | Bacteria | 1776 |
| 523 | Ga0207669_10123273 | 3300025937 | Bacteria | 1764 |
| 524 | Ga0207669_10782080 | 3300025937 | Bacteria | 790 |
| 525 | Ga0207704_10050252 | 3300025938 | Bacteria | 2514 |
| 526 | Ga0207704_10494722 | 3300025938 | Bacteria | 984 |
| 527 | Ga0207704_10500872 | 3300025938 | Bacteria | 979 |
| 528 | Ga0207704_11006129 | 3300025938 | Bacteria | 705 |
| 529 | Ga0207665_10452007 | 3300025939 | Bacteria | 986 |
| 530 | Ga0207691_10029127 | 3300025940 | Bacteria | 5165 |
| 531 | Ga0207691_10040440 | 3300025940 | Bacteria | 4307 |
| 532 | Ga0207691_10052613 | 3300025940 | Bacteria | 3719 |
| 533 | Ga0207691_10055017 | 3300025940 | Bacteria | 3628 |
| 534 | Ga0207691_10122157 | 3300025940 | Bacteria | 2307 |
| 535 | Ga0207691_10199532 | 3300025940 | Bacteria | 1742 |
| 536 | Ga0207691_10324178 | 3300025940 | Bacteria | 1320 |
| 537 | Ga0207691_10446283 | 3300025940 | Bacteria | 1101 |
| 538 | Ga0207691_10480642 | 3300025940 | Bacteria | 1056 |
| 539 | Ga0207691_10522681 | 3300025940 | Bacteria | 1007 |
| 540 | Ga0207711_10021079 | 3300025941 | Bacteria | 5443 |
| 541 | Ga0207711_10025658 | 3300025941 | Bacteria | 4942 |
| 542 | Ga0207711_10186248 | 3300025941 | Bacteria | 1890 |
| 543 | Ga0207711_10207381 | 3300025941 | Bacteria | 1790 |
| 544 | Ga0207689_10010535 | 3300025942 | Bacteria | 7959 |
| 545 | Ga0207689_10013874 | 3300025942 | Bacteria | 6864 |
| 546 | Ga0207689_10031595 | 3300025942 | Bacteria | 4406 |
| 547 | Ga0207689_10095823 | 3300025942 | Bacteria | 2437 |
| 548 | Ga0207661_10176600 | 3300025944 | Bacteria | 1862 |
| 549 | Ga0207661_10888849 | 3300025944 | Bacteria | 820 |
| 550 | Ga0207661_11379629 | 3300025944 | Bacteria | 647 |
| 551 | Ga0207679_10039737 | 3300025945 | Bacteria | 3362 |
| 552 | Ga0207679_10096341 | 3300025945 | Bacteria | 2302 |
| 553 | Ga0207679_10195046 | 3300025945 | Bacteria | 1687 |
| 554 | Ga0207679_10321562 | 3300025945 | Bacteria | 1340 |
| 555 | Ga0207679_10598961 | 3300025945 | Bacteria | 993 |
| 556 | Ga0207679_11137874 | 3300025945 | Bacteria | 716 |
| 557 | Ga0207679_11267132 | 3300025945 | Bacteria | 677 |
| 558 | Ga0207679_11686370 | 3300025945 | Bacteria | 580 |
| 559 | Ga0207667_10394009 | 3300025949 | Bacteria | 1410 |
| 560 | Ga0207667_11147727 | 3300025949 | Bacteria | 758 |
| 561 | Ga0207651_10004673 | 3300025960 | Bacteria | 6942 |
| 562 | Ga0207651_10039338 | 3300025960 | Bacteria | 3118 |
| 563 | Ga0207651_10045993 | 3300025960 | Bacteria | 2931 |
| 564 | Ga0207651_10121226 | 3300025960 | Bacteria | 1983 |
| 565 | Ga0207651_10280292 | 3300025960 | Bacteria | 1377 |
| 566 | Ga0207651_10332864 | 3300025960 | Bacteria | 1273 |
| 567 | Ga0207651_10532558 | 3300025960 | Bacteria | 1019 |
| 568 | Ga0207651_10754146 | 3300025960 | Bacteria | 860 |
| 569 | Ga0207651_10860525 | 3300025960 | Bacteria | 806 |
| 570 | Ga0207651_11116435 | 3300025960 | Bacteria | 707 |
| 571 | Ga0207651_11966971 | 3300025960 | Bacteria | 525 |
| 572 | Ga0207712_10168668 | 3300025961 | Bacteria | 1709 |
| 573 | Ga0207668_10085291 | 3300025972 | Bacteria | 2304 |
| 574 | Ga0207668_10153059 | 3300025972 | Bacteria | 1788 |
| 575 | Ga0207668_10335248 | 3300025972 | Bacteria | 1260 |
| 576 | Ga0207668_10356237 | 3300025972 | Bacteria | 1225 |
| 577 | Ga0207668_11173781 | 3300025972 | Bacteria | 689 |
| 578 | Ga0207640_10035795 | 3300025981 | Bacteria | 3110 |
| 579 | Ga0207640_10162658 | 3300025981 | Bacteria | 1653 |
| 580 | Ga0207640_10525867 | 3300025981 | Bacteria | 989 |
| 581 | Ga0207640_10761489 | 3300025981 | Bacteria | 836 |
| 582 | Ga0207658_10020571 | 3300025986 | Bacteria | 4569 |
| 583 | Ga0207658_10068722 | 3300025986 | Bacteria | 2674 |
| 584 | Ga0207658_10070079 | 3300025986 | Bacteria | 2652 |
| 585 | Ga0207658_10115289 | 3300025986 | Bacteria | 2132 |
| 586 | Ga0207658_10329291 | 3300025986 | Bacteria | 1324 |
| 587 | Ga0207658_10975899 | 3300025986 | Bacteria | 773 |
| 588 | Ga0207677_10003814 | 3300026023 | Bacteria | 8012 |
| 589 | Ga0207677_10027411 | 3300026023 | Bacteria | 3587 |
| 590 | Ga0207677_10375101 | 3300026023 | Bacteria | 1199 |
| 591 | Ga0207677_10869853 | 3300026023 | Bacteria | 811 |
| 592 | Ga0207677_11692881 | 3300026023 | Bacteria | 586 |
| 593 | Ga0207703_10001562 | 3300026035 | Bacteria | 20760 |
| 594 | Ga0207703_10008849 | 3300026035 | Bacteria | 7936 |
| 595 | Ga0207703_10020445 | 3300026035 | Bacteria | 5178 |
| 596 | Ga0207703_10178481 | 3300026035 | Bacteria | 1873 |
| 597 | Ga0207639_10010593 | 3300026041 | Bacteria | 6388 |
| 598 | Ga0207639_11028147 | 3300026041 | Bacteria | 772 |
| 599 | Ga0207678_10003783 | 3300026067 | Bacteria | 13608 |
| 600 | Ga0207678_10012734 | 3300026067 | Bacteria | 7386 |
| 601 | Ga0207678_10045136 | 3300026067 | Bacteria | 3811 |
| 602 | Ga0207678_11490600 | 3300026067 | Bacteria | 597 |
| 603 | Ga0207708_10075077 | 3300026075 | Bacteria | 2592 |
| 604 | Ga0207708_10160831 | 3300026075 | Bacteria | 1773 |
| 605 | Ga0207708_11203673 | 3300026075 | Bacteria | 662 |
| 606 | Ga0207702_10072573 | 3300026078 | Bacteria | 2967 |
| 607 | Ga0207702_10108822 | 3300026078 | Bacteria | 2460 |
| 608 | Ga0207702_10186497 | 3300026078 | Bacteria | 1913 |
| 609 | Ga0207702_12043531 | 3300026078 | Bacteria | 563 |
| 610 | Ga0207641_10000655 | 3300026088 | Bacteria | 37743 |
| 611 | Ga0207641_10002300 | 3300026088 | Bacteria | 17770 |
| 612 | Ga0207641_10234396 | 3300026088 | Bacteria | 1707 |
| 613 | Ga0207641_10412113 | 3300026088 | Bacteria | 1299 |
| 614 | Ga0207641_10436561 | 3300026088 | Bacteria | 1263 |
| 615 | Ga0207641_11035074 | 3300026088 | Bacteria | 818 |
| 616 | Ga0207641_11113301 | 3300026088 | Bacteria | 788 |
| 617 | Ga0207641_11697814 | 3300026088 | Bacteria | 633 |
| 618 | Ga0207648_10001074 | 3300026089 | Bacteria | 30606 |
| 619 | Ga0207648_10014921 | 3300026089 | Bacteria | 7161 |
| 620 | Ga0207648_10016497 | 3300026089 | Bacteria | 6745 |
| 621 | Ga0207648_10075240 | 3300026089 | Bacteria | 2944 |
| 622 | Ga0207648_10186283 | 3300026089 | Bacteria | 1839 |
| 623 | Ga0207648_10202928 | 3300026089 | Bacteria | 1759 |
| 624 | Ga0207648_11261935 | 3300026089 | Bacteria | 694 |
| 625 | Ga0207648_11488458 | 3300026089 | Bacteria | 636 |
| 626 | Ga0207676_10032242 | 3300026095 | Bacteria | 3946 |
| 627 | Ga0207676_10038292 | 3300026095 | Bacteria | 3658 |
| 628 | Ga0207676_10058595 | 3300026095 | Bacteria | 3038 |
| 629 | Ga0207676_10315699 | 3300026095 | Bacteria | 1432 |
| 630 | Ga0207676_12085534 | 3300026095 | Bacteria | 565 |
| 631 | Ga0207674_10096614 | 3300026116 | Bacteria | 2939 |
| 632 | Ga0207674_10101334 | 3300026116 | Bacteria | 2860 |
| 633 | Ga0207674_10662448 | 3300026116 | Bacteria | 1008 |
| 634 | Ga0207675_100004707 | 3300026118 | Bacteria | 13136 |
| 635 | Ga0207675_100017601 | 3300026118 | Bacteria | 6666 |
| 636 | Ga0207675_100182078 | 3300026118 | Bacteria | 2012 |
| 637 | Ga0207675_100522179 | 3300026118 | Bacteria | 1184 |
| 638 | Ga0207675_100664677 | 3300026118 | Bacteria | 1049 |
| 639 | Ga0207675_100864109 | 3300026118 | Bacteria | 920 |
| 640 | Ga0207675_102337014 | 3300026118 | Bacteria | 548 |
| 641 | Ga0207675_102649171 | 3300026118 | Unclassified | 510 |
| 642 | Ga0207683_10009924 | 3300026121 | Bacteria | 8121 |
| 643 | Ga0207683_10022883 | 3300026121 | Bacteria | 5369 |
| 644 | Ga0207683_10050891 | 3300026121 | Bacteria | 3629 |
| 645 | Ga0207683_10087698 | 3300026121 | Bacteria | 2768 |
| 646 | Ga0207683_10141670 | 3300026121 | Bacteria | 2167 |
| 647 | Ga0207683_10278360 | 3300026121 | Bacteria | 1529 |
| 648 | Ga0207683_10567821 | 3300026121 | Bacteria | 1049 |
| 649 | Ga0207683_10683211 | 3300026121 | Bacteria | 951 |
| 650 | Ga0207683_11521922 | 3300026121 | Bacteria | 618 |
| 651 | Ga0207683_11704337 | 3300026121 | Bacteria | 580 |
| 652 | Ga0207683_12119983 | 3300026121 | Bacteria | 510 |
| 653 | Ga0207698_10004331 | 3300026142 | Bacteria | 8639 |
| 654 | Ga0207698_10026032 | 3300026142 | Bacteria | 4133 |
| 655 | Ga0207698_10039973 | 3300026142 | Bacteria | 3479 |
| 656 | Ga0207698_10042642 | 3300026142 | Bacteria | 3392 |
| 657 | Ga0207698_10121702 | 3300026142 | Bacteria | 2210 |
| 658 | Ga0207698_10341159 | 3300026142 | Bacteria | 1411 |
| 659 | Ga0207698_10659331 | 3300026142 | Bacteria | 1037 |
| 660 | Ga0207698_11258709 | 3300026142 | Bacteria | 754 |
| 661 | Ga0207698_12600978 | 3300026142 | Bacteria | 515 |
| 662 | Ga0268266_10758396 | 3300028379 | Bacteria | 937 |
| 663 | Ga0268266_10869988 | 3300028379 | Bacteria | 871 |
| 664 | Ga0268266_10897402 | 3300028379 | Bacteria | 857 |
| 665 | Ga0268266_10971025 | 3300028379 | Bacteria | 822 |
| 666 | Ga0268266_12193883 | 3300028379 | Bacteria | 524 |
| 667 | Ga0268265_10422181 | 3300028380 | Bacteria | 1238 |
| 668 | Ga0268265_11089431 | 3300028380 | Bacteria | 793 |
| 669 | Ga0268265_11101237 | 3300028380 | Bacteria | 788 |
| 670 | Ga0268264_10172460 | 3300028381 | Bacteria | 1957 |
| 671 | Ga0268264_10549120 | 3300028381 | Bacteria | 1133 |
| 672 | Ga0307517_10000173 | 3300028786 | Bacteria | 105751 |
| 673 | Ga0307515_10089385 | 3300028794 | Bacteria | 3879 |
| 674 | Ga0307515_10162825 | 3300028794 | Bacteria | 2265 |
| 675 | Ga0307515_10291152 | 3300028794 | Bacteria | 1328 |
| 676 | Ga0307515_10331801 | 3300028794 | Bacteria | 1179 |
| 677 | Ga0307512_10049347 | 3300030522 | Bacteria | 3395 |
| 678 | Ga0307512_10059848 | 3300030522 | Bacteria | 2951 |
| 679 | Ga0307513_10030756 | 3300031456 | Bacteria | 6095 |
| 680 | Ga0307513_10109519 | 3300031456 | Bacteria | 2759 |
| 681 | Ga0307513_10146635 | 3300031456 | Bacteria | 2277 |
| 682 | Ga0307509_10000181 | 3300031507 | Bacteria | 98346 |
| 683 | Ga0307509_10050392 | 3300031507 | Bacteria | 4458 |
| 684 | Ga0307509_10053814 | 3300031507 | Bacteria | 4288 |
| 685 | Ga0307509_10160049 | 3300031507 | Bacteria | 2151 |
| 686 | Ga0307509_10175044 | 3300031507 | Bacteria | 2019 |
| 687 | Ga0307509_10839467 | 3300031507 | Bacteria | 583 |
| 688 | Ga0307408_100120697 | 3300031548 | Bacteria | 2030 |
| 689 | Ga0307408_100207826 | 3300031548 | Bacteria | 1589 |
| 690 | Ga0307408_100449412 | 3300031548 | Bacteria | 1117 |
| 691 | Ga0307408_101612929 | 3300031548 | Bacteria | 616 |
| 692 | Ga0307508_10000738 | 3300031616 | Bacteria | 38723 |
| 693 | Ga0307508_10340777 | 3300031616 | Bacteria | 1090 |
| 694 | Ga0307514_10073480 | 3300031649 | Bacteria | 2557 |
| 695 | Ga0307516_10010101 | 3300031730 | Bacteria | 10436 |
| 696 | Ga0307516_10136356 | 3300031730 | Bacteria | 2228 |
| 697 | Ga0307405_10002174 | 3300031731 | Bacteria | 8565 |
| 698 | Ga0307405_10063724 | 3300031731 | Bacteria | 2339 |
| 699 | Ga0307405_10886948 | 3300031731 | Bacteria | 753 |
| 700 | Ga0307413_10733549 | 3300031824 | Bacteria | 824 |
| 701 | Ga0307518_10375560 | 3300031838 | Bacteria | 810 |
| 702 | Ga0307518_10426021 | 3300031838 | Bacteria | 725 |
| 703 | Ga0307410_10457974 | 3300031852 | Bacteria | 1042 |
| 704 | Ga0307406_10119880 | 3300031901 | Bacteria | 1827 |
| 705 | Ga0307406_10160694 | 3300031901 | Bacteria | 1614 |
| 706 | Ga0307406_11170277 | 3300031901 | Bacteria | 666 |
| 707 | Ga0307406_11579764 | 3300031901 | Bacteria | 579 |
| 708 | Ga0307407_10016152 | 3300031903 | Bacteria | 3710 |
| 709 | Ga0307407_10142732 | 3300031903 | Bacteria | 1547 |
| 710 | Ga0307407_10584081 | 3300031903 | Bacteria | 830 |
| 711 | Ga0307407_11283278 | 3300031903 | Bacteria | 574 |
| 712 | Ga0307412_10055698 | 3300031911 | Bacteria | 2631 |
| 713 | Ga0307412_10280350 | 3300031911 | Bacteria | 1308 |
| 714 | Ga0307409_100000998 | 3300031995 | Bacteria | 13235 |
| 715 | Ga0307409_100176604 | 3300031995 | Bacteria | 1886 |
| 716 | Ga0307409_100965120 | 3300031995 | Bacteria | 869 |
| 717 | Ga0307409_101452959 | 3300031995 | Bacteria | 712 |
| 718 | Ga0307409_101876405 | 3300031995 | Bacteria | 629 |
| 719 | Ga0307416_100002959 | 3300032002 | Bacteria | 9907 |
| 720 | Ga0307416_100020663 | 3300032002 | Bacteria | 4705 |
| 721 | Ga0307416_101035753 | 3300032002 | Bacteria | 924 |
| 722 | Ga0307414_10174618 | 3300032004 | Bacteria | 1722 |
| 723 | Ga0307414_10393865 | 3300032004 | Bacteria | 1201 |
| 724 | Ga0307411_10118014 | 3300032005 | Bacteria | 1913 |
| 725 | Ga0307411_10347968 | 3300032005 | Bacteria | 1207 |
| 726 | Ga0307411_10623965 | 3300032005 | Bacteria | 930 |
| 727 | Ga0307411_10737774 | 3300032005 | Bacteria | 861 |
| 728 | Ga0307411_11056610 | 3300032005 | Bacteria | 730 |
| 729 | Ga0307415_100018265 | 3300032126 | Bacteria | 4230 |
| 730 | Ga0307415_101336537 | 3300032126 | Bacteria | 680 |
| 731 | Ga0307507_10195459 | 3300033179 | Bacteria | 1412 |
| 732 | Ga0307507_10247572 | 3300033179 | Bacteria | 1156 |
| 733 | Ga0307510_10001034 | 3300033180 | Bacteria | 29497 |
| 734 | Ga0307510_10115919 | 3300033180 | Bacteria | 2402 |
| 735 | Ga0307510_10197173 | 3300033180 | Bacteria | 1553 |
| 736 | Ga0307510_10662132 | 3300033180 | Bacteria | 503 |
| 737 | Ga0373938_0048547 | 3300034957 | Bacteria | 963 |
| 738 | Ga0373928_0039245 | 3300035084 | Bacteria | 1081 |
| 739 | Ga0373928_0048659 | 3300035084 | Bacteria | 995 |
| 740 | Ga0373932_0034803 | 3300035112 | Bacteria | 1421 |
| 741 | Ga0373939_0019235 | 3300035114 | Bacteria | 1840 |
| 742 | Ga0373943_0095824 | 3300035170 | Bacteria | 1544 |
| 743 | Ga0373946_0263875 | 3300035171 | Bacteria | 843 |
| 744 | Ga0373962_0265784 | 3300035242 | Bacteria | 599 |
| 745 | Ga0373931_0030179 | 3300035691 | Bacteria | 2789 |
| 746 | Ga0373931_0891642 | 3300035691 | Bacteria | 597 |
| 747 | Ga0373947_1097154 | 3300035725 | Bacteria | 543 |
| 748 | Ga0373937_0955671 | 3300036401 | Bacteria | 806 |
| 749 | Ga0395905_0030862 | 3300037471 | Bacteria | 5047 |
| 750 | Ga0436364_0872711 | 3300037853 | Unclassified | 756 |
| 751 | Ga0436365_0830380 | 3300039437 | Bacteria | 931 |
| 752 | Ga0436365_1729666 | 3300039437 | Bacteria | 4109 |
| 753 | Ga0436363_1353996 | 3300039450 | Bacteria | 1993 |
| 754 | Ga0451793_0301768 | 3300041452 | Bacteria | 503 |
| 755 | Ga0451797_0590806 | 3300041453 | Bacteria | 568 |
| 756 | Ga0451798_0746032 | 3300041458 | Bacteria | 677 |
| 757 | Ga0451800_0691674 | 3300041459 | Bacteria | 527 |
| 758 | Ga0451802_1535241 | 3300041460 | Bacteria | 1034 |
| 759 | Ga0451807_0244690 | 3300041486 | Bacteria | 643 |
| 760 | Ga0451847_0322153 | 3300041503 | Bacteria | 581 |
| 761 | Ga0451851_1352704 | 3300041507 | Bacteria | 824 |
| 762 | Ga0451843_1166635 | 3300041509 | Bacteria | 572 |
| 763 | Ga0451853_2191125 | 3300041512 | Bacteria | 736 |
| 764 | Ga0439455_0161594 | 3300042012 | Bacteria | 641 |
| 765 | Ga0450913_021465 | 3300042117 | Bacteria | 595 |
| 766 | Ga0450898_084372 | 3300042134 | Bacteria | 649 |
| 767 | Ga0439464_0096006 | 3300042439 | Bacteria | 897 |
| 768 | Ga0439460_0174247 | 3300042461 | Bacteria | 725 |
| 769 | Ga0451576_0386825 | 3300045051 | Bacteria | 1466 |
| 770 | Ga0451576_0577456 | 3300045051 | Bacteria | 1181 |
| 771 | Ga0495592_0000234 | 3300046454 | Bacteria | 47791 |
| 772 | Ga0495592_0183951 | 3300046454 | Bacteria | 1421 |
| 773 | Ga0495638_0129775 | 3300046460 | Bacteria | 1482 |
| 774 | Ga0495582_0363670 | 3300046473 | Bacteria | 833 |
| 775 | Ga0495582_0562783 | 3300046473 | Bacteria | 660 |
| 776 | Ga0495608_0380208 | 3300046511 | Bacteria | 866 |
| 777 | Ga0495610_0055804 | 3300046512 | Bacteria | 1902 |
| 778 | Ga0495620_0280138 | 3300046515 | Bacteria | 634 |
| 779 | Ga0495628_0541018 | 3300046516 | Bacteria | 837 |
| 780 | Ga0495630_0095573 | 3300046517 | Bacteria | 2247 |
| 781 | Ga0495632_0071188 | 3300046519 | Bacteria | 1671 |
| 782 | Ga0495632_0159626 | 3300046519 | Bacteria | 1039 |
| 783 | Ga0495648_0083206 | 3300046524 | Bacteria | 1814 |
| 784 | Ga0495654_0246427 | 3300046530 | Bacteria | 746 |
| 785 | Ga0495586_0249774 | 3300046535 | Bacteria | 1012 |
| 786 | Ga0495586_0460853 | 3300046535 | Bacteria | 733 |
| 787 | Ga0495598_0166716 | 3300046537 | Bacteria | 778 |
| 788 | Ga0495621_0140935 | 3300046539 | Bacteria | 943 |
| 789 | Ga0495622_0142242 | 3300046557 | Bacteria | 1089 |
| 790 | Ga0495668_0115134 | 3300046616 | Bacteria | 1471 |
| 791 | Ga0495611_0341401 | 3300046648 | Bacteria | 688 |
| 792 | Ga0495625_0323826 | 3300046660 | Bacteria | 981 |
| 793 | Ga0495646_0207646 | 3300046680 | Bacteria | 1064 |
| 794 | Ga0495647_0056914 | 3300046681 | Bacteria | 1534 |
| 795 | Ga0495658_0028770 | 3300046683 | Bacteria | 3002 |
| 796 | Ga0495658_0098601 | 3300046683 | Bacteria | 1741 |
| 797 | Ga0495658_0311390 | 3300046683 | Bacteria | 997 |
| 798 | Ga0495658_0539703 | 3300046683 | Bacteria | 747 |
| 799 | Ga0495624_0017157 | 3300046690 | Bacteria | 4867 |
| 800 | Ga0495636_0663588 | 3300047318 | Bacteria | 513 |
| 801 | Ga0495676_0114566 | 3300047321 | Bacteria | 1972 |
| 802 | Ga0495683_0296305 | 3300047323 | Bacteria | 696 |
| 803 | Ga0495675_0223797 | 3300047444 | Bacteria | 1138 |
| 804 | Ga0495615_0159241 | 3300048090 | Bacteria | 677 |
| 805 | Ga0496100_0135463 | 3300048903 | Bacteria | 1739 |
| 806 | Ga0496101_0151451 | 3300048904 | Bacteria | 1774 |
| 807 | Ga0496101_0180669 | 3300048904 | Bacteria | 1625 |
| 808 | Ga0496102_0365076 | 3300048905 | Bacteria | 1359 |
| 809 | Ga0496104_0026264 | 3300048907 | Bacteria | 5375 |
| 810 | Ga0496104_0677349 | 3300048907 | Bacteria | 939 |
| 811 | Ga0496104_1294369 | 3300048907 | Bacteria | 632 |
| 812 | Ga0496105_0453340 | 3300048908 | Bacteria | 1012 |
| 813 | Ga0496105_0722096 | 3300048908 | Bacteria | 763 |
| 814 | Ga0496106_0053191 | 3300048909 | Bacteria | 3057 |
| 815 | Ga0496106_0169444 | 3300048909 | Bacteria | 1730 |
| 816 | Ga0496107_0059091 | 3300048910 | Bacteria | 2774 |
| 817 | Ga0496107_1245042 | 3300048910 | Bacteria | 534 |
| 818 | Ga0496108_0123130 | 3300048911 | Bacteria | 2225 |
| 819 | Ga0496108_0167208 | 3300048911 | Bacteria | 1902 |
| 820 | Ga0496108_0900308 | 3300048911 | Bacteria | 759 |
| 821 | Ga0496109_0085339 | 3300048912 | Bacteria | 2914 |
| 822 | Ga0496110_0239621 | 3300048913 | Bacteria | 1650 |
| 823 | Ga0496110_0305532 | 3300048913 | Bacteria | 1449 |
| 824 | Ga0496110_0406612 | 3300048913 | Bacteria | 1241 |
| 825 | Ga0496110_0816931 | 3300048913 | Bacteria | 837 |
| 826 | Ga0496110_0853512 | 3300048913 | Bacteria | 816 |
| 827 | Ga0496111_0170347 | 3300048914 | Bacteria | 1618 |
| 828 | Ga0496111_0207295 | 3300048914 | Bacteria | 1457 |
| 829 | Ga0496113_0304954 | 3300048916 | Bacteria | 1275 |
| 830 | Ga0496114_0218567 | 3300048917 | Bacteria | 1672 |
| 831 | Ga0496114_0478741 | 3300048917 | Bacteria | 1101 |
| 832 | Ga0496114_0549530 | 3300048917 | Bacteria | 1020 |
| 833 | Ga0496114_0630345 | 3300048917 | Bacteria | 944 |
| 834 | Ga0496114_0987976 | 3300048917 | Bacteria | 725 |
| 835 | Ga0496115_0108476 | 3300048918 | Bacteria | 2279 |
| 836 | Ga0496121_0366734 | 3300048924 | Bacteria | 954 |
| 837 | Ga0495678_223737 | 3300049459 | Bacteria | 570 |
| 838 | Ga0501300_025195 | 3300049523 | Bacteria | 872 |
| 839 | Ga0501043_0000038 | 3300049579 | Bacteria | 128656 |
| 840 | Ga0501046_0000049 | 3300049580 | Bacteria | 135088 |
| 841 | Ga0501047_0000039 | 3300049581 | Bacteria | 187849 |
| 842 | Ga0501048_0011326 | 3300049582 | Bacteria | 6651 |
| 843 | Ga0501198_000058 | 3300049649 | Bacteria | 31939 |
| 844 | Ga0501206_034761 | 3300049653 | Bacteria | 760 |
| 845 | Ga0501222_000066 | 3300049662 | Bacteria | 32105 |
| 846 | Ga0501253_130541 | 3300049683 | Bacteria | 617 |
| 847 | Ga0501257_021230 | 3300049686 | Bacteria | 1530 |
| 848 | Ga0501083_0505031 | 3300049744 | Bacteria | 787 |
| 849 | Ga0501262_009888 | 3300049759 | Bacteria | 1186 |
| 850 | Ga0501265_003351 | 3300049762 | Bacteria | 1821 |
| 851 | Ga0501273_091386 | 3300049770 | Bacteria | 518 |
| 852 | Ga0501044_0175870 | 3300049823 | Bacteria | 2110 |
| 853 | Ga0501045_0007021 | 3300049824 | Bacteria | 7809 |
| 854 | nmdc:mga03683_55825_c1 | 3300050489 | Bacteria | 1659 |
| 855 | nmdc:mga0k408_147931_c1 | 3300050493 | Bacteria | 1398 |
| 856 | nmdc:mga0k408_286076_c1 | 3300050493 | Bacteria | 984 |
| 857 | nmdc:mga0k408_521054_c1 | 3300050493 | Bacteria | 704 |
| 858 | nmdc:mga0k408_5343_c1 | 3300050493 | Bacteria | 6826 |
| 859 | nmdc:mga0k408_873488_c1 | 3300050493 | Bacteria | 522 |
| 860 | nmdc:mga07m45_417047_c1 | 3300050496 | Bacteria | 779 |
| 861 | nmdc:mga09592_2954_c1 | 3300050508 | Bacteria | 13781 |
| 862 | nmdc:mga0qj67_37390_c1 | 3300050509 | Bacteria | 3802 |
| 863 | nmdc:mga08y16_863607_c1 | 3300050511 | Bacteria | 893 |
| 864 | nmdc:mga08y16_899569_c1 | 3300050511 | Bacteria | 871 |
| 865 | nmdc:mga0n895_480444_c1 | 3300050512 | Bacteria | 1253 |
| 866 | nmdc:mga08x19_858063_c1 | 3300050514 | Bacteria | 645 |
| 867 | nmdc:mga0sz30_352752_c1 | 3300050516 | Bacteria | 657 |
| 868 | Ga0495601_0930788 | 3300053077 | Bacteria | 548 |
| 869 | Ga0495595_0599681 | 3300053084 | Bacteria | 563 |
| 870 | Ga0495595_0718807 | 3300053084 | Bacteria | 512 |
| 871 | Ga0500644_0008644 | 3300053088 | Bacteria | 2693 |
| 872 | Ga0500647_0294610 | 3300053091 | Bacteria | 696 |
| 873 | Ga0500583_0067135 | 3300053092 | Bacteria | 1708 |
| 874 | Ga0500651_0040675 | 3300053093 | Bacteria | 2929 |
| 875 | Ga0500651_0271594 | 3300053093 | Bacteria | 980 |
| 876 | Ga0500650_0112775 | 3300053098 | Bacteria | 1269 |
| 877 | Ga0500650_0355014 | 3300053098 | Bacteria | 640 |
| 878 | Ga0500594_0023894 | 3300053118 | Bacteria | 1553 |
| 879 | Ga0500607_232469 | 3300053121 | Bacteria | 754 |
| 880 | Ga0500652_248080 | 3300053131 | Bacteria | 706 |
| 881 | Ga0500559_0000262 | 3300053136 | Bacteria | 41173 |
| 882 | Ga0500564_121366 | 3300053138 | Bacteria | 1138 |
| 883 | Ga0500573_0160143 | 3300053140 | Bacteria | 1226 |
| 884 | Ga0500590_210174 | 3300053148 | Bacteria | 813 |
| 885 | Ga0500604_0311153 | 3300053151 | Bacteria | 546 |
| 886 | Ga0500616_0192579 | 3300053153 | Bacteria | 909 |
| 887 | Ga0500619_014471 | 3300053154 | Bacteria | 2121 |
| 888 | Ga0500619_267121 | 3300053154 | Bacteria | 559 |
| 889 | Ga0500622_0002641 | 3300053156 | Bacteria | 12735 |
| 890 | Ga0500636_0355069 | 3300053177 | Bacteria | 698 |
| 891 | Ga0500636_0390505 | 3300053177 | Bacteria | 649 |
| 892 | Ga0500599_011466 | 3300053736 | Bacteria | 1182 |
| 893 | Ga0500587_009905 | 3300053739 | Bacteria | 1212 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005343 | Ga0070687_100975239 | Ga0070687_1009752392 | 82 |
| 2 | 3300031507 | Ga0307509_10000181 | Ga0307509_10000181100 | 83 |
| 3 | 3300031649 | Ga0307514_10073480 | Ga0307514_100734803 | 83 |
| 4 | 3300031838 | Ga0307518_10375560 | Ga0307518_103755602 | 83 |
| 5 | 3300032005 | Ga0307411_10623965 | Ga0307411_106239652 | 83 |
| 6 | 3300033180 | Ga0307510_10115919 | Ga0307510_101159193 | 83 |
| 7 | 3300053093 | Ga0500651_0271594 | Ga0500651_0271594_573_884 | 83 |
| 8 | 3300031730 | Ga0307516_10010101 | Ga0307516_100101018 | 84 |
| 9 | 3300047318 | Ga0495636_0663588 | Ga0495636_0663588_51_362 | 84 |
| 10 | 3300005614 | Ga0068856_100117837 | Ga0068856_1001178373 | 87 |
| 11 | 3300025885 | Ga0207653_10259647 | Ga0207653_102596472 | 87 |
| 12 | 3300026078 | Ga0207702_10108822 | Ga0207702_101088223 | 87 |
| 13 | 3300005367 | Ga0070667_101688766 | Ga0070667_1016887662 | 88 |
| 14 | 3300005617 | Ga0068859_101908909 | Ga0068859_1019089092 | 88 |
| 15 | 3300005841 | Ga0068863_100371030 | Ga0068863_1003710303 | 88 |
| 16 | 3300006358 | Ga0068871_100216933 | Ga0068871_1002169333 | 88 |
| 17 | 3300006931 | Ga0097620_101909298 | Ga0097620_1019092982 | 88 |
| 18 | 3300012512 | Ga0157327_1077805 | Ga0157327_10778051 | 89 |
| 19 | 3300041509 | Ga0451843_1166635 | Ga0451843_1166635_263_550 | 89 |
| 20 | 3300046454 | Ga0495592_0183951 | Ga0495592_0183951_963_1274 | 89 |
| 21 | 3300053148 | Ga0500590_210174 | Ga0500590_210174_423_734 | 89 |
| 22 | 3300026088 | Ga0207641_10436561 | Ga0207641_104365612 | 91 |
| 23 | 3300031507 | Ga0307509_10160049 | Ga0307509_101600492 | 91 |
| 24 | 3300046511 | Ga0495608_0380208 | Ga0495608_0380208_501_812 | 91 |
| 25 | 3300048917 | Ga0496114_0549530 | Ga0496114_0549530_266_577 | 91 |
| 26 | 3300053091 | Ga0500647_0294610 | Ga0500647_0294610_142_453 | 91 |
| 27 | 3300053140 | Ga0500573_0160143 | Ga0500573_0160143_260_571 | 91 |
| 28 | 3300053177 | Ga0500636_0390505 | Ga0500636_0390505_55_366 | 91 |
| 29 | 3300005364 | Ga0070673_100145026 | Ga0070673_1001450263 | 93 |
| 30 | 3300005456 | Ga0070678_100630850 | Ga0070678_1006308502 | 93 |
| 31 | 3300005543 | Ga0070672_100074936 | Ga0070672_1000749363 | 93 |
| 32 | 3300005616 | Ga0068852_100552013 | Ga0068852_1005520132 | 93 |
| 33 | 3300005618 | Ga0068864_100407935 | Ga0068864_1004079352 | 93 |
| 34 | 3300005718 | Ga0068866_10205713 | Ga0068866_102057132 | 93 |
| 35 | 3300005841 | Ga0068863_100246333 | Ga0068863_1002463333 | 93 |
| 36 | 3300005841 | Ga0068863_100516454 | Ga0068863_1005164543 | 93 |
| 37 | 3300006237 | Ga0097621_100107483 | Ga0097621_1001074833 | 93 |
| 38 | 3300013297 | Ga0157378_11158758 | Ga0157378_111587582 | 93 |
| 39 | 3300014325 | Ga0163163_11031335 | Ga0163163_110313351 | 93 |
| 40 | 3300014968 | Ga0157379_11266112 | Ga0157379_112661121 | 93 |
| 41 | 3300014969 | Ga0157376_11018690 | Ga0157376_110186901 | 93 |
| 42 | 3300048907 | Ga0496104_1294369 | Ga0496104_1294369_107_421 | 93 |
| 43 | iso_pu_bacteria | 2643221654 | 2644304091 | 93 |
| 44 | 3300005328 | Ga0070676_10184425 | Ga0070676_101844252 | 94 |
| 45 | 3300005330 | Ga0070690_100133536 | Ga0070690_1001335361 | 94 |
| 46 | 3300005331 | Ga0070670_100597115 | Ga0070670_1005971152 | 94 |
| 47 | 3300005333 | Ga0070677_10299493 | Ga0070677_102994932 | 94 |
| 48 | 3300005334 | Ga0068869_100017070 | Ga0068869_1000170703 | 94 |
| 49 | 3300005335 | Ga0070666_10074189 | Ga0070666_100741892 | 94 |
| 50 | 3300005338 | Ga0068868_100018750 | Ga0068868_1000187503 | 94 |
| 51 | 3300005340 | Ga0070689_100284221 | Ga0070689_1002842212 | 94 |
| 52 | 3300005343 | Ga0070687_100426997 | Ga0070687_1004269972 | 94 |
| 53 | 3300005354 | Ga0070675_100031950 | Ga0070675_1000319504 | 94 |
| 54 | 3300005355 | Ga0070671_100058539 | Ga0070671_1000585393 | 94 |
| 55 | 3300005356 | Ga0070674_100807553 | Ga0070674_1008075532 | 94 |
| 56 | 3300005364 | Ga0070673_100003072 | Ga0070673_1000030728 | 94 |
| 57 | 3300005365 | Ga0070688_100532432 | Ga0070688_1005324322 | 94 |
| 58 | 3300005367 | Ga0070667_100026069 | Ga0070667_1000260693 | 94 |
| 59 | 3300005441 | Ga0070700_100409423 | Ga0070700_1004094232 | 94 |
| 60 | 3300005456 | Ga0070678_100001895 | Ga0070678_1000018953 | 94 |
| 61 | 3300005457 | Ga0070662_100497571 | Ga0070662_1004975712 | 94 |
| 62 | 3300005459 | Ga0068867_100612940 | Ga0068867_1006129402 | 94 |
| 63 | 3300005539 | Ga0068853_102092931 | Ga0068853_1020929312 | 94 |
| 64 | 3300005544 | Ga0070686_101485202 | Ga0070686_1014852022 | 94 |
| 65 | 3300005564 | Ga0070664_101365466 | Ga0070664_1013654662 | 94 |
| 66 | 3300005578 | Ga0068854_100391481 | Ga0068854_1003914812 | 94 |
| 67 | 3300005616 | Ga0068852_100016636 | Ga0068852_1000166366 | 94 |
| 68 | 3300005617 | Ga0068859_100006084 | Ga0068859_1000060843 | 94 |
| 69 | 3300005618 | Ga0068864_100016650 | Ga0068864_1000166503 | 94 |
| 70 | 3300005718 | Ga0068866_10425006 | Ga0068866_104250062 | 94 |
| 71 | 3300005719 | Ga0068861_100327840 | Ga0068861_1003278402 | 94 |
| 72 | 3300005834 | Ga0068851_10022932 | Ga0068851_100229322 | 94 |
| 73 | 3300005841 | Ga0068863_100017253 | Ga0068863_1000172532 | 94 |
| 74 | 3300005842 | Ga0068858_100018855 | Ga0068858_1000188553 | 94 |
| 75 | 3300005843 | Ga0068860_100969429 | Ga0068860_1009694292 | 94 |
| 76 | 3300006237 | Ga0097621_100032745 | Ga0097621_1000327453 | 94 |
| 77 | 3300006358 | Ga0068871_100213588 | Ga0068871_1002135882 | 94 |
| 78 | 3300006931 | Ga0097620_100006084 | Ga0097620_1000060843 | 94 |
| 79 | 3300009098 | Ga0105245_12862586 | Ga0105245_128625861 | 94 |
| 80 | 3300009177 | Ga0105248_10121531 | Ga0105248_101215313 | 94 |
| 81 | 3300013296 | Ga0157374_10020861 | Ga0157374_100208616 | 94 |
| 82 | 3300013297 | Ga0157378_10394325 | Ga0157378_103943253 | 94 |
| 83 | 3300013306 | Ga0163162_10382224 | Ga0163162_103822243 | 94 |
| 84 | 3300014325 | Ga0163163_10148503 | Ga0163163_101485033 | 94 |
| 85 | 3300014745 | Ga0157377_10165481 | Ga0157377_101654812 | 94 |
| 86 | 3300014968 | Ga0157379_10010120 | Ga0157379_100101203 | 94 |
| 87 | 3300014969 | Ga0157376_10311588 | Ga0157376_103115883 | 94 |
| 88 | 3300017792 | Ga0163161_10436226 | Ga0163161_104362262 | 94 |
| 89 | 3300017792 | Ga0163161_10779967 | Ga0163161_107799672 | 94 |
| 90 | 3300025321 | Ga0207656_10030751 | Ga0207656_100307512 | 94 |
| 91 | 3300025893 | Ga0207682_10049842 | Ga0207682_100498422 | 94 |
| 92 | 3300025903 | Ga0207680_10007478 | Ga0207680_100074783 | 94 |
| 93 | 3300025907 | Ga0207645_10193925 | Ga0207645_101939252 | 94 |
| 94 | 3300025918 | Ga0207662_10208925 | Ga0207662_102089252 | 94 |
| 95 | 3300025923 | Ga0207681_10699743 | Ga0207681_106997432 | 94 |
| 96 | 3300025925 | Ga0207650_10481654 | Ga0207650_104816542 | 94 |
| 97 | 3300025926 | Ga0207659_10014232 | Ga0207659_100142323 | 94 |
| 98 | 3300025931 | Ga0207644_10052986 | Ga0207644_100529863 | 94 |
| 99 | 3300025933 | Ga0207706_10411722 | Ga0207706_104117223 | 94 |
| 100 | 3300025936 | Ga0207670_10231615 | Ga0207670_102316152 | 94 |
| 101 | 3300025937 | Ga0207669_10121165 | Ga0207669_101211652 | 94 |
| 102 | 3300025940 | Ga0207691_10052613 | Ga0207691_100526132 | 94 |
| 103 | 3300025941 | Ga0207711_10021079 | Ga0207711_100210796 | 94 |
| 104 | 3300025942 | Ga0207689_10031595 | Ga0207689_100315952 | 94 |
| 105 | 3300025945 | Ga0207679_10598961 | Ga0207679_105989612 | 94 |
| 106 | 3300025960 | Ga0207651_10004673 | Ga0207651_100046737 | 94 |
| 107 | 3300025960 | Ga0207651_10039338 | Ga0207651_100393382 | 94 |
| 108 | 3300025981 | Ga0207640_10162658 | Ga0207640_101626582 | 94 |
| 109 | 3300025986 | Ga0207658_10020571 | Ga0207658_100205713 | 94 |
| 110 | 3300026023 | Ga0207677_10003814 | Ga0207677_100038143 | 94 |
| 111 | 3300026035 | Ga0207703_10008849 | Ga0207703_100088493 | 94 |
| 112 | 3300026075 | Ga0207708_10160831 | Ga0207708_101608313 | 94 |
| 113 | 3300026088 | Ga0207641_10002300 | Ga0207641_1000230015 | 94 |
| 114 | 3300026088 | Ga0207641_10234396 | Ga0207641_102343962 | 94 |
| 115 | 3300026089 | Ga0207648_10202928 | Ga0207648_102029283 | 94 |
| 116 | 3300026095 | Ga0207676_10032242 | Ga0207676_100322423 | 94 |
| 117 | 3300026095 | Ga0207676_10315699 | Ga0207676_103156992 | 94 |
| 118 | 3300026118 | Ga0207675_100182078 | Ga0207675_1001820782 | 94 |
| 119 | 3300026121 | Ga0207683_10009924 | Ga0207683_100099247 | 94 |
| 120 | 3300026142 | Ga0207698_10659331 | Ga0207698_106593313 | 94 |
| 121 | 3300028381 | Ga0268264_10549120 | Ga0268264_105491202 | 94 |
| 122 | 3300048904 | Ga0496101_0180669 | Ga0496101_0180669_1149_1463 | 94 |
| 123 | 3300048908 | Ga0496105_0722096 | Ga0496105_0722096_200_514 | 94 |
| 124 | 3300048909 | Ga0496106_0169444 | Ga0496106_0169444_872_1186 | 94 |
| 125 | 3300048911 | Ga0496108_0167208 | Ga0496108_0167208_973_1287 | 94 |
| 126 | 3300048913 | Ga0496110_0816931 | Ga0496110_0816931_90_404 | 94 |
| 127 | 3300048914 | Ga0496111_0207295 | Ga0496111_0207295_400_714 | 94 |
| 128 | 3300048917 | Ga0496114_0987976 | Ga0496114_0987976_161_472 | 94 |
| 129 | 3300005333 | Ga0070677_10503645 | Ga0070677_105036452 | 95 |
| 130 | 3300005356 | Ga0070674_100198471 | Ga0070674_1001984712 | 95 |
| 131 | 3300005564 | Ga0070664_101008498 | Ga0070664_1010084982 | 95 |
| 132 | 3300005719 | Ga0068861_100558116 | Ga0068861_1005581162 | 95 |
| 133 | 3300014326 | Ga0157380_10252016 | Ga0157380_102520162 | 95 |
| 134 | 3300025893 | Ga0207682_10418431 | Ga0207682_104184312 | 95 |
| 135 | 3300025937 | Ga0207669_10123273 | Ga0207669_101232732 | 95 |
| 136 | 3300026118 | Ga0207675_100664677 | Ga0207675_1006646772 | 95 |
| 137 | 3300026121 | Ga0207683_11704337 | Ga0207683_117043372 | 95 |
| 138 | 3300032004 | Ga0307414_10174618 | Ga0307414_101746183 | 95 |
| 139 | 3300035725 | Ga0373947_1097154 | Ga0373947_1097154_61_363 | 95 |
| 140 | 3300036401 | Ga0373937_0955671 | Ga0373937_0955671_304_618 | 95 |
| 141 | 3300026121 | Ga0207683_11521922 | Ga0207683_115219222 | 96 |
| 142 | 3300046535 | Ga0495586_0460853 | Ga0495586_0460853_138_446 | 96 |
| 143 | 3300046681 | Ga0495647_0056914 | Ga0495647_0056914_359_667 | 96 |
| 144 | 3300046683 | Ga0495658_0539703 | Ga0495658_0539703_347_655 | 96 |
| 145 | 3300053077 | Ga0495601_0930788 | Ga0495601_0930788_122_430 | 96 |
| 146 | 3300053084 | Ga0495595_0599681 | Ga0495595_0599681_190_498 | 96 |
| 147 | 3300005331 | Ga0070670_100002048 | Ga0070670_1000020487 | 97 |
| 148 | 3300005331 | Ga0070670_100048945 | Ga0070670_1000489452 | 97 |
| 149 | 3300005331 | Ga0070670_100088528 | Ga0070670_1000885283 | 97 |
| 150 | 3300005331 | Ga0070670_100832159 | Ga0070670_1008321592 | 97 |
| 151 | 3300005333 | Ga0070677_10010108 | Ga0070677_100101084 | 97 |
| 152 | 3300005333 | Ga0070677_10026730 | Ga0070677_100267302 | 97 |
| 153 | 3300005334 | Ga0068869_100091609 | Ga0068869_1000916092 | 97 |
| 154 | 3300005338 | Ga0068868_100010644 | Ga0068868_1000106446 | 97 |
| 155 | 3300005338 | Ga0068868_100053087 | Ga0068868_1000530873 | 97 |
| 156 | 3300005340 | Ga0070689_100525160 | Ga0070689_1005251601 | 97 |
| 157 | 3300005340 | Ga0070689_101049450 | Ga0070689_1010494501 | 97 |
| 158 | 3300005345 | Ga0070692_10964935 | Ga0070692_109649352 | 97 |
| 159 | 3300005347 | Ga0070668_100509589 | Ga0070668_1005095893 | 97 |
| 160 | 3300005347 | Ga0070668_100520932 | Ga0070668_1005209322 | 97 |
| 161 | 3300005353 | Ga0070669_100037703 | Ga0070669_1000377034 | 97 |
| 162 | 3300005353 | Ga0070669_101159185 | Ga0070669_1011591852 | 97 |
| 163 | 3300005354 | Ga0070675_100012448 | Ga0070675_1000124486 | 97 |
| 164 | 3300005354 | Ga0070675_100037552 | Ga0070675_1000375524 | 97 |
| 165 | 3300005355 | Ga0070671_100006025 | Ga0070671_1000060253 | 97 |
| 166 | 3300005355 | Ga0070671_100191660 | Ga0070671_1001916603 | 97 |
| 167 | 3300005356 | Ga0070674_100012726 | Ga0070674_1000127263 | 97 |
| 168 | 3300005356 | Ga0070674_100018236 | Ga0070674_1000182363 | 97 |
| 169 | 3300005364 | Ga0070673_100019451 | Ga0070673_1000194514 | 97 |
| 170 | 3300005364 | Ga0070673_101372576 | Ga0070673_1013725761 | 97 |
| 171 | 3300005367 | Ga0070667_100035293 | Ga0070667_1000352933 | 97 |
| 172 | 3300005456 | Ga0070678_100007671 | Ga0070678_1000076716 | 97 |
| 173 | 3300005457 | Ga0070662_100717437 | Ga0070662_1007174372 | 97 |
| 174 | 3300005459 | Ga0068867_100018743 | Ga0068867_1000187434 | 97 |
| 175 | 3300005459 | Ga0068867_100021533 | Ga0068867_1000215332 | 97 |
| 176 | 3300005530 | Ga0070679_101216217 | Ga0070679_1012162172 | 97 |
| 177 | 3300005543 | Ga0070672_100000556 | Ga0070672_1000005563 | 97 |
| 178 | 3300005543 | Ga0070672_100084451 | Ga0070672_1000844513 | 97 |
| 179 | 3300005548 | Ga0070665_100349546 | Ga0070665_1003495462 | 97 |
| 180 | 3300005564 | Ga0070664_100111426 | Ga0070664_1001114262 | 97 |
| 181 | 3300005564 | Ga0070664_100233075 | Ga0070664_1002330752 | 97 |
| 182 | 3300005577 | Ga0068857_100202074 | Ga0068857_1002020743 | 97 |
| 183 | 3300005616 | Ga0068852_100400678 | Ga0068852_1004006782 | 97 |
| 184 | 3300005617 | Ga0068859_100403071 | Ga0068859_1004030712 | 97 |
| 185 | 3300005618 | Ga0068864_100535381 | Ga0068864_1005353812 | 97 |
| 186 | 3300005718 | Ga0068866_10424953 | Ga0068866_104249532 | 97 |
| 187 | 3300005719 | Ga0068861_101503614 | Ga0068861_1015036142 | 97 |
| 188 | 3300005719 | Ga0068861_101943021 | Ga0068861_1019430212 | 97 |
| 189 | 3300005834 | Ga0068851_10912409 | Ga0068851_109124091 | 97 |
| 190 | 3300005844 | Ga0068862_101878111 | Ga0068862_1018781111 | 97 |
| 191 | 3300006195 | Ga0075366_10023190 | Ga0075366_100231903 | 97 |
| 192 | 3300006195 | Ga0075366_10179258 | Ga0075366_101792582 | 97 |
| 193 | 3300006237 | Ga0097621_100148369 | Ga0097621_1001483693 | 97 |
| 194 | 3300006237 | Ga0097621_100204467 | Ga0097621_1002044672 | 97 |
| 195 | 3300006358 | Ga0068871_100093997 | Ga0068871_1000939973 | 97 |
| 196 | 3300006881 | Ga0068865_100106466 | Ga0068865_1001064663 | 97 |
| 197 | 3300006931 | Ga0097620_100403075 | Ga0097620_1004030752 | 97 |
| 198 | 3300009036 | Ga0105244_10324843 | Ga0105244_103248432 | 97 |
| 199 | 3300009094 | Ga0111539_10424034 | Ga0111539_104240343 | 97 |
| 200 | 3300009098 | Ga0105245_10639337 | Ga0105245_106393372 | 97 |
| 201 | 3300009148 | Ga0105243_10168213 | Ga0105243_101682132 | 97 |
| 202 | 3300009553 | Ga0105249_11749942 | Ga0105249_117499422 | 97 |
| 203 | 3300011119 | Ga0105246_11393175 | Ga0105246_113931752 | 97 |
| 204 | 3300013296 | Ga0157374_10463718 | Ga0157374_104637182 | 97 |
| 205 | 3300013297 | Ga0157378_10250530 | Ga0157378_102505302 | 97 |
| 206 | 3300013306 | Ga0163162_10183218 | Ga0163162_101832183 | 97 |
| 207 | 3300013308 | Ga0157375_10075696 | Ga0157375_100756964 | 97 |
| 208 | 3300013308 | Ga0157375_10260662 | Ga0157375_102606622 | 97 |
| 209 | 3300014325 | Ga0163163_11367113 | Ga0163163_113671131 | 97 |
| 210 | 3300014968 | Ga0157379_11095155 | Ga0157379_110951552 | 97 |
| 211 | 3300014969 | Ga0157376_11062436 | Ga0157376_110624362 | 97 |
| 212 | 3300017792 | Ga0163161_10263539 | Ga0163161_102635392 | 97 |
| 213 | 3300017792 | Ga0163161_10267244 | Ga0163161_102672442 | 97 |
| 214 | 3300025321 | Ga0207656_10435054 | Ga0207656_104350542 | 97 |
| 215 | 3300025893 | Ga0207682_10002798 | Ga0207682_100027983 | 97 |
| 216 | 3300025899 | Ga0207642_10217890 | Ga0207642_102178902 | 97 |
| 217 | 3300025901 | Ga0207688_10051580 | Ga0207688_100515802 | 97 |
| 218 | 3300025901 | Ga0207688_10413580 | Ga0207688_104135802 | 97 |
| 219 | 3300025907 | Ga0207645_10007554 | Ga0207645_100075547 | 97 |
| 220 | 3300025907 | Ga0207645_10034917 | Ga0207645_100349173 | 97 |
| 221 | 3300025923 | Ga0207681_10033049 | Ga0207681_100330493 | 97 |
| 222 | 3300025923 | Ga0207681_10686797 | Ga0207681_106867972 | 97 |
| 223 | 3300025925 | Ga0207650_10000348 | Ga0207650_1000034812 | 97 |
| 224 | 3300025925 | Ga0207650_10284044 | Ga0207650_102840442 | 97 |
| 225 | 3300025925 | Ga0207650_10428009 | Ga0207650_104280092 | 97 |
| 226 | 3300025925 | Ga0207650_11804990 | Ga0207650_118049902 | 97 |
| 227 | 3300025926 | Ga0207659_10000583 | Ga0207659_100005839 | 97 |
| 228 | 3300025926 | Ga0207659_11800545 | Ga0207659_118005452 | 97 |
| 229 | 3300025927 | Ga0207687_10211632 | Ga0207687_102116322 | 97 |
| 230 | 3300025931 | Ga0207644_10005232 | Ga0207644_100052323 | 97 |
| 231 | 3300025931 | Ga0207644_10034321 | Ga0207644_100343214 | 97 |
| 232 | 3300025933 | Ga0207706_10831125 | Ga0207706_108311252 | 97 |
| 233 | 3300025935 | Ga0207709_10229502 | Ga0207709_102295022 | 97 |
| 234 | 3300025936 | Ga0207670_10238795 | Ga0207670_102387951 | 97 |
| 235 | 3300025937 | Ga0207669_10008088 | Ga0207669_100080886 | 97 |
| 236 | 3300025938 | Ga0207704_10050252 | Ga0207704_100502522 | 97 |
| 237 | 3300025938 | Ga0207704_10494722 | Ga0207704_104947222 | 97 |
| 238 | 3300025940 | Ga0207691_10040440 | Ga0207691_100404404 | 97 |
| 239 | 3300025940 | Ga0207691_10324178 | Ga0207691_103241782 | 97 |
| 240 | 3300025942 | Ga0207689_10095823 | Ga0207689_100958233 | 97 |
| 241 | 3300025945 | Ga0207679_10321562 | Ga0207679_103215622 | 97 |
| 242 | 3300025960 | Ga0207651_10280292 | Ga0207651_102802923 | 97 |
| 243 | 3300025960 | Ga0207651_11966971 | Ga0207651_119669712 | 97 |
| 244 | 3300025972 | Ga0207668_10153059 | Ga0207668_101530592 | 97 |
| 245 | 3300025972 | Ga0207668_10356237 | Ga0207668_103562373 | 97 |
| 246 | 3300025981 | Ga0207640_10525867 | Ga0207640_105258672 | 97 |
| 247 | 3300025986 | Ga0207658_10070079 | Ga0207658_100700792 | 97 |
| 248 | 3300026023 | Ga0207677_10375101 | Ga0207677_103751013 | 97 |
| 249 | 3300026067 | Ga0207678_11490600 | Ga0207678_114906002 | 97 |
| 250 | 3300026075 | Ga0207708_11203673 | Ga0207708_112036732 | 97 |
| 251 | 3300026089 | Ga0207648_10014921 | Ga0207648_100149213 | 97 |
| 252 | 3300026089 | Ga0207648_10016497 | Ga0207648_100164973 | 97 |
| 253 | 3300026089 | Ga0207648_10075240 | Ga0207648_100752403 | 97 |
| 254 | 3300026116 | Ga0207674_10101334 | Ga0207674_101013343 | 97 |
| 255 | 3300026118 | Ga0207675_102337014 | Ga0207675_1023370141 | 97 |
| 256 | 3300026121 | Ga0207683_10141670 | Ga0207683_101416702 | 97 |
| 257 | 3300026121 | Ga0207683_10278360 | Ga0207683_102783602 | 97 |
| 258 | 3300028380 | Ga0268265_11089431 | Ga0268265_110894312 | 97 |
| 259 | 3300028786 | Ga0307517_10000173 | Ga0307517_100001733 | 97 |
| 260 | 3300028794 | Ga0307515_10089385 | Ga0307515_100893854 | 97 |
| 261 | 3300028794 | Ga0307515_10162825 | Ga0307515_101628253 | 97 |
| 262 | 3300028794 | Ga0307515_10291152 | Ga0307515_102911522 | 97 |
| 263 | 3300028794 | Ga0307515_10331801 | Ga0307515_103318013 | 97 |
| 264 | 3300030522 | Ga0307512_10049347 | Ga0307512_100493472 | 97 |
| 265 | 3300030522 | Ga0307512_10059848 | Ga0307512_100598482 | 97 |
| 266 | 3300031456 | Ga0307513_10030756 | Ga0307513_100307563 | 97 |
| 267 | 3300031456 | Ga0307513_10109519 | Ga0307513_101095192 | 97 |
| 268 | 3300031507 | Ga0307509_10050392 | Ga0307509_100503924 | 97 |
| 269 | 3300031507 | Ga0307509_10053814 | Ga0307509_100538144 | 97 |
| 270 | 3300031507 | Ga0307509_10175044 | Ga0307509_101750441 | 97 |
| 271 | 3300031507 | Ga0307509_10839467 | Ga0307509_108394672 | 97 |
| 272 | 3300031616 | Ga0307508_10000738 | Ga0307508_100007387 | 97 |
| 273 | 3300031616 | Ga0307508_10340777 | Ga0307508_103407772 | 97 |
| 274 | 3300031730 | Ga0307516_10136356 | Ga0307516_101363563 | 97 |
| 275 | 3300031731 | Ga0307405_10002174 | Ga0307405_100021747 | 97 |
| 276 | 3300031731 | Ga0307405_10886948 | Ga0307405_108869482 | 97 |
| 277 | 3300031838 | Ga0307518_10426021 | Ga0307518_104260212 | 97 |
| 278 | 3300031901 | Ga0307406_10160694 | Ga0307406_101606942 | 97 |
| 279 | 3300031903 | Ga0307407_10016152 | Ga0307407_100161523 | 97 |
| 280 | 3300031911 | Ga0307412_10055698 | Ga0307412_100556983 | 97 |
| 281 | 3300031995 | Ga0307409_101452959 | Ga0307409_1014529592 | 97 |
| 282 | 3300031995 | Ga0307409_101876405 | Ga0307409_1018764052 | 97 |
| 283 | 3300032002 | Ga0307416_100002959 | Ga0307416_1000029598 | 97 |
| 284 | 3300032002 | Ga0307416_101035753 | Ga0307416_1010357532 | 97 |
| 285 | 3300032004 | Ga0307414_10393865 | Ga0307414_103938652 | 97 |
| 286 | 3300032005 | Ga0307411_10118014 | Ga0307411_101180143 | 97 |
| 287 | 3300032005 | Ga0307411_10737774 | Ga0307411_107377742 | 97 |
| 288 | 3300032126 | Ga0307415_101336537 | Ga0307415_1013365372 | 97 |
| 289 | 3300033179 | Ga0307507_10195459 | Ga0307507_101954592 | 97 |
| 290 | 3300033179 | Ga0307507_10247572 | Ga0307507_102475721 | 97 |
| 291 | 3300033180 | Ga0307510_10001034 | Ga0307510_1000103427 | 97 |
| 292 | 3300033180 | Ga0307510_10197173 | Ga0307510_101971733 | 97 |
| 293 | 3300033180 | Ga0307510_10662132 | Ga0307510_106621322 | 97 |
| 294 | 3300035084 | Ga0373928_0039245 | Ga0373928_0039245_527_838 | 97 |
| 295 | 3300035691 | Ga0373931_0891642 | Ga0373931_0891642_48_359 | 97 |
| 296 | 3300041452 | Ga0451793_0301768 | Ga0451793_0301768_52_363 | 97 |
| 297 | 3300041458 | Ga0451798_0746032 | Ga0451798_0746032_284_595 | 97 |
| 298 | 3300041486 | Ga0451807_0244690 | Ga0451807_0244690_114_425 | 97 |
| 299 | 3300041507 | Ga0451851_1352704 | Ga0451851_1352704_63_374 | 97 |
| 300 | 3300046454 | Ga0495592_0000234 | Ga0495592_0000234_45820_46131 | 97 |
| 301 | 3300046460 | Ga0495638_0129775 | Ga0495638_0129775_417_728 | 97 |
| 302 | 3300046473 | Ga0495582_0363670 | Ga0495582_0363670_435_746 | 97 |
| 303 | 3300046512 | Ga0495610_0055804 | Ga0495610_0055804_447_758 | 97 |
| 304 | 3300046516 | Ga0495628_0541018 | Ga0495628_0541018_91_402 | 97 |
| 305 | 3300046517 | Ga0495630_0095573 | Ga0495630_0095573_49_360 | 97 |
| 306 | 3300046519 | Ga0495632_0071188 | Ga0495632_0071188_521_832 | 97 |
| 307 | 3300046519 | Ga0495632_0159626 | Ga0495632_0159626_571_882 | 97 |
| 308 | 3300046524 | Ga0495648_0083206 | Ga0495648_0083206_1414_1725 | 97 |
| 309 | 3300046535 | Ga0495586_0249774 | Ga0495586_0249774_497_808 | 97 |
| 310 | 3300046557 | Ga0495622_0142242 | Ga0495622_0142242_132_443 | 97 |
| 311 | 3300046616 | Ga0495668_0115134 | Ga0495668_0115134_1071_1382 | 97 |
| 312 | 3300046648 | Ga0495611_0341401 | Ga0495611_0341401_176_487 | 97 |
| 313 | 3300046660 | Ga0495625_0323826 | Ga0495625_0323826_72_383 | 97 |
| 314 | 3300046680 | Ga0495646_0207646 | Ga0495646_0207646_99_410 | 97 |
| 315 | 3300046683 | Ga0495658_0028770 | Ga0495658_0028770_806_1117 | 97 |
| 316 | 3300046683 | Ga0495658_0311390 | Ga0495658_0311390_546_857 | 97 |
| 317 | 3300046690 | Ga0495624_0017157 | Ga0495624_0017157_747_1058 | 97 |
| 318 | 3300047321 | Ga0495676_0114566 | Ga0495676_0114566_940_1251 | 97 |
| 319 | 3300047323 | Ga0495683_0296305 | Ga0495683_0296305_348_659 | 97 |
| 320 | 3300047444 | Ga0495675_0223797 | Ga0495675_0223797_408_719 | 97 |
| 321 | 3300048924 | Ga0496121_0366734 | Ga0496121_0366734_185_499 | 97 |
| 322 | 3300049459 | Ga0495678_223737 | Ga0495678_223737_234_545 | 97 |
| 323 | 3300050489 | nmdc:mga03683_55825_c1 | nmdc:mga03683_55825_c1_1277_1588 | 97 |
| 324 | 3300050493 | nmdc:mga0k408_147931_c1 | nmdc:mga0k408_147931_c1_806_1126 | 97 |
| 325 | 3300050493 | nmdc:mga0k408_521054_c1 | nmdc:mga0k408_521054_c1_167_481 | 97 |
| 326 | 3300050493 | nmdc:mga0k408_5343_c1 | nmdc:mga0k408_5343_c1_621_932 | 97 |
| 327 | 3300050496 | nmdc:mga07m45_417047_c1 | nmdc:mga07m45_417047_c1_82_393 | 97 |
| 328 | 3300050511 | nmdc:mga08y16_899569_c1 | nmdc:mga08y16_899569_c1_311_622 | 97 |
| 329 | 3300050516 | nmdc:mga0sz30_352752_c1 | nmdc:mga0sz30_352752_c1_116_430 | 97 |
| 330 | 3300053088 | Ga0500644_0008644 | Ga0500644_0008644_166_477 | 97 |
| 331 | 3300053092 | Ga0500583_0067135 | Ga0500583_0067135_605_916 | 97 |
| 332 | 3300053093 | Ga0500651_0040675 | Ga0500651_0040675_557_868 | 97 |
| 333 | 3300053098 | Ga0500650_0112775 | Ga0500650_0112775_112_423 | 97 |
| 334 | 3300053098 | Ga0500650_0355014 | Ga0500650_0355014_132_443 | 97 |
| 335 | 3300053118 | Ga0500594_0023894 | Ga0500594_0023894_1109_1420 | 97 |
| 336 | 3300053121 | Ga0500607_232469 | Ga0500607_232469_318_632 | 97 |
| 337 | 3300053131 | Ga0500652_248080 | Ga0500652_248080_20_334 | 97 |
| 338 | 3300053136 | Ga0500559_0000262 | Ga0500559_0000262_7002_7313 | 97 |
| 339 | 3300053138 | Ga0500564_121366 | Ga0500564_121366_157_468 | 97 |
| 340 | 3300053151 | Ga0500604_0311153 | Ga0500604_0311153_63_374 | 97 |
| 341 | 3300053153 | Ga0500616_0192579 | Ga0500616_0192579_362_673 | 97 |
| 342 | 3300053154 | Ga0500619_014471 | Ga0500619_014471_1244_1555 | 97 |
| 343 | 3300053154 | Ga0500619_267121 | Ga0500619_267121_121_435 | 97 |
| 344 | 3300053156 | Ga0500622_0002641 | Ga0500622_0002641_1163_1474 | 97 |
| 345 | 3300053177 | Ga0500636_0355069 | Ga0500636_0355069_70_381 | 97 |
| 346 | 3300053736 | Ga0500599_011466 | Ga0500599_011466_211_522 | 97 |
| 347 | 3300053739 | Ga0500587_009905 | Ga0500587_009905_686_997 | 97 |
| 348 | 3300005456 | Ga0070678_100173436 | Ga0070678_1001734363 | 98 |
| 349 | 3300005539 | Ga0068853_100056675 | Ga0068853_1000566753 | 98 |
| 350 | 3300005616 | Ga0068852_100062538 | Ga0068852_1000625382 | 98 |
| 351 | 3300005834 | Ga0068851_10437783 | Ga0068851_104377832 | 98 |
| 352 | 3300006846 | Ga0075430_100145784 | Ga0075430_1001457843 | 98 |
| 353 | 3300006880 | Ga0075429_100128059 | Ga0075429_1001280593 | 98 |
| 354 | 3300009093 | Ga0105240_10015269 | Ga0105240_100152694 | 98 |
| 355 | 3300009174 | Ga0105241_11019532 | Ga0105241_110195322 | 98 |
| 356 | 3300009545 | Ga0105237_10001569 | Ga0105237_1000156921 | 98 |
| 357 | 3300009551 | Ga0105238_10011025 | Ga0105238_100110257 | 98 |
| 358 | 3300010375 | Ga0105239_10000486 | Ga0105239_1000048627 | 98 |
| 359 | 3300025914 | Ga0207671_10006936 | Ga0207671_100069367 | 98 |
| 360 | 3300025924 | Ga0207694_10017774 | Ga0207694_100177744 | 98 |
| 361 | 3300026121 | Ga0207683_10050891 | Ga0207683_100508912 | 98 |
| 362 | 3300026142 | Ga0207698_10004331 | Ga0207698_100043316 | 98 |
| 363 | 3300028379 | Ga0268266_10971025 | Ga0268266_109710252 | 98 |
| 364 | 3300032005 | Ga0307411_11056610 | Ga0307411_110566101 | 98 |
| 365 | 3300041503 | Ga0451847_0322153 | Ga0451847_0322153_37_357 | 98 |
| 366 | 3300050508 | nmdc:mga09592_2954_c1 | nmdc:mga09592_2954_c1_1153_1467 | 98 |
| 367 | 3300050509 | nmdc:mga0qj67_37390_c1 | nmdc:mga0qj67_37390_c1_2891_3205 | 98 |
| 368 | 3300005445 | Ga0070708_100678062 | Ga0070708_1006780622 | 99 |
| 369 | 3300005455 | Ga0070663_100001309 | Ga0070663_1000013098 | 99 |
| 370 | 3300005467 | Ga0070706_101296912 | Ga0070706_1012969122 | 99 |
| 371 | 3300005718 | Ga0068866_10801482 | Ga0068866_108014822 | 99 |
| 372 | 3300006177 | Ga0075362_10371837 | Ga0075362_103718372 | 99 |
| 373 | 3300006195 | Ga0075366_10023780 | Ga0075366_100237803 | 99 |
| 374 | 3300006195 | Ga0075366_10234084 | Ga0075366_102340842 | 99 |
| 375 | 3300011119 | Ga0105246_11972286 | Ga0105246_119722862 | 99 |
| 376 | 3300013100 | Ga0157373_10814614 | Ga0157373_108146142 | 99 |
| 377 | 3300013297 | Ga0157378_11194890 | Ga0157378_111948902 | 99 |
| 378 | 3300014325 | Ga0163163_11486655 | Ga0163163_114866552 | 99 |
| 379 | 3300014969 | Ga0157376_11231925 | Ga0157376_112319251 | 99 |
| 380 | 3300025922 | Ga0207646_10916814 | Ga0207646_109168142 | 99 |
| 381 | 3300025972 | Ga0207668_10335248 | Ga0207668_103352482 | 99 |
| 382 | 3300026067 | Ga0207678_10003783 | Ga0207678_100037834 | 99 |
| 383 | 3300026121 | Ga0207683_10567821 | Ga0207683_105678212 | 99 |
| 384 | 3300028379 | Ga0268266_10758396 | Ga0268266_107583962 | 99 |
| 385 | 3300031548 | Ga0307408_100120697 | Ga0307408_1001206973 | 99 |
| 386 | 3300031548 | Ga0307408_100449412 | Ga0307408_1004494122 | 99 |
| 387 | 3300031548 | Ga0307408_101612929 | Ga0307408_1016129291 | 99 |
| 388 | 3300031824 | Ga0307413_10733549 | Ga0307413_107335492 | 99 |
| 389 | 3300031852 | Ga0307410_10457974 | Ga0307410_104579742 | 99 |
| 390 | 3300031901 | Ga0307406_11170277 | Ga0307406_111702772 | 99 |
| 391 | 3300031901 | Ga0307406_11579764 | Ga0307406_115797642 | 99 |
| 392 | 3300031903 | Ga0307407_10142732 | Ga0307407_101427322 | 99 |
| 393 | 3300031995 | Ga0307409_100176604 | Ga0307409_1001766042 | 99 |
| 394 | 3300031995 | Ga0307409_100965120 | Ga0307409_1009651201 | 99 |
| 395 | 3300032005 | Ga0307411_10347968 | Ga0307411_103479682 | 99 |
| 396 | 3300034957 | Ga0373938_0048547 | Ga0373938_0048547_492_809 | 99 |
| 397 | 3300035114 | Ga0373939_0019235 | Ga0373939_0019235_771_1088 | 99 |
| 398 | 3300037471 | Ga0395905_0030862 | Ga0395905_0030862_2669_2986 | 99 |
| 399 | 3300042134 | Ga0450898_084372 | Ga0450898_084372_143_457 | 99 |
| 400 | 3300049523 | Ga0501300_025195 | Ga0501300_025195_527_841 | 99 |
| 401 | 3300049579 | Ga0501043_0000038 | Ga0501043_0000038_1205_1522 | 99 |
| 402 | 3300049580 | Ga0501046_0000049 | Ga0501046_0000049_127158_127475 | 99 |
| 403 | 3300049581 | Ga0501047_0000039 | Ga0501047_0000039_60398_60715 | 99 |
| 404 | 3300049582 | Ga0501048_0011326 | Ga0501048_0011326_5255_5572 | 99 |
| 405 | 3300049649 | Ga0501198_000058 | Ga0501198_000058_1272_1589 | 99 |
| 406 | 3300049653 | Ga0501206_034761 | Ga0501206_034761_347_661 | 99 |
| 407 | 3300049662 | Ga0501222_000066 | Ga0501222_000066_1413_1730 | 99 |
| 408 | 3300049686 | Ga0501257_021230 | Ga0501257_021230_834_1148 | 99 |
| 409 | 3300049744 | Ga0501083_0505031 | Ga0501083_0505031_167_484 | 99 |
| 410 | 3300049759 | Ga0501262_009888 | Ga0501262_009888_324_638 | 99 |
| 411 | 3300049762 | Ga0501265_003351 | Ga0501265_003351_990_1304 | 99 |
| 412 | 3300049770 | Ga0501273_091386 | Ga0501273_091386_54_368 | 99 |
| 413 | 3300049823 | Ga0501044_0175870 | Ga0501044_0175870_626_943 | 99 |
| 414 | 3300049824 | Ga0501045_0007021 | Ga0501045_0007021_1255_1572 | 99 |
| 415 | 3300050493 | nmdc:mga0k408_286076_c1 | nmdc:mga0k408_286076_c1_542_856 | 99 |
| 416 | 3300005340 | Ga0070689_101116316 | Ga0070689_1011163162 | 100 |
| 417 | 3300005354 | Ga0070675_100299381 | Ga0070675_1002993812 | 100 |
| 418 | 3300005459 | Ga0068867_100000642 | Ga0068867_10000064214 | 100 |
| 419 | 3300005543 | Ga0070672_100123155 | Ga0070672_1001231552 | 100 |
| 420 | 3300009148 | Ga0105243_10027612 | Ga0105243_100276124 | 100 |
| 421 | 3300013297 | Ga0157378_10352979 | Ga0157378_103529792 | 100 |
| 422 | 3300014745 | Ga0157377_10000052 | Ga0157377_1000005211 | 100 |
| 423 | 3300014745 | Ga0157377_10134587 | Ga0157377_101345872 | 100 |
| 424 | 3300025923 | Ga0207681_11361911 | Ga0207681_113619112 | 100 |
| 425 | 3300025926 | Ga0207659_10069861 | Ga0207659_100698613 | 100 |
| 426 | 3300025935 | Ga0207709_10007425 | Ga0207709_100074257 | 100 |
| 427 | 3300025986 | Ga0207658_10975899 | Ga0207658_109758992 | 100 |
| 428 | 3300026089 | Ga0207648_10001074 | Ga0207648_100010743 | 100 |
| 429 | 3300031456 | Ga0307513_10146635 | Ga0307513_101466352 | 100 |
| 430 | 3300049683 | Ga0501253_130541 | Ga0501253_130541_175_498 | 100 |
| 431 | 3300050493 | nmdc:mga0k408_873488_c1 | nmdc:mga0k408_873488_c1_110_430 | 100 |
| 432 | 3300005466 | Ga0070685_10761647 | Ga0070685_107616472 | 101 |
| 433 | 3300005327 | Ga0070658_10058793 | Ga0070658_100587932 | 102 |
| 434 | 3300005327 | Ga0070658_10336488 | Ga0070658_103364882 | 102 |
| 435 | 3300005328 | Ga0070676_10019591 | Ga0070676_100195914 | 102 |
| 436 | 3300005328 | Ga0070676_10047823 | Ga0070676_100478233 | 102 |
| 437 | 3300005328 | Ga0070676_10065683 | Ga0070676_100656833 | 102 |
| 438 | 3300005328 | Ga0070676_10498903 | Ga0070676_104989032 | 102 |
| 439 | 3300005329 | Ga0070683_100033736 | Ga0070683_1000337363 | 102 |
| 440 | 3300005330 | Ga0070690_100054342 | Ga0070690_1000543422 | 102 |
| 441 | 3300005330 | Ga0070690_100321216 | Ga0070690_1003212162 | 102 |
| 442 | 3300005331 | Ga0070670_100027077 | Ga0070670_1000270773 | 102 |
| 443 | 3300005331 | Ga0070670_100056760 | Ga0070670_1000567603 | 102 |
| 444 | 3300005331 | Ga0070670_100069450 | Ga0070670_1000694503 | 102 |
| 445 | 3300005331 | Ga0070670_100112972 | Ga0070670_1001129723 | 102 |
| 446 | 3300005331 | Ga0070670_100579613 | Ga0070670_1005796132 | 102 |
| 447 | 3300005331 | Ga0070670_100774365 | Ga0070670_1007743652 | 102 |
| 448 | 3300005331 | Ga0070670_100892644 | Ga0070670_1008926442 | 102 |
| 449 | 3300005333 | Ga0070677_10031430 | Ga0070677_100314303 | 102 |
| 450 | 3300005333 | Ga0070677_10084808 | Ga0070677_100848082 | 102 |
| 451 | 3300005333 | Ga0070677_10243698 | Ga0070677_102436981 | 102 |
| 452 | 3300005333 | Ga0070677_10482866 | Ga0070677_104828662 | 102 |
| 453 | 3300005334 | Ga0068869_100012173 | Ga0068869_1000121735 | 102 |
| 454 | 3300005334 | Ga0068869_100025577 | Ga0068869_1000255773 | 102 |
| 455 | 3300005335 | Ga0070666_10129261 | Ga0070666_101292612 | 102 |
| 456 | 3300005335 | Ga0070666_10277513 | Ga0070666_102775132 | 102 |
| 457 | 3300005335 | Ga0070666_10300236 | Ga0070666_103002361 | 102 |
| 458 | 3300005335 | Ga0070666_10827474 | Ga0070666_108274742 | 102 |
| 459 | 3300005336 | Ga0070680_100009759 | Ga0070680_1000097597 | 102 |
| 460 | 3300005337 | Ga0070682_100199716 | Ga0070682_1001997161 | 102 |
| 461 | 3300005338 | Ga0068868_100031049 | Ga0068868_1000310494 | 102 |
| 462 | 3300005338 | Ga0068868_100627762 | Ga0068868_1006277621 | 102 |
| 463 | 3300005338 | Ga0068868_100680352 | Ga0068868_1006803521 | 102 |
| 464 | 3300005339 | Ga0070660_100832667 | Ga0070660_1008326672 | 102 |
| 465 | 3300005339 | Ga0070660_100857877 | Ga0070660_1008578772 | 102 |
| 466 | 3300005340 | Ga0070689_100242167 | Ga0070689_1002421672 | 102 |
| 467 | 3300005343 | Ga0070687_100045771 | Ga0070687_1000457712 | 102 |
| 468 | 3300005343 | Ga0070687_100258931 | Ga0070687_1002589313 | 102 |
| 469 | 3300005344 | Ga0070661_100627784 | Ga0070661_1006277842 | 102 |
| 470 | 3300005344 | Ga0070661_101243292 | Ga0070661_1012432922 | 102 |
| 471 | 3300005345 | Ga0070692_10958293 | Ga0070692_109582931 | 102 |
| 472 | 3300005347 | Ga0070668_100007413 | Ga0070668_1000074132 | 102 |
| 473 | 3300005347 | Ga0070668_101221492 | Ga0070668_1012214922 | 102 |
| 474 | 3300005353 | Ga0070669_100005073 | Ga0070669_1000050733 | 102 |
| 475 | 3300005353 | Ga0070669_100033288 | Ga0070669_1000332883 | 102 |
| 476 | 3300005353 | Ga0070669_101206703 | Ga0070669_1012067032 | 102 |
| 477 | 3300005353 | Ga0070669_101818049 | Ga0070669_1018180492 | 102 |
| 478 | 3300005354 | Ga0070675_100003224 | Ga0070675_1000032244 | 102 |
| 479 | 3300005354 | Ga0070675_100060803 | Ga0070675_1000608033 | 102 |
| 480 | 3300005354 | Ga0070675_100086553 | Ga0070675_1000865533 | 102 |
| 481 | 3300005354 | Ga0070675_100477909 | Ga0070675_1004779093 | 102 |
| 482 | 3300005354 | Ga0070675_100499962 | Ga0070675_1004999622 | 102 |
| 483 | 3300005354 | Ga0070675_100734153 | Ga0070675_1007341531 | 102 |
| 484 | 3300005354 | Ga0070675_100782719 | Ga0070675_1007827192 | 102 |
| 485 | 3300005355 | Ga0070671_100075668 | Ga0070671_1000756684 | 102 |
| 486 | 3300005355 | Ga0070671_100694176 | Ga0070671_1006941762 | 102 |
| 487 | 3300005355 | Ga0070671_100816398 | Ga0070671_1008163982 | 102 |
| 488 | 3300005355 | Ga0070671_101027924 | Ga0070671_1010279241 | 102 |
| 489 | 3300005356 | Ga0070674_100013607 | Ga0070674_1000136076 | 102 |
| 490 | 3300005356 | Ga0070674_101080575 | Ga0070674_1010805752 | 102 |
| 491 | 3300005356 | Ga0070674_101352197 | Ga0070674_1013521972 | 102 |
| 492 | 3300005356 | Ga0070674_102022094 | Ga0070674_1020220941 | 102 |
| 493 | 3300005364 | Ga0070673_100131219 | Ga0070673_1001312192 | 102 |
| 494 | 3300005364 | Ga0070673_100410431 | Ga0070673_1004104312 | 102 |
| 495 | 3300005364 | Ga0070673_100543674 | Ga0070673_1005436743 | 102 |
| 496 | 3300005364 | Ga0070673_100762300 | Ga0070673_1007623002 | 102 |
| 497 | 3300005364 | Ga0070673_100820450 | Ga0070673_1008204501 | 102 |
| 498 | 3300005364 | Ga0070673_100957642 | Ga0070673_1009576422 | 102 |
| 499 | 3300005366 | Ga0070659_100011889 | Ga0070659_1000118897 | 102 |
| 500 | 3300005366 | Ga0070659_100018169 | Ga0070659_1000181693 | 102 |
| 501 | 3300005366 | Ga0070659_100203882 | Ga0070659_1002038822 | 102 |
| 502 | 3300005367 | Ga0070667_100008961 | Ga0070667_1000089613 | 102 |
| 503 | 3300005367 | Ga0070667_100095130 | Ga0070667_1000951303 | 102 |
| 504 | 3300005367 | Ga0070667_100251054 | Ga0070667_1002510543 | 102 |
| 505 | 3300005367 | Ga0070667_100331751 | Ga0070667_1003317512 | 102 |
| 506 | 3300005367 | Ga0070667_101573398 | Ga0070667_1015733982 | 102 |
| 507 | 3300005438 | Ga0070701_10246032 | Ga0070701_102460323 | 102 |
| 508 | 3300005441 | Ga0070700_100076306 | Ga0070700_1000763063 | 102 |
| 509 | 3300005455 | Ga0070663_100015103 | Ga0070663_1000151034 | 102 |
| 510 | 3300005455 | Ga0070663_100077979 | Ga0070663_1000779792 | 102 |
| 511 | 3300005455 | Ga0070663_100422419 | Ga0070663_1004224192 | 102 |
| 512 | 3300005456 | Ga0070678_100073477 | Ga0070678_1000734773 | 102 |
| 513 | 3300005456 | Ga0070678_100080791 | Ga0070678_1000807912 | 102 |
| 514 | 3300005456 | Ga0070678_100563879 | Ga0070678_1005638792 | 102 |
| 515 | 3300005456 | Ga0070678_101761916 | Ga0070678_1017619162 | 102 |
| 516 | 3300005456 | Ga0070678_102273122 | Ga0070678_1022731221 | 102 |
| 517 | 3300005457 | Ga0070662_100028876 | Ga0070662_1000288763 | 102 |
| 518 | 3300005457 | Ga0070662_100141047 | Ga0070662_1001410473 | 102 |
| 519 | 3300005457 | Ga0070662_100347539 | Ga0070662_1003475393 | 102 |
| 520 | 3300005457 | Ga0070662_100430677 | Ga0070662_1004306772 | 102 |
| 521 | 3300005457 | Ga0070662_100539438 | Ga0070662_1005394381 | 102 |
| 522 | 3300005457 | Ga0070662_101122899 | Ga0070662_1011228992 | 102 |
| 523 | 3300005458 | Ga0070681_10338724 | Ga0070681_103387242 | 102 |
| 524 | 3300005458 | Ga0070681_10571099 | Ga0070681_105710992 | 102 |
| 525 | 3300005459 | Ga0068867_100058810 | Ga0068867_1000588103 | 102 |
| 526 | 3300005459 | Ga0068867_100120849 | Ga0068867_1001208492 | 102 |
| 527 | 3300005459 | Ga0068867_101641707 | Ga0068867_1016417071 | 102 |
| 528 | 3300005468 | Ga0070707_101602619 | Ga0070707_1016026192 | 102 |
| 529 | 3300005530 | Ga0070679_100005910 | Ga0070679_1000059104 | 102 |
| 530 | 3300005530 | Ga0070679_101204174 | Ga0070679_1012041741 | 102 |
| 531 | 3300005530 | Ga0070679_101560032 | Ga0070679_1015600322 | 102 |
| 532 | 3300005535 | Ga0070684_100344415 | Ga0070684_1003444153 | 102 |
| 533 | 3300005539 | Ga0068853_100024777 | Ga0068853_1000247774 | 102 |
| 534 | 3300005539 | Ga0068853_101035323 | Ga0068853_1010353232 | 102 |
| 535 | 3300005539 | Ga0068853_101532422 | Ga0068853_1015324222 | 102 |
| 536 | 3300005543 | Ga0070672_100031086 | Ga0070672_1000310864 | 102 |
| 537 | 3300005543 | Ga0070672_100035268 | Ga0070672_1000352683 | 102 |
| 538 | 3300005543 | Ga0070672_100046034 | Ga0070672_1000460342 | 102 |
| 539 | 3300005543 | Ga0070672_100103215 | Ga0070672_1001032153 | 102 |
| 540 | 3300005543 | Ga0070672_100117126 | Ga0070672_1001171263 | 102 |
| 541 | 3300005543 | Ga0070672_100371159 | Ga0070672_1003711592 | 102 |
| 542 | 3300005544 | Ga0070686_100112647 | Ga0070686_1001126472 | 102 |
| 543 | 3300005545 | Ga0070695_100356570 | Ga0070695_1003565702 | 102 |
| 544 | 3300005547 | Ga0070693_100932884 | Ga0070693_1009328842 | 102 |
| 545 | 3300005548 | Ga0070665_100405384 | Ga0070665_1004053842 | 102 |
| 546 | 3300005548 | Ga0070665_100690840 | Ga0070665_1006908402 | 102 |
| 547 | 3300005548 | Ga0070665_100752282 | Ga0070665_1007522822 | 102 |
| 548 | 3300005548 | Ga0070665_102045678 | Ga0070665_1020456781 | 102 |
| 549 | 3300005549 | Ga0070704_100508124 | Ga0070704_1005081242 | 102 |
| 550 | 3300005563 | Ga0068855_100066039 | Ga0068855_1000660394 | 102 |
| 551 | 3300005563 | Ga0068855_100412939 | Ga0068855_1004129392 | 102 |
| 552 | 3300005564 | Ga0070664_100145261 | Ga0070664_1001452612 | 102 |
| 553 | 3300005564 | Ga0070664_100178886 | Ga0070664_1001788863 | 102 |
| 554 | 3300005564 | Ga0070664_100276244 | Ga0070664_1002762442 | 102 |
| 555 | 3300005564 | Ga0070664_100674737 | Ga0070664_1006747372 | 102 |
| 556 | 3300005564 | Ga0070664_100834392 | Ga0070664_1008343922 | 102 |
| 557 | 3300005564 | Ga0070664_101357878 | Ga0070664_1013578782 | 102 |
| 558 | 3300005564 | Ga0070664_101444025 | Ga0070664_1014440252 | 102 |
| 559 | 3300005577 | Ga0068857_100094200 | Ga0068857_1000942003 | 102 |
| 560 | 3300005578 | Ga0068854_100016864 | Ga0068854_1000168644 | 102 |
| 561 | 3300005614 | Ga0068856_100129957 | Ga0068856_1001299573 | 102 |
| 562 | 3300005614 | Ga0068856_100136686 | Ga0068856_1001366863 | 102 |
| 563 | 3300005614 | Ga0068856_100414739 | Ga0068856_1004147393 | 102 |
| 564 | 3300005615 | Ga0070702_100531188 | Ga0070702_1005311881 | 102 |
| 565 | 3300005616 | Ga0068852_100014893 | Ga0068852_1000148933 | 102 |
| 566 | 3300005616 | Ga0068852_100090637 | Ga0068852_1000906373 | 102 |
| 567 | 3300005616 | Ga0068852_100094656 | Ga0068852_1000946563 | 102 |
| 568 | 3300005616 | Ga0068852_100261225 | Ga0068852_1002612252 | 102 |
| 569 | 3300005616 | Ga0068852_100865932 | Ga0068852_1008659322 | 102 |
| 570 | 3300005616 | Ga0068852_101483298 | Ga0068852_1014832982 | 102 |
| 571 | 3300005616 | Ga0068852_102078317 | Ga0068852_1020783172 | 102 |
| 572 | 3300005616 | Ga0068852_102535526 | Ga0068852_1025355262 | 102 |
| 573 | 3300005617 | Ga0068859_100070397 | Ga0068859_1000703973 | 102 |
| 574 | 3300005618 | Ga0068864_100031659 | Ga0068864_1000316593 | 102 |
| 575 | 3300005618 | Ga0068864_100065319 | Ga0068864_1000653193 | 102 |
| 576 | 3300005618 | Ga0068864_100080246 | Ga0068864_1000802463 | 102 |
| 577 | 3300005618 | Ga0068864_100551872 | Ga0068864_1005518722 | 102 |
| 578 | 3300005618 | Ga0068864_100560329 | Ga0068864_1005603293 | 102 |
| 579 | 3300005618 | Ga0068864_101251714 | Ga0068864_1012517141 | 102 |
| 580 | 3300005718 | Ga0068866_10457995 | Ga0068866_104579953 | 102 |
| 581 | 3300005718 | Ga0068866_10709988 | Ga0068866_107099882 | 102 |
| 582 | 3300005719 | Ga0068861_100011424 | Ga0068861_1000114243 | 102 |
| 583 | 3300005719 | Ga0068861_100023590 | Ga0068861_1000235903 | 102 |
| 584 | 3300005719 | Ga0068861_100398616 | Ga0068861_1003986162 | 102 |
| 585 | 3300005834 | Ga0068851_10076090 | Ga0068851_100760903 | 102 |
| 586 | 3300005834 | Ga0068851_10227290 | Ga0068851_102272902 | 102 |
| 587 | 3300005834 | Ga0068851_10283165 | Ga0068851_102831652 | 102 |
| 588 | 3300005840 | Ga0068870_10748004 | Ga0068870_107480042 | 102 |
| 589 | 3300005840 | Ga0068870_10882354 | Ga0068870_108823542 | 102 |
| 590 | 3300005841 | Ga0068863_100024199 | Ga0068863_1000241993 | 102 |
| 591 | 3300005841 | Ga0068863_100335406 | Ga0068863_1003354062 | 102 |
| 592 | 3300005841 | Ga0068863_101160718 | Ga0068863_1011607181 | 102 |
| 593 | 3300005842 | Ga0068858_100024676 | Ga0068858_1000246766 | 102 |
| 594 | 3300005842 | Ga0068858_100073309 | Ga0068858_1000733093 | 102 |
| 595 | 3300005842 | Ga0068858_100075568 | Ga0068858_1000755683 | 102 |
| 596 | 3300005842 | Ga0068858_100489250 | Ga0068858_1004892502 | 102 |
| 597 | 3300005843 | Ga0068860_100005841 | Ga0068860_10000584110 | 102 |
| 598 | 3300005843 | Ga0068860_100116688 | Ga0068860_1001166883 | 102 |
| 599 | 3300005843 | Ga0068860_100851194 | Ga0068860_1008511942 | 102 |
| 600 | 3300005844 | Ga0068862_101024243 | Ga0068862_1010242432 | 102 |
| 601 | 3300006173 | Ga0070716_100266048 | Ga0070716_1002660483 | 102 |
| 602 | 3300006237 | Ga0097621_100065895 | Ga0097621_1000658953 | 102 |
| 603 | 3300006237 | Ga0097621_100079659 | Ga0097621_1000796592 | 102 |
| 604 | 3300006237 | Ga0097621_100614509 | Ga0097621_1006145092 | 102 |
| 605 | 3300006358 | Ga0068871_100114047 | Ga0068871_1001140473 | 102 |
| 606 | 3300006358 | Ga0068871_100130403 | Ga0068871_1001304032 | 102 |
| 607 | 3300006358 | Ga0068871_100305890 | Ga0068871_1003058902 | 102 |
| 608 | 3300006358 | Ga0068871_100335356 | Ga0068871_1003353562 | 102 |
| 609 | 3300006358 | Ga0068871_100342524 | Ga0068871_1003425242 | 102 |
| 610 | 3300006871 | Ga0075434_100450734 | Ga0075434_1004507343 | 102 |
| 611 | 3300006880 | Ga0075429_101359730 | Ga0075429_1013597302 | 102 |
| 612 | 3300006881 | Ga0068865_100027153 | Ga0068865_1000271534 | 102 |
| 613 | 3300006881 | Ga0068865_100204575 | Ga0068865_1002045752 | 102 |
| 614 | 3300006881 | Ga0068865_100378676 | Ga0068865_1003786763 | 102 |
| 615 | 3300006914 | Ga0075436_100665807 | Ga0075436_1006658072 | 102 |
| 616 | 3300006931 | Ga0097620_100070394 | Ga0097620_1000703943 | 102 |
| 617 | 3300007076 | Ga0075435_100744455 | Ga0075435_1007444552 | 102 |
| 618 | 3300009093 | Ga0105240_10283164 | Ga0105240_102831643 | 102 |
| 619 | 3300009094 | Ga0111539_10267976 | Ga0111539_102679763 | 102 |
| 620 | 3300009094 | Ga0111539_10289122 | Ga0111539_102891223 | 102 |
| 621 | 3300009098 | Ga0105245_10108671 | Ga0105245_101086713 | 102 |
| 622 | 3300009098 | Ga0105245_10870356 | Ga0105245_108703562 | 102 |
| 623 | 3300009101 | Ga0105247_10773101 | Ga0105247_107731011 | 102 |
| 624 | 3300009148 | Ga0105243_10023684 | Ga0105243_100236846 | 102 |
| 625 | 3300009148 | Ga0105243_10487973 | Ga0105243_104879732 | 102 |
| 626 | 3300009148 | Ga0105243_11404104 | Ga0105243_114041042 | 102 |
| 627 | 3300009148 | Ga0105243_11435905 | Ga0105243_114359051 | 102 |
| 628 | 3300009176 | Ga0105242_10143125 | Ga0105242_101431253 | 102 |
| 629 | 3300009176 | Ga0105242_10638069 | Ga0105242_106380692 | 102 |
| 630 | 3300009177 | Ga0105248_10066287 | Ga0105248_100662874 | 102 |
| 631 | 3300009177 | Ga0105248_10193409 | Ga0105248_101934092 | 102 |
| 632 | 3300009177 | Ga0105248_10271747 | Ga0105248_102717472 | 102 |
| 633 | 3300009177 | Ga0105248_10484692 | Ga0105248_104846922 | 102 |
| 634 | 3300009545 | Ga0105237_10096291 | Ga0105237_100962912 | 102 |
| 635 | 3300009551 | Ga0105238_10124517 | Ga0105238_101245173 | 102 |
| 636 | 3300009553 | Ga0105249_10137749 | Ga0105249_101377492 | 102 |
| 637 | 3300010375 | Ga0105239_10295005 | Ga0105239_102950053 | 102 |
| 638 | 3300010375 | Ga0105239_10954720 | Ga0105239_109547202 | 102 |
| 639 | 3300013100 | Ga0157373_10024144 | Ga0157373_100241443 | 102 |
| 640 | 3300013102 | Ga0157371_10138859 | Ga0157371_101388592 | 102 |
| 641 | 3300013105 | Ga0157369_10062981 | Ga0157369_100629813 | 102 |
| 642 | 3300013296 | Ga0157374_10031304 | Ga0157374_100313043 | 102 |
| 643 | 3300013296 | Ga0157374_10321419 | Ga0157374_103214192 | 102 |
| 644 | 3300013296 | Ga0157374_11757986 | Ga0157374_117579862 | 102 |
| 645 | 3300013297 | Ga0157378_10990661 | Ga0157378_109906612 | 102 |
| 646 | 3300013297 | Ga0157378_11799559 | Ga0157378_117995592 | 102 |
| 647 | 3300013306 | Ga0163162_10001541 | Ga0163162_1000154120 | 102 |
| 648 | 3300013306 | Ga0163162_10070367 | Ga0163162_100703673 | 102 |
| 649 | 3300013306 | Ga0163162_10305079 | Ga0163162_103050793 | 102 |
| 650 | 3300013306 | Ga0163162_10499622 | Ga0163162_104996223 | 102 |
| 651 | 3300013306 | Ga0163162_11364280 | Ga0163162_113642802 | 102 |
| 652 | 3300013307 | Ga0157372_10073108 | Ga0157372_100731084 | 102 |
| 653 | 3300013307 | Ga0157372_10093451 | Ga0157372_100934513 | 102 |
| 654 | 3300013308 | Ga0157375_10079558 | Ga0157375_100795584 | 102 |
| 655 | 3300013308 | Ga0157375_10092138 | Ga0157375_100921382 | 102 |
| 656 | 3300013308 | Ga0157375_10612496 | Ga0157375_106124963 | 102 |
| 657 | 3300013308 | Ga0157375_10788862 | Ga0157375_107888621 | 102 |
| 658 | 3300014325 | Ga0163163_10259237 | Ga0163163_102592372 | 102 |
| 659 | 3300014326 | Ga0157380_10133171 | Ga0157380_101331712 | 102 |
| 660 | 3300014326 | Ga0157380_10548647 | Ga0157380_105486472 | 102 |
| 661 | 3300014745 | Ga0157377_10001746 | Ga0157377_100017468 | 102 |
| 662 | 3300014968 | Ga0157379_10018961 | Ga0157379_100189617 | 102 |
| 663 | 3300014968 | Ga0157379_10032422 | Ga0157379_100324225 | 102 |
| 664 | 3300014968 | Ga0157379_10124526 | Ga0157379_101245263 | 102 |
| 665 | 3300014968 | Ga0157379_10157361 | Ga0157379_101573613 | 102 |
| 666 | 3300014969 | Ga0157376_10049664 | Ga0157376_100496644 | 102 |
| 667 | 3300014969 | Ga0157376_10882528 | Ga0157376_108825282 | 102 |
| 668 | 3300014969 | Ga0157376_11018245 | Ga0157376_110182451 | 102 |
| 669 | 3300015261 | Ga0182006_1278431 | Ga0182006_12784312 | 102 |
| 670 | 3300015265 | Ga0182005_1128173 | Ga0182005_11281732 | 102 |
| 671 | 3300017792 | Ga0163161_10175056 | Ga0163161_101750562 | 102 |
| 672 | 3300017792 | Ga0163161_10510577 | Ga0163161_105105772 | 102 |
| 673 | 3300017792 | Ga0163161_11017028 | Ga0163161_110170282 | 102 |
| 674 | 3300021384 | Ga0213876_10165029 | Ga0213876_101650292 | 102 |
| 675 | 3300025271 | Ga0207666_1044135 | Ga0207666_10441352 | 102 |
| 676 | 3300025321 | Ga0207656_10018712 | Ga0207656_100187123 | 102 |
| 677 | 3300025321 | Ga0207656_10060820 | Ga0207656_100608202 | 102 |
| 678 | 3300025321 | Ga0207656_10087605 | Ga0207656_100876053 | 102 |
| 679 | 3300025321 | Ga0207656_10391007 | Ga0207656_103910072 | 102 |
| 680 | 3300025893 | Ga0207682_10006323 | Ga0207682_100063234 | 102 |
| 681 | 3300025893 | Ga0207682_10050056 | Ga0207682_100500562 | 102 |
| 682 | 3300025893 | Ga0207682_10174224 | Ga0207682_101742241 | 102 |
| 683 | 3300025899 | Ga0207642_10284648 | Ga0207642_102846482 | 102 |
| 684 | 3300025901 | Ga0207688_10047915 | Ga0207688_100479153 | 102 |
| 685 | 3300025901 | Ga0207688_10316967 | Ga0207688_103169672 | 102 |
| 686 | 3300025903 | Ga0207680_10193932 | Ga0207680_101939321 | 102 |
| 687 | 3300025903 | Ga0207680_10524368 | Ga0207680_105243682 | 102 |
| 688 | 3300025904 | Ga0207647_10399755 | Ga0207647_103997552 | 102 |
| 689 | 3300025907 | Ga0207645_10025382 | Ga0207645_100253824 | 102 |
| 690 | 3300025907 | Ga0207645_10036225 | Ga0207645_100362253 | 102 |
| 691 | 3300025907 | Ga0207645_10078905 | Ga0207645_100789053 | 102 |
| 692 | 3300025907 | Ga0207645_10138024 | Ga0207645_101380242 | 102 |
| 693 | 3300025909 | Ga0207705_10133962 | Ga0207705_101339623 | 102 |
| 694 | 3300025909 | Ga0207705_10367801 | Ga0207705_103678012 | 102 |
| 695 | 3300025909 | Ga0207705_10834683 | Ga0207705_108346831 | 102 |
| 696 | 3300025912 | Ga0207707_10315027 | Ga0207707_103150272 | 102 |
| 697 | 3300025913 | Ga0207695_10203848 | Ga0207695_102038482 | 102 |
| 698 | 3300025914 | Ga0207671_10306590 | Ga0207671_103065903 | 102 |
| 699 | 3300025917 | Ga0207660_10009668 | Ga0207660_100096686 | 102 |
| 700 | 3300025919 | Ga0207657_10473941 | Ga0207657_104739412 | 102 |
| 701 | 3300025919 | Ga0207657_10620415 | Ga0207657_106204151 | 102 |
| 702 | 3300025920 | Ga0207649_10089105 | Ga0207649_100891052 | 102 |
| 703 | 3300025920 | Ga0207649_10518660 | Ga0207649_105186602 | 102 |
| 704 | 3300025921 | Ga0207652_10013674 | Ga0207652_100136743 | 102 |
| 705 | 3300025923 | Ga0207681_10021768 | Ga0207681_100217684 | 102 |
| 706 | 3300025923 | Ga0207681_10061183 | Ga0207681_100611833 | 102 |
| 707 | 3300025923 | Ga0207681_10457546 | Ga0207681_104575463 | 102 |
| 708 | 3300025923 | Ga0207681_10713234 | Ga0207681_107132342 | 102 |
| 709 | 3300025923 | Ga0207681_10742925 | Ga0207681_107429252 | 102 |
| 710 | 3300025924 | Ga0207694_10167559 | Ga0207694_101675593 | 102 |
| 711 | 3300025924 | Ga0207694_10700091 | Ga0207694_107000912 | 102 |
| 712 | 3300025925 | Ga0207650_10006455 | Ga0207650_100064552 | 102 |
| 713 | 3300025925 | Ga0207650_10038591 | Ga0207650_100385913 | 102 |
| 714 | 3300025925 | Ga0207650_10092424 | Ga0207650_100924242 | 102 |
| 715 | 3300025925 | Ga0207650_10100288 | Ga0207650_101002882 | 102 |
| 716 | 3300025925 | Ga0207650_10115135 | Ga0207650_101151352 | 102 |
| 717 | 3300025925 | Ga0207650_10181055 | Ga0207650_101810553 | 102 |
| 718 | 3300025925 | Ga0207650_10888675 | Ga0207650_108886752 | 102 |
| 719 | 3300025926 | Ga0207659_10009948 | Ga0207659_100099486 | 102 |
| 720 | 3300025926 | Ga0207659_10010917 | Ga0207659_100109174 | 102 |
| 721 | 3300025926 | Ga0207659_10041819 | Ga0207659_100418193 | 102 |
| 722 | 3300025926 | Ga0207659_10419995 | Ga0207659_104199952 | 102 |
| 723 | 3300025927 | Ga0207687_10056250 | Ga0207687_100562503 | 102 |
| 724 | 3300025927 | Ga0207687_10775581 | Ga0207687_107755812 | 102 |
| 725 | 3300025931 | Ga0207644_10041754 | Ga0207644_100417543 | 102 |
| 726 | 3300025931 | Ga0207644_10216505 | Ga0207644_102165053 | 102 |
| 727 | 3300025931 | Ga0207644_10256651 | Ga0207644_102566512 | 102 |
| 728 | 3300025931 | Ga0207644_11364647 | Ga0207644_113646472 | 102 |
| 729 | 3300025931 | Ga0207644_11880628 | Ga0207644_118806282 | 102 |
| 730 | 3300025932 | Ga0207690_10050834 | Ga0207690_100508343 | 102 |
| 731 | 3300025932 | Ga0207690_10055305 | Ga0207690_100553053 | 102 |
| 732 | 3300025932 | Ga0207690_10189841 | Ga0207690_101898412 | 102 |
| 733 | 3300025933 | Ga0207706_10051645 | Ga0207706_100516453 | 102 |
| 734 | 3300025933 | Ga0207706_10080651 | Ga0207706_100806513 | 102 |
| 735 | 3300025933 | Ga0207706_10150655 | Ga0207706_101506553 | 102 |
| 736 | 3300025933 | Ga0207706_10467903 | Ga0207706_104679033 | 102 |
| 737 | 3300025934 | Ga0207686_10803521 | Ga0207686_108035212 | 102 |
| 738 | 3300025935 | Ga0207709_10081126 | Ga0207709_100811263 | 102 |
| 739 | 3300025935 | Ga0207709_10813349 | Ga0207709_108133492 | 102 |
| 740 | 3300025935 | Ga0207709_10901308 | Ga0207709_109013082 | 102 |
| 741 | 3300025936 | Ga0207670_10343637 | Ga0207670_103436372 | 102 |
| 742 | 3300025937 | Ga0207669_10782080 | Ga0207669_107820802 | 102 |
| 743 | 3300025938 | Ga0207704_10500872 | Ga0207704_105008723 | 102 |
| 744 | 3300025938 | Ga0207704_11006129 | Ga0207704_110061292 | 102 |
| 745 | 3300025939 | Ga0207665_10452007 | Ga0207665_104520072 | 102 |
| 746 | 3300025940 | Ga0207691_10029127 | Ga0207691_100291276 | 102 |
| 747 | 3300025940 | Ga0207691_10055017 | Ga0207691_100550174 | 102 |
| 748 | 3300025940 | Ga0207691_10122157 | Ga0207691_101221572 | 102 |
| 749 | 3300025940 | Ga0207691_10199532 | Ga0207691_101995322 | 102 |
| 750 | 3300025940 | Ga0207691_10446283 | Ga0207691_104462832 | 102 |
| 751 | 3300025940 | Ga0207691_10480642 | Ga0207691_104806422 | 102 |
| 752 | 3300025940 | Ga0207691_10522681 | Ga0207691_105226812 | 102 |
| 753 | 3300025941 | Ga0207711_10025658 | Ga0207711_100256584 | 102 |
| 754 | 3300025941 | Ga0207711_10186248 | Ga0207711_101862483 | 102 |
| 755 | 3300025941 | Ga0207711_10207381 | Ga0207711_102073812 | 102 |
| 756 | 3300025942 | Ga0207689_10010535 | Ga0207689_100105358 | 102 |
| 757 | 3300025942 | Ga0207689_10013874 | Ga0207689_100138743 | 102 |
| 758 | 3300025944 | Ga0207661_10176600 | Ga0207661_101766003 | 102 |
| 759 | 3300025944 | Ga0207661_10888849 | Ga0207661_108888492 | 102 |
| 760 | 3300025944 | Ga0207661_11379629 | Ga0207661_113796292 | 102 |
| 761 | 3300025945 | Ga0207679_10039737 | Ga0207679_100397373 | 102 |
| 762 | 3300025945 | Ga0207679_10096341 | Ga0207679_100963413 | 102 |
| 763 | 3300025945 | Ga0207679_10195046 | Ga0207679_101950462 | 102 |
| 764 | 3300025945 | Ga0207679_11137874 | Ga0207679_111378742 | 102 |
| 765 | 3300025945 | Ga0207679_11267132 | Ga0207679_112671322 | 102 |
| 766 | 3300025945 | Ga0207679_11686370 | Ga0207679_116863702 | 102 |
| 767 | 3300025949 | Ga0207667_10394009 | Ga0207667_103940092 | 102 |
| 768 | 3300025949 | Ga0207667_11147727 | Ga0207667_111477272 | 102 |
| 769 | 3300025960 | Ga0207651_10045993 | Ga0207651_100459933 | 102 |
| 770 | 3300025960 | Ga0207651_10121226 | Ga0207651_101212263 | 102 |
| 771 | 3300025960 | Ga0207651_10332864 | Ga0207651_103328642 | 102 |
| 772 | 3300025960 | Ga0207651_10532558 | Ga0207651_105325582 | 102 |
| 773 | 3300025960 | Ga0207651_10754146 | Ga0207651_107541462 | 102 |
| 774 | 3300025960 | Ga0207651_10860525 | Ga0207651_108605252 | 102 |
| 775 | 3300025960 | Ga0207651_11116435 | Ga0207651_111164352 | 102 |
| 776 | 3300025961 | Ga0207712_10168668 | Ga0207712_101686682 | 102 |
| 777 | 3300025972 | Ga0207668_10085291 | Ga0207668_100852913 | 102 |
| 778 | 3300025972 | Ga0207668_11173781 | Ga0207668_111737811 | 102 |
| 779 | 3300025981 | Ga0207640_10035795 | Ga0207640_100357954 | 102 |
| 780 | 3300025981 | Ga0207640_10761489 | Ga0207640_107614892 | 102 |
| 781 | 3300025986 | Ga0207658_10068722 | Ga0207658_100687222 | 102 |
| 782 | 3300025986 | Ga0207658_10115289 | Ga0207658_101152893 | 102 |
| 783 | 3300025986 | Ga0207658_10329291 | Ga0207658_103292913 | 102 |
| 784 | 3300026023 | Ga0207677_10027411 | Ga0207677_100274113 | 102 |
| 785 | 3300026023 | Ga0207677_10869853 | Ga0207677_108698532 | 102 |
| 786 | 3300026023 | Ga0207677_11692881 | Ga0207677_116928811 | 102 |
| 787 | 3300026035 | Ga0207703_10001562 | Ga0207703_100015624 | 102 |
| 788 | 3300026035 | Ga0207703_10020445 | Ga0207703_100204456 | 102 |
| 789 | 3300026035 | Ga0207703_10178481 | Ga0207703_101784813 | 102 |
| 790 | 3300026041 | Ga0207639_10010593 | Ga0207639_100105937 | 102 |
| 791 | 3300026041 | Ga0207639_11028147 | Ga0207639_110281472 | 102 |
| 792 | 3300026067 | Ga0207678_10012734 | Ga0207678_100127348 | 102 |
| 793 | 3300026067 | Ga0207678_10045136 | Ga0207678_100451363 | 102 |
| 794 | 3300026075 | Ga0207708_10075077 | Ga0207708_100750773 | 102 |
| 795 | 3300026078 | Ga0207702_10072573 | Ga0207702_100725733 | 102 |
| 796 | 3300026078 | Ga0207702_10186497 | Ga0207702_101864973 | 102 |
| 797 | 3300026078 | Ga0207702_12043531 | Ga0207702_120435312 | 102 |
| 798 | 3300026088 | Ga0207641_10000655 | Ga0207641_100006553 | 102 |
| 799 | 3300026088 | Ga0207641_10412113 | Ga0207641_104121132 | 102 |
| 800 | 3300026088 | Ga0207641_11035074 | Ga0207641_110350741 | 102 |
| 801 | 3300026088 | Ga0207641_11113301 | Ga0207641_111133011 | 102 |
| 802 | 3300026088 | Ga0207641_11697814 | Ga0207641_116978142 | 102 |
| 803 | 3300026089 | Ga0207648_10186283 | Ga0207648_101862832 | 102 |
| 804 | 3300026089 | Ga0207648_11261935 | Ga0207648_112619351 | 102 |
| 805 | 3300026089 | Ga0207648_11488458 | Ga0207648_114884582 | 102 |
| 806 | 3300026095 | Ga0207676_10038292 | Ga0207676_100382924 | 102 |
| 807 | 3300026095 | Ga0207676_10058595 | Ga0207676_100585953 | 102 |
| 808 | 3300026095 | Ga0207676_12085534 | Ga0207676_120855342 | 102 |
| 809 | 3300026116 | Ga0207674_10096614 | Ga0207674_100966143 | 102 |
| 810 | 3300026116 | Ga0207674_10662448 | Ga0207674_106624482 | 102 |
| 811 | 3300026118 | Ga0207675_100004707 | Ga0207675_1000047076 | 102 |
| 812 | 3300026118 | Ga0207675_100017601 | Ga0207675_1000176013 | 102 |
| 813 | 3300026118 | Ga0207675_100522179 | Ga0207675_1005221792 | 102 |
| 814 | 3300026118 | Ga0207675_100864109 | Ga0207675_1008641092 | 102 |
| 815 | 3300026118 | Ga0207675_102649171 | Ga0207675_1026491712 | 102 |
| 816 | 3300026121 | Ga0207683_10022883 | Ga0207683_100228833 | 102 |
| 817 | 3300026121 | Ga0207683_10087698 | Ga0207683_100876983 | 102 |
| 818 | 3300026121 | Ga0207683_10683211 | Ga0207683_106832112 | 102 |
| 819 | 3300026121 | Ga0207683_12119983 | Ga0207683_121199832 | 102 |
| 820 | 3300026142 | Ga0207698_10026032 | Ga0207698_100260323 | 102 |
| 821 | 3300026142 | Ga0207698_10039973 | Ga0207698_100399733 | 102 |
| 822 | 3300026142 | Ga0207698_10042642 | Ga0207698_100426424 | 102 |
| 823 | 3300026142 | Ga0207698_10121702 | Ga0207698_101217023 | 102 |
| 824 | 3300026142 | Ga0207698_10341159 | Ga0207698_103411592 | 102 |
| 825 | 3300026142 | Ga0207698_11258709 | Ga0207698_112587092 | 102 |
| 826 | 3300026142 | Ga0207698_12600978 | Ga0207698_126009781 | 102 |
| 827 | 3300028379 | Ga0268266_10869988 | Ga0268266_108699882 | 102 |
| 828 | 3300028379 | Ga0268266_10897402 | Ga0268266_108974022 | 102 |
| 829 | 3300028379 | Ga0268266_12193883 | Ga0268266_121938831 | 102 |
| 830 | 3300028380 | Ga0268265_10422181 | Ga0268265_104221813 | 102 |
| 831 | 3300028380 | Ga0268265_11101237 | Ga0268265_111012372 | 102 |
| 832 | 3300028381 | Ga0268264_10172460 | Ga0268264_101724603 | 102 |
| 833 | 3300031548 | Ga0307408_100207826 | Ga0307408_1002078262 | 102 |
| 834 | 3300031731 | Ga0307405_10063724 | Ga0307405_100637243 | 102 |
| 835 | 3300031901 | Ga0307406_10119880 | Ga0307406_101198802 | 102 |
| 836 | 3300031903 | Ga0307407_10584081 | Ga0307407_105840812 | 102 |
| 837 | 3300031903 | Ga0307407_11283278 | Ga0307407_112832782 | 102 |
| 838 | 3300031911 | Ga0307412_10280350 | Ga0307412_102803502 | 102 |
| 839 | 3300031995 | Ga0307409_100000998 | Ga0307409_1000009986 | 102 |
| 840 | 3300032002 | Ga0307416_100020663 | Ga0307416_1000206634 | 102 |
| 841 | 3300032126 | Ga0307415_100018265 | Ga0307415_1000182652 | 102 |
| 842 | 3300035084 | Ga0373928_0048659 | Ga0373928_0048659_350_658 | 102 |
| 843 | 3300035112 | Ga0373932_0034803 | Ga0373932_0034803_840_1148 | 102 |
| 844 | 3300035170 | Ga0373943_0095824 | Ga0373943_0095824_302_616 | 102 |
| 845 | 3300035171 | Ga0373946_0263875 | Ga0373946_0263875_486_800 | 102 |
| 846 | 3300035242 | Ga0373962_0265784 | Ga0373962_0265784_63_371 | 102 |
| 847 | 3300035691 | Ga0373931_0030179 | Ga0373931_0030179_1517_1825 | 102 |
| 848 | 3300037853 | Ga0436364_0872711 | Ga0436364_0872711_17_334 | 102 |
| 849 | 3300039437 | Ga0436365_0830380 | Ga0436365_0830380_172_480 | 102 |
| 850 | 3300039437 | Ga0436365_1729666 | Ga0436365_1729666_1895_2209 | 102 |
| 851 | 3300039450 | Ga0436363_1353996 | Ga0436363_1353996_1297_1611 | 102 |
| 852 | 3300041453 | Ga0451797_0590806 | Ga0451797_0590806_166_480 | 102 |
| 853 | 3300041459 | Ga0451800_0691674 | Ga0451800_0691674_122_430 | 102 |
| 854 | 3300041460 | Ga0451802_1535241 | Ga0451802_1535241_150_458 | 102 |
| 855 | 3300041512 | Ga0451853_2191125 | Ga0451853_2191125_298_606 | 102 |
| 856 | 3300042012 | Ga0439455_0161594 | Ga0439455_0161594_230_544 | 102 |
| 857 | 3300042117 | Ga0450913_021465 | Ga0450913_021465_199_513 | 102 |
| 858 | 3300042439 | Ga0439464_0096006 | Ga0439464_0096006_394_708 | 102 |
| 859 | 3300042461 | Ga0439460_0174247 | Ga0439460_0174247_274_588 | 102 |
| 860 | 3300045051 | Ga0451576_0386825 | Ga0451576_0386825_257_565 | 102 |
| 861 | 3300045051 | Ga0451576_0577456 | Ga0451576_0577456_614_928 | 102 |
| 862 | 3300046473 | Ga0495582_0562783 | Ga0495582_0562783_183_497 | 102 |
| 863 | 3300046515 | Ga0495620_0280138 | Ga0495620_0280138_306_620 | 102 |
| 864 | 3300046530 | Ga0495654_0246427 | Ga0495654_0246427_188_496 | 102 |
| 865 | 3300046537 | Ga0495598_0166716 | Ga0495598_0166716_192_506 | 102 |
| 866 | 3300046539 | Ga0495621_0140935 | Ga0495621_0140935_247_561 | 102 |
| 867 | 3300046683 | Ga0495658_0098601 | Ga0495658_0098601_665_979 | 102 |
| 868 | 3300048090 | Ga0495615_0159241 | Ga0495615_0159241_35_349 | 102 |
| 869 | 3300048903 | Ga0496100_0135463 | Ga0496100_0135463_797_1105 | 102 |
| 870 | 3300048904 | Ga0496101_0151451 | Ga0496101_0151451_808_1116 | 102 |
| 871 | 3300048905 | Ga0496102_0365076 | Ga0496102_0365076_808_1116 | 102 |
| 872 | 3300048907 | Ga0496104_0026264 | Ga0496104_0026264_163_477 | 102 |
| 873 | 3300048907 | Ga0496104_0677349 | Ga0496104_0677349_591_899 | 102 |
| 874 | 3300048908 | Ga0496105_0453340 | Ga0496105_0453340_51_359 | 102 |
| 875 | 3300048909 | Ga0496106_0053191 | Ga0496106_0053191_808_1116 | 102 |
| 876 | 3300048910 | Ga0496107_0059091 | Ga0496107_0059091_1486_1794 | 102 |
| 877 | 3300048910 | Ga0496107_1245042 | Ga0496107_1245042_39_353 | 102 |
| 878 | 3300048911 | Ga0496108_0123130 | Ga0496108_0123130_784_1092 | 102 |
| 879 | 3300048911 | Ga0496108_0900308 | Ga0496108_0900308_61_369 | 102 |
| 880 | 3300048912 | Ga0496109_0085339 | Ga0496109_0085339_1265_1573 | 102 |
| 881 | 3300048913 | Ga0496110_0239621 | Ga0496110_0239621_1034_1342 | 102 |
| 882 | 3300048913 | Ga0496110_0305532 | Ga0496110_0305532_523_831 | 102 |
| 883 | 3300048913 | Ga0496110_0406612 | Ga0496110_0406612_531_845 | 102 |
| 884 | 3300048913 | Ga0496110_0853512 | Ga0496110_0853512_347_655 | 102 |
| 885 | 3300048914 | Ga0496111_0170347 | Ga0496111_0170347_621_929 | 102 |
| 886 | 3300048916 | Ga0496113_0304954 | Ga0496113_0304954_635_943 | 102 |
| 887 | 3300048917 | Ga0496114_0218567 | Ga0496114_0218567_638_952 | 102 |
| 888 | 3300048917 | Ga0496114_0478741 | Ga0496114_0478741_765_1073 | 102 |
| 889 | 3300048917 | Ga0496114_0630345 | Ga0496114_0630345_118_432 | 102 |
| 890 | 3300048918 | Ga0496115_0108476 | Ga0496115_0108476_1556_1864 | 102 |
| 891 | 3300050511 | nmdc:mga08y16_863607_c1 | nmdc:mga08y16_863607_c1_311_619 | 102 |
| 892 | 3300050512 | nmdc:mga0n895_480444_c1 | nmdc:mga0n895_480444_c1_32_340 | 102 |
| 893 | 3300050514 | nmdc:mga08x19_858063_c1 | nmdc:mga08x19_858063_c1_123_431 | 102 |
| 894 | 3300053084 | Ga0495595_0718807 | Ga0495595_0718807_133_447 | 102 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar