F484973

General Info

Members Datasets Scaffolds Average Seq Length
895 387 1790 107

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10656295|Ga0105239_106562952
Length 129
Sequence MTKVDQVAEQLDQLTLLEAAQLSKLLQEKWGVSAAEPMAVAAIPGMAMPGGGVKNPEEEKTEFDLVLLSSGEKKIQVIKVVRELTGLGLKEAKAVVDEAPKPVKEKVSKAEAEDMKKKLEEVGATVEIK

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
117 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
118 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
119 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
123 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
124 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
125 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
126 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
127 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
128 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
129 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
154 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
157 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
222 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
223 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
224 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
225 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
226 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
239 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
242 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
243 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
244 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
245 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
246 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
247 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
261 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
264 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
265 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
266 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
267 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
268 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
269 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
270 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
271 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
272 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
273 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
274 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
275 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
276 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
277 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
278 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
286 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
287 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
288 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
289 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
295 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
334 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
335 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
336 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
337 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
338 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
339 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
340 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
341 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
342 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
343 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
352 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
356 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
357 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
358 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
359 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
360 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
361 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
369 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
370 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
373 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
374 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
375 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
376 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
377 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
385 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
386 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
387 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.87
Metatranscriptomes 2.91
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 1.79
Rhizosphere 92.18
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10656295 3300010375 Bacteria 1198
2 2214745813 2209111006 Bacteria 922
3 2214947989 2209111006 Bacteria 1290
4 rootH1_10104780 3300003323 Bacteria 2920
5 JGI26141J51220_1000264 3300003503 Bacteria 2775
6 JGI25405J52794_10031302 3300003911 Bacteria 1105
7 Ga0058859_11822547 3300004798 Bacteria 519
8 Ga0058861_10008596 3300004800 Bacteria 2362
9 Ga0058862_12853443 3300004803 Bacteria 1558
10 Ga0065717_1007684 3300005276 Bacteria 721
11 Ga0065712_10073006 3300005290 Bacteria 4538
12 Ga0065715_10000958 3300005293 Bacteria 9616
13 Ga0070658_10054413 3300005327 Bacteria 3250
14 Ga0070658_10323524 3300005327 Bacteria 1317
15 Ga0070676_10016036 3300005328 Bacteria 4138
16 Ga0070676_10130532 3300005328 Bacteria 1588
17 Ga0070676_10467687 3300005328 Bacteria 890
18 Ga0070683_100029815 3300005329 Bacteria 4944
19 Ga0070690_100007126 3300005330 Bacteria 6389
20 Ga0070670_100002592 3300005331 Bacteria 14941
21 Ga0070670_100016026 3300005331 Bacteria 6432
22 Ga0070677_10064234 3300005333 Bacteria 1524
23 Ga0070677_10075492 3300005333 Bacteria 1429
24 Ga0068869_100013457 3300005334 Bacteria 5443
25 Ga0068869_100184178 3300005334 Bacteria 1638
26 Ga0068869_100698093 3300005334 Bacteria 865
27 Ga0070666_10012610 3300005335 Bacteria 5338
28 Ga0070680_100048009 3300005336 Bacteria 3478
29 Ga0070680_100232847 3300005336 Bacteria 1556
30 Ga0070680_101390186 3300005336 Bacteria 608
31 Ga0070682_100001264 3300005337 Bacteria 14351
32 Ga0068868_100037991 3300005338 Bacteria 3736
33 Ga0068868_100094040 3300005338 Bacteria 2417
34 Ga0070660_100039844 3300005339 Bacteria 3572
35 Ga0070660_100696717 3300005339 Unclassified 851
36 Ga0070689_100097686 3300005340 Bacteria 2323
37 Ga0070689_100099661 3300005340 Bacteria 2298
38 Ga0070689_100970937 3300005340 Unclassified 754
39 Ga0070691_10009186 3300005341 Bacteria 4518
40 Ga0070691_10020621 3300005341 Bacteria 3046
41 Ga0070687_100001147 3300005343 Bacteria 9141
42 Ga0070687_100018680 3300005343 Bacteria 3211
43 Ga0070687_100036155 3300005343 Bacteria 2458
44 Ga0070661_100065294 3300005344 Bacteria 2674
45 Ga0070661_100079103 3300005344 Bacteria 2425
46 Ga0070692_10002909 3300005345 Bacteria 6792
47 Ga0070692_10015695 3300005345 Bacteria 3587
48 Ga0070692_10144026 3300005345 Bacteria 1351
49 Ga0070692_10883829 3300005345 Bacteria 617
50 Ga0070668_100107172 3300005347 Bacteria 2221
51 Ga0070668_100440334 3300005347 Bacteria 1119
52 Ga0070668_100560901 3300005347 Bacteria 995
53 Ga0070668_100614005 3300005347 Bacteria 952
54 Ga0070669_100102601 3300005353 Bacteria 2160
55 Ga0070669_100410671 3300005353 Bacteria 1109
56 Ga0070669_100706231 3300005353 Bacteria 852
57 Ga0070675_100214193 3300005354 Bacteria 1675
58 Ga0070674_100064892 3300005356 Bacteria 2561
59 Ga0070674_100137938 3300005356 Bacteria 1827
60 Ga0070674_100184827 3300005356 Bacteria 1599
61 Ga0070674_100354431 3300005356 Bacteria 1186
62 Ga0070673_100073500 3300005364 Bacteria 2752
63 Ga0070673_100130888 3300005364 Bacteria 2105
64 Ga0070673_100135081 3300005364 Bacteria 2075
65 Ga0070688_100235293 3300005365 Bacteria 1298
66 Ga0070688_100249179 3300005365 Bacteria 1264
67 Ga0070688_100763770 3300005365 Bacteria 753
68 Ga0070659_100002953 3300005366 Bacteria 12125
69 Ga0070659_100470310 3300005366 Unclassified 1068
70 Ga0070667_100020945 3300005367 Bacteria 5431
71 Ga0070714_101245958 3300005435 Bacteria 726
72 Ga0070701_10002390 3300005438 Bacteria 7217
73 Ga0070701_10067503 3300005438 Bacteria 1903
74 Ga0070701_10208948 3300005438 Bacteria 1158
75 Ga0070711_100878551 3300005439 Bacteria 764
76 Ga0070705_100026524 3300005440 Bacteria 3155
77 Ga0070705_100148049 3300005440 Bacteria 1554
78 Ga0070705_100656295 3300005440 Bacteria 819
79 Ga0070700_100009609 3300005441 Bacteria 5315
80 Ga0070700_100107265 3300005441 Bacteria 1851
81 Ga0070700_100315951 3300005441 Bacteria 1146
82 Ga0070700_100541235 3300005441 Bacteria 903
83 Ga0070700_101730570 3300005441 Bacteria 537
84 Ga0070694_100017374 3300005444 Bacteria 4546
85 Ga0070694_100017377 3300005444 Bacteria 4546
86 Ga0070694_100054732 3300005444 Bacteria 2703
87 Ga0070694_100095455 3300005444 Bacteria 2094
88 Ga0070694_100718284 3300005444 Bacteria 814
89 Ga0070708_100001270 3300005445 Bacteria 19412
90 Ga0070708_100014198 3300005445 Bacteria 6545
91 Ga0070708_100124144 3300005445 Bacteria 2385
92 Ga0070708_100223694 3300005445 Bacteria 1765
93 Ga0070708_100345601 3300005445 Bacteria 1402
94 Ga0070708_100357030 3300005445 Bacteria 1377
95 Ga0070708_100684609 3300005445 Bacteria 966
96 Ga0070708_101009962 3300005445 Bacteria 780
97 Ga0070663_100005046 3300005455 Bacteria 7800
98 Ga0070663_100240497 3300005455 Bacteria 1428
99 Ga0070663_100613018 3300005455 Bacteria 917
100 Ga0070678_100125573 3300005456 Bacteria 2030
101 Ga0070678_100308608 3300005456 Bacteria 1347
102 Ga0070662_100018770 3300005457 Bacteria 4683
103 Ga0070662_100026131 3300005457 Bacteria 4041
104 Ga0070662_100094776 3300005457 Bacteria 2248
105 Ga0070681_10002507 3300005458 Bacteria 16826
106 Ga0070681_10011332 3300005458 Bacteria 8819
107 Ga0070681_10051013 3300005458 Bacteria 4127
108 Ga0070681_10742941 3300005458 Bacteria 898
109 Ga0068867_100052875 3300005459 Bacteria 2998
110 Ga0068867_100112820 3300005459 Bacteria 2091
111 Ga0068867_100162165 3300005459 Bacteria 1764
112 Ga0068867_100291186 3300005459 Bacteria 1342
113 Ga0070706_100006254 3300005467 Bacteria 11262
114 Ga0070706_100026972 3300005467 Bacteria 5286
115 Ga0070706_100171435 3300005467 Bacteria 2026
116 Ga0070706_100196113 3300005467 Bacteria 1886
117 Ga0070706_100260726 3300005467 Bacteria 1618
118 Ga0070706_100316498 3300005467 Bacteria 1456
119 Ga0070706_100406541 3300005467 Bacteria 1267
120 Ga0070706_100577176 3300005467 Bacteria 1045
121 Ga0070706_101009797 3300005467 Bacteria 767
122 Ga0070707_100025576 3300005468 Bacteria 5602
123 Ga0070707_100025730 3300005468 Bacteria 5586
124 Ga0070707_100029339 3300005468 Bacteria 5237
125 Ga0070707_100283942 3300005468 Bacteria 1608
126 Ga0070707_100893709 3300005468 Bacteria 853
127 Ga0070707_100903681 3300005468 Bacteria 848
128 Ga0070707_100995571 3300005468 Bacteria 803
129 Ga0070707_101817783 3300005468 Bacteria 577
130 Ga0070698_100022198 3300005471 Bacteria 6645
131 Ga0070698_100059875 3300005471 Bacteria 3844
132 Ga0070698_100125738 3300005471 Bacteria 2521
133 Ga0070698_100185460 3300005471 Bacteria 2018
134 Ga0070698_100347520 3300005471 Bacteria 1414
135 Ga0070698_100564784 3300005471 Bacteria 1077
136 Ga0070698_100993114 3300005471 Bacteria 786
137 Ga0070698_101180870 3300005471 Bacteria 714
138 Ga0070699_100001658 3300005518 Bacteria 20329
139 Ga0070699_100028934 3300005518 Bacteria 4777
140 Ga0070699_100044841 3300005518 Bacteria 3828
141 Ga0070699_100059853 3300005518 Bacteria 3299
142 Ga0070699_100061001 3300005518 Bacteria 3268
143 Ga0070699_100081601 3300005518 Bacteria 2819
144 Ga0070699_100157264 3300005518 Bacteria 2011
145 Ga0070699_100324945 3300005518 Bacteria 1383
146 Ga0070699_100422589 3300005518 Bacteria 1206
147 Ga0070699_100652637 3300005518 Bacteria 960
148 Ga0070699_100790087 3300005518 Bacteria 869
149 Ga0070679_100004937 3300005530 Bacteria 12304
150 Ga0070679_100016606 3300005530 Bacteria 7108
151 Ga0070679_100089107 3300005530 Bacteria 3072
152 Ga0070684_100073788 3300005535 Bacteria 3007
153 Ga0070684_100333616 3300005535 Bacteria 1394
154 Ga0070697_100011655 3300005536 Bacteria 6872
155 Ga0070697_100019710 3300005536 Bacteria 5328
156 Ga0070697_100038605 3300005536 Bacteria 3859
157 Ga0070697_100089835 3300005536 Bacteria 2538
158 Ga0070697_100199747 3300005536 Bacteria 1699
159 Ga0070697_100416448 3300005536 Bacteria 1167
160 Ga0070697_100613633 3300005536 Bacteria 956
161 Ga0070697_100781424 3300005536 Bacteria 844
162 Ga0070697_101012796 3300005536 Bacteria 738
163 Ga0070697_101232959 3300005536 Bacteria 667
164 Ga0068853_100006499 3300005539 Bacteria 9300
165 Ga0068853_100087028 3300005539 Bacteria 2741
166 Ga0068853_100087148 3300005539 Bacteria 2739
167 Ga0070672_100028832 3300005543 Bacteria 4156
168 Ga0070686_100044761 3300005544 Bacteria 2784
169 Ga0070686_100184465 3300005544 Bacteria 1485
170 Ga0070695_100009417 3300005545 Bacteria 5814
171 Ga0070695_100017089 3300005545 Bacteria 4400
172 Ga0070695_100034336 3300005545 Bacteria 3179
173 Ga0070695_100056895 3300005545 Bacteria 2525
174 Ga0070695_100201893 3300005545 Bacteria 1421
175 Ga0070696_100022061 3300005546 Bacteria 4323
176 Ga0070696_100057210 3300005546 Bacteria 2721
177 Ga0070696_100064605 3300005546 Bacteria 2564
178 Ga0070696_100226983 3300005546 Bacteria 1404
179 Ga0070696_100726646 3300005546 Bacteria 811
180 Ga0070696_101210041 3300005546 Bacteria 638
181 Ga0070693_100026618 3300005547 Bacteria 3125
182 Ga0070665_100014575 3300005548 Bacteria 7887
183 Ga0070704_100026371 3300005549 Bacteria 3838
184 Ga0070704_100107355 3300005549 Bacteria 2117
185 Ga0070704_100162908 3300005549 Bacteria 1765
186 Ga0070704_100309977 3300005549 Bacteria 1318
187 Ga0070704_100341202 3300005549 Bacteria 1261
188 Ga0068855_100001896 3300005563 Bacteria 25943
189 Ga0068855_100007165 3300005563 Bacteria 13531
190 Ga0068855_100113585 3300005563 Bacteria 3106
191 Ga0070664_100026879 3300005564 Bacteria 4779
192 Ga0070664_100075853 3300005564 Bacteria 2888
193 Ga0068857_100105265 3300005577 Bacteria 2533
194 Ga0068857_100407436 3300005577 Bacteria 1266
195 Ga0068854_100001054 3300005578 Bacteria 16563
196 Ga0068854_100030869 3300005578 Bacteria 3720
197 Ga0068854_100097465 3300005578 Bacteria 2198
198 Ga0068856_100005242 3300005614 Bacteria 12792
199 Ga0068856_100027892 3300005614 Bacteria 5508
200 Ga0070702_100366740 3300005615 Bacteria 1019
201 Ga0070702_101553703 3300005615 Bacteria 546
202 Ga0068852_100111503 3300005616 Bacteria 2488
203 Ga0068859_100036000 3300005617 Bacteria 4967
204 Ga0068859_101394601 3300005617 Bacteria 773
205 Ga0068864_100127936 3300005618 Bacteria 2278
206 Ga0068864_100192001 3300005618 Bacteria 1873
207 Ga0068866_10211135 3300005718 Bacteria 1165
208 Ga0068866_10259528 3300005718 Bacteria 1067
209 Ga0068866_10675558 3300005718 Bacteria 706
210 Ga0068866_10822894 3300005718 Bacteria 647
211 Ga0068861_100320151 3300005719 Bacteria 1350
212 Ga0068861_100643243 3300005719 Bacteria 979
213 Ga0068861_100844462 3300005719 Bacteria 863
214 Ga0068851_10351891 3300005834 Bacteria 857
215 Ga0068851_10903560 3300005834 Unclassified 553
216 Ga0068870_10000560 3300005840 Bacteria 14068
217 Ga0068863_100203801 3300005841 Bacteria 1903
218 Ga0068863_100697554 3300005841 Bacteria 1009
219 Ga0068863_102225254 3300005841 Bacteria 558
220 Ga0068860_100041055 3300005843 Bacteria 4420
221 Ga0068860_100117951 3300005843 Bacteria 2540
222 Ga0068860_100941110 3300005843 Bacteria 881
223 Ga0068860_101049066 3300005843 Bacteria 834
224 Ga0068862_100030715 3300005844 Bacteria 4529
225 Ga0068862_100035243 3300005844 Bacteria 4236
226 Ga0068862_100099431 3300005844 Bacteria 2543
227 Ga0068862_100328749 3300005844 Bacteria 1413
228 Ga0068862_100344728 3300005844 Bacteria 1381
229 Ga0068862_100569057 3300005844 Bacteria 1084
230 Ga0068862_100655095 3300005844 Unclassified 1013
231 Ga0068862_101070418 3300005844 Bacteria 800
232 Ga0081455_10000422 3300005937 Bacteria 55396
233 Ga0081455_10000593 3300005937 Bacteria 46922
234 Ga0081455_10522083 3300005937 Bacteria 792
235 Ga0081538_10108435 3300005981 Bacteria 1371
236 Ga0081538_10118681 3300005981 Bacteria 1277
237 Ga0081538_10229370 3300005981 Unclassified 727
238 Ga0070717_10006773 3300006028 Bacteria 8457
239 Ga0070717_10050855 3300006028 Bacteria 3408
240 Ga0075365_10076547 3300006038 Bacteria 2259
241 Ga0075368_10000628 3300006042 Bacteria 10684
242 Ga0075363_100006560 3300006048 Bacteria 5300
243 Ga0075364_10020188 3300006051 Bacteria 4190
244 Ga0075364_10034596 3300006051 Bacteria 3261
245 Ga0075432_10014107 3300006058 Bacteria 2720
246 Ga0070715_10059830 3300006163 Bacteria 1668
247 Ga0070716_100020860 3300006173 Bacteria 3445
248 Ga0070716_100383350 3300006173 Bacteria 1005
249 Ga0070712_100042578 3300006175 Bacteria 3123
250 Ga0070712_100410682 3300006175 Bacteria 1120
251 Ga0075362_10004474 3300006177 Bacteria 5031
252 Ga0075367_10022523 3300006178 Bacteria 3535
253 Ga0097621_100108966 3300006237 Bacteria 2339
254 Ga0075370_10407049 3300006353 Bacteria 816
255 Ga0075428_100060226 3300006844 Bacteria 4157
256 Ga0075428_100089266 3300006844 Bacteria 3362
257 Ga0075428_100186663 3300006844 Bacteria 2243
258 Ga0075428_100267778 3300006844 Bacteria 1839
259 Ga0075428_100887899 3300006844 Bacteria 946
260 Ga0075428_100963053 3300006844 Bacteria 904
261 Ga0075428_102077671 3300006844 Bacteria 588
262 Ga0075430_100007675 3300006846 Bacteria 9113
263 Ga0075430_100077838 3300006846 Unclassified 2780
264 Ga0075430_100405979 3300006846 Bacteria 1125
265 Ga0075430_100733428 3300006846 Bacteria 815
266 Ga0075431_100484440 3300006847 Bacteria 1229
267 Ga0075431_100588529 3300006847 Bacteria 1097
268 Ga0075431_101094382 3300006847 Bacteria 762
269 Ga0075433_10017695 3300006852 Bacteria 5911
270 Ga0075433_10018619 3300006852 Bacteria 5776
271 Ga0075433_10021817 3300006852 Bacteria 5373
272 Ga0075433_10024737 3300006852 Bacteria 5071
273 Ga0075433_10056582 3300006852 Bacteria 3426
274 Ga0075433_10060611 3300006852 Bacteria 3314
275 Ga0075433_10062480 3300006852 Bacteria 3261
276 Ga0075433_10113115 3300006852 Bacteria 2408
277 Ga0075433_10114150 3300006852 Bacteria 2396
278 Ga0075433_10155624 3300006852 Bacteria 2034
279 Ga0075433_10590300 3300006852 Bacteria 975
280 Ga0075433_11134216 3300006852 Bacteria 679
281 Ga0075434_100022907 3300006871 Bacteria 6080
282 Ga0075434_100038530 3300006871 Bacteria 4733
283 Ga0075434_100094064 3300006871 Bacteria 3001
284 Ga0075434_100117856 3300006871 Bacteria 2668
285 Ga0075434_100124157 3300006871 Bacteria 2598
286 Ga0075434_100147668 3300006871 Bacteria 2371
287 Ga0075434_100148722 3300006871 Bacteria 2362
288 Ga0075434_100164392 3300006871 Bacteria 2239
289 Ga0075434_100223768 3300006871 Bacteria 1901
290 Ga0075434_100252341 3300006871 Bacteria 1783
291 Ga0075434_100318488 3300006871 Bacteria 1576
292 Ga0075434_100381662 3300006871 Bacteria 1430
293 Ga0075434_100616538 3300006871 Bacteria 1104
294 Ga0075434_102629580 3300006871 Bacteria 503
295 Ga0075429_100029843 3300006880 Bacteria 4736
296 Ga0075429_100104105 3300006880 Bacteria 2479
297 Ga0075429_100224096 3300006880 Bacteria 1647
298 Ga0075429_100671777 3300006880 Bacteria 908
299 Ga0075429_100727861 3300006880 Bacteria 869
300 Ga0068865_100131177 3300006881 Bacteria 1878
301 Ga0075436_100007112 3300006914 Bacteria 7661
302 Ga0075436_100217103 3300006914 Bacteria 1356
303 Ga0075436_100265146 3300006914 Bacteria 1225
304 Ga0075436_100493487 3300006914 Bacteria 895
305 Ga0075436_100637462 3300006914 Bacteria 787
306 Ga0097620_100036001 3300006931 Bacteria 4967
307 Ga0097620_101394716 3300006931 Bacteria 773
308 Ga0075435_100075797 3300007076 Bacteria 2755
309 Ga0075435_100087753 3300007076 Bacteria 2563
310 Ga0075435_100093058 3300007076 Bacteria 2490
311 Ga0075435_100096506 3300007076 Bacteria 2445
312 Ga0075435_100142357 3300007076 Bacteria 2012
313 Ga0075435_100281887 3300007076 Bacteria 1419
314 Ga0075435_100290647 3300007076 Bacteria 1396
315 Ga0075435_100999107 3300007076 Bacteria 730
316 Ga0099794_10011851 3300007265 Bacteria 3746
317 Ga0099794_10019102 3300007265 Bacteria 3082
318 Ga0099794_10098701 3300007265 Bacteria 1456
319 Ga0105240_10013491 3300009093 Bacteria 11221
320 Ga0105240_10279710 3300009093 Bacteria 1917
321 Ga0111539_10027897 3300009094 Bacteria 6894
322 Ga0111539_10105606 3300009094 Bacteria 3304
323 Ga0111539_10230737 3300009094 Bacteria 2155
324 Ga0111539_10312872 3300009094 Bacteria 1828
325 Ga0111539_10614897 3300009094 Bacteria 1265
326 Ga0111539_13073616 3300009094 Bacteria 539
327 Ga0105245_10511316 3300009098 Bacteria 1218
328 Ga0114129_10000332 3300009147 Bacteria 55123
329 Ga0114129_10012121 3300009147 Bacteria 12271
330 Ga0114129_10018448 3300009147 Bacteria 9939
331 Ga0114129_10033317 3300009147 Bacteria 7280
332 Ga0114129_10038278 3300009147 Bacteria 6767
333 Ga0114129_10083626 3300009147 Bacteria 4433
334 Ga0114129_10088887 3300009147 Bacteria 4283
335 Ga0114129_10092421 3300009147 Bacteria 4192
336 Ga0114129_10096608 3300009147 Bacteria 4090
337 Ga0114129_10120830 3300009147 Bacteria 3607
338 Ga0114129_10348740 3300009147 Bacteria 1962
339 Ga0114129_10596189 3300009147 Unclassified 1432
340 Ga0114129_10613347 3300009147 Bacteria 1408
341 Ga0114129_10964271 3300009147 Bacteria 1076
342 Ga0114129_10996431 3300009147 Bacteria 1055
343 Ga0114129_11457439 3300009147 Bacteria 843
344 Ga0114129_12677009 3300009147 Bacteria 594
345 Ga0105241_10015599 3300009174 Bacteria 5567
346 Ga0105241_10026668 3300009174 Bacteria 4300
347 Ga0105241_10095784 3300009174 Bacteria 2350
348 Ga0105241_10198585 3300009174 Bacteria 1674
349 Ga0105242_10007188 3300009176 Bacteria 8588
350 Ga0105242_10375839 3300009176 Bacteria 1319
351 Ga0105242_11246650 3300009176 Bacteria 765
352 Ga0105248_10155109 3300009177 Bacteria 2584
353 Ga0105237_10032956 3300009545 Bacteria 5247
354 Ga0105237_10213118 3300009545 Bacteria 1931
355 Ga0105237_11502531 3300009545 Bacteria 680
356 Ga0105238_10011691 3300009551 Bacteria 8848
357 Ga0105249_10046335 3300009553 Bacteria 3957
358 Ga0105249_10391456 3300009553 Bacteria 1418
359 Ga0105249_10402094 3300009553 Bacteria 1400
360 Ga0105249_11208125 3300009553 Bacteria 827
361 Ga0130087_1037661 3300009828 Bacteria 1851
362 Ga0130086_1061563 3300009829 Bacteria 1851
363 Ga0130084_1089025 3300009835 Bacteria 1851
364 Ga0130085_1093847 3300009850 Bacteria 1851
365 Ga0099796_10060909 3300010159 Bacteria 1337
366 Ga0105239_10035504 3300010375 Bacteria 5475
367 Ga0105239_10526018 3300010375 Bacteria 1346
368 Ga0105246_10111381 3300011119 Bacteria 2011
369 Ga0157344_1020624 3300012476 Bacteria 565
370 Ga0157325_1022198 3300012485 Bacteria 576
371 Ga0157335_1028401 3300012492 Bacteria 574
372 Ga0157323_1017379 3300012495 Bacteria 649
373 Ga0157324_1012128 3300012506 Bacteria 759
374 Ga0157342_1054614 3300012507 Unclassified 571
375 Ga0157326_1018345 3300012513 Bacteria 844
376 Ga0157338_1004775 3300012515 Bacteria 1189
377 Ga0157373_10005841 3300013100 Bacteria 9211
378 Ga0157371_10042131 3300013102 Bacteria 3255
379 Ga0157371_10089175 3300013102 Bacteria 2184
380 Ga0157371_10161973 3300013102 Bacteria 1598
381 Ga0157369_10008047 3300013105 Bacteria 12091
382 Ga0157369_10772690 3300013105 Bacteria 988
383 Ga0157374_10036959 3300013296 Bacteria 4477
384 Ga0157374_10378726 3300013296 Bacteria 1409
385 Ga0157378_10061572 3300013297 Bacteria 3350
386 Ga0157378_10114670 3300013297 Bacteria 2475
387 Ga0157378_10136219 3300013297 Bacteria 2277
388 Ga0163162_10003246 3300013306 Bacteria 15546
389 Ga0163162_10169870 3300013306 Bacteria 2305
390 Ga0163162_10568193 3300013306 Bacteria 1261
391 Ga0157372_10032105 3300013307 Bacteria 5755
392 Ga0157372_10051875 3300013307 Bacteria 4566
393 Ga0157372_10105080 3300013307 Bacteria 3230
394 Ga0157375_10230765 3300013308 Bacteria 2010
395 Ga0157375_10695812 3300013308 Bacteria 1170
396 Ga0157375_11936793 3300013308 Bacteria 700
397 Ga0163163_10105359 3300014325 Bacteria 2845
398 Ga0163163_10413802 3300014325 Bacteria 1407
399 Ga0157380_10140720 3300014326 Bacteria 2073
400 Ga0182008_10046380 3300014497 Bacteria 2160
401 Ga0157377_10043351 3300014745 Bacteria 2504
402 Ga0157379_10104217 3300014968 Bacteria 2546
403 Ga0182007_10031324 3300015262 Bacteria 1813
404 Ga0163161_10322384 3300017792 Bacteria 1222
405 Ga0163161_11208186 3300017792 Bacteria 654
406 Ga0197907_10423327 3300020069 Bacteria 8039
407 Ga0206356_11641698 3300020070 Bacteria 4268
408 Ga0206349_1043118 3300020075 Bacteria 5525
409 Ga0206351_10245893 3300020077 Bacteria 1641
410 Ga0206352_10098864 3300020078 Bacteria 10133
411 Ga0206352_10572215 3300020078 Bacteria 947
412 Ga0206350_10135750 3300020080 Bacteria 8772
413 Ga0206350_10807924 3300020080 Bacteria 9631
414 Ga0206350_10990574 3300020080 Bacteria 1256
415 Ga0206354_11101861 3300020081 Bacteria 3294
416 Ga0206353_10116078 3300020082 Bacteria 1728
417 Ga0206353_11451431 3300020082 Bacteria 2976
418 Ga0213873_10019956 3300021358 Bacteria 1560
419 Ga0213874_10000323 3300021377 Bacteria 9496
420 Ga0213874_10003847 3300021377 Bacteria 3372
421 Ga0213874_10046400 3300021377 Bacteria 1318
422 Ga0213874_10121035 3300021377 Unclassified 889
423 Ga0213876_10580714 3300021384 Bacteria 596
424 Ga0213875_10126435 3300021388 Bacteria 1195
425 Ga0224712_10000464 3300022467 Bacteria 8141
426 Ga0207673_1011793 3300025290 Bacteria 1134
427 Ga0207697_10012509 3300025315 Bacteria 3557
428 Ga0207653_10014980 3300025885 Bacteria 2433
429 Ga0207682_10053442 3300025893 Bacteria 1675
430 Ga0207642_10832707 3300025899 Bacteria 588
431 Ga0207688_10003716 3300025901 Bacteria 8326
432 Ga0207680_10075580 3300025903 Bacteria 2101
433 Ga0207647_10000592 3300025904 Bacteria 28197
434 Ga0207645_10000293 3300025907 Bacteria 42010
435 Ga0207705_10051409 3300025909 Bacteria 2966
436 Ga0207705_10241576 3300025909 Bacteria 1376
437 Ga0207684_10005489 3300025910 Bacteria 11682
438 Ga0207684_10009118 3300025910 Bacteria 8788
439 Ga0207684_10044353 3300025910 Bacteria 3770
440 Ga0207684_10288904 3300025910 Bacteria 1414
441 Ga0207684_10853660 3300025910 Bacteria 767
442 Ga0207684_11704063 3300025910 Bacteria 508
443 Ga0207654_10003542 3300025911 Bacteria 7895
444 Ga0207707_10007464 3300025912 Bacteria 9524
445 Ga0207695_10000465 3300025913 Bacteria 87928
446 Ga0207671_10000128 3300025914 Bacteria 117836
447 Ga0207671_10228302 3300025914 Bacteria 1460
448 Ga0207660_10841083 3300025917 Bacteria 749
449 Ga0207662_10002551 3300025918 Bacteria 9170
450 Ga0207662_10096517 3300025918 Bacteria 1826
451 Ga0207657_10003227 3300025919 Bacteria 17452
452 Ga0207657_10972439 3300025919 Unclassified 652
453 Ga0207649_10338795 3300025920 Unclassified 1110
454 Ga0207652_10012934 3300025921 Bacteria 6752
455 Ga0207652_10036233 3300025921 Bacteria 4171
456 Ga0207646_10000786 3300025922 Bacteria 41153
457 Ga0207646_10001781 3300025922 Bacteria 26103
458 Ga0207646_10034220 3300025922 Bacteria 4593
459 Ga0207646_10079582 3300025922 Bacteria 2930
460 Ga0207681_11352127 3300025923 Bacteria 598
461 Ga0207681_11784840 3300025923 Bacteria 513
462 Ga0207694_10001095 3300025924 Bacteria 23479
463 Ga0207650_10001868 3300025925 Bacteria 14865
464 Ga0207650_11576339 3300025925 Bacteria 558
465 Ga0207659_10025522 3300025926 Bacteria 3973
466 Ga0207659_11400703 3300025926 Bacteria 599
467 Ga0207687_10172772 3300025927 Bacteria 1668
468 Ga0207700_10132683 3300025928 Bacteria 2036
469 Ga0207644_10069948 3300025931 Bacteria 2564
470 Ga0207690_10032826 3300025932 Bacteria 3333
471 Ga0207706_10004744 3300025933 Bacteria 12728
472 Ga0207706_10108014 3300025933 Bacteria 2449
473 Ga0207706_10200373 3300025933 Bacteria 1751
474 Ga0207686_10576649 3300025934 Bacteria 882
475 Ga0207670_10036647 3300025936 Bacteria 3191
476 Ga0207670_10046472 3300025936 Bacteria 2885
477 Ga0207669_10233261 3300025937 Bacteria 1359
478 Ga0207669_10550441 3300025937 Bacteria 931
479 Ga0207665_10068859 3300025939 Bacteria 2412
480 Ga0207691_10019557 3300025940 Bacteria 6407
481 Ga0207689_11822028 3300025942 Bacteria 502
482 Ga0207679_10065325 3300025945 Bacteria 2722
483 Ga0207679_10118721 3300025945 Bacteria 2101
484 Ga0207667_10018880 3300025949 Bacteria 7714
485 Ga0207712_10279970 3300025961 Bacteria 1361
486 Ga0207712_10331856 3300025961 Bacteria 1258
487 Ga0207712_10361829 3300025961 Bacteria 1209
488 Ga0207668_10093022 3300025972 Bacteria 2221
489 Ga0207668_10131961 3300025972 Bacteria 1909
490 Ga0207668_11523910 3300025972 Bacteria 603
491 Ga0207640_10005139 3300025981 Bacteria 7115
492 Ga0207640_10170000 3300025981 Bacteria 1623
493 Ga0207703_10712630 3300026035 Bacteria 955
494 Ga0207639_10106089 3300026041 Bacteria 2280
495 Ga0207639_11845219 3300026041 Bacteria 565
496 Ga0207678_10003112 3300026067 Bacteria 15020
497 Ga0207678_10009868 3300026067 Bacteria 8384
498 Ga0207678_10739493 3300026067 Bacteria 867
499 Ga0207708_10045254 3300026075 Bacteria 3354
500 Ga0207708_10376098 3300026075 Bacteria 1170
501 Ga0207708_10464546 3300026075 Bacteria 1056
502 Ga0207702_10762386 3300026078 Bacteria 955
503 Ga0207641_10244102 3300026088 Bacteria 1675
504 Ga0207648_10123082 3300026089 Bacteria 2281
505 Ga0207676_10196523 3300026095 Bacteria 1779
506 Ga0207675_100199744 3300026118 Bacteria 1920
507 Ga0207675_100440310 3300026118 Bacteria 1290
508 Ga0207683_10001743 3300026121 Bacteria 19330
509 Ga0207683_12047413 3300026121 Bacteria 521
510 Ga0209981_1038107 3300027378 Bacteria 715
511 Ga0209983_1003492 3300027665 Bacteria 3356
512 Ga0209983_1006870 3300027665 Bacteria 2334
513 Ga0209588_1038058 3300027671 Bacteria 1549
514 Ga0209588_1121563 3300027671 Bacteria 835
515 Ga0209971_1009932 3300027682 Bacteria 2252
516 Ga0209971_1072036 3300027682 Bacteria 839
517 Ga0209966_1151314 3300027695 Bacteria 540
518 Ga0209998_10002417 3300027717 Bacteria 4292
519 Ga0209813_10000415 3300027866 Bacteria 10405
520 Ga0209974_10003939 3300027876 Bacteria 5311
521 Ga0207428_10000068 3300027907 Bacteria 150215
522 Ga0207428_10194497 3300027907 Bacteria 1528
523 Ga0268266_10825719 3300028379 Bacteria 895
524 Ga0268265_10253641 3300028380 Bacteria 1560
525 Ga0268264_10654972 3300028381 Bacteria 1040
526 Ga0268264_10922550 3300028381 Bacteria 877
527 Ga0268264_11249129 3300028381 Bacteria 753
528 Ga0265324_10042712 3300029957 Bacteria 1567
529 Ga0307511_10003345 3300030521 Bacteria 16496
530 Ga0316177_1091689 3300030731 Bacteria 2192
531 Ga0314311_1078775 3300030733 Bacteria 874
532 Ga0316178_1107985 3300030735 Bacteria 1349
533 Ga0316578_10244233 3300031728 Bacteria 1078
534 Ga0316578_10435536 3300031728 Bacteria 775
535 Ga0307405_12111220 3300031731 Bacteria 506
536 Ga0307413_10002818 3300031824 Bacteria 7169
537 Ga0307413_10205070 3300031824 Bacteria 1427
538 Ga0307410_10097576 3300031852 Bacteria 2100
539 Ga0307410_10127796 3300031852 Bacteria 1863
540 Ga0307406_10140280 3300031901 Unclassified 1710
541 Ga0307406_12022765 3300031901 Bacteria 515
542 Ga0307407_10142036 3300031903 Unclassified 1550
543 Ga0307412_10136954 3300031911 Unclassified 1788
544 Ga0307412_11360844 3300031911 Unclassified 641
545 Ga0307409_100002679 3300031995 Bacteria 9377
546 Ga0307409_100090744 3300031995 Bacteria 2502
547 Ga0307416_100000471 3300032002 Bacteria 20537
548 Ga0307416_100038656 3300032002 Bacteria 3684
549 Ga0307414_10005074 3300032004 Bacteria 7217
550 Ga0307411_10002706 3300032005 Bacteria 7950
551 Ga0307415_100004157 3300032126 Bacteria 7467
552 Ga0307415_102120150 3300032126 Bacteria 549
553 Ga0307507_10052430 3300033179 Bacteria 3910
554 Ga0316588_1072917 3300033528 Unclassified 844
555 Ga0316596_1039385 3300033541 Bacteria 1240
556 Ga0316596_1163892 3300033541 Bacteria 613
557 Ga0373948_0024351 3300034817 Bacteria 1180
558 Ga0373938_0047834 3300034957 Bacteria 969
559 Ga0373928_0142948 3300035084 Bacteria 657
560 Ga0373932_0072454 3300035112 Bacteria 1071
561 Ga0373932_0427942 3300035112 Bacteria 516
562 Ga0373939_0116801 3300035114 Bacteria 936
563 Ga0373941_0419705 3300035115 Bacteria 556
564 Ga0373945_0006383 3300035116 Bacteria 3804
565 Ga0373954_0193492 3300035118 Bacteria 999
566 Ga0373961_0361979 3300035241 Bacteria 549
567 Ga0373931_0021528 3300035691 Bacteria 3236
568 Ga0373931_0050621 3300035691 Bacteria 2210
569 Ga0373935_0293848 3300035692 Bacteria 1147
570 Ga0373927_0055132 3300035695 Bacteria 2571
571 Ga0373933_0001006 3300035724 Bacteria 17157
572 Ga0373947_0001183 3300035725 Bacteria 16055
573 Ga0373937_0186578 3300036401 Bacteria 1948
574 Ga0373937_0392666 3300036401 Bacteria 1316
575 Ga0373937_1773482 3300036401 Bacteria 564
576 Ga0316584_0163094 3300036712 Bacteria 1655
577 Ga0373925_0005242 3300037068 Bacteria 9685
578 Ga0373925_0209487 3300037068 Bacteria 1553
579 Ga0436364_0080211 3300037853 Bacteria 5130
580 Ga0436364_0237548 3300037853 Bacteria 1265
581 Ga0436364_0450520 3300037853 Bacteria 1270
582 Ga0436364_1343927 3300037853 Bacteria 509
583 Ga0395901_0473766 3300038443 Bacteria 1278
584 Ga0400483_013664 3300039062 Bacteria 1215
585 Ga0400489_40187 3300039093 Bacteria 1119
586 Ga0436365_0176958 3300039437 Bacteria 3532
587 Ga0436365_1040651 3300039437 Bacteria 586
588 Ga0436365_1589039 3300039437 Unclassified 750
589 Ga0436365_1657161 3300039437 Bacteria 682
590 Ga0436363_0152484 3300039450 Bacteria 2327
591 Ga0436363_0627696 3300039450 Bacteria 32730
592 Ga0436363_0914349 3300039450 Bacteria 31901
593 Ga0436363_1187018 3300039450 Bacteria 4362
594 Ga0436362_1256068 3300039453 Bacteria 5446
595 Ga0439461_0161345 3300041410 Bacteria 584
596 Ga0451787_215061 3300041441 Bacteria 551
597 Ga0451800_0304442 3300041459 Bacteria 595
598 Ga0451802_0282335 3300041460 Bacteria 631
599 Ga0451807_1309538 3300041486 Unclassified 856
600 Ga0439448_0035252 3300042005 Bacteria 1602
601 Ga0439446_0320950 3300042156 Bacteria 547
602 Ga0439444_0012469 3300042437 Bacteria 1394
603 Ga0439464_0005101 3300042439 Bacteria 3381
604 Ga0439460_0001173 3300042461 Bacteria 6149
605 Ga0451577_0011827 3300042876 Bacteria 8233
606 Ga0451577_0064625 3300042876 Bacteria 3263
607 Ga0451577_0088710 3300042876 Bacteria 2759
608 Ga0451577_0237299 3300042876 Bacteria 1649
609 Ga0466969_0013784 3300044656 Bacteria 4257
610 Ga0466969_0015778 3300044656 Bacteria 3959
611 Ga0466969_0137322 3300044656 Bacteria 1131
612 Ga0466969_0254664 3300044656 Bacteria 795
613 Ga0466969_0515827 3300044656 Bacteria 546
614 Ga0466972_0019729 3300044658 Bacteria 3371
615 Ga0466972_0056639 3300044658 Bacteria 1884
616 Ga0466972_0156043 3300044658 Bacteria 1072
617 Ga0453683_0146308 3300044673 Bacteria 1492
618 Ga0453683_0606966 3300044673 Bacteria 714
619 Ga0466965_0031416 3300044683 Bacteria 2590
620 Ga0466965_0057112 3300044683 Bacteria 1944
621 Ga0466966_0003293 3300044684 Bacteria 10654
622 Ga0466966_0003798 3300044684 Bacteria 9961
623 Ga0466966_0059786 3300044684 Bacteria 2406
624 Ga0466961_0005574 3300044693 Bacteria 7949
625 Ga0466961_0008523 3300044693 Bacteria 6531
626 Ga0466961_0108948 3300044693 Bacteria 1743
627 Ga0466961_0875473 3300044693 Bacteria 535
628 Ga0466963_0092476 3300044694 Bacteria 2061
629 Ga0466964_0002987 3300044706 Bacteria 6123
630 Ga0453684_0000194 3300044712 Bacteria 265783
631 Ga0453684_0177284 3300044712 Bacteria 2505
632 Ga0453684_0241237 3300044712 Bacteria 2080
633 Ga0453684_0547324 3300044712 Bacteria 1275
634 Ga0466971_0033817 3300044719 Bacteria 2290
635 Ga0466971_0431876 3300044719 Bacteria 644
636 Ga0466968_0000316 3300044735 Bacteria 15514
637 Ga0466970_0000729 3300044765 Bacteria 16009
638 Ga0466970_0144318 3300044765 Bacteria 1312
639 Ga0466960_0034605 3300044901 Bacteria 2355
640 Ga0466959_0027826 3300045049 Bacteria 4193
641 Ga0466959_0039400 3300045049 Bacteria 3492
642 Ga0466959_0084659 3300045049 Bacteria 2282
643 Ga0466959_0091095 3300045049 Bacteria 2189
644 Ga0451576_0026896 3300045051 Bacteria 6182
645 Ga0451576_0145759 3300045051 Bacteria 2468
646 Ga0451576_0150576 3300045051 Bacteria 2426
647 Ga0451576_0589685 3300045051 Bacteria 1168
648 Ga0466958_0004601 3300045836 Bacteria 7306
649 Ga0495580_0000625 3300046472 Bacteria 29936
650 Ga0495580_0122321 3300046472 Bacteria 1806
651 Ga0495594_0285517 3300046499 Bacteria 940
652 Ga0495630_1265070 3300046517 Bacteria 557
653 Ga0495644_0330032 3300046523 Bacteria 599
654 Ga0495586_0228960 3300046535 Bacteria 1057
655 Ga0495656_0165044 3300046615 Bacteria 1079
656 Ga0495659_0051871 3300046664 Bacteria 1495
657 Ga0495659_0158000 3300046664 Bacteria 914
658 Ga0495646_0598496 3300046680 Bacteria 560
659 Ga0495669_0665991 3300046684 Bacteria 506
660 Ga0495674_1079030 3300047319 Bacteria 612
661 Ga0495676_0153668 3300047321 Bacteria 1635
662 Ga0496102_0248948 3300048905 Bacteria 1675
663 Ga0496102_1076243 3300048905 Bacteria 724
664 Ga0496103_0095521 3300048906 Bacteria 1878
665 Ga0496103_0119549 3300048906 Bacteria 1678
666 Ga0496106_0335288 3300048909 Bacteria 1214
667 Ga0496107_0353737 3300048910 Bacteria 1093
668 Ga0496107_0437697 3300048910 Unclassified 972
669 Ga0496108_0013667 3300048911 Bacteria 6628
670 Ga0496109_0350921 3300048912 Bacteria 1394
671 Ga0496112_0038880 3300048915 Bacteria 4648
672 Ga0496112_0646460 3300048915 Bacteria 987
673 Ga0496113_0051398 3300048916 Bacteria 3076
674 Ga0501297_078282 3300049520 Unclassified 532
675 Ga0501031_0016759 3300049568 Bacteria 4760
676 Ga0501031_0156886 3300049568 Bacteria 1487
677 Ga0501032_0300458 3300049569 Bacteria 1038
678 Ga0501032_0374312 3300049569 Bacteria 916
679 Ga0501033_0048211 3300049570 Bacteria 3164
680 Ga0501034_0276742 3300049571 Bacteria 1618
681 Ga0501036_0010433 3300049572 Bacteria 7671
682 Ga0501036_0014629 3300049572 Bacteria 6537
683 Ga0501036_0046456 3300049572 Bacteria 3677
684 Ga0501036_0077625 3300049572 Bacteria 2810
685 Ga0501036_0129039 3300049572 Bacteria 2135
686 Ga0501036_0193766 3300049572 Bacteria 1710
687 Ga0501037_0021847 3300049573 Bacteria 4736
688 Ga0501037_0038187 3300049573 Bacteria 3539
689 Ga0501037_0121232 3300049573 Bacteria 1880
690 Ga0501037_0464331 3300049573 Bacteria 862
691 Ga0501038_0000271 3300049574 Bacteria 43706
692 Ga0501038_0012309 3300049574 Bacteria 7815
693 Ga0501038_0079413 3300049574 Bacteria 2767
694 Ga0501038_0123524 3300049574 Bacteria 2132
695 Ga0501038_0770181 3300049574 Bacteria 717
696 Ga0501039_0000761 3300049575 Bacteria 23187
697 Ga0501039_0001941 3300049575 Bacteria 15319
698 Ga0501039_0052316 3300049575 Bacteria 3160
699 Ga0501039_0674338 3300049575 Bacteria 809
700 Ga0501040_0000010 3300049576 Bacteria 80841
701 Ga0501040_0009549 3300049576 Bacteria 6329
702 Ga0501040_0029576 3300049576 Bacteria 3699
703 Ga0501040_0031354 3300049576 Bacteria 3592
704 Ga0501040_0032356 3300049576 Bacteria 3539
705 Ga0501041_0000002 3300049577 Bacteria 84985
706 Ga0501041_0004888 3300049577 Bacteria 7788
707 Ga0501042_0001370 3300049578 Bacteria 14294
708 Ga0501042_0025436 3300049578 Bacteria 4158
709 Ga0501042_0128236 3300049578 Bacteria 1827
710 Ga0501042_0177475 3300049578 Bacteria 1536
711 Ga0501043_0112169 3300049579 Bacteria 2141
712 Ga0501043_0390356 3300049579 Bacteria 1053
713 Ga0501046_0004431 3300049580 Bacteria 12744
714 Ga0501046_0015004 3300049580 Bacteria 6517
715 Ga0501046_0058614 3300049580 Bacteria 3018
716 Ga0501046_0428428 3300049580 Bacteria 953
717 Ga0501047_0039848 3300049581 Bacteria 4544
718 Ga0501048_0003955 3300049582 Bacteria 11260
719 Ga0501048_0007054 3300049582 Bacteria 8535
720 Ga0501048_0030209 3300049582 Bacteria 3921
721 Ga0501048_0381707 3300049582 Bacteria 1006
722 Ga0501068_0007581 3300049584 Bacteria 6008
723 Ga0501068_0025641 3300049584 Bacteria 3469
724 Ga0501070_0145659 3300049586 Bacteria 1955
725 Ga0501070_0217106 3300049586 Bacteria 1569
726 Ga0501071_0001030 3300049587 Bacteria 15403
727 Ga0501071_0001156 3300049587 Bacteria 14785
728 Ga0501071_0326195 3300049587 Bacteria 1166
729 Ga0501071_0470554 3300049587 Bacteria 963
730 Ga0501072_0000128 3300049588 Bacteria 56185
731 Ga0501072_0002940 3300049588 Bacteria 12815
732 Ga0501072_0044284 3300049588 Bacteria 3499
733 Ga0501072_0520639 3300049588 Bacteria 940
734 Ga0501072_0657687 3300049588 Bacteria 825
735 Ga0501072_0855089 3300049588 Bacteria 711
736 Ga0501072_1224648 3300049588 Bacteria 583
737 Ga0501073_0073936 3300049589 Bacteria 2373
738 Ga0501073_0207532 3300049589 Bacteria 1354
739 Ga0501073_0337266 3300049589 Bacteria 1041
740 Ga0501074_0006457 3300049590 Bacteria 8469
741 Ga0501074_0008383 3300049590 Bacteria 7492
742 Ga0501074_0106685 3300049590 Bacteria 2005
743 Ga0501074_0354819 3300049590 Bacteria 1041
744 Ga0501075_0000148 3300049591 Bacteria 34965
745 Ga0501075_0005474 3300049591 Bacteria 8683
746 Ga0501075_0005748 3300049591 Bacteria 8485
747 Ga0501075_0059441 3300049591 Bacteria 2879
748 Ga0501075_0391450 3300049591 Bacteria 1059
749 Ga0501076_0000022 3300049592 Bacteria 83199
750 Ga0501076_0001365 3300049592 Bacteria 16357
751 Ga0501076_0005550 3300049592 Bacteria 9086
752 Ga0501076_0015980 3300049592 Bacteria 5681
753 Ga0501076_0039704 3300049592 Bacteria 3696
754 Ga0501076_0155084 3300049592 Bacteria 1864
755 Ga0501076_0375265 3300049592 Bacteria 1169
756 Ga0501076_0524163 3300049592 Bacteria 977
757 Ga0501076_1650803 3300049592 Bacteria 526
758 Ga0501077_0000017 3300049593 Bacteria 86892
759 Ga0501077_0001274 3300049593 Bacteria 15221
760 Ga0501077_0046294 3300049593 Bacteria 2764
761 Ga0501209_008517 3300049656 Unclassified 2026
762 Ga0501216_043019 3300049660 Bacteria 869
763 Ga0501217_017925 3300049661 Bacteria 1637
764 Ga0501230_091509 3300049667 Bacteria 647
765 Ga0501257_032364 3300049686 Bacteria 1265
766 Ga0501259_040891 3300049688 Bacteria 911
767 Ga0501261_090541 3300049690 Bacteria 568
768 Ga0501234_008003 3300049707 Bacteria 1652
769 Ga0501079_0000549 3300049741 Bacteria 24511
770 Ga0501079_0001854 3300049741 Bacteria 15152
771 Ga0501079_0026321 3300049741 Bacteria 4461
772 Ga0501079_0065396 3300049741 Bacteria 2805
773 Ga0501079_0350360 3300049741 Bacteria 1157
774 Ga0501079_0580567 3300049741 Bacteria 882
775 Ga0501079_0750329 3300049741 Bacteria 768
776 Ga0501080_0057156 3300049742 Bacteria 3633
777 Ga0501080_0069952 3300049742 Bacteria 3264
778 Ga0501080_0318672 3300049742 Bacteria 1408
779 Ga0501080_1400736 3300049742 Bacteria 596
780 Ga0501081_0000105 3300049743 Bacteria 35434
781 Ga0501081_0012557 3300049743 Bacteria 5569
782 Ga0501081_0328350 3300049743 Bacteria 1125
783 Ga0501081_1153329 3300049743 Bacteria 587
784 Ga0501083_0056836 3300049744 Bacteria 2621
785 Ga0501083_0174381 3300049744 Bacteria 1405
786 Ga0501083_0993345 3300049744 Bacteria 546
787 Ga0501035_0036548 3300049822 Bacteria 4451
788 Ga0501035_0157005 3300049822 Bacteria 1971
789 Ga0501035_0166057 3300049822 Bacteria 1909
790 Ga0501044_0211312 3300049823 Bacteria 1894
791 Ga0501044_0549629 3300049823 Bacteria 1052
792 Ga0501045_0000113 3300049824 Bacteria 40870
793 Ga0501045_0001571 3300049824 Bacteria 15223
794 Ga0501045_0020734 3300049824 Bacteria 4697
795 Ga0501045_0062060 3300049824 Bacteria 2742
796 Ga0501045_0636848 3300049824 Bacteria 788
797 nmdc:mga03683_15356_c1 3300050489 Bacteria 2857
798 nmdc:mga03n38_13253_c1 3300050490 Bacteria 3126
799 nmdc:mga00v17_72300_c1 3300050491 Bacteria 2140
800 nmdc:mga0yw44_268646_c1 3300050492 Bacteria 1138
801 nmdc:mga0yw44_65569_c1 3300050492 Bacteria 2239
802 nmdc:mga0yw44_967215_c1 3300050492 Bacteria 577
803 nmdc:mga0k408_48373_c1 3300050493 Bacteria 2460
804 nmdc:mga06z11_13908_c2 3300050494 Bacteria 3288
805 nmdc:mga04h51_5501_c1 3300050495 Bacteria 3234
806 nmdc:mga07m45_16967_c1 3300050496 Bacteria 3904
807 nmdc:mga05p37_1268_c1 3300050507 Bacteria 29301
808 nmdc:mga05p37_138484_c1 3300050507 Bacteria 2983
809 nmdc:mga05p37_154731_c1 3300050507 Bacteria 2803
810 nmdc:mga05p37_16963_c1 3300050507 Bacteria 8784
811 nmdc:mga05p37_2150_c1 3300050507 Bacteria 23008
812 nmdc:mga05p37_32073_c1 3300050507 Bacteria 6424
813 nmdc:mga05p37_35685_c1 3300050507 Bacteria 6098
814 nmdc:mga05p37_489060_c1 3300050507 Unclassified 1415
815 nmdc:mga05p37_7463_c1 3300050507 Bacteria 12893
816 nmdc:mga05p37_75391_c1 3300050507 Bacteria 4152
817 nmdc:mga05p37_79745_c1 3300050507 Bacteria 3490
818 nmdc:mga05p37_845470_c1 3300050507 Unclassified 995
819 nmdc:mga09592_183884_c1 3300050508 Bacteria 1808
820 nmdc:mga09592_46354_c1 3300050508 Bacteria 3662
821 nmdc:mga09592_868082_c1 3300050508 Bacteria 760
822 nmdc:mga0qj67_129955_c1 3300050509 Bacteria 2040
823 nmdc:mga0qj67_1439946_c1 3300050509 Bacteria 531
824 nmdc:mga0qj67_3143_c1 3300050509 Bacteria 11892
825 nmdc:mga0qj67_66768_c1 3300050509 Unclassified 2865
826 nmdc:mga06r32_151446_c1 3300050510 Bacteria 2298
827 nmdc:mga06r32_172415_c1 3300050510 Bacteria 2147
828 nmdc:mga06r32_486248_c1 3300050510 Bacteria 1212
829 nmdc:mga06r32_693636_c1 3300050510 Unclassified 984
830 nmdc:mga06r32_739423_c1 3300050510 Bacteria 947
831 nmdc:mga06r32_9393_c1 3300050510 Bacteria 8820
832 nmdc:mga08y16_1940634_c1 3300050511 Bacteria 539
833 nmdc:mga08y16_267786_c1 3300050511 Bacteria 1764
834 nmdc:mga08y16_460604_c1 3300050511 Bacteria 1296
835 nmdc:mga08y16_716_c1 3300050511 Bacteria 31529
836 nmdc:mga0n895_145290_c1 3300050512 Bacteria 2401
837 nmdc:mga0n895_289269_c1 3300050512 Bacteria 1661
838 nmdc:mga0n895_37094_c1 3300050512 Bacteria 4713
839 nmdc:mga0n895_39478_c1 3300050512 Bacteria 4580
840 nmdc:mga0n895_519580_c1 3300050512 Bacteria 1198
841 nmdc:mga0n895_536223_c1 3300050512 Bacteria 1177
842 nmdc:mga0n895_57672_c1 3300050512 Bacteria 3828
843 nmdc:mga0n895_59174_c1 3300050512 Bacteria 3781
844 nmdc:mga0n895_83903_c1 3300050512 Bacteria 3179
845 nmdc:mga0rr50_1145496_c1 3300050513 Bacteria 661
846 nmdc:mga0rr50_1669784_c1 3300050513 Unclassified 537
847 nmdc:mga0rr50_243308_c1 3300050513 Bacteria 1492
848 nmdc:mga0rr50_268600_c1 3300050513 Bacteria 1421
849 nmdc:mga0rr50_3579_c1 3300050513 Bacteria 8977
850 nmdc:mga0rr50_405511_c1 3300050513 Bacteria 1152
851 nmdc:mga0rr50_526821_c1 3300050513 Bacteria 1006
852 nmdc:mga08x19_149073_c1 3300050514 Bacteria 1583
853 nmdc:mga0a205_130575_c1 3300050515 Bacteria 2413
854 nmdc:mga0a205_144037_c1 3300050515 Bacteria 2283
855 nmdc:mga0a205_190391_c1 3300050515 Bacteria 1944
856 nmdc:mga0a205_42892_c1 3300050515 Bacteria 4360
857 nmdc:mga0a205_70442_c1 3300050515 Bacteria 3376
858 nmdc:mga0a205_79912_c1 3300050515 Bacteria 3160
859 nmdc:mga0sz30_352281_c1 3300050516 Bacteria 658
860 Ga0500646_0003154 3300053090 Bacteria 4235
861 Ga0500583_0584004 3300053092 Bacteria 515
862 Ga0500651_0021648 3300053093 Bacteria 4011
863 Ga0500607_296483 3300053121 Bacteria 601
864 Ga0500614_163468 3300053123 Bacteria 675
865 Ga0500604_0002588 3300053151 Bacteria 4928
866 Ga0500620_041251 3300053155 Bacteria 1515
867 Ga0500636_0497960 3300053177 Bacteria 539
868 Ga0500645_038577 3300053730 Bacteria 1417
869 Ga0501084_0000159 3300054114 Bacteria 52081
870 Ga0501084_0002357 3300054114 Bacteria 15199
871 Ga0501084_0018046 3300054114 Bacteria 5877
872 Ga0501084_0126145 3300054114 Bacteria 2154
873 Ga0501084_1530676 3300054114 Bacteria 558
874 Ga0590074_004451 3300059423 Bacteria 2316
875 Ga0590077_005837 3300059426 Bacteria 2523
876 Ga0587073_0039536 3300059492 Bacteria 1021
877 Ga0587073_0084316 3300059492 Bacteria 795
878 Ga0587089_076057 3300059509 Bacteria 577
879 Ga0501082_0000331 3300060353 Bacteria 41893
880 Ga0501082_0007672 3300060353 Bacteria 9314
881 Ga0501082_0015281 3300060353 Bacteria 6610
882 Ga0501082_0208074 3300060353 Bacteria 1702
883 Ga0501082_1912003 3300060353 Bacteria 517
884 Ga0466962_0005839 3300061719 Bacteria 5915
885 Ga0466962_0235858 3300061719 Bacteria 897
886 Ga0530510_0000404 3300061734 Bacteria 27985
887 Ga0530510_0001484 3300061734 Bacteria 15751
888 Ga0530510_0003573 3300061734 Bacteria 10707
889 Ga0530510_0004469 3300061734 Bacteria 9678
890 Ga0530510_0029556 3300061734 Bacteria 3934
891 Ga0530510_0122610 3300061734 Bacteria 1909
892 Ga0530510_0478925 3300061734 Bacteria 943
893 Ga0530510_0502555 3300061734 Bacteria 919
894 2928513061 2928510474 Bacteria 4815308
895 639788587 639633007 Bacteria 4376040
896 Ga0105239_10656295
897 2214745813
898 2214947989
899 rootH1_10104780
900 JGI26141J51220_1000264
901 JGI25405J52794_10031302
902 Ga0058859_11822547
903 Ga0058861_10008596
904 Ga0058862_12853443
905 Ga0065717_1007684
906 Ga0065712_10073006
907 Ga0065715_10000958
908 Ga0070658_10054413
909 Ga0070658_10323524
910 Ga0070676_10016036
911 Ga0070676_10130532
912 Ga0070676_10467687
913 Ga0070683_100029815
914 Ga0070690_100007126
915 Ga0070670_100002592
916 Ga0070670_100016026
917 Ga0070677_10064234
918 Ga0070677_10075492
919 Ga0068869_100013457
920 Ga0068869_100184178
921 Ga0068869_100698093
922 Ga0070666_10012610
923 Ga0070680_100048009
924 Ga0070680_100232847
925 Ga0070680_101390186
926 Ga0070682_100001264
927 Ga0068868_100037991
928 Ga0068868_100094040
929 Ga0070660_100039844
930 Ga0070660_100696717
931 Ga0070689_100097686
932 Ga0070689_100099661
933 Ga0070689_100970937
934 Ga0070691_10009186
935 Ga0070691_10020621
936 Ga0070687_100001147
937 Ga0070687_100018680
938 Ga0070687_100036155
939 Ga0070661_100065294
940 Ga0070661_100079103
941 Ga0070692_10002909
942 Ga0070692_10015695
943 Ga0070692_10144026
944 Ga0070692_10883829
945 Ga0070668_100107172
946 Ga0070668_100440334
947 Ga0070668_100560901
948 Ga0070668_100614005
949 Ga0070669_100102601
950 Ga0070669_100410671
951 Ga0070669_100706231
952 Ga0070675_100214193
953 Ga0070674_100064892
954 Ga0070674_100137938
955 Ga0070674_100184827
956 Ga0070674_100354431
957 Ga0070673_100073500
958 Ga0070673_100130888
959 Ga0070673_100135081
960 Ga0070688_100235293
961 Ga0070688_100249179
962 Ga0070688_100763770
963 Ga0070659_100002953
964 Ga0070659_100470310
965 Ga0070667_100020945
966 Ga0070714_101245958
967 Ga0070701_10002390
968 Ga0070701_10067503
969 Ga0070701_10208948
970 Ga0070711_100878551
971 Ga0070705_100026524
972 Ga0070705_100148049
973 Ga0070705_100656295
974 Ga0070700_100009609
975 Ga0070700_100107265
976 Ga0070700_100315951
977 Ga0070700_100541235
978 Ga0070700_101730570
979 Ga0070694_100017374
980 Ga0070694_100017377
981 Ga0070694_100054732
982 Ga0070694_100095455
983 Ga0070694_100718284
984 Ga0070708_100001270
985 Ga0070708_100014198
986 Ga0070708_100124144
987 Ga0070708_100223694
988 Ga0070708_100345601
989 Ga0070708_100357030
990 Ga0070708_100684609
991 Ga0070708_101009962
992 Ga0070663_100005046
993 Ga0070663_100240497
994 Ga0070663_100613018
995 Ga0070678_100125573
996 Ga0070678_100308608
997 Ga0070662_100018770
998 Ga0070662_100026131
999 Ga0070662_100094776
1000 Ga0070681_10002507
1001 Ga0070681_10011332
1002 Ga0070681_10051013
1003 Ga0070681_10742941
1004 Ga0068867_100052875
1005 Ga0068867_100112820
1006 Ga0068867_100162165
1007 Ga0068867_100291186
1008 Ga0070706_100006254
1009 Ga0070706_100026972
1010 Ga0070706_100171435
1011 Ga0070706_100196113
1012 Ga0070706_100260726
1013 Ga0070706_100316498
1014 Ga0070706_100406541
1015 Ga0070706_100577176
1016 Ga0070706_101009797
1017 Ga0070707_100025576
1018 Ga0070707_100025730
1019 Ga0070707_100029339
1020 Ga0070707_100283942
1021 Ga0070707_100893709
1022 Ga0070707_100903681
1023 Ga0070707_100995571
1024 Ga0070707_101817783
1025 Ga0070698_100022198
1026 Ga0070698_100059875
1027 Ga0070698_100125738
1028 Ga0070698_100185460
1029 Ga0070698_100347520
1030 Ga0070698_100564784
1031 Ga0070698_100993114
1032 Ga0070698_101180870
1033 Ga0070699_100001658
1034 Ga0070699_100028934
1035 Ga0070699_100044841
1036 Ga0070699_100059853
1037 Ga0070699_100061001
1038 Ga0070699_100081601
1039 Ga0070699_100157264
1040 Ga0070699_100324945
1041 Ga0070699_100422589
1042 Ga0070699_100652637
1043 Ga0070699_100790087
1044 Ga0070679_100004937
1045 Ga0070679_100016606
1046 Ga0070679_100089107
1047 Ga0070684_100073788
1048 Ga0070684_100333616
1049 Ga0070697_100011655
1050 Ga0070697_100019710
1051 Ga0070697_100038605
1052 Ga0070697_100089835
1053 Ga0070697_100199747
1054 Ga0070697_100416448
1055 Ga0070697_100613633
1056 Ga0070697_100781424
1057 Ga0070697_101012796
1058 Ga0070697_101232959
1059 Ga0068853_100006499
1060 Ga0068853_100087028
1061 Ga0068853_100087148
1062 Ga0070672_100028832
1063 Ga0070686_100044761
1064 Ga0070686_100184465
1065 Ga0070695_100009417
1066 Ga0070695_100017089
1067 Ga0070695_100034336
1068 Ga0070695_100056895
1069 Ga0070695_100201893
1070 Ga0070696_100022061
1071 Ga0070696_100057210
1072 Ga0070696_100064605
1073 Ga0070696_100226983
1074 Ga0070696_100726646
1075 Ga0070696_101210041
1076 Ga0070693_100026618
1077 Ga0070665_100014575
1078 Ga0070704_100026371
1079 Ga0070704_100107355
1080 Ga0070704_100162908
1081 Ga0070704_100309977
1082 Ga0070704_100341202
1083 Ga0068855_100001896
1084 Ga0068855_100007165
1085 Ga0068855_100113585
1086 Ga0070664_100026879
1087 Ga0070664_100075853
1088 Ga0068857_100105265
1089 Ga0068857_100407436
1090 Ga0068854_100001054
1091 Ga0068854_100030869
1092 Ga0068854_100097465
1093 Ga0068856_100005242
1094 Ga0068856_100027892
1095 Ga0070702_100366740
1096 Ga0070702_101553703
1097 Ga0068852_100111503
1098 Ga0068859_100036000
1099 Ga0068859_101394601
1100 Ga0068864_100127936
1101 Ga0068864_100192001
1102 Ga0068866_10211135
1103 Ga0068866_10259528
1104 Ga0068866_10675558
1105 Ga0068866_10822894
1106 Ga0068861_100320151
1107 Ga0068861_100643243
1108 Ga0068861_100844462
1109 Ga0068851_10351891
1110 Ga0068851_10903560
1111 Ga0068870_10000560
1112 Ga0068863_100203801
1113 Ga0068863_100697554
1114 Ga0068863_102225254
1115 Ga0068860_100041055
1116 Ga0068860_100117951
1117 Ga0068860_100941110
1118 Ga0068860_101049066
1119 Ga0068862_100030715
1120 Ga0068862_100035243
1121 Ga0068862_100099431
1122 Ga0068862_100328749
1123 Ga0068862_100344728
1124 Ga0068862_100569057
1125 Ga0068862_100655095
1126 Ga0068862_101070418
1127 Ga0081455_10000422
1128 Ga0081455_10000593
1129 Ga0081455_10522083
1130 Ga0081538_10108435
1131 Ga0081538_10118681
1132 Ga0081538_10229370
1133 Ga0070717_10006773
1134 Ga0070717_10050855
1135 Ga0075365_10076547
1136 Ga0075368_10000628
1137 Ga0075363_100006560
1138 Ga0075364_10020188
1139 Ga0075364_10034596
1140 Ga0075432_10014107
1141 Ga0070715_10059830
1142 Ga0070716_100020860
1143 Ga0070716_100383350
1144 Ga0070712_100042578
1145 Ga0070712_100410682
1146 Ga0075362_10004474
1147 Ga0075367_10022523
1148 Ga0097621_100108966
1149 Ga0075370_10407049
1150 Ga0075428_100060226
1151 Ga0075428_100089266
1152 Ga0075428_100186663
1153 Ga0075428_100267778
1154 Ga0075428_100887899
1155 Ga0075428_100963053
1156 Ga0075428_102077671
1157 Ga0075430_100007675
1158 Ga0075430_100077838
1159 Ga0075430_100405979
1160 Ga0075430_100733428
1161 Ga0075431_100484440
1162 Ga0075431_100588529
1163 Ga0075431_101094382
1164 Ga0075433_10017695
1165 Ga0075433_10018619
1166 Ga0075433_10021817
1167 Ga0075433_10024737
1168 Ga0075433_10056582
1169 Ga0075433_10060611
1170 Ga0075433_10062480
1171 Ga0075433_10113115
1172 Ga0075433_10114150
1173 Ga0075433_10155624
1174 Ga0075433_10590300
1175 Ga0075433_11134216
1176 Ga0075434_100022907
1177 Ga0075434_100038530
1178 Ga0075434_100094064
1179 Ga0075434_100117856
1180 Ga0075434_100124157
1181 Ga0075434_100147668
1182 Ga0075434_100148722
1183 Ga0075434_100164392
1184 Ga0075434_100223768
1185 Ga0075434_100252341
1186 Ga0075434_100318488
1187 Ga0075434_100381662
1188 Ga0075434_100616538
1189 Ga0075434_102629580
1190 Ga0075429_100029843
1191 Ga0075429_100104105
1192 Ga0075429_100224096
1193 Ga0075429_100671777
1194 Ga0075429_100727861
1195 Ga0068865_100131177
1196 Ga0075436_100007112
1197 Ga0075436_100217103
1198 Ga0075436_100265146
1199 Ga0075436_100493487
1200 Ga0075436_100637462
1201 Ga0097620_100036001
1202 Ga0097620_101394716
1203 Ga0075435_100075797
1204 Ga0075435_100087753
1205 Ga0075435_100093058
1206 Ga0075435_100096506
1207 Ga0075435_100142357
1208 Ga0075435_100281887
1209 Ga0075435_100290647
1210 Ga0075435_100999107
1211 Ga0099794_10011851
1212 Ga0099794_10019102
1213 Ga0099794_10098701
1214 Ga0105240_10013491
1215 Ga0105240_10279710
1216 Ga0111539_10027897
1217 Ga0111539_10105606
1218 Ga0111539_10230737
1219 Ga0111539_10312872
1220 Ga0111539_10614897
1221 Ga0111539_13073616
1222 Ga0105245_10511316
1223 Ga0114129_10000332
1224 Ga0114129_10012121
1225 Ga0114129_10018448
1226 Ga0114129_10033317
1227 Ga0114129_10038278
1228 Ga0114129_10083626
1229 Ga0114129_10088887
1230 Ga0114129_10092421
1231 Ga0114129_10096608
1232 Ga0114129_10120830
1233 Ga0114129_10348740
1234 Ga0114129_10596189
1235 Ga0114129_10613347
1236 Ga0114129_10964271
1237 Ga0114129_10996431
1238 Ga0114129_11457439
1239 Ga0114129_12677009
1240 Ga0105241_10015599
1241 Ga0105241_10026668
1242 Ga0105241_10095784
1243 Ga0105241_10198585
1244 Ga0105242_10007188
1245 Ga0105242_10375839
1246 Ga0105242_11246650
1247 Ga0105248_10155109
1248 Ga0105237_10032956
1249 Ga0105237_10213118
1250 Ga0105237_11502531
1251 Ga0105238_10011691
1252 Ga0105249_10046335
1253 Ga0105249_10391456
1254 Ga0105249_10402094
1255 Ga0105249_11208125
1256 Ga0130087_1037661
1257 Ga0130086_1061563
1258 Ga0130084_1089025
1259 Ga0130085_1093847
1260 Ga0099796_10060909
1261 Ga0105239_10035504
1262 Ga0105239_10526018
1263 Ga0105246_10111381
1264 Ga0157344_1020624
1265 Ga0157325_1022198
1266 Ga0157335_1028401
1267 Ga0157323_1017379
1268 Ga0157324_1012128
1269 Ga0157342_1054614
1270 Ga0157326_1018345
1271 Ga0157338_1004775
1272 Ga0157373_10005841
1273 Ga0157371_10042131
1274 Ga0157371_10089175
1275 Ga0157371_10161973
1276 Ga0157369_10008047
1277 Ga0157369_10772690
1278 Ga0157374_10036959
1279 Ga0157374_10378726
1280 Ga0157378_10061572
1281 Ga0157378_10114670
1282 Ga0157378_10136219
1283 Ga0163162_10003246
1284 Ga0163162_10169870
1285 Ga0163162_10568193
1286 Ga0157372_10032105
1287 Ga0157372_10051875
1288 Ga0157372_10105080
1289 Ga0157375_10230765
1290 Ga0157375_10695812
1291 Ga0157375_11936793
1292 Ga0163163_10105359
1293 Ga0163163_10413802
1294 Ga0157380_10140720
1295 Ga0182008_10046380
1296 Ga0157377_10043351
1297 Ga0157379_10104217
1298 Ga0182007_10031324
1299 Ga0163161_10322384
1300 Ga0163161_11208186
1301 Ga0197907_10423327
1302 Ga0206356_11641698
1303 Ga0206349_1043118
1304 Ga0206351_10245893
1305 Ga0206352_10098864
1306 Ga0206352_10572215
1307 Ga0206350_10135750
1308 Ga0206350_10807924
1309 Ga0206350_10990574
1310 Ga0206354_11101861
1311 Ga0206353_10116078
1312 Ga0206353_11451431
1313 Ga0213873_10019956
1314 Ga0213874_10000323
1315 Ga0213874_10003847
1316 Ga0213874_10046400
1317 Ga0213874_10121035
1318 Ga0213876_10580714
1319 Ga0213875_10126435
1320 Ga0224712_10000464
1321 Ga0207673_1011793
1322 Ga0207697_10012509
1323 Ga0207653_10014980
1324 Ga0207682_10053442
1325 Ga0207642_10832707
1326 Ga0207688_10003716
1327 Ga0207680_10075580
1328 Ga0207647_10000592
1329 Ga0207645_10000293
1330 Ga0207705_10051409
1331 Ga0207705_10241576
1332 Ga0207684_10005489
1333 Ga0207684_10009118
1334 Ga0207684_10044353
1335 Ga0207684_10288904
1336 Ga0207684_10853660
1337 Ga0207684_11704063
1338 Ga0207654_10003542
1339 Ga0207707_10007464
1340 Ga0207695_10000465
1341 Ga0207671_10000128
1342 Ga0207671_10228302
1343 Ga0207660_10841083
1344 Ga0207662_10002551
1345 Ga0207662_10096517
1346 Ga0207657_10003227
1347 Ga0207657_10972439
1348 Ga0207649_10338795
1349 Ga0207652_10012934
1350 Ga0207652_10036233
1351 Ga0207646_10000786
1352 Ga0207646_10001781
1353 Ga0207646_10034220
1354 Ga0207646_10079582
1355 Ga0207681_11352127
1356 Ga0207681_11784840
1357 Ga0207694_10001095
1358 Ga0207650_10001868
1359 Ga0207650_11576339
1360 Ga0207659_10025522
1361 Ga0207659_11400703
1362 Ga0207687_10172772
1363 Ga0207700_10132683
1364 Ga0207644_10069948
1365 Ga0207690_10032826
1366 Ga0207706_10004744
1367 Ga0207706_10108014
1368 Ga0207706_10200373
1369 Ga0207686_10576649
1370 Ga0207670_10036647
1371 Ga0207670_10046472
1372 Ga0207669_10233261
1373 Ga0207669_10550441
1374 Ga0207665_10068859
1375 Ga0207691_10019557
1376 Ga0207689_11822028
1377 Ga0207679_10065325
1378 Ga0207679_10118721
1379 Ga0207667_10018880
1380 Ga0207712_10279970
1381 Ga0207712_10331856
1382 Ga0207712_10361829
1383 Ga0207668_10093022
1384 Ga0207668_10131961
1385 Ga0207668_11523910
1386 Ga0207640_10005139
1387 Ga0207640_10170000
1388 Ga0207703_10712630
1389 Ga0207639_10106089
1390 Ga0207639_11845219
1391 Ga0207678_10003112
1392 Ga0207678_10009868
1393 Ga0207678_10739493
1394 Ga0207708_10045254
1395 Ga0207708_10376098
1396 Ga0207708_10464546
1397 Ga0207702_10762386
1398 Ga0207641_10244102
1399 Ga0207648_10123082
1400 Ga0207676_10196523
1401 Ga0207675_100199744
1402 Ga0207675_100440310
1403 Ga0207683_10001743
1404 Ga0207683_12047413
1405 Ga0209981_1038107
1406 Ga0209983_1003492
1407 Ga0209983_1006870
1408 Ga0209588_1038058
1409 Ga0209588_1121563
1410 Ga0209971_1009932
1411 Ga0209971_1072036
1412 Ga0209966_1151314
1413 Ga0209998_10002417
1414 Ga0209813_10000415
1415 Ga0209974_10003939
1416 Ga0207428_10000068
1417 Ga0207428_10194497
1418 Ga0268266_10825719
1419 Ga0268265_10253641
1420 Ga0268264_10654972
1421 Ga0268264_10922550
1422 Ga0268264_11249129
1423 Ga0265324_10042712
1424 Ga0307511_10003345
1425 Ga0316177_1091689
1426 Ga0314311_1078775
1427 Ga0316178_1107985
1428 Ga0316578_10244233
1429 Ga0316578_10435536
1430 Ga0307405_12111220
1431 Ga0307413_10002818
1432 Ga0307413_10205070
1433 Ga0307410_10097576
1434 Ga0307410_10127796
1435 Ga0307406_10140280
1436 Ga0307406_12022765
1437 Ga0307407_10142036
1438 Ga0307412_10136954
1439 Ga0307412_11360844
1440 Ga0307409_100002679
1441 Ga0307409_100090744
1442 Ga0307416_100000471
1443 Ga0307416_100038656
1444 Ga0307414_10005074
1445 Ga0307411_10002706
1446 Ga0307415_100004157
1447 Ga0307415_102120150
1448 Ga0307507_10052430
1449 Ga0316588_1072917
1450 Ga0316596_1039385
1451 Ga0316596_1163892
1452 Ga0373948_0024351
1453 Ga0373938_0047834
1454 Ga0373928_0142948
1455 Ga0373932_0072454
1456 Ga0373932_0427942
1457 Ga0373939_0116801
1458 Ga0373941_0419705
1459 Ga0373945_0006383
1460 Ga0373954_0193492
1461 Ga0373961_0361979
1462 Ga0373931_0021528
1463 Ga0373931_0050621
1464 Ga0373935_0293848
1465 Ga0373927_0055132
1466 Ga0373933_0001006
1467 Ga0373947_0001183
1468 Ga0373937_0186578
1469 Ga0373937_0392666
1470 Ga0373937_1773482
1471 Ga0316584_0163094
1472 Ga0373925_0005242
1473 Ga0373925_0209487
1474 Ga0436364_0080211
1475 Ga0436364_0237548
1476 Ga0436364_0450520
1477 Ga0436364_1343927
1478 Ga0395901_0473766
1479 Ga0400483_013664
1480 Ga0400489_40187
1481 Ga0436365_0176958
1482 Ga0436365_1040651
1483 Ga0436365_1589039
1484 Ga0436365_1657161
1485 Ga0436363_0152484
1486 Ga0436363_0627696
1487 Ga0436363_0914349
1488 Ga0436363_1187018
1489 Ga0436362_1256068
1490 Ga0439461_0161345
1491 Ga0451787_215061
1492 Ga0451800_0304442
1493 Ga0451802_0282335
1494 Ga0451807_1309538
1495 Ga0439448_0035252
1496 Ga0439446_0320950
1497 Ga0439444_0012469
1498 Ga0439464_0005101
1499 Ga0439460_0001173
1500 Ga0451577_0011827
1501 Ga0451577_0064625
1502 Ga0451577_0088710
1503 Ga0451577_0237299
1504 Ga0466969_0013784
1505 Ga0466969_0015778
1506 Ga0466969_0137322
1507 Ga0466969_0254664
1508 Ga0466969_0515827
1509 Ga0466972_0019729
1510 Ga0466972_0056639
1511 Ga0466972_0156043
1512 Ga0453683_0146308
1513 Ga0453683_0606966
1514 Ga0466965_0031416
1515 Ga0466965_0057112
1516 Ga0466966_0003293
1517 Ga0466966_0003798
1518 Ga0466966_0059786
1519 Ga0466961_0005574
1520 Ga0466961_0008523
1521 Ga0466961_0108948
1522 Ga0466961_0875473
1523 Ga0466963_0092476
1524 Ga0466964_0002987
1525 Ga0453684_0000194
1526 Ga0453684_0177284
1527 Ga0453684_0241237
1528 Ga0453684_0547324
1529 Ga0466971_0033817
1530 Ga0466971_0431876
1531 Ga0466968_0000316
1532 Ga0466970_0000729
1533 Ga0466970_0144318
1534 Ga0466960_0034605
1535 Ga0466959_0027826
1536 Ga0466959_0039400
1537 Ga0466959_0084659
1538 Ga0466959_0091095
1539 Ga0451576_0026896
1540 Ga0451576_0145759
1541 Ga0451576_0150576
1542 Ga0451576_0589685
1543 Ga0466958_0004601
1544 Ga0495580_0000625
1545 Ga0495580_0122321
1546 Ga0495594_0285517
1547 Ga0495630_1265070
1548 Ga0495644_0330032
1549 Ga0495586_0228960
1550 Ga0495656_0165044
1551 Ga0495659_0051871
1552 Ga0495659_0158000
1553 Ga0495646_0598496
1554 Ga0495669_0665991
1555 Ga0495674_1079030
1556 Ga0495676_0153668
1557 Ga0496102_0248948
1558 Ga0496102_1076243
1559 Ga0496103_0095521
1560 Ga0496103_0119549
1561 Ga0496106_0335288
1562 Ga0496107_0353737
1563 Ga0496107_0437697
1564 Ga0496108_0013667
1565 Ga0496109_0350921
1566 Ga0496112_0038880
1567 Ga0496112_0646460
1568 Ga0496113_0051398
1569 Ga0501297_078282
1570 Ga0501031_0016759
1571 Ga0501031_0156886
1572 Ga0501032_0300458
1573 Ga0501032_0374312
1574 Ga0501033_0048211
1575 Ga0501034_0276742
1576 Ga0501036_0010433
1577 Ga0501036_0014629
1578 Ga0501036_0046456
1579 Ga0501036_0077625
1580 Ga0501036_0129039
1581 Ga0501036_0193766
1582 Ga0501037_0021847
1583 Ga0501037_0038187
1584 Ga0501037_0121232
1585 Ga0501037_0464331
1586 Ga0501038_0000271
1587 Ga0501038_0012309
1588 Ga0501038_0079413
1589 Ga0501038_0123524
1590 Ga0501038_0770181
1591 Ga0501039_0000761
1592 Ga0501039_0001941
1593 Ga0501039_0052316
1594 Ga0501039_0674338
1595 Ga0501040_0000010
1596 Ga0501040_0009549
1597 Ga0501040_0029576
1598 Ga0501040_0031354
1599 Ga0501040_0032356
1600 Ga0501041_0000002
1601 Ga0501041_0004888
1602 Ga0501042_0001370
1603 Ga0501042_0025436
1604 Ga0501042_0128236
1605 Ga0501042_0177475
1606 Ga0501043_0112169
1607 Ga0501043_0390356
1608 Ga0501046_0004431
1609 Ga0501046_0015004
1610 Ga0501046_0058614
1611 Ga0501046_0428428
1612 Ga0501047_0039848
1613 Ga0501048_0003955
1614 Ga0501048_0007054
1615 Ga0501048_0030209
1616 Ga0501048_0381707
1617 Ga0501068_0007581
1618 Ga0501068_0025641
1619 Ga0501070_0145659
1620 Ga0501070_0217106
1621 Ga0501071_0001030
1622 Ga0501071_0001156
1623 Ga0501071_0326195
1624 Ga0501071_0470554
1625 Ga0501072_0000128
1626 Ga0501072_0002940
1627 Ga0501072_0044284
1628 Ga0501072_0520639
1629 Ga0501072_0657687
1630 Ga0501072_0855089
1631 Ga0501072_1224648
1632 Ga0501073_0073936
1633 Ga0501073_0207532
1634 Ga0501073_0337266
1635 Ga0501074_0006457
1636 Ga0501074_0008383
1637 Ga0501074_0106685
1638 Ga0501074_0354819
1639 Ga0501075_0000148
1640 Ga0501075_0005474
1641 Ga0501075_0005748
1642 Ga0501075_0059441
1643 Ga0501075_0391450
1644 Ga0501076_0000022
1645 Ga0501076_0001365
1646 Ga0501076_0005550
1647 Ga0501076_0015980
1648 Ga0501076_0039704
1649 Ga0501076_0155084
1650 Ga0501076_0375265
1651 Ga0501076_0524163
1652 Ga0501076_1650803
1653 Ga0501077_0000017
1654 Ga0501077_0001274
1655 Ga0501077_0046294
1656 Ga0501209_008517
1657 Ga0501216_043019
1658 Ga0501217_017925
1659 Ga0501230_091509
1660 Ga0501257_032364
1661 Ga0501259_040891
1662 Ga0501261_090541
1663 Ga0501234_008003
1664 Ga0501079_0000549
1665 Ga0501079_0001854
1666 Ga0501079_0026321
1667 Ga0501079_0065396
1668 Ga0501079_0350360
1669 Ga0501079_0580567
1670 Ga0501079_0750329
1671 Ga0501080_0057156
1672 Ga0501080_0069952
1673 Ga0501080_0318672
1674 Ga0501080_1400736
1675 Ga0501081_0000105
1676 Ga0501081_0012557
1677 Ga0501081_0328350
1678 Ga0501081_1153329
1679 Ga0501083_0056836
1680 Ga0501083_0174381
1681 Ga0501083_0993345
1682 Ga0501035_0036548
1683 Ga0501035_0157005
1684 Ga0501035_0166057
1685 Ga0501044_0211312
1686 Ga0501044_0549629
1687 Ga0501045_0000113
1688 Ga0501045_0001571
1689 Ga0501045_0020734
1690 Ga0501045_0062060
1691 Ga0501045_0636848
1692 nmdc:mga03683_15356_c1
1693 nmdc:mga03n38_13253_c1
1694 nmdc:mga00v17_72300_c1
1695 nmdc:mga0yw44_268646_c1
1696 nmdc:mga0yw44_65569_c1
1697 nmdc:mga0yw44_967215_c1
1698 nmdc:mga0k408_48373_c1
1699 nmdc:mga06z11_13908_c2
1700 nmdc:mga04h51_5501_c1
1701 nmdc:mga07m45_16967_c1
1702 nmdc:mga05p37_1268_c1
1703 nmdc:mga05p37_138484_c1
1704 nmdc:mga05p37_154731_c1
1705 nmdc:mga05p37_16963_c1
1706 nmdc:mga05p37_2150_c1
1707 nmdc:mga05p37_32073_c1
1708 nmdc:mga05p37_35685_c1
1709 nmdc:mga05p37_489060_c1
1710 nmdc:mga05p37_7463_c1
1711 nmdc:mga05p37_75391_c1
1712 nmdc:mga05p37_79745_c1
1713 nmdc:mga05p37_845470_c1
1714 nmdc:mga09592_183884_c1
1715 nmdc:mga09592_46354_c1
1716 nmdc:mga09592_868082_c1
1717 nmdc:mga0qj67_129955_c1
1718 nmdc:mga0qj67_1439946_c1
1719 nmdc:mga0qj67_3143_c1
1720 nmdc:mga0qj67_66768_c1
1721 nmdc:mga06r32_151446_c1
1722 nmdc:mga06r32_172415_c1
1723 nmdc:mga06r32_486248_c1
1724 nmdc:mga06r32_693636_c1
1725 nmdc:mga06r32_739423_c1
1726 nmdc:mga06r32_9393_c1
1727 nmdc:mga08y16_1940634_c1
1728 nmdc:mga08y16_267786_c1
1729 nmdc:mga08y16_460604_c1
1730 nmdc:mga08y16_716_c1
1731 nmdc:mga0n895_145290_c1
1732 nmdc:mga0n895_289269_c1
1733 nmdc:mga0n895_37094_c1
1734 nmdc:mga0n895_39478_c1
1735 nmdc:mga0n895_519580_c1
1736 nmdc:mga0n895_536223_c1
1737 nmdc:mga0n895_57672_c1
1738 nmdc:mga0n895_59174_c1
1739 nmdc:mga0n895_83903_c1
1740 nmdc:mga0rr50_1145496_c1
1741 nmdc:mga0rr50_1669784_c1
1742 nmdc:mga0rr50_243308_c1
1743 nmdc:mga0rr50_268600_c1
1744 nmdc:mga0rr50_3579_c1
1745 nmdc:mga0rr50_405511_c1
1746 nmdc:mga0rr50_526821_c1
1747 nmdc:mga08x19_149073_c1
1748 nmdc:mga0a205_130575_c1
1749 nmdc:mga0a205_144037_c1
1750 nmdc:mga0a205_190391_c1
1751 nmdc:mga0a205_42892_c1
1752 nmdc:mga0a205_70442_c1
1753 nmdc:mga0a205_79912_c1
1754 nmdc:mga0sz30_352281_c1
1755 Ga0500646_0003154
1756 Ga0500583_0584004
1757 Ga0500651_0021648
1758 Ga0500607_296483
1759 Ga0500614_163468
1760 Ga0500604_0002588
1761 Ga0500620_041251
1762 Ga0500636_0497960
1763 Ga0500645_038577
1764 Ga0501084_0000159
1765 Ga0501084_0002357
1766 Ga0501084_0018046
1767 Ga0501084_0126145
1768 Ga0501084_1530676
1769 Ga0590074_004451
1770 Ga0590077_005837
1771 Ga0587073_0039536
1772 Ga0587073_0084316
1773 Ga0587089_076057
1774 Ga0501082_0000331
1775 Ga0501082_0007672
1776 Ga0501082_0015281
1777 Ga0501082_0208074
1778 Ga0501082_1912003
1779 Ga0466962_0005839
1780 Ga0466962_0235858
1781 Ga0530510_0000404
1782 Ga0530510_0001484
1783 Ga0530510_0003573
1784 Ga0530510_0004469
1785 Ga0530510_0029556
1786 Ga0530510_0122610
1787 Ga0530510_0478925
1788 Ga0530510_0502555
1789 2928513061
1790 639788587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00542

Ribosomal_L12

Ribosomal protein L7/L12 C-terminal domain

63

129

0.99

PF16320

Ribosomal_L12_N

Ribosomal protein L7/L12 dimerisation domain

3

53

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ctf-assembly1.cif.gz_A-2 structure of the c-terminal domain of the ribosomal protein l7/l12 from escherichia coli at 1.7 angstroms 0.9678 37 104
1ctf-assembly1.cif.gz_A-2 structure of the c-terminal domain of the ribosomal protein l7/l12 from escherichia coli at 1.7 angstroms 0.9542 37 104
1rqs-assembly1.cif.gz_A nmr structure of c-terminal domain of ribosomal protein l7 from e.coli 0.9506 36 104
8phj-assembly1.cif.gz_W ca4-bound cami1 in complex with 70s ribosome 0.9442 38 102
4v5n-assembly1.cif.gz_BL trna translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post) 0.94 38 104
ID Description Score Start End Superfamily
af_P9WHE3_59_130_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.989 36 104 3.30.1390.10
1ctfA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9678 37 104 3.30.1390.10
af_C0P7V5_86_159_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.962 36 102 3.30.1390.10
af_O96202_182_254_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9559 36 102 3.30.1390.10
1ctfA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9542 37 104 3.30.1390.10
ID Description Score Start End GO Terms
AF-A0A659XXZ9-F1-model_v4 50S ribosomal protein L7/L12 1.002 37 104 GO:0003729
GO:0003735
GO:0006412
GO:0022625
AF-A0A848VRX4-F1-model_v4 50S ribosomal protein L7/L12 1.002 36 104 GO:0003729
GO:0003735
GO:0006412
GO:0022625
AF-A0A4Y8ZP62-F1-model_v4 deleted 1.002 37 104
AF-A0A0E1Y8G5-F1-model_v4 deleted 1.001 36 104
AF-A0A6J6EFV9-F1-model_v4 Unannotated protein 1.001 36 104 GO:0003729
GO:0003735
GO:0006412
GO:0022625

Map