F484976
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 895 | 384 | 895 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10012863|Ga0163163_100128637 |
| Length | 243 |
| Sequence | VEALFAAQVTDGPLQQLSFWALQFQIVSEAGRMARTRLLLADDHTLLVDAFRKLLEPEFEIVGTASDGRTLLAGALQLRPDVVVVDLGLPLLNGMDAGRELKKLMPQIKLLVVTMSEDVGVAAEALREWASGYLLKKSAGTELTHAIREVIKGRTYVTPHVAQQLVDQFIREPEHARRALTSRQREVLQLLAEGRTMKETADILKLTTRTIAFHKYRIMQEFGLQNNSELLKLAIREHLVPPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 12 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 13 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 14 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 15 | 3300003383 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM | Metagenome | Rhizosphere |
| 16 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 20 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 153 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 154 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 243 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 244 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 246 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 256 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 264 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 271 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 273 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 278 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 279 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 280 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 281 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 282 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 284 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 285 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 286 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 287 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 288 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 337 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 338 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 339 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 357 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 358 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 366 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 368 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 380 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 383 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0.78 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.56 |
| Nodule | 0 |
| Rhizoplane | 4.36 |
| Rhizosphere | 92.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3676544 | 2162886007 | Bacteria | 2524 |
| 2 | MRS1b_contig_650282 | 2162886011 | Bacteria | 1433 |
| 3 | MRS1b_contig_6820307 | 2162886011 | Unclassified | 851 |
| 4 | MBSR1b_contig_7203822 | 2162886012 | Bacteria | 1502 |
| 5 | MBSR1b_contig_8982173 | 2162886012 | Unclassified | 1498 |
| 6 | JGI24752J21851_1002687 | 3300001976 | Bacteria | 2364 |
| 7 | JGI24737J22298_10025386 | 3300001990 | Bacteria | 1874 |
| 8 | JGI24737J22298_10066052 | 3300001990 | Bacteria | 1083 |
| 9 | JGI24743J22301_10003233 | 3300001991 | Bacteria | 2560 |
| 10 | JGI24750J21931_1023451 | 3300002070 | Unclassified | 876 |
| 11 | JGI24033J26618_1003840 | 3300002155 | Bacteria | 1599 |
| 12 | JGI24034J26672_10004298 | 3300002239 | Bacteria | 2013 |
| 13 | JGI24751J29686_10001753 | 3300002459 | Bacteria | 4460 |
| 14 | JGI24751J29686_10033813 | 3300002459 | Bacteria | 1060 |
| 15 | JGI25162J39368_1009987 | 3300002737 | Bacteria | 1229 |
| 16 | JGI26128J50194_1001479 | 3300003347 | Bacteria | 1496 |
| 17 | JGI26129J50193_1001113 | 3300003349 | Bacteria | 1794 |
| 18 | JGI26145J50221_1000604 | 3300003371 | Unclassified | 3056 |
| 19 | JGI26140J50224_100513 | 3300003383 | Bacteria | 1655 |
| 20 | Ga0058859_11676364 | 3300004798 | Unclassified | 856 |
| 21 | Ga0058863_11434404 | 3300004799 | Unclassified | 877 |
| 22 | Ga0058861_12004268 | 3300004800 | Unclassified | 1375 |
| 23 | Ga0058860_11325207 | 3300004801 | Unclassified | 1005 |
| 24 | Ga0058860_11635791 | 3300004801 | Unclassified | 860 |
| 25 | Ga0058860_11739536 | 3300004801 | Bacteria | 1720 |
| 26 | Ga0058862_10044413 | 3300004803 | Bacteria | 1711 |
| 27 | Ga0065704_10071835 | 3300005289 | Bacteria | 9791 |
| 28 | Ga0065712_10071490 | 3300005290 | Bacteria | 5234 |
| 29 | Ga0065712_10089919 | 3300005290 | Bacteria | 2447 |
| 30 | Ga0065712_10138160 | 3300005290 | Unclassified | 1468 |
| 31 | Ga0065712_10149010 | 3300005290 | Bacteria | 1385 |
| 32 | Ga0065715_10006312 | 3300005293 | Bacteria | 3474 |
| 33 | Ga0065715_10017945 | 3300005293 | Bacteria | 2257 |
| 34 | Ga0065715_10135651 | 3300005293 | Bacteria | 1935 |
| 35 | Ga0065715_10139294 | 3300005293 | Bacteria | 1879 |
| 36 | Ga0065715_10407023 | 3300005293 | Unclassified | 874 |
| 37 | Ga0065707_10003017 | 3300005295 | Bacteria | 4389 |
| 38 | Ga0065707_10107130 | 3300005295 | Bacteria | 2568 |
| 39 | Ga0065707_10124507 | 3300005295 | Unclassified | 2042 |
| 40 | Ga0065707_10154527 | 3300005295 | Unclassified | 1622 |
| 41 | Ga0065707_10164315 | 3300005295 | Unclassified | 1536 |
| 42 | Ga0070658_10666313 | 3300005327 | Bacteria | 903 |
| 43 | Ga0070676_10001350 | 3300005328 | Bacteria | 12334 |
| 44 | Ga0070676_10031752 | 3300005328 | Bacteria | 3021 |
| 45 | Ga0070676_10110356 | 3300005328 | Unclassified | 1712 |
| 46 | Ga0070676_10551809 | 3300005328 | Bacteria | 825 |
| 47 | Ga0070683_100006993 | 3300005329 | Bacteria | 9494 |
| 48 | Ga0070683_100051999 | 3300005329 | Bacteria | 3795 |
| 49 | Ga0070690_100000310 | 3300005330 | Bacteria | 25176 |
| 50 | Ga0070690_100015219 | 3300005330 | Bacteria | 4584 |
| 51 | Ga0070670_100004761 | 3300005331 | Bacteria | 11398 |
| 52 | Ga0070670_100074171 | 3300005331 | Bacteria | 2922 |
| 53 | Ga0070677_10010323 | 3300005333 | Bacteria | 3191 |
| 54 | Ga0070677_10014268 | 3300005333 | Bacteria | 2795 |
| 55 | Ga0068869_100014772 | 3300005334 | Bacteria | 5223 |
| 56 | Ga0068869_100110422 | 3300005334 | Bacteria | 2091 |
| 57 | Ga0068869_100531267 | 3300005334 | Bacteria | 986 |
| 58 | Ga0070666_10020223 | 3300005335 | Unclassified | 4302 |
| 59 | Ga0070666_10177451 | 3300005335 | Bacteria | 1493 |
| 60 | Ga0070666_10222857 | 3300005335 | Bacteria | 1330 |
| 61 | Ga0070680_100018896 | 3300005336 | Bacteria | 5451 |
| 62 | Ga0070680_100035842 | 3300005336 | Bacteria | 4006 |
| 63 | Ga0070680_100142887 | 3300005336 | Bacteria | 2007 |
| 64 | Ga0070680_100433549 | 3300005336 | Unclassified | 1122 |
| 65 | Ga0070680_100436723 | 3300005336 | Unclassified | 1117 |
| 66 | Ga0070680_100912499 | 3300005336 | Unclassified | 758 |
| 67 | Ga0070682_100414863 | 3300005337 | Bacteria | 1022 |
| 68 | Ga0070682_100676923 | 3300005337 | Unclassified | 824 |
| 69 | Ga0068868_100028184 | 3300005338 | Bacteria | 4291 |
| 70 | Ga0068868_100099409 | 3300005338 | Bacteria | 2353 |
| 71 | Ga0070660_100003327 | 3300005339 | Bacteria | 11047 |
| 72 | Ga0070660_100039824 | 3300005339 | Unclassified | 3573 |
| 73 | Ga0070660_100085814 | 3300005339 | Bacteria | 2476 |
| 74 | Ga0070689_100004859 | 3300005340 | Bacteria | 9123 |
| 75 | Ga0070689_100014437 | 3300005340 | Bacteria | 5738 |
| 76 | Ga0070689_100039896 | 3300005340 | Bacteria | 3597 |
| 77 | Ga0070689_100070610 | 3300005340 | Bacteria | 2727 |
| 78 | Ga0070689_100218750 | 3300005340 | Bacteria | 1561 |
| 79 | Ga0070691_10001905 | 3300005341 | Bacteria | 9147 |
| 80 | Ga0070691_10086713 | 3300005341 | Bacteria | 1539 |
| 81 | Ga0070691_10107514 | 3300005341 | Bacteria | 1392 |
| 82 | Ga0070687_100002265 | 3300005343 | Bacteria | 7147 |
| 83 | Ga0070687_100114928 | 3300005343 | Bacteria | 1529 |
| 84 | Ga0070661_100012144 | 3300005344 | Bacteria | 6022 |
| 85 | Ga0070661_100033766 | 3300005344 | Bacteria | 3708 |
| 86 | Ga0070661_100066322 | 3300005344 | Bacteria | 2652 |
| 87 | Ga0070661_100329613 | 3300005344 | Bacteria | 1194 |
| 88 | Ga0070661_100563048 | 3300005344 | Bacteria | 918 |
| 89 | Ga0070692_10015880 | 3300005345 | Bacteria | 3571 |
| 90 | Ga0070692_10072168 | 3300005345 | Bacteria | 1841 |
| 91 | Ga0070668_100010502 | 3300005347 | Bacteria | 6884 |
| 92 | Ga0070668_100078830 | 3300005347 | Bacteria | 2577 |
| 93 | Ga0070668_100334386 | 3300005347 | Unclassified | 1278 |
| 94 | Ga0070669_100017825 | 3300005353 | Bacteria | 5068 |
| 95 | Ga0070669_100077647 | 3300005353 | Bacteria | 2467 |
| 96 | Ga0070669_100309785 | 3300005353 | Bacteria | 1272 |
| 97 | Ga0070669_100379060 | 3300005353 | Unclassified | 1153 |
| 98 | Ga0070669_100525458 | 3300005353 | Bacteria | 984 |
| 99 | Ga0070675_100001819 | 3300005354 | Bacteria | 15788 |
| 100 | Ga0070675_100011171 | 3300005354 | Bacteria | 7026 |
| 101 | Ga0070675_100082629 | 3300005354 | Bacteria | 2680 |
| 102 | Ga0070675_100172984 | 3300005354 | Bacteria | 1863 |
| 103 | Ga0070675_100211928 | 3300005354 | Bacteria | 1684 |
| 104 | Ga0070675_100283243 | 3300005354 | Bacteria | 1457 |
| 105 | Ga0070671_100005413 | 3300005355 | Bacteria | 10183 |
| 106 | Ga0070671_100235624 | 3300005355 | Bacteria | 1553 |
| 107 | Ga0070671_100378618 | 3300005355 | Unclassified | 1209 |
| 108 | Ga0070674_100000555 | 3300005356 | Bacteria | 18749 |
| 109 | Ga0070674_100012998 | 3300005356 | Bacteria | 5130 |
| 110 | Ga0070674_100085345 | 3300005356 | Bacteria | 2266 |
| 111 | Ga0070674_100280492 | 3300005356 | Bacteria | 1320 |
| 112 | Ga0070674_101008616 | 3300005356 | Unclassified | 731 |
| 113 | Ga0070673_100003366 | 3300005364 | Bacteria | 9946 |
| 114 | Ga0070673_100008456 | 3300005364 | Bacteria | 6844 |
| 115 | Ga0070673_100064718 | 3300005364 | Bacteria | 2914 |
| 116 | Ga0070673_100095320 | 3300005364 | Unclassified | 2441 |
| 117 | Ga0070673_100097585 | 3300005364 | Bacteria | 2413 |
| 118 | Ga0070673_100268636 | 3300005364 | Bacteria | 1492 |
| 119 | Ga0070673_100480693 | 3300005364 | Unclassified | 1121 |
| 120 | Ga0070688_100044989 | 3300005365 | Bacteria | 2725 |
| 121 | Ga0070688_100085816 | 3300005365 | Bacteria | 2047 |
| 122 | Ga0070688_100410758 | 3300005365 | Bacteria | 1004 |
| 123 | Ga0070659_100006001 | 3300005366 | Bacteria | 8760 |
| 124 | Ga0070659_100008916 | 3300005366 | Bacteria | 7351 |
| 125 | Ga0070659_100027932 | 3300005366 | Unclassified | 4352 |
| 126 | Ga0070659_100028076 | 3300005366 | Bacteria | 4342 |
| 127 | Ga0070659_100044634 | 3300005366 | Bacteria | 3471 |
| 128 | Ga0070667_100004550 | 3300005367 | Bacteria | 11671 |
| 129 | Ga0070667_100286419 | 3300005367 | Bacteria | 1481 |
| 130 | Ga0070667_100459554 | 3300005367 | Bacteria | 1164 |
| 131 | Ga0070667_100476776 | 3300005367 | Unclassified | 1142 |
| 132 | Ga0070667_101300591 | 3300005367 | Bacteria | 681 |
| 133 | Ga0070709_10021279 | 3300005434 | Unclassified | 3775 |
| 134 | Ga0070709_10156740 | 3300005434 | Bacteria | 1579 |
| 135 | Ga0070714_100099447 | 3300005435 | Bacteria | 2560 |
| 136 | Ga0070714_100214890 | 3300005435 | Unclassified | 1764 |
| 137 | Ga0070714_100284605 | 3300005435 | Unclassified | 1537 |
| 138 | Ga0070713_100000446 | 3300005436 | Bacteria | 26332 |
| 139 | Ga0070713_100004441 | 3300005436 | Bacteria | 9424 |
| 140 | Ga0070713_100005822 | 3300005436 | Bacteria | 8474 |
| 141 | Ga0070713_100019679 | 3300005436 | Bacteria | 5162 |
| 142 | Ga0070713_100132076 | 3300005436 | Unclassified | 2203 |
| 143 | Ga0070713_100552992 | 3300005436 | Bacteria | 1090 |
| 144 | Ga0070713_100570705 | 3300005436 | Bacteria | 1073 |
| 145 | Ga0070710_10009202 | 3300005437 | Unclassified | 4829 |
| 146 | Ga0070710_10169991 | 3300005437 | Unclassified | 1358 |
| 147 | Ga0070701_10015524 | 3300005438 | Bacteria | 3520 |
| 148 | Ga0070701_10088921 | 3300005438 | Bacteria | 1688 |
| 149 | Ga0070701_10551466 | 3300005438 | Bacteria | 756 |
| 150 | Ga0070711_100000290 | 3300005439 | Bacteria | 26042 |
| 151 | Ga0070711_100068974 | 3300005439 | Unclassified | 2486 |
| 152 | Ga0070711_100084180 | 3300005439 | Unclassified | 2274 |
| 153 | Ga0070711_100148168 | 3300005439 | Unclassified | 1767 |
| 154 | Ga0070711_100235217 | 3300005439 | Bacteria | 1430 |
| 155 | Ga0070711_100258084 | 3300005439 | Bacteria | 1370 |
| 156 | Ga0070711_100653018 | 3300005439 | Unclassified | 882 |
| 157 | Ga0070705_100015260 | 3300005440 | Bacteria | 3967 |
| 158 | Ga0070700_100000432 | 3300005441 | Bacteria | 21239 |
| 159 | Ga0070700_100157658 | 3300005441 | Bacteria | 1559 |
| 160 | Ga0070700_100169810 | 3300005441 | Unclassified | 1509 |
| 161 | Ga0070700_100182678 | 3300005441 | Unclassified | 1461 |
| 162 | Ga0070694_100026224 | 3300005444 | Bacteria | 3776 |
| 163 | Ga0070694_100083877 | 3300005444 | Unclassified | 2222 |
| 164 | Ga0070708_100371451 | 3300005445 | Unclassified | 1348 |
| 165 | Ga0070663_100152065 | 3300005455 | Bacteria | 1775 |
| 166 | Ga0070678_100000013 | 3300005456 | Bacteria | 57048 |
| 167 | Ga0070678_100045306 | 3300005456 | Bacteria | 3146 |
| 168 | Ga0070678_100184157 | 3300005456 | Bacteria | 1712 |
| 169 | Ga0070678_100496280 | 3300005456 | Bacteria | 1076 |
| 170 | Ga0070662_100013995 | 3300005457 | Bacteria | 5346 |
| 171 | Ga0070662_100099992 | 3300005457 | Bacteria | 2193 |
| 172 | Ga0070681_10001666 | 3300005458 | Bacteria | 19826 |
| 173 | Ga0070681_10014004 | 3300005458 | Bacteria | 7982 |
| 174 | Ga0070681_10044822 | 3300005458 | Bacteria | 4428 |
| 175 | Ga0068867_100000203 | 3300005459 | Bacteria | 39550 |
| 176 | Ga0068867_100003472 | 3300005459 | Bacteria | 11083 |
| 177 | Ga0070685_10001794 | 3300005466 | Bacteria | 11204 |
| 178 | Ga0070685_10010123 | 3300005466 | Bacteria | 4893 |
| 179 | Ga0070685_10012334 | 3300005466 | Bacteria | 4490 |
| 180 | Ga0070685_10272288 | 3300005466 | Bacteria | 1130 |
| 181 | Ga0070706_100024489 | 3300005467 | Bacteria | 5556 |
| 182 | Ga0070707_101101884 | 3300005468 | Unclassified | 760 |
| 183 | Ga0070698_100001691 | 3300005471 | Bacteria | 24608 |
| 184 | Ga0070699_100001008 | 3300005518 | Bacteria | 26211 |
| 185 | Ga0070699_100009056 | 3300005518 | Bacteria | 8626 |
| 186 | Ga0070699_100953537 | 3300005518 | Bacteria | 786 |
| 187 | Ga0070679_100001194 | 3300005530 | Bacteria | 22826 |
| 188 | Ga0070679_100009610 | 3300005530 | Bacteria | 9149 |
| 189 | Ga0070679_100621969 | 3300005530 | Unclassified | 1023 |
| 190 | Ga0070684_100004138 | 3300005535 | Bacteria | 10982 |
| 191 | Ga0070684_100090319 | 3300005535 | Bacteria | 2724 |
| 192 | Ga0070697_100001902 | 3300005536 | Bacteria | 15967 |
| 193 | Ga0070697_100935798 | 3300005536 | Unclassified | 769 |
| 194 | Ga0068853_100011567 | 3300005539 | Bacteria | 7175 |
| 195 | Ga0068853_100029389 | 3300005539 | Bacteria | 4633 |
| 196 | Ga0068853_100033712 | 3300005539 | Unclassified | 4344 |
| 197 | Ga0068853_100816655 | 3300005539 | Bacteria | 893 |
| 198 | Ga0070672_100000661 | 3300005543 | Bacteria | 20203 |
| 199 | Ga0070672_100024864 | 3300005543 | Bacteria | 4434 |
| 200 | Ga0070672_100029390 | 3300005543 | Bacteria | 4121 |
| 201 | Ga0070672_100034927 | 3300005543 | Bacteria | 3818 |
| 202 | Ga0070672_100114027 | 3300005543 | Bacteria | 2206 |
| 203 | Ga0070686_100003559 | 3300005544 | Bacteria | 8547 |
| 204 | Ga0070686_100014963 | 3300005544 | Bacteria | 4482 |
| 205 | Ga0070686_100078247 | 3300005544 | Bacteria | 2183 |
| 206 | Ga0070695_100005322 | 3300005545 | Bacteria | 7578 |
| 207 | Ga0070695_100202734 | 3300005545 | Bacteria | 1419 |
| 208 | Ga0070696_100000625 | 3300005546 | Bacteria | 22572 |
| 209 | Ga0070696_100037178 | 3300005546 | Bacteria | 3358 |
| 210 | Ga0070696_100664609 | 3300005546 | Bacteria | 846 |
| 211 | Ga0070693_100046904 | 3300005547 | Bacteria | 2456 |
| 212 | Ga0070665_100073119 | 3300005548 | Unclassified | 3435 |
| 213 | Ga0070665_100076157 | 3300005548 | Unclassified | 3362 |
| 214 | Ga0070665_100156858 | 3300005548 | Bacteria | 2278 |
| 215 | Ga0070665_100442842 | 3300005548 | Unclassified | 1308 |
| 216 | Ga0070665_100670775 | 3300005548 | Unclassified | 1050 |
| 217 | Ga0070665_100891151 | 3300005548 | Unclassified | 902 |
| 218 | Ga0070704_100029699 | 3300005549 | Bacteria | 3654 |
| 219 | Ga0068855_100049255 | 3300005563 | Bacteria | 4969 |
| 220 | Ga0070664_100003168 | 3300005564 | Bacteria | 13296 |
| 221 | Ga0070664_100003543 | 3300005564 | Bacteria | 12610 |
| 222 | Ga0070664_100005990 | 3300005564 | Bacteria | 9829 |
| 223 | Ga0070664_100026065 | 3300005564 | Bacteria | 4847 |
| 224 | Ga0070664_100028799 | 3300005564 | Unclassified | 4625 |
| 225 | Ga0070664_100053287 | 3300005564 | Bacteria | 3428 |
| 226 | Ga0070664_100082437 | 3300005564 | Unclassified | 2774 |
| 227 | Ga0068857_100007847 | 3300005577 | Bacteria | 9205 |
| 228 | Ga0068857_100095168 | 3300005577 | Bacteria | 2668 |
| 229 | Ga0068854_100020958 | 3300005578 | Bacteria | 4429 |
| 230 | Ga0068854_100681944 | 3300005578 | Bacteria | 885 |
| 231 | Ga0068856_100012904 | 3300005614 | Bacteria | 8086 |
| 232 | Ga0068856_100357876 | 3300005614 | Unclassified | 1478 |
| 233 | Ga0068856_100469258 | 3300005614 | Bacteria | 1279 |
| 234 | Ga0068852_100129931 | 3300005616 | Bacteria | 2318 |
| 235 | Ga0068859_100042252 | 3300005617 | Bacteria | 4579 |
| 236 | Ga0068859_100146076 | 3300005617 | Unclassified | 2440 |
| 237 | Ga0068859_100175726 | 3300005617 | Bacteria | 2223 |
| 238 | Ga0068859_100222905 | 3300005617 | Bacteria | 1973 |
| 239 | Ga0068859_100303296 | 3300005617 | Bacteria | 1690 |
| 240 | Ga0068864_100001672 | 3300005618 | Bacteria | 18248 |
| 241 | Ga0068864_100009474 | 3300005618 | Bacteria | 8036 |
| 242 | Ga0068864_100019584 | 3300005618 | Bacteria | 5660 |
| 243 | Ga0068864_100094454 | 3300005618 | Bacteria | 2643 |
| 244 | Ga0068864_100170967 | 3300005618 | Bacteria | 1981 |
| 245 | Ga0068864_101000370 | 3300005618 | Bacteria | 829 |
| 246 | Ga0068866_10006009 | 3300005718 | Bacteria | 5051 |
| 247 | Ga0068866_10032651 | 3300005718 | Bacteria | 2519 |
| 248 | Ga0068861_100015268 | 3300005719 | Bacteria | 5408 |
| 249 | Ga0068861_100032636 | 3300005719 | Bacteria | 3835 |
| 250 | Ga0068861_100047695 | 3300005719 | Bacteria | 3235 |
| 251 | Ga0068861_100197266 | 3300005719 | Bacteria | 1687 |
| 252 | Ga0068851_10009594 | 3300005834 | Bacteria | 4507 |
| 253 | Ga0068870_10006412 | 3300005840 | Bacteria | 5185 |
| 254 | Ga0068863_100003190 | 3300005841 | Bacteria | 16219 |
| 255 | Ga0068863_100044844 | 3300005841 | Bacteria | 4196 |
| 256 | Ga0068858_100105508 | 3300005842 | Bacteria | 2629 |
| 257 | Ga0068858_100166813 | 3300005842 | Bacteria | 2075 |
| 258 | Ga0068858_100783110 | 3300005842 | Bacteria | 930 |
| 259 | Ga0068860_100028516 | 3300005843 | Bacteria | 5374 |
| 260 | Ga0068860_100236396 | 3300005843 | Bacteria | 1776 |
| 261 | Ga0068860_100712035 | 3300005843 | Unclassified | 1014 |
| 262 | Ga0068862_100139331 | 3300005844 | Bacteria | 2152 |
| 263 | Ga0068862_100147891 | 3300005844 | Bacteria | 2089 |
| 264 | Ga0068862_100271823 | 3300005844 | Bacteria | 1550 |
| 265 | Ga0068862_100372854 | 3300005844 | Unclassified | 1329 |
| 266 | Ga0068862_100647899 | 3300005844 | Unclassified | 1019 |
| 267 | Ga0081455_10000317 | 3300005937 | Bacteria | 63219 |
| 268 | Ga0081455_10154161 | 3300005937 | Bacteria | 1768 |
| 269 | Ga0081538_10135380 | 3300005981 | Bacteria | 1148 |
| 270 | Ga0081540_1001614 | 3300005983 | Bacteria | 19225 |
| 271 | Ga0081540_1011995 | 3300005983 | Bacteria | 5742 |
| 272 | Ga0081539_10008569 | 3300005985 | Bacteria | 8845 |
| 273 | Ga0070717_10000457 | 3300006028 | Bacteria | 25932 |
| 274 | Ga0070717_10000640 | 3300006028 | Bacteria | 22510 |
| 275 | Ga0070717_10028291 | 3300006028 | Unclassified | 4485 |
| 276 | Ga0070717_10359903 | 3300006028 | Bacteria | 1302 |
| 277 | Ga0075365_10264685 | 3300006038 | Bacteria | 1209 |
| 278 | Ga0075364_10030978 | 3300006051 | Bacteria | 3436 |
| 279 | Ga0075364_10260225 | 3300006051 | Bacteria | 1179 |
| 280 | Ga0075432_10001421 | 3300006058 | Bacteria | 7794 |
| 281 | Ga0070715_10006086 | 3300006163 | Bacteria | 4077 |
| 282 | Ga0070716_100000456 | 3300006173 | Bacteria | 16938 |
| 283 | Ga0070716_100018178 | 3300006173 | Bacteria | 3658 |
| 284 | Ga0070712_100003988 | 3300006175 | Bacteria | 9072 |
| 285 | Ga0070712_100012277 | 3300006175 | Bacteria | 5445 |
| 286 | Ga0070712_100073097 | 3300006175 | Bacteria | 2458 |
| 287 | Ga0070712_100090640 | 3300006175 | Unclassified | 2238 |
| 288 | Ga0070712_100897724 | 3300006175 | Unclassified | 764 |
| 289 | Ga0075367_10006970 | 3300006178 | Bacteria | 5756 |
| 290 | Ga0097621_100003757 | 3300006237 | Bacteria | 10520 |
| 291 | Ga0097621_100116634 | 3300006237 | Bacteria | 2261 |
| 292 | Ga0097621_100470731 | 3300006237 | Bacteria | 1134 |
| 293 | Ga0075370_10366342 | 3300006353 | Bacteria | 862 |
| 294 | Ga0068871_100026581 | 3300006358 | Bacteria | 4518 |
| 295 | Ga0068871_100127951 | 3300006358 | Bacteria | 2151 |
| 296 | Ga0068871_100147170 | 3300006358 | Bacteria | 2006 |
| 297 | Ga0068871_100505326 | 3300006358 | Unclassified | 1090 |
| 298 | Ga0075428_100016539 | 3300006844 | Bacteria | 8145 |
| 299 | Ga0075428_100050123 | 3300006844 | Unclassified | 4579 |
| 300 | Ga0075428_100300288 | 3300006844 | Bacteria | 1726 |
| 301 | Ga0075428_100693233 | 3300006844 | Bacteria | 1085 |
| 302 | Ga0075430_100006387 | 3300006846 | Bacteria | 9938 |
| 303 | Ga0075430_100017058 | 3300006846 | Bacteria | 6185 |
| 304 | Ga0075430_100070526 | 3300006846 | Bacteria | 2931 |
| 305 | Ga0075430_100138300 | 3300006846 | Unclassified | 2028 |
| 306 | Ga0075430_100249948 | 3300006846 | Bacteria | 1469 |
| 307 | Ga0075431_100002813 | 3300006847 | Bacteria | 16835 |
| 308 | Ga0075431_100006181 | 3300006847 | Bacteria | 11885 |
| 309 | Ga0075431_100011175 | 3300006847 | Bacteria | 9040 |
| 310 | Ga0075431_100020745 | 3300006847 | Bacteria | 6714 |
| 311 | Ga0075431_100082302 | 3300006847 | Bacteria | 3322 |
| 312 | Ga0075431_100126092 | 3300006847 | Unclassified | 2641 |
| 313 | Ga0075431_100508026 | 3300006847 | Bacteria | 1196 |
| 314 | Ga0075433_10087922 | 3300006852 | Bacteria | 2745 |
| 315 | Ga0075433_10237061 | 3300006852 | Bacteria | 1620 |
| 316 | Ga0075434_100232013 | 3300006871 | Bacteria | 1865 |
| 317 | Ga0075434_100629677 | 3300006871 | Unclassified | 1091 |
| 318 | Ga0075429_100001748 | 3300006880 | Bacteria | 17994 |
| 319 | Ga0075429_100055210 | 3300006880 | Bacteria | 3456 |
| 320 | Ga0075429_100138859 | 3300006880 | Bacteria | 2127 |
| 321 | Ga0075429_100141131 | 3300006880 | Bacteria | 2109 |
| 322 | Ga0075429_100316892 | 3300006880 | Unclassified | 1365 |
| 323 | Ga0068865_100001611 | 3300006881 | Bacteria | 13222 |
| 324 | Ga0068865_100005765 | 3300006881 | Bacteria | 7528 |
| 325 | Ga0075436_100000125 | 3300006914 | Bacteria | 45485 |
| 326 | Ga0075436_100008160 | 3300006914 | Bacteria | 7169 |
| 327 | Ga0075436_100214558 | 3300006914 | Unclassified | 1365 |
| 328 | Ga0097620_100042254 | 3300006931 | Bacteria | 4579 |
| 329 | Ga0097620_100146070 | 3300006931 | Unclassified | 2440 |
| 330 | Ga0097620_100175715 | 3300006931 | Bacteria | 2223 |
| 331 | Ga0097620_100222905 | 3300006931 | Bacteria | 1973 |
| 332 | Ga0097620_100303296 | 3300006931 | Bacteria | 1690 |
| 333 | Ga0075435_100048583 | 3300007076 | Bacteria | 3409 |
| 334 | Ga0075435_100562231 | 3300007076 | Unclassified | 988 |
| 335 | Ga0099794_10007589 | 3300007265 | Unclassified | 4462 |
| 336 | Ga0099794_10242377 | 3300007265 | Bacteria | 929 |
| 337 | Ga0105250_10006934 | 3300009092 | Bacteria | 4905 |
| 338 | Ga0111539_10005667 | 3300009094 | Bacteria | 16156 |
| 339 | Ga0111539_10096679 | 3300009094 | Bacteria | 3469 |
| 340 | Ga0111539_10167164 | 3300009094 | Unclassified | 2571 |
| 341 | Ga0111539_10249666 | 3300009094 | Bacteria | 2066 |
| 342 | Ga0105245_10001382 | 3300009098 | Bacteria | 21973 |
| 343 | Ga0105245_10005295 | 3300009098 | Bacteria | 11336 |
| 344 | Ga0105247_10021179 | 3300009101 | Bacteria | 3912 |
| 345 | Ga0105247_10054329 | 3300009101 | Bacteria | 2471 |
| 346 | Ga0114129_10001427 | 3300009147 | Bacteria | 32269 |
| 347 | Ga0114129_10002913 | 3300009147 | Bacteria | 23937 |
| 348 | Ga0114129_10012627 | 3300009147 | Bacteria | 12025 |
| 349 | Ga0114129_10032531 | 3300009147 | Bacteria | 7370 |
| 350 | Ga0114129_10087188 | 3300009147 | Unclassified | 4329 |
| 351 | Ga0114129_10100200 | 3300009147 | Bacteria | 4008 |
| 352 | Ga0114129_10596540 | 3300009147 | Bacteria | 1432 |
| 353 | Ga0105243_10006158 | 3300009148 | Bacteria | 9275 |
| 354 | Ga0105243_10700356 | 3300009148 | Unclassified | 987 |
| 355 | Ga0105243_10800586 | 3300009148 | Unclassified | 929 |
| 356 | Ga0105241_10061881 | 3300009174 | Bacteria | 2884 |
| 357 | Ga0105241_10084292 | 3300009174 | Unclassified | 2495 |
| 358 | Ga0105241_10284557 | 3300009174 | Bacteria | 1413 |
| 359 | Ga0105241_10427869 | 3300009174 | Bacteria | 1166 |
| 360 | Ga0105242_10000602 | 3300009176 | Bacteria | 28181 |
| 361 | Ga0105242_10055443 | 3300009176 | Bacteria | 3242 |
| 362 | Ga0105242_10088069 | 3300009176 | Bacteria | 2607 |
| 363 | Ga0105248_10067628 | 3300009177 | Unclassified | 4011 |
| 364 | Ga0105248_10240083 | 3300009177 | Unclassified | 2040 |
| 365 | Ga0105248_10567349 | 3300009177 | Unclassified | 1280 |
| 366 | Ga0105237_10015273 | 3300009545 | Bacteria | 7998 |
| 367 | Ga0105237_10535059 | 3300009545 | Unclassified | 1178 |
| 368 | Ga0105238_10134128 | 3300009551 | Bacteria | 2454 |
| 369 | Ga0105238_10245370 | 3300009551 | Bacteria | 1769 |
| 370 | Ga0105238_10338958 | 3300009551 | Unclassified | 1491 |
| 371 | Ga0105249_10008227 | 3300009553 | Bacteria | 9083 |
| 372 | Ga0105249_10060525 | 3300009553 | Bacteria | 3474 |
| 373 | Ga0105249_10219634 | 3300009553 | Bacteria | 1870 |
| 374 | Ga0105239_10024492 | 3300010375 | Bacteria | 6649 |
| 375 | Ga0105239_10039827 | 3300010375 | Bacteria | 5148 |
| 376 | Ga0105246_10000247 | 3300011119 | Bacteria | 27878 |
| 377 | Ga0105246_10024334 | 3300011119 | Bacteria | 3932 |
| 378 | Ga0157373_10047337 | 3300013100 | Bacteria | 3067 |
| 379 | Ga0157373_10165207 | 3300013100 | Bacteria | 1558 |
| 380 | Ga0157371_10029266 | 3300013102 | Bacteria | 3985 |
| 381 | Ga0157371_10035234 | 3300013102 | Bacteria | 3587 |
| 382 | Ga0157369_10047314 | 3300013105 | Unclassified | 4671 |
| 383 | Ga0157369_10400120 | 3300013105 | Bacteria | 1425 |
| 384 | Ga0157374_10001511 | 3300013296 | Bacteria | 19594 |
| 385 | Ga0157374_10020434 | 3300013296 | Bacteria | 5875 |
| 386 | Ga0157374_10033741 | 3300013296 | Unclassified | 4671 |
| 387 | Ga0157374_10046186 | 3300013296 | Unclassified | 4032 |
| 388 | Ga0157374_10050881 | 3300013296 | Bacteria | 3853 |
| 389 | Ga0157374_10093200 | 3300013296 | Bacteria | 2875 |
| 390 | Ga0157374_10236335 | 3300013296 | Bacteria | 1796 |
| 391 | Ga0157374_10465671 | 3300013296 | Bacteria | 1266 |
| 392 | Ga0157378_10000734 | 3300013297 | Bacteria | 30654 |
| 393 | Ga0157378_10218492 | 3300013297 | Bacteria | 1811 |
| 394 | Ga0163162_10127638 | 3300013306 | Bacteria | 2651 |
| 395 | Ga0163162_10130752 | 3300013306 | Unclassified | 2619 |
| 396 | Ga0163162_10666351 | 3300013306 | Bacteria | 1164 |
| 397 | Ga0157372_10129699 | 3300013307 | Bacteria | 2900 |
| 398 | Ga0157372_10190616 | 3300013307 | Bacteria | 2375 |
| 399 | Ga0157372_10247815 | 3300013307 | Unclassified | 2067 |
| 400 | Ga0157372_10469251 | 3300013307 | Unclassified | 1467 |
| 401 | Ga0157375_10014212 | 3300013308 | Bacteria | 7096 |
| 402 | Ga0157375_10106874 | 3300013308 | Bacteria | 2891 |
| 403 | Ga0157375_10120104 | 3300013308 | Unclassified | 2736 |
| 404 | Ga0163163_10000851 | 3300014325 | Bacteria | 25945 |
| 405 | Ga0163163_10003753 | 3300014325 | Bacteria | 12934 |
| 406 | Ga0163163_10004565 | 3300014325 | Bacteria | 11820 |
| 407 | Ga0163163_10005139 | 3300014325 | Bacteria | 11281 |
| 408 | Ga0163163_10012863 | 3300014325 | Bacteria | 7638 |
| 409 | Ga0163163_10032241 | 3300014325 | Bacteria | 5060 |
| 410 | Ga0163163_10053430 | 3300014325 | Unclassified | 3987 |
| 411 | Ga0163163_10064502 | 3300014325 | Unclassified | 3634 |
| 412 | Ga0163163_10142769 | 3300014325 | Unclassified | 2437 |
| 413 | Ga0157380_10013441 | 3300014326 | Bacteria | 5967 |
| 414 | Ga0157377_10004292 | 3300014745 | Bacteria | 6539 |
| 415 | Ga0157377_10008341 | 3300014745 | Bacteria | 5050 |
| 416 | Ga0157377_10030048 | 3300014745 | Bacteria | 2940 |
| 417 | Ga0157379_10080723 | 3300014968 | Bacteria | 2914 |
| 418 | Ga0157379_10218159 | 3300014968 | Bacteria | 1728 |
| 419 | Ga0157376_10002681 | 3300014969 | Bacteria | 12101 |
| 420 | Ga0157376_10028783 | 3300014969 | Bacteria | 4420 |
| 421 | Ga0157376_10085325 | 3300014969 | Bacteria | 2720 |
| 422 | Ga0157376_10086291 | 3300014969 | Bacteria | 2706 |
| 423 | Ga0157376_10088980 | 3300014969 | Bacteria | 2669 |
| 424 | Ga0157376_10091677 | 3300014969 | Bacteria | 2633 |
| 425 | Ga0157376_10101979 | 3300014969 | Unclassified | 2509 |
| 426 | Ga0157376_10531900 | 3300014969 | Bacteria | 1160 |
| 427 | Ga0163161_10032686 | 3300017792 | Bacteria | 3716 |
| 428 | Ga0213874_10002459 | 3300021377 | Bacteria | 3996 |
| 429 | Ga0228598_1010024 | 3300024227 | Bacteria | 1890 |
| 430 | Ga0209437_104073 | 3300025233 | Bacteria | 2590 |
| 431 | Ga0209233_1009661 | 3300025261 | Bacteria | 2927 |
| 432 | Ga0207697_10119407 | 3300025315 | Bacteria | 1134 |
| 433 | Ga0207656_10258178 | 3300025321 | Bacteria | 855 |
| 434 | Ga0207682_10009860 | 3300025893 | Bacteria | 3756 |
| 435 | Ga0207682_10015444 | 3300025893 | Bacteria | 2972 |
| 436 | Ga0207682_10078681 | 3300025893 | Bacteria | 1409 |
| 437 | Ga0207642_10003372 | 3300025899 | Bacteria | 5035 |
| 438 | Ga0207642_10027177 | 3300025899 | Bacteria | 2339 |
| 439 | Ga0207710_10041483 | 3300025900 | Unclassified | 2041 |
| 440 | Ga0207710_10047049 | 3300025900 | Bacteria | 1927 |
| 441 | Ga0207710_10279503 | 3300025900 | Bacteria | 840 |
| 442 | Ga0207688_10001619 | 3300025901 | Bacteria | 11878 |
| 443 | Ga0207688_10046618 | 3300025901 | Unclassified | 2420 |
| 444 | Ga0207680_10070369 | 3300025903 | Bacteria | 2165 |
| 445 | Ga0207680_10210165 | 3300025903 | Bacteria | 1330 |
| 446 | Ga0207647_10012575 | 3300025904 | Bacteria | 5886 |
| 447 | Ga0207647_10209736 | 3300025904 | Bacteria | 1125 |
| 448 | Ga0207685_10003175 | 3300025905 | Bacteria | 3945 |
| 449 | Ga0207685_10061451 | 3300025905 | Unclassified | 1489 |
| 450 | Ga0207699_10001273 | 3300025906 | Bacteria | 11974 |
| 451 | Ga0207645_10000024 | 3300025907 | Bacteria | 98683 |
| 452 | Ga0207645_10000423 | 3300025907 | Bacteria | 35040 |
| 453 | Ga0207645_10062283 | 3300025907 | Unclassified | 2383 |
| 454 | Ga0207643_10000124 | 3300025908 | Bacteria | 53060 |
| 455 | Ga0207643_10180174 | 3300025908 | Bacteria | 1278 |
| 456 | Ga0207705_10209431 | 3300025909 | Unclassified | 1479 |
| 457 | Ga0207684_10075169 | 3300025910 | Bacteria | 2871 |
| 458 | Ga0207654_10084326 | 3300025911 | Bacteria | 1921 |
| 459 | Ga0207707_10073794 | 3300025912 | Bacteria | 2975 |
| 460 | Ga0207671_10269178 | 3300025914 | Bacteria | 1342 |
| 461 | Ga0207671_10340218 | 3300025914 | Unclassified | 1189 |
| 462 | Ga0207693_10000012 | 3300025915 | Bacteria | 154708 |
| 463 | Ga0207693_10011931 | 3300025915 | Bacteria | 7023 |
| 464 | Ga0207693_10016315 | 3300025915 | Bacteria | 5938 |
| 465 | Ga0207693_10151681 | 3300025915 | Bacteria | 1823 |
| 466 | Ga0207693_10155182 | 3300025915 | Unclassified | 1800 |
| 467 | Ga0207663_10001246 | 3300025916 | Bacteria | 11776 |
| 468 | Ga0207663_10114196 | 3300025916 | Unclassified | 1838 |
| 469 | Ga0207663_10515203 | 3300025916 | Unclassified | 931 |
| 470 | Ga0207663_10550709 | 3300025916 | Unclassified | 902 |
| 471 | Ga0207663_10786263 | 3300025916 | Unclassified | 757 |
| 472 | Ga0207660_10037799 | 3300025917 | Bacteria | 3366 |
| 473 | Ga0207662_10004785 | 3300025918 | Bacteria | 7155 |
| 474 | Ga0207662_10118812 | 3300025918 | Bacteria | 1656 |
| 475 | Ga0207657_10000221 | 3300025919 | Bacteria | 59396 |
| 476 | Ga0207657_10007622 | 3300025919 | Bacteria | 11076 |
| 477 | Ga0207657_10051804 | 3300025919 | Bacteria | 3566 |
| 478 | Ga0207649_10000180 | 3300025920 | Bacteria | 52042 |
| 479 | Ga0207649_10005050 | 3300025920 | Bacteria | 7136 |
| 480 | Ga0207652_10032513 | 3300025921 | Bacteria | 4387 |
| 481 | Ga0207652_10145434 | 3300025921 | Bacteria | 2121 |
| 482 | Ga0207652_10402515 | 3300025921 | Unclassified | 1235 |
| 483 | Ga0207646_10004882 | 3300025922 | Bacteria | 14364 |
| 484 | Ga0207681_10079641 | 3300025923 | Bacteria | 2308 |
| 485 | Ga0207681_10165469 | 3300025923 | Bacteria | 1671 |
| 486 | Ga0207681_10330573 | 3300025923 | Unclassified | 1215 |
| 487 | Ga0207681_10340972 | 3300025923 | Unclassified | 1197 |
| 488 | Ga0207650_10000169 | 3300025925 | Bacteria | 77854 |
| 489 | Ga0207650_10001408 | 3300025925 | Bacteria | 17336 |
| 490 | Ga0207650_10014788 | 3300025925 | Bacteria | 5427 |
| 491 | Ga0207659_10015050 | 3300025926 | Bacteria | 5003 |
| 492 | Ga0207659_10043489 | 3300025926 | Bacteria | 3155 |
| 493 | Ga0207659_10047763 | 3300025926 | Bacteria | 3029 |
| 494 | Ga0207659_10114637 | 3300025926 | Bacteria | 2054 |
| 495 | Ga0207659_10379876 | 3300025926 | Unclassified | 1178 |
| 496 | Ga0207687_10046903 | 3300025927 | Bacteria | 2993 |
| 497 | Ga0207687_10193160 | 3300025927 | Bacteria | 1586 |
| 498 | Ga0207700_10001077 | 3300025928 | Bacteria | 15752 |
| 499 | Ga0207700_10009434 | 3300025928 | Bacteria | 6095 |
| 500 | Ga0207700_10056383 | 3300025928 | Bacteria | 2958 |
| 501 | Ga0207700_10130929 | 3300025928 | Bacteria | 2048 |
| 502 | Ga0207700_10218240 | 3300025928 | Unclassified | 1615 |
| 503 | Ga0207664_10096666 | 3300025929 | Bacteria | 2432 |
| 504 | Ga0207664_10281999 | 3300025929 | Unclassified | 1458 |
| 505 | Ga0207644_10001371 | 3300025931 | Bacteria | 15674 |
| 506 | Ga0207644_10018027 | 3300025931 | Bacteria | 4772 |
| 507 | Ga0207644_10220962 | 3300025931 | Unclassified | 1502 |
| 508 | Ga0207690_10011744 | 3300025932 | Bacteria | 5238 |
| 509 | Ga0207690_10061745 | 3300025932 | Bacteria | 2549 |
| 510 | Ga0207706_10000080 | 3300025933 | Bacteria | 99912 |
| 511 | Ga0207706_10000366 | 3300025933 | Bacteria | 48929 |
| 512 | Ga0207686_10013826 | 3300025934 | Bacteria | 4477 |
| 513 | Ga0207686_10106275 | 3300025934 | Bacteria | 1884 |
| 514 | Ga0207709_10005246 | 3300025935 | Bacteria | 7373 |
| 515 | Ga0207709_10467233 | 3300025935 | Unclassified | 978 |
| 516 | Ga0207670_10010130 | 3300025936 | Bacteria | 5412 |
| 517 | Ga0207670_10032756 | 3300025936 | Bacteria | 3344 |
| 518 | Ga0207670_10081043 | 3300025936 | Bacteria | 2270 |
| 519 | Ga0207670_10154336 | 3300025936 | Bacteria | 1707 |
| 520 | Ga0207669_10015753 | 3300025937 | Bacteria | 3821 |
| 521 | Ga0207669_10046738 | 3300025937 | Bacteria | 2560 |
| 522 | Ga0207669_10103835 | 3300025937 | Bacteria | 1886 |
| 523 | Ga0207669_10283784 | 3300025937 | Bacteria | 1250 |
| 524 | Ga0207704_10018158 | 3300025938 | Bacteria | 3666 |
| 525 | Ga0207665_10005926 | 3300025939 | Bacteria | 8135 |
| 526 | Ga0207665_10021474 | 3300025939 | Bacteria | 4245 |
| 527 | Ga0207665_10266423 | 3300025939 | Unclassified | 1271 |
| 528 | Ga0207665_10384327 | 3300025939 | Bacteria | 1066 |
| 529 | Ga0207691_10000099 | 3300025940 | Bacteria | 76056 |
| 530 | Ga0207691_10003081 | 3300025940 | Bacteria | 16266 |
| 531 | Ga0207691_10043780 | 3300025940 | Bacteria | 4124 |
| 532 | Ga0207691_10062991 | 3300025940 | Bacteria | 3364 |
| 533 | Ga0207691_10080549 | 3300025940 | Bacteria | 2928 |
| 534 | Ga0207711_10068304 | 3300025941 | Bacteria | 3078 |
| 535 | Ga0207711_10083079 | 3300025941 | Unclassified | 2801 |
| 536 | Ga0207711_10116368 | 3300025941 | Bacteria | 2383 |
| 537 | Ga0207689_10000517 | 3300025942 | Bacteria | 36643 |
| 538 | Ga0207689_10142992 | 3300025942 | Unclassified | 1971 |
| 539 | Ga0207661_10006657 | 3300025944 | Bacteria | 8170 |
| 540 | Ga0207661_10015684 | 3300025944 | Bacteria | 5582 |
| 541 | Ga0207661_10406371 | 3300025944 | Bacteria | 1235 |
| 542 | Ga0207679_10000179 | 3300025945 | Bacteria | 52312 |
| 543 | Ga0207679_10005133 | 3300025945 | Bacteria | 8196 |
| 544 | Ga0207679_10033358 | 3300025945 | Bacteria | 3622 |
| 545 | Ga0207679_10100186 | 3300025945 | Bacteria | 2264 |
| 546 | Ga0207679_10159360 | 3300025945 | Unclassified | 1846 |
| 547 | Ga0207679_10166873 | 3300025945 | Bacteria | 1808 |
| 548 | Ga0207667_10165114 | 3300025949 | Bacteria | 2276 |
| 549 | Ga0207667_10240803 | 3300025949 | Bacteria | 1851 |
| 550 | Ga0207651_10005383 | 3300025960 | Bacteria | 6565 |
| 551 | Ga0207651_10032120 | 3300025960 | Bacteria | 3367 |
| 552 | Ga0207651_10275180 | 3300025960 | Bacteria | 1388 |
| 553 | Ga0207668_10041648 | 3300025972 | Bacteria | 3106 |
| 554 | Ga0207668_10057176 | 3300025972 | Bacteria | 2720 |
| 555 | Ga0207668_10086768 | 3300025972 | Bacteria | 2287 |
| 556 | Ga0207668_10165379 | 3300025972 | Unclassified | 1729 |
| 557 | Ga0207658_10005794 | 3300025986 | Bacteria | 8455 |
| 558 | Ga0207658_10155387 | 3300025986 | Bacteria | 1869 |
| 559 | Ga0207658_10421333 | 3300025986 | Unclassified | 1177 |
| 560 | Ga0207677_10030182 | 3300026023 | Bacteria | 3456 |
| 561 | Ga0207677_10110724 | 3300026023 | Bacteria | 2044 |
| 562 | Ga0207703_10007980 | 3300026035 | Bacteria | 8366 |
| 563 | Ga0207703_10114163 | 3300026035 | Bacteria | 2309 |
| 564 | Ga0207703_10511531 | 3300026035 | Bacteria | 1128 |
| 565 | Ga0207703_10698077 | 3300026035 | Bacteria | 965 |
| 566 | Ga0207639_10020765 | 3300026041 | Bacteria | 4707 |
| 567 | Ga0207639_10025268 | 3300026041 | Unclassified | 4306 |
| 568 | Ga0207639_10766950 | 3300026041 | Bacteria | 897 |
| 569 | Ga0207678_10000037 | 3300026067 | Bacteria | 102480 |
| 570 | Ga0207708_10000072 | 3300026075 | Bacteria | 81023 |
| 571 | Ga0207708_10304673 | 3300026075 | Unclassified | 1297 |
| 572 | Ga0207702_10063066 | 3300026078 | Bacteria | 3168 |
| 573 | Ga0207702_10176041 | 3300026078 | Unclassified | 1966 |
| 574 | Ga0207641_10000086 | 3300026088 | Bacteria | 133444 |
| 575 | Ga0207641_10178084 | 3300026088 | Bacteria | 1945 |
| 576 | Ga0207648_10000057 | 3300026089 | Bacteria | 104605 |
| 577 | Ga0207648_10000295 | 3300026089 | Bacteria | 54257 |
| 578 | Ga0207676_10000250 | 3300026095 | Bacteria | 46725 |
| 579 | Ga0207676_10005175 | 3300026095 | Bacteria | 9225 |
| 580 | Ga0207676_10011556 | 3300026095 | Bacteria | 6315 |
| 581 | Ga0207676_10068919 | 3300026095 | Bacteria | 2831 |
| 582 | Ga0207676_10297141 | 3300026095 | Unclassified | 1473 |
| 583 | Ga0207674_10000070 | 3300026116 | Bacteria | 106245 |
| 584 | Ga0207674_10000115 | 3300026116 | Bacteria | 93114 |
| 585 | Ga0207674_10013599 | 3300026116 | Bacteria | 9017 |
| 586 | Ga0207674_10465183 | 3300026116 | Bacteria | 1222 |
| 587 | Ga0207675_100037764 | 3300026118 | Bacteria | 4505 |
| 588 | Ga0207675_100093728 | 3300026118 | Bacteria | 2825 |
| 589 | Ga0207675_100161017 | 3300026118 | Bacteria | 2140 |
| 590 | Ga0207675_100757936 | 3300026118 | Bacteria | 982 |
| 591 | Ga0207683_10000036 | 3300026121 | Bacteria | 101173 |
| 592 | Ga0207683_10000062 | 3300026121 | Bacteria | 81362 |
| 593 | Ga0207683_10345498 | 3300026121 | Bacteria | 1365 |
| 594 | Ga0207683_10411444 | 3300026121 | Bacteria | 1245 |
| 595 | Ga0207683_10534959 | 3300026121 | Bacteria | 1083 |
| 596 | Ga0207683_10834977 | 3300026121 | Bacteria | 855 |
| 597 | Ga0207698_10555309 | 3300026142 | Bacteria | 1126 |
| 598 | Ga0209973_1002144 | 3300027252 | Bacteria | 1811 |
| 599 | Ga0209969_1000031 | 3300027360 | Bacteria | 17279 |
| 600 | Ga0209967_1000195 | 3300027364 | Bacteria | 8586 |
| 601 | Ga0209981_1000029 | 3300027378 | Bacteria | 14346 |
| 602 | Ga0209996_1000032 | 3300027395 | Bacteria | 21561 |
| 603 | Ga0209984_1000086 | 3300027424 | Bacteria | 10244 |
| 604 | Ga0210000_1000004 | 3300027462 | Bacteria | 39716 |
| 605 | Ga0209995_1000199 | 3300027471 | Bacteria | 9581 |
| 606 | Ga0209968_1000015 | 3300027526 | Bacteria | 36548 |
| 607 | Ga0209999_1000108 | 3300027543 | Bacteria | 10159 |
| 608 | Ga0209982_1000941 | 3300027552 | Bacteria | 3839 |
| 609 | Ga0209970_1000033 | 3300027614 | Bacteria | 18012 |
| 610 | Ga0209970_1005674 | 3300027614 | Bacteria | 2056 |
| 611 | Ga0210002_1000009 | 3300027617 | Bacteria | 29971 |
| 612 | Ga0209983_1001657 | 3300027665 | Bacteria | 4929 |
| 613 | Ga0209588_1040555 | 3300027671 | Bacteria | 1502 |
| 614 | Ga0209971_1004115 | 3300027682 | Bacteria | 3445 |
| 615 | Ga0209966_1000012 | 3300027695 | Bacteria | 83147 |
| 616 | Ga0209998_10000174 | 3300027717 | Bacteria | 23823 |
| 617 | Ga0209974_10000002 | 3300027876 | Bacteria | 70010 |
| 618 | Ga0209974_10000042 | 3300027876 | Bacteria | 31277 |
| 619 | Ga0207428_10000476 | 3300027907 | Bacteria | 48340 |
| 620 | Ga0207428_10015716 | 3300027907 | Bacteria | 6538 |
| 621 | Ga0265354_1000450 | 3300028016 | Bacteria | 7156 |
| 622 | Ga0268266_10013719 | 3300028379 | Bacteria | 6978 |
| 623 | Ga0268266_10022015 | 3300028379 | Bacteria | 5433 |
| 624 | Ga0268266_10153858 | 3300028379 | Unclassified | 2075 |
| 625 | Ga0268266_10307546 | 3300028379 | Bacteria | 1480 |
| 626 | Ga0268266_10587085 | 3300028379 | Bacteria | 1069 |
| 627 | Ga0268265_10119899 | 3300028380 | Bacteria | 2165 |
| 628 | Ga0268265_10308423 | 3300028380 | Bacteria | 1428 |
| 629 | Ga0268265_10381806 | 3300028380 | Bacteria | 1296 |
| 630 | Ga0268264_10173486 | 3300028381 | Bacteria | 1952 |
| 631 | Ga0268264_10225820 | 3300028381 | Bacteria | 1726 |
| 632 | Ga0268264_10411226 | 3300028381 | Bacteria | 1302 |
| 633 | Ga0307511_10315651 | 3300030521 | Bacteria | 695 |
| 634 | Ga0307408_100015580 | 3300031548 | Bacteria | 5063 |
| 635 | Ga0307408_100039816 | 3300031548 | Unclassified | 3325 |
| 636 | Ga0307408_100090530 | 3300031548 | Unclassified | 2309 |
| 637 | Ga0307408_101125577 | 3300031548 | Bacteria | 729 |
| 638 | Ga0307405_10002372 | 3300031731 | Bacteria | 8290 |
| 639 | Ga0307405_10082369 | 3300031731 | Bacteria | 2106 |
| 640 | Ga0307405_10241361 | 3300031731 | Unclassified | 1338 |
| 641 | Ga0307413_10037311 | 3300031824 | Unclassified | 2806 |
| 642 | Ga0307413_10056625 | 3300031824 | Bacteria | 2392 |
| 643 | Ga0307413_10447019 | 3300031824 | Bacteria | 1025 |
| 644 | Ga0307413_10528424 | 3300031824 | Bacteria | 953 |
| 645 | Ga0307410_10090755 | 3300031852 | Bacteria | 2168 |
| 646 | Ga0307406_10434351 | 3300031901 | Bacteria | 1049 |
| 647 | Ga0307407_10013753 | 3300031903 | Bacteria | 3939 |
| 648 | Ga0307412_10025662 | 3300031911 | Bacteria | 3652 |
| 649 | Ga0307412_10098662 | 3300031911 | Unclassified | 2060 |
| 650 | Ga0307409_100002548 | 3300031995 | Bacteria | 9560 |
| 651 | Ga0307409_100007567 | 3300031995 | Bacteria | 6509 |
| 652 | Ga0307409_100647469 | 3300031995 | Bacteria | 1050 |
| 653 | Ga0307409_100957791 | 3300031995 | Unclassified | 872 |
| 654 | Ga0307416_100006905 | 3300032002 | Bacteria | 7150 |
| 655 | Ga0307416_100010002 | 3300032002 | Bacteria | 6244 |
| 656 | Ga0307416_100018688 | 3300032002 | Bacteria | 4892 |
| 657 | Ga0307416_100304964 | 3300032002 | Bacteria | 1585 |
| 658 | Ga0307416_100949170 | 3300032002 | Bacteria | 962 |
| 659 | Ga0307414_10063777 | 3300032004 | Bacteria | 2620 |
| 660 | Ga0307414_10365529 | 3300032004 | Bacteria | 1243 |
| 661 | Ga0307414_10423846 | 3300032004 | Bacteria | 1161 |
| 662 | Ga0307411_10016505 | 3300032005 | Bacteria | 4181 |
| 663 | Ga0307411_10049832 | 3300032005 | Unclassified | 2724 |
| 664 | Ga0307411_10107907 | 3300032005 | Bacteria | 1985 |
| 665 | Ga0307411_10587004 | 3300032005 | Unclassified | 956 |
| 666 | Ga0307415_100014091 | 3300032126 | Unclassified | 4687 |
| 667 | Ga0307415_100019282 | 3300032126 | Unclassified | 4139 |
| 668 | Ga0307415_100117518 | 3300032126 | Bacteria | 1986 |
| 669 | Ga0307415_100123424 | 3300032126 | Unclassified | 1947 |
| 670 | Ga0373926_0000496 | 3300035083 | Bacteria | 10450 |
| 671 | Ga0373944_0033688 | 3300035089 | Unclassified | 1553 |
| 672 | Ga0373932_0071046 | 3300035112 | Bacteria | 1080 |
| 673 | Ga0373936_0003091 | 3300035113 | Bacteria | 6231 |
| 674 | Ga0373945_0015892 | 3300035116 | Bacteria | 2536 |
| 675 | Ga0373945_0063992 | 3300035116 | Unclassified | 1378 |
| 676 | Ga0373953_0003091 | 3300035117 | Bacteria | 5118 |
| 677 | Ga0373954_0000521 | 3300035118 | Bacteria | 14444 |
| 678 | Ga0373956_0030116 | 3300035119 | Unclassified | 2370 |
| 679 | Ga0373957_0178489 | 3300035120 | Unclassified | 879 |
| 680 | Ga0373960_0049852 | 3300035121 | Bacteria | 1239 |
| 681 | Ga0373943_0006242 | 3300035170 | Bacteria | 5353 |
| 682 | Ga0373943_0087967 | 3300035170 | Bacteria | 1604 |
| 683 | Ga0373946_0016628 | 3300035171 | Bacteria | 2805 |
| 684 | Ga0373946_0058360 | 3300035171 | Unclassified | 1635 |
| 685 | Ga0373942_0075039 | 3300035207 | Unclassified | 994 |
| 686 | Ga0373961_0041572 | 3300035241 | Bacteria | 1329 |
| 687 | Ga0373961_0064729 | 3300035241 | Bacteria | 1118 |
| 688 | Ga0373935_0008767 | 3300035692 | Bacteria | 6060 |
| 689 | Ga0373935_0226042 | 3300035692 | Bacteria | 1302 |
| 690 | Ga0373935_0263477 | 3300035692 | Unclassified | 1209 |
| 691 | Ga0373927_0019011 | 3300035695 | Unclassified | 4507 |
| 692 | Ga0373933_0009697 | 3300035724 | Bacteria | 5267 |
| 693 | Ga0373933_0139133 | 3300035724 | Bacteria | 1532 |
| 694 | Ga0373947_0529287 | 3300035725 | Bacteria | 802 |
| 695 | Ga0373937_0002978 | 3300036401 | Bacteria | 14186 |
| 696 | Ga0373937_0426274 | 3300036401 | Unclassified | 1259 |
| 697 | Ga0373937_0895208 | 3300036401 | Bacteria | 836 |
| 698 | Ga0373937_1052574 | 3300036401 | Bacteria | 762 |
| 699 | Ga0373925_0001055 | 3300037068 | Bacteria | 24976 |
| 700 | Ga0373925_0034065 | 3300037068 | Bacteria | 3754 |
| 701 | Ga0395901_0931028 | 3300038443 | Unclassified | 849 |
| 702 | Ga0436365_0249650 | 3300039437 | Bacteria | 1032 |
| 703 | Ga0436365_1320079 | 3300039437 | Bacteria | 721 |
| 704 | Ga0436360_1227145 | 3300039438 | Bacteria | 1639 |
| 705 | Ga0436361_0839417 | 3300039447 | Unclassified | 796 |
| 706 | Ga0436363_0165098 | 3300039450 | Bacteria | 4747 |
| 707 | Ga0436363_0931942 | 3300039450 | Unclassified | 1095 |
| 708 | Ga0436362_1266166 | 3300039453 | Unclassified | 1050 |
| 709 | Ga0439466_0023643 | 3300041411 | Archaea | 2160 |
| 710 | Ga0451807_1807335 | 3300041486 | Bacteria | 1933 |
| 711 | Ga0439431_0130234 | 3300041997 | Unclassified | 706 |
| 712 | Ga0439432_007270 | 3300042006 | Bacteria | 3932 |
| 713 | Ga0439446_0010583 | 3300042156 | Unclassified | 2487 |
| 714 | Ga0439460_0026035 | 3300042461 | Bacteria | 1634 |
| 715 | Ga0451576_0002672 | 3300045051 | Bacteria | 25967 |
| 716 | Ga0451576_0273911 | 3300045051 | Bacteria | 1764 |
| 717 | Ga0451576_0355237 | 3300045051 | Unclassified | 1534 |
| 718 | Ga0495592_0037197 | 3300046454 | Unclassified | 3665 |
| 719 | Ga0495651_0000387 | 3300046462 | Bacteria | 34039 |
| 720 | Ga0495651_0099452 | 3300046462 | Unclassified | 2169 |
| 721 | Ga0495650_0000041 | 3300046471 | Bacteria | 363945 |
| 722 | Ga0495580_0000266 | 3300046472 | Bacteria | 41949 |
| 723 | Ga0495580_0000558 | 3300046472 | Bacteria | 31485 |
| 724 | Ga0495580_0277544 | 3300046472 | Unclassified | 1144 |
| 725 | Ga0495580_0344767 | 3300046472 | Unclassified | 1010 |
| 726 | Ga0495580_0595230 | 3300046472 | Bacteria | 731 |
| 727 | Ga0495582_0000315 | 3300046473 | Bacteria | 26627 |
| 728 | Ga0495582_0002636 | 3300046473 | Bacteria | 9999 |
| 729 | Ga0495605_0191138 | 3300046474 | Unclassified | 896 |
| 730 | Ga0495594_0032636 | 3300046499 | Bacteria | 2827 |
| 731 | Ga0495628_0085382 | 3300046516 | Bacteria | 2449 |
| 732 | Ga0495652_0532952 | 3300046529 | Unclassified | 810 |
| 733 | Ga0495665_0000962 | 3300046531 | Bacteria | 15239 |
| 734 | Ga0495665_0068730 | 3300046531 | Bacteria | 1868 |
| 735 | Ga0495640_0067085 | 3300046533 | Bacteria | 2418 |
| 736 | Ga0495640_0195082 | 3300046533 | Bacteria | 1286 |
| 737 | Ga0495586_0197856 | 3300046535 | Bacteria | 1139 |
| 738 | Ga0495586_0309838 | 3300046535 | Unclassified | 905 |
| 739 | Ga0495587_0014393 | 3300046536 | Unclassified | 4964 |
| 740 | Ga0495598_0012875 | 3300046537 | Bacteria | 2063 |
| 741 | Ga0495621_0016395 | 3300046539 | Bacteria | 2378 |
| 742 | Ga0495645_0047887 | 3300046543 | Bacteria | 3114 |
| 743 | Ga0495645_0079517 | 3300046543 | Bacteria | 2355 |
| 744 | Ga0495645_0459927 | 3300046543 | Bacteria | 801 |
| 745 | Ga0495622_0430712 | 3300046557 | Unclassified | 566 |
| 746 | Ga0495633_0031518 | 3300046558 | Bacteria | 2569 |
| 747 | Ga0495667_0298798 | 3300046559 | Unclassified | 1020 |
| 748 | Ga0495634_0040705 | 3300046642 | Bacteria | 3158 |
| 749 | Ga0495625_0259163 | 3300046660 | Bacteria | 1126 |
| 750 | Ga0495599_0483628 | 3300046678 | Unclassified | 730 |
| 751 | Ga0495623_0028058 | 3300046679 | Bacteria | 3624 |
| 752 | Ga0495623_0053194 | 3300046679 | Unclassified | 2557 |
| 753 | Ga0495658_0197002 | 3300046683 | Unclassified | 1254 |
| 754 | Ga0495669_0017460 | 3300046684 | Bacteria | 3081 |
| 755 | Ga0495669_0034444 | 3300046684 | Bacteria | 2233 |
| 756 | Ga0495669_0111259 | 3300046684 | Bacteria | 1279 |
| 757 | Ga0495669_0128233 | 3300046684 | Unclassified | 1193 |
| 758 | Ga0495670_0076731 | 3300046691 | Bacteria | 1698 |
| 759 | Ga0495581_0039645 | 3300047315 | Unclassified | 2727 |
| 760 | Ga0495581_0298589 | 3300047315 | Unclassified | 941 |
| 761 | Ga0495604_0001638 | 3300047317 | Bacteria | 18396 |
| 762 | Ga0495674_0165347 | 3300047319 | Bacteria | 1849 |
| 763 | Ga0495674_0210635 | 3300047319 | Bacteria | 1610 |
| 764 | Ga0495674_0222977 | 3300047319 | Bacteria | 1558 |
| 765 | Ga0495674_0545820 | 3300047319 | Unclassified | 923 |
| 766 | Ga0495676_0392607 | 3300047321 | Unclassified | 922 |
| 767 | Ga0495675_0023065 | 3300047444 | Unclassified | 3967 |
| 768 | Ga0495684_0009523 | 3300047471 | Bacteria | 7491 |
| 769 | Ga0495602_0014394 | 3300048088 | Bacteria | 8033 |
| 770 | Ga0496100_0038356 | 3300048903 | Unclassified | 3036 |
| 771 | Ga0496100_0192533 | 3300048903 | Unclassified | 1481 |
| 772 | Ga0496101_0536655 | 3300048904 | Unclassified | 925 |
| 773 | Ga0496101_0627754 | 3300048904 | Bacteria | 849 |
| 774 | Ga0496101_1190484 | 3300048904 | Unclassified | 597 |
| 775 | Ga0496102_0098126 | 3300048905 | Bacteria | 2718 |
| 776 | Ga0496102_0101440 | 3300048905 | Unclassified | 2674 |
| 777 | Ga0496102_0452170 | 3300048905 | Bacteria | 1205 |
| 778 | Ga0496103_0308997 | 3300048906 | Bacteria | 1017 |
| 779 | Ga0496103_0309422 | 3300048906 | Unclassified | 1016 |
| 780 | Ga0496104_0195423 | 3300048907 | Unclassified | 1935 |
| 781 | Ga0496104_0204003 | 3300048907 | Bacteria | 1889 |
| 782 | Ga0496104_0280955 | 3300048907 | Bacteria | 1578 |
| 783 | Ga0496104_0287984 | 3300048907 | Bacteria | 1555 |
| 784 | Ga0496105_0256747 | 3300048908 | Bacteria | 1415 |
| 785 | Ga0496106_0022018 | 3300048909 | Bacteria | 4735 |
| 786 | Ga0496106_0615474 | 3300048909 | Unclassified | 869 |
| 787 | Ga0496108_0000346 | 3300048911 | Bacteria | 39125 |
| 788 | Ga0496108_0063380 | 3300048911 | Unclassified | 3113 |
| 789 | Ga0496109_0000158 | 3300048912 | Bacteria | 66126 |
| 790 | Ga0496109_0068190 | 3300048912 | Bacteria | 3261 |
| 791 | Ga0496109_0086567 | 3300048912 | Unclassified | 2894 |
| 792 | Ga0496110_0020022 | 3300048913 | Bacteria | 5641 |
| 793 | Ga0496110_0100980 | 3300048913 | Bacteria | 2586 |
| 794 | Ga0496110_0909240 | 3300048913 | Unclassified | 786 |
| 795 | Ga0496111_0026455 | 3300048914 | Bacteria | 4098 |
| 796 | Ga0496112_0000049 | 3300048915 | Bacteria | 83780 |
| 797 | Ga0496112_0109001 | 3300048915 | Bacteria | 2739 |
| 798 | Ga0496112_0169272 | 3300048915 | Unclassified | 2150 |
| 799 | Ga0496112_0534222 | 3300048915 | Unclassified | 1107 |
| 800 | Ga0496113_0002692 | 3300048916 | Bacteria | 10423 |
| 801 | Ga0496113_0048911 | 3300048916 | Unclassified | 3147 |
| 802 | Ga0496113_0151470 | 3300048916 | Bacteria | 1830 |
| 803 | Ga0496114_0589164 | 3300048917 | Unclassified | 981 |
| 804 | Ga0496115_0048441 | 3300048918 | Bacteria | 3399 |
| 805 | Ga0496115_0109020 | 3300048918 | Unclassified | 2273 |
| 806 | Ga0496115_0193134 | 3300048918 | Unclassified | 1682 |
| 807 | Ga0496115_0343198 | 3300048918 | Bacteria | 1218 |
| 808 | Ga0496126_0000004 | 3300048929 | Bacteria | 925026 |
| 809 | Ga0501291_034360 | 3300049514 | Unclassified | 868 |
| 810 | Ga0501299_019713 | 3300049522 | Bacteria | 1223 |
| 811 | Ga0501299_030814 | 3300049522 | Bacteria | 1034 |
| 812 | Ga0501303_019074 | 3300049526 | Bacteria | 716 |
| 813 | Ga0501036_0029916 | 3300049572 | Bacteria | 4602 |
| 814 | Ga0501037_0058229 | 3300049573 | Bacteria | 2820 |
| 815 | Ga0501039_0235272 | 3300049575 | Bacteria | 1440 |
| 816 | Ga0501039_0247298 | 3300049575 | Bacteria | 1402 |
| 817 | Ga0501040_0196444 | 3300049576 | Bacteria | 1432 |
| 818 | Ga0501040_0249090 | 3300049576 | Bacteria | 1267 |
| 819 | Ga0501041_0053228 | 3300049577 | Bacteria | 2468 |
| 820 | Ga0501041_0141115 | 3300049577 | Bacteria | 1502 |
| 821 | Ga0501042_0036246 | 3300049578 | Bacteria | 3499 |
| 822 | Ga0501043_0083086 | 3300049579 | Bacteria | 2518 |
| 823 | Ga0501048_0056199 | 3300049582 | Bacteria | 2793 |
| 824 | Ga0501048_0070819 | 3300049582 | Bacteria | 2462 |
| 825 | Ga0501068_0010691 | 3300049584 | Bacteria | 5162 |
| 826 | Ga0501068_0309076 | 3300049584 | Bacteria | 1012 |
| 827 | Ga0501069_0335858 | 3300049585 | Unclassified | 889 |
| 828 | Ga0501071_0008830 | 3300049587 | Bacteria | 6680 |
| 829 | Ga0501071_0076448 | 3300049587 | Bacteria | 2445 |
| 830 | Ga0501072_0067295 | 3300049588 | Bacteria | 2826 |
| 831 | Ga0501072_0097777 | 3300049588 | Bacteria | 2333 |
| 832 | Ga0501073_0074000 | 3300049589 | Bacteria | 2372 |
| 833 | Ga0501075_0112568 | 3300049591 | Bacteria | 2069 |
| 834 | Ga0501075_0622224 | 3300049591 | Bacteria | 823 |
| 835 | Ga0501076_0036063 | 3300049592 | Bacteria | 3873 |
| 836 | Ga0501076_0105927 | 3300049592 | Bacteria | 2269 |
| 837 | Ga0501077_0033062 | 3300049593 | Bacteria | 3293 |
| 838 | Ga0501233_084630 | 3300049668 | Unclassified | 821 |
| 839 | Ga0501247_027627 | 3300049677 | Unclassified | 762 |
| 840 | Ga0501261_012459 | 3300049690 | Unclassified | 1145 |
| 841 | Ga0501079_0045140 | 3300049741 | Bacteria | 3401 |
| 842 | Ga0501079_0108982 | 3300049741 | Bacteria | 2151 |
| 843 | Ga0501079_0116509 | 3300049741 | Bacteria | 2077 |
| 844 | Ga0501080_0054428 | 3300049742 | Bacteria | 3726 |
| 845 | Ga0501081_0080523 | 3300049743 | Bacteria | 2280 |
| 846 | Ga0501083_0025403 | 3300049744 | Bacteria | 4101 |
| 847 | Ga0501083_0315505 | 3300049744 | Bacteria | 1017 |
| 848 | Ga0501035_0072228 | 3300049822 | Bacteria | 3055 |
| 849 | Ga0501045_0018409 | 3300049824 | Bacteria | 4969 |
| 850 | Ga0501045_0344178 | 3300049824 | Unclassified | 1110 |
| 851 | nmdc:mga00v17_187301_c1 | 3300050491 | Bacteria | 1336 |
| 852 | nmdc:mga0yw44_112294_c1 | 3300050492 | Bacteria | 1747 |
| 853 | nmdc:mga06z11_8725_c1 | 3300050494 | Bacteria | 4245 |
| 854 | nmdc:mga05p37_2994_c1 | 3300050507 | Bacteria | 19614 |
| 855 | nmdc:mga05p37_324165_c1 | 3300050507 | Bacteria | 1822 |
| 856 | nmdc:mga05p37_348744_c1 | 3300050507 | Bacteria | 1743 |
| 857 | nmdc:mga05p37_475416_c1 | 3300050507 | Bacteria | 1441 |
| 858 | nmdc:mga05p37_52596_c1 | 3300050507 | Bacteria | 5007 |
| 859 | nmdc:mga05p37_67642_c1 | 3300050507 | Bacteria | 4395 |
| 860 | nmdc:mga05p37_772351_c1 | 3300050507 | Bacteria | 1056 |
| 861 | nmdc:mga09592_169090_c1 | 3300050508 | Unclassified | 1890 |
| 862 | nmdc:mga09592_23131_c1 | 3300050508 | Bacteria | 5130 |
| 863 | nmdc:mga09592_254475_c1 | 3300050508 | Bacteria | 1522 |
| 864 | nmdc:mga0qj67_195942_c1 | 3300050509 | Bacteria | 1642 |
| 865 | nmdc:mga0qj67_411011_c1 | 3300050509 | Unclassified | 1092 |
| 866 | nmdc:mga0qj67_74111_c1 | 3300050509 | Bacteria | 2720 |
| 867 | nmdc:mga0qj67_81544_c1 | 3300050509 | Bacteria | 2594 |
| 868 | nmdc:mga06r32_100016_c1 | 3300050510 | Bacteria | 2845 |
| 869 | nmdc:mga06r32_13414_c1 | 3300050510 | Bacteria | 7419 |
| 870 | nmdc:mga06r32_14125_c1 | 3300050510 | Bacteria | 7242 |
| 871 | nmdc:mga06r32_255559_c1 | 3300050510 | Unclassified | 1740 |
| 872 | nmdc:mga06r32_84557_c1 | 3300050510 | Bacteria | 3093 |
| 873 | nmdc:mga06r32_94400_c1 | 3300050510 | Unclassified | 2927 |
| 874 | nmdc:mga08y16_1289752_c1 | 3300050511 | Unclassified | 697 |
| 875 | nmdc:mga08y16_2263_c1 | 3300050511 | Bacteria | 19735 |
| 876 | nmdc:mga08y16_290448_c1 | 3300050511 | Bacteria | 1686 |
| 877 | nmdc:mga08y16_7332_c1 | 3300050511 | Bacteria | 11569 |
| 878 | nmdc:mga08y16_78431_c1 | 3300050511 | Bacteria | 3443 |
| 879 | nmdc:mga0n895_23084_c1 | 3300050512 | Bacteria | 5843 |
| 880 | nmdc:mga0n895_379057_c1 | 3300050512 | Bacteria | 1431 |
| 881 | nmdc:mga0rr50_49382_c1 | 3300050513 | Bacteria | 3115 |
| 882 | nmdc:mga08x19_25958_c1 | 3300050514 | Bacteria | 3653 |
| 883 | nmdc:mga08x19_439_c1 | 3300050514 | Bacteria | 28578 |
| 884 | nmdc:mga0a205_167577_c1 | 3300050515 | Bacteria | 2092 |
| 885 | nmdc:mga0a205_266665_c1 | 3300050515 | Bacteria | 1590 |
| 886 | nmdc:mga0a205_335661_c1 | 3300050515 | Bacteria | 1381 |
| 887 | Ga0495601_0274261 | 3300053077 | Unclassified | 1100 |
| 888 | Ga0495619_0029367 | 3300053085 | Bacteria | 3551 |
| 889 | Ga0500555_000078 | 3300053103 | Bacteria | 46576 |
| 890 | Ga0500595_012548 | 3300053119 | Bacteria | 3274 |
| 891 | Ga0501084_0036765 | 3300054114 | Unclassified | 4092 |
| 892 | Ga0501084_0132630 | 3300054114 | Bacteria | 2097 |
| 893 | Ga0500661_002080 | 3300055283 | Bacteria | 3783 |
| 894 | Ga0590071_032333 | 3300059421 | Bacteria | 1249 |
| 895 | Ga0501082_0129065 | 3300060353 | Bacteria | 2193 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046535 | Ga0495586_0309838 | Ga0495586_0309838_338_853 | 170 |
| 2 | 3300046557 | Ga0495622_0430712 | Ga0495622_0430712_38_553 | 170 |
| 3 | 3300050511 | nmdc:mga08y16_1289752_c1 | nmdc:mga08y16_1289752_c1_165_680 | 171 |
| 4 | 3300035725 | Ga0373947_0529287 | Ga0373947_0529287_247_780 | 177 |
| 5 | 3300048904 | Ga0496101_1190484 | Ga0496101_1190484_17_562 | 180 |
| 6 | 3300046683 | Ga0495658_0197002 | Ga0495658_0197002_689_1234 | 181 |
| 7 | 3300004803 | Ga0058862_10044413 | Ga0058862_100444132 | 185 |
| 8 | 3300009147 | Ga0114129_10100200 | Ga0114129_101002002 | 191 |
| 9 | 3300039437 | Ga0436365_1320079 | Ga0436365_1320079_24_602 | 191 |
| 10 | 3300050507 | nmdc:mga05p37_772351_c1 | nmdc:mga05p37_772351_c1_307_939 | 191 |
| 11 | 3300006051 | Ga0075364_10260225 | Ga0075364_102602252 | 195 |
| 12 | 3300007076 | Ga0075435_100562231 | Ga0075435_1005622312 | 195 |
| 13 | 3300007265 | Ga0099794_10007589 | Ga0099794_100075893 | 196 |
| 14 | 3300048906 | Ga0496103_0309422 | Ga0496103_0309422_17_616 | 198 |
| 15 | 3300039437 | Ga0436365_0249650 | Ga0436365_0249650_406_1008 | 199 |
| 16 | 3300046472 | Ga0495580_0277544 | Ga0495580_0277544_37_639 | 199 |
| 17 | 3300009094 | Ga0111539_10167164 | Ga0111539_101671641 | 200 |
| 18 | 3300009147 | Ga0114129_10596540 | Ga0114129_105965401 | 200 |
| 19 | 3300048916 | Ga0496113_0151470 | Ga0496113_0151470_392_994 | 200 |
| 20 | 3300050507 | nmdc:mga05p37_475416_c1 | nmdc:mga05p37_475416_c1_76_678 | 200 |
| 21 | 3300050515 | nmdc:mga0a205_266665_c1 | nmdc:mga0a205_266665_c1_874_1476 | 200 |
| 22 | 3300009148 | Ga0105243_10700356 | Ga0105243_107003561 | 201 |
| 23 | 3300047319 | Ga0495674_0545820 | Ga0495674_0545820_233_841 | 201 |
| 24 | 3300049585 | Ga0501069_0335858 | Ga0501069_0335858_71_676 | 201 |
| 25 | 3300049690 | Ga0501261_012459 | Ga0501261_012459_380_985 | 201 |
| 26 | 3300050508 | nmdc:mga09592_254475_c1 | nmdc:mga09592_254475_c1_185_790 | 201 |
| 27 | 3300050509 | nmdc:mga0qj67_74111_c1 | nmdc:mga0qj67_74111_c1_369_974 | 201 |
| 28 | 3300050510 | nmdc:mga06r32_14125_c1 | nmdc:mga06r32_14125_c1_2537_3142 | 201 |
| 29 | 3300005336 | Ga0070680_100912499 | Ga0070680_1009124991 | 202 |
| 30 | 3300005341 | Ga0070691_10107514 | Ga0070691_101075143 | 202 |
| 31 | 3300005438 | Ga0070701_10551466 | Ga0070701_105514661 | 202 |
| 32 | 3300048905 | Ga0496102_0098126 | Ga0496102_0098126_1541_2152 | 203 |
| 33 | 3300048906 | Ga0496103_0308997 | Ga0496103_0308997_332_943 | 203 |
| 34 | 3300048907 | Ga0496104_0204003 | Ga0496104_0204003_533_1144 | 203 |
| 35 | 3300048912 | Ga0496109_0068190 | Ga0496109_0068190_911_1522 | 203 |
| 36 | 3300048913 | Ga0496110_0100980 | Ga0496110_0100980_1705_2316 | 203 |
| 37 | 3300048915 | Ga0496112_0109001 | Ga0496112_0109001_1641_2252 | 203 |
| 38 | 3300027671 | Ga0209588_1040555 | Ga0209588_10405552 | 204 |
| 39 | 3300046559 | Ga0495667_0298798 | Ga0495667_0298798_317_937 | 205 |
| 40 | 3300005334 | Ga0068869_100014772 | Ga0068869_1000147723 | 206 |
| 41 | 3300005290 | Ga0065712_10071490 | Ga0065712_100714906 | 207 |
| 42 | 3300005293 | Ga0065715_10135651 | Ga0065715_101356512 | 207 |
| 43 | 3300005295 | Ga0065707_10107130 | Ga0065707_101071303 | 207 |
| 44 | 3300005334 | Ga0068869_100531267 | Ga0068869_1005312671 | 207 |
| 45 | 3300005340 | Ga0070689_100218750 | Ga0070689_1002187502 | 207 |
| 46 | 3300005353 | Ga0070669_100525458 | Ga0070669_1005254581 | 207 |
| 47 | 3300005354 | Ga0070675_100011171 | Ga0070675_1000111713 | 207 |
| 48 | 3300005530 | Ga0070679_100621969 | Ga0070679_1006219692 | 207 |
| 49 | 3300005617 | Ga0068859_100303296 | Ga0068859_1003032963 | 207 |
| 50 | 3300005844 | Ga0068862_100647899 | Ga0068862_1006478992 | 207 |
| 51 | 3300005985 | Ga0081539_10008569 | Ga0081539_100085699 | 207 |
| 52 | 3300006038 | Ga0075365_10264685 | Ga0075365_102646852 | 207 |
| 53 | 3300006051 | Ga0075364_10030978 | Ga0075364_100309785 | 207 |
| 54 | 3300006178 | Ga0075367_10006970 | Ga0075367_100069705 | 207 |
| 55 | 3300006353 | Ga0075370_10366342 | Ga0075370_103663422 | 207 |
| 56 | 3300006852 | Ga0075433_10237061 | Ga0075433_102370611 | 207 |
| 57 | 3300006931 | Ga0097620_100303296 | Ga0097620_1003032963 | 207 |
| 58 | 3300025908 | Ga0207643_10180174 | Ga0207643_101801741 | 207 |
| 59 | 3300025926 | Ga0207659_10043489 | Ga0207659_100434892 | 207 |
| 60 | 3300025942 | Ga0207689_10142992 | Ga0207689_101429922 | 207 |
| 61 | 3300026095 | Ga0207676_10297141 | Ga0207676_102971412 | 207 |
| 62 | 3300026118 | Ga0207675_100757936 | Ga0207675_1007579362 | 207 |
| 63 | 3300036401 | Ga0373937_1052574 | Ga0373937_1052574_70_723 | 207 |
| 64 | 3300038443 | Ga0395901_0931028 | Ga0395901_0931028_20_646 | 207 |
| 65 | 3300050491 | nmdc:mga00v17_187301_c1 | nmdc:mga00v17_187301_c1_393_1016 | 207 |
| 66 | 3300050492 | nmdc:mga0yw44_112294_c1 | nmdc:mga0yw44_112294_c1_317_940 | 207 |
| 67 | 3300050494 | nmdc:mga06z11_8725_c1 | nmdc:mga06z11_8725_c1_246_869 | 207 |
| 68 | 3300005293 | Ga0065715_10407023 | Ga0065715_104070231 | 208 |
| 69 | 3300005295 | Ga0065707_10154527 | Ga0065707_101545272 | 208 |
| 70 | 3300005328 | Ga0070676_10110356 | Ga0070676_101103562 | 208 |
| 71 | 3300005336 | Ga0070680_100035842 | Ga0070680_1000358423 | 208 |
| 72 | 3300005336 | Ga0070680_100436723 | Ga0070680_1004367232 | 208 |
| 73 | 3300005344 | Ga0070661_100033766 | Ga0070661_1000337663 | 208 |
| 74 | 3300005344 | Ga0070661_100563048 | Ga0070661_1005630482 | 208 |
| 75 | 3300005345 | Ga0070692_10072168 | Ga0070692_100721682 | 208 |
| 76 | 3300005347 | Ga0070668_100334386 | Ga0070668_1003343862 | 208 |
| 77 | 3300005353 | Ga0070669_100379060 | Ga0070669_1003790602 | 208 |
| 78 | 3300005356 | Ga0070674_100012998 | Ga0070674_1000129984 | 208 |
| 79 | 3300005356 | Ga0070674_100280492 | Ga0070674_1002804922 | 208 |
| 80 | 3300005356 | Ga0070674_101008616 | Ga0070674_1010086161 | 208 |
| 81 | 3300005364 | Ga0070673_100064718 | Ga0070673_1000647182 | 208 |
| 82 | 3300005366 | Ga0070659_100006001 | Ga0070659_1000060013 | 208 |
| 83 | 3300005367 | Ga0070667_100459554 | Ga0070667_1004595541 | 208 |
| 84 | 3300005367 | Ga0070667_101300591 | Ga0070667_1013005911 | 208 |
| 85 | 3300005441 | Ga0070700_100169810 | Ga0070700_1001698101 | 208 |
| 86 | 3300005444 | Ga0070694_100083877 | Ga0070694_1000838773 | 208 |
| 87 | 3300005458 | Ga0070681_10014004 | Ga0070681_100140047 | 208 |
| 88 | 3300005467 | Ga0070706_100024489 | Ga0070706_1000244892 | 208 |
| 89 | 3300005471 | Ga0070698_100001691 | Ga0070698_10000169127 | 208 |
| 90 | 3300005518 | Ga0070699_100001008 | Ga0070699_10000100817 | 208 |
| 91 | 3300005536 | Ga0070697_100001902 | Ga0070697_10000190215 | 208 |
| 92 | 3300005539 | Ga0068853_100029389 | Ga0068853_1000293893 | 208 |
| 93 | 3300005546 | Ga0070696_100664609 | Ga0070696_1006646091 | 208 |
| 94 | 3300005549 | Ga0070704_100029699 | Ga0070704_1000296992 | 208 |
| 95 | 3300005564 | Ga0070664_100003168 | Ga0070664_1000031688 | 208 |
| 96 | 3300005577 | Ga0068857_100007847 | Ga0068857_1000078474 | 208 |
| 97 | 3300005617 | Ga0068859_100146076 | Ga0068859_1001460762 | 208 |
| 98 | 3300005617 | Ga0068859_100175726 | Ga0068859_1001757262 | 208 |
| 99 | 3300005618 | Ga0068864_100019584 | Ga0068864_1000195843 | 208 |
| 100 | 3300005981 | Ga0081538_10135380 | Ga0081538_101353802 | 208 |
| 101 | 3300006844 | Ga0075428_100016539 | Ga0075428_1000165392 | 208 |
| 102 | 3300006844 | Ga0075428_100050123 | Ga0075428_1000501237 | 208 |
| 103 | 3300006844 | Ga0075428_100693233 | Ga0075428_1006932331 | 208 |
| 104 | 3300006846 | Ga0075430_100070526 | Ga0075430_1000705262 | 208 |
| 105 | 3300006846 | Ga0075430_100138300 | Ga0075430_1001383002 | 208 |
| 106 | 3300006846 | Ga0075430_100249948 | Ga0075430_1002499482 | 208 |
| 107 | 3300006847 | Ga0075431_100006181 | Ga0075431_1000061816 | 208 |
| 108 | 3300006847 | Ga0075431_100011175 | Ga0075431_10001117510 | 208 |
| 109 | 3300006847 | Ga0075431_100020745 | Ga0075431_1000207454 | 208 |
| 110 | 3300006847 | Ga0075431_100126092 | Ga0075431_1001260923 | 208 |
| 111 | 3300006880 | Ga0075429_100001748 | Ga0075429_1000017482 | 208 |
| 112 | 3300006880 | Ga0075429_100141131 | Ga0075429_1001411313 | 208 |
| 113 | 3300006880 | Ga0075429_100316892 | Ga0075429_1003168922 | 208 |
| 114 | 3300006931 | Ga0097620_100146070 | Ga0097620_1001460702 | 208 |
| 115 | 3300006931 | Ga0097620_100175715 | Ga0097620_1001757152 | 208 |
| 116 | 3300009094 | Ga0111539_10005667 | Ga0111539_100056679 | 208 |
| 117 | 3300009094 | Ga0111539_10096679 | Ga0111539_100966791 | 208 |
| 118 | 3300009101 | Ga0105247_10054329 | Ga0105247_100543293 | 208 |
| 119 | 3300009147 | Ga0114129_10001427 | Ga0114129_1000142724 | 208 |
| 120 | 3300009147 | Ga0114129_10032531 | Ga0114129_100325319 | 208 |
| 121 | 3300009147 | Ga0114129_10087188 | Ga0114129_100871882 | 208 |
| 122 | 3300009174 | Ga0105241_10427869 | Ga0105241_104278691 | 208 |
| 123 | 3300013307 | Ga0157372_10129699 | Ga0157372_101296992 | 208 |
| 124 | 3300014325 | Ga0163163_10003753 | Ga0163163_100037538 | 208 |
| 125 | 3300014325 | Ga0163163_10032241 | Ga0163163_100322415 | 208 |
| 126 | 3300014325 | Ga0163163_10053430 | Ga0163163_100534303 | 208 |
| 127 | 3300014325 | Ga0163163_10064502 | Ga0163163_100645022 | 208 |
| 128 | 3300014968 | Ga0157379_10218159 | Ga0157379_102181592 | 208 |
| 129 | 3300025321 | Ga0207656_10258178 | Ga0207656_102581782 | 208 |
| 130 | 3300025893 | Ga0207682_10078681 | Ga0207682_100786812 | 208 |
| 131 | 3300025900 | Ga0207710_10041483 | Ga0207710_100414832 | 208 |
| 132 | 3300025907 | Ga0207645_10062283 | Ga0207645_100622833 | 208 |
| 133 | 3300025910 | Ga0207684_10075169 | Ga0207684_100751692 | 208 |
| 134 | 3300025919 | Ga0207657_10051804 | Ga0207657_100518044 | 208 |
| 135 | 3300025921 | Ga0207652_10032513 | Ga0207652_100325131 | 208 |
| 136 | 3300025922 | Ga0207646_10004882 | Ga0207646_1000488212 | 208 |
| 137 | 3300025923 | Ga0207681_10330573 | Ga0207681_103305732 | 208 |
| 138 | 3300025923 | Ga0207681_10340972 | Ga0207681_103409722 | 208 |
| 139 | 3300025937 | Ga0207669_10046738 | Ga0207669_100467382 | 208 |
| 140 | 3300025937 | Ga0207669_10283784 | Ga0207669_102837842 | 208 |
| 141 | 3300025945 | Ga0207679_10033358 | Ga0207679_100333583 | 208 |
| 142 | 3300025949 | Ga0207667_10165114 | Ga0207667_101651143 | 208 |
| 143 | 3300025972 | Ga0207668_10165379 | Ga0207668_101653792 | 208 |
| 144 | 3300026035 | Ga0207703_10511531 | Ga0207703_105115312 | 208 |
| 145 | 3300026041 | Ga0207639_10020765 | Ga0207639_100207653 | 208 |
| 146 | 3300026095 | Ga0207676_10068919 | Ga0207676_100689193 | 208 |
| 147 | 3300026116 | Ga0207674_10000115 | Ga0207674_1000011557 | 208 |
| 148 | 3300027907 | Ga0207428_10015716 | Ga0207428_100157164 | 208 |
| 149 | 3300030521 | Ga0307511_10315651 | Ga0307511_103156511 | 208 |
| 150 | 3300031548 | Ga0307408_100039816 | Ga0307408_1000398162 | 208 |
| 151 | 3300031731 | Ga0307405_10082369 | Ga0307405_100823693 | 208 |
| 152 | 3300031824 | Ga0307413_10447019 | Ga0307413_104470192 | 208 |
| 153 | 3300031824 | Ga0307413_10528424 | Ga0307413_105284242 | 208 |
| 154 | 3300031852 | Ga0307410_10090755 | Ga0307410_100907553 | 208 |
| 155 | 3300031995 | Ga0307409_100647469 | Ga0307409_1006474691 | 208 |
| 156 | 3300031995 | Ga0307409_100957791 | Ga0307409_1009577911 | 208 |
| 157 | 3300032002 | Ga0307416_100010002 | Ga0307416_1000100024 | 208 |
| 158 | 3300032002 | Ga0307416_100304964 | Ga0307416_1003049642 | 208 |
| 159 | 3300032002 | Ga0307416_100949170 | Ga0307416_1009491702 | 208 |
| 160 | 3300032004 | Ga0307414_10365529 | Ga0307414_103655291 | 208 |
| 161 | 3300032004 | Ga0307414_10423846 | Ga0307414_104238461 | 208 |
| 162 | 3300032005 | Ga0307411_10049832 | Ga0307411_100498322 | 208 |
| 163 | 3300032005 | Ga0307411_10107907 | Ga0307411_101079073 | 208 |
| 164 | 3300032126 | Ga0307415_100019282 | Ga0307415_1000192822 | 208 |
| 165 | 3300032126 | Ga0307415_100123424 | Ga0307415_1001234242 | 208 |
| 166 | 3300035121 | Ga0373960_0049852 | Ga0373960_0049852_157_789 | 208 |
| 167 | 3300046474 | Ga0495605_0191138 | Ga0495605_0191138_215_844 | 208 |
| 168 | 3300046499 | Ga0495594_0032636 | Ga0495594_0032636_2092_2721 | 208 |
| 169 | 3300046684 | Ga0495669_0017460 | Ga0495669_0017460_1889_2518 | 208 |
| 170 | 3300049514 | Ga0501291_034360 | Ga0501291_034360_96_725 | 208 |
| 171 | 3300049522 | Ga0501299_030814 | Ga0501299_030814_102_731 | 208 |
| 172 | 3300049526 | Ga0501303_019074 | Ga0501303_019074_56_685 | 208 |
| 173 | 3300049577 | Ga0501041_0141115 | Ga0501041_0141115_612_1238 | 208 |
| 174 | 3300049668 | Ga0501233_084630 | Ga0501233_084630_142_768 | 208 |
| 175 | 3300049677 | Ga0501247_027627 | Ga0501247_027627_23_652 | 208 |
| 176 | 3300049824 | Ga0501045_0344178 | Ga0501045_0344178_369_995 | 208 |
| 177 | 3300050507 | nmdc:mga05p37_2994_c1 | nmdc:mga05p37_2994_c1_2982_3608 | 208 |
| 178 | 3300050507 | nmdc:mga05p37_324165_c1 | nmdc:mga05p37_324165_c1_803_1435 | 208 |
| 179 | 3300050507 | nmdc:mga05p37_348744_c1 | nmdc:mga05p37_348744_c1_345_971 | 208 |
| 180 | 3300050508 | nmdc:mga09592_169090_c1 | nmdc:mga09592_169090_c1_764_1390 | 208 |
| 181 | 3300050508 | nmdc:mga09592_23131_c1 | nmdc:mga09592_23131_c1_3923_4549 | 208 |
| 182 | 3300050509 | nmdc:mga0qj67_411011_c1 | nmdc:mga0qj67_411011_c1_353_979 | 208 |
| 183 | 3300050509 | nmdc:mga0qj67_81544_c1 | nmdc:mga0qj67_81544_c1_1729_2355 | 208 |
| 184 | 3300050510 | nmdc:mga06r32_13414_c1 | nmdc:mga06r32_13414_c1_3069_3698 | 208 |
| 185 | 3300050510 | nmdc:mga06r32_255559_c1 | nmdc:mga06r32_255559_c1_137_763 | 208 |
| 186 | 3300050510 | nmdc:mga06r32_94400_c1 | nmdc:mga06r32_94400_c1_836_1462 | 208 |
| 187 | 3300050511 | nmdc:mga08y16_2263_c1 | nmdc:mga08y16_2263_c1_17072_17698 | 208 |
| 188 | 3300050511 | nmdc:mga08y16_78431_c1 | nmdc:mga08y16_78431_c1_2646_3272 | 208 |
| 189 | 3300053103 | Ga0500555_000078 | Ga0500555_000078_37462_38088 | 208 |
| 190 | 3300054114 | Ga0501084_0036765 | Ga0501084_0036765_2529_3155 | 208 |
| 191 | 3300002459 | JGI24751J29686_10033813 | JGI24751J29686_100338132 | 209 |
| 192 | 3300005290 | Ga0065712_10089919 | Ga0065712_100899192 | 209 |
| 193 | 3300005293 | Ga0065715_10017945 | Ga0065715_100179452 | 209 |
| 194 | 3300005295 | Ga0065707_10124507 | Ga0065707_101245073 | 209 |
| 195 | 3300005295 | Ga0065707_10164315 | Ga0065707_101643152 | 209 |
| 196 | 3300005327 | Ga0070658_10666313 | Ga0070658_106663131 | 209 |
| 197 | 3300005328 | Ga0070676_10551809 | Ga0070676_105518091 | 209 |
| 198 | 3300005330 | Ga0070690_100015219 | Ga0070690_1000152195 | 209 |
| 199 | 3300005331 | Ga0070670_100004761 | Ga0070670_1000047618 | 209 |
| 200 | 3300005336 | Ga0070680_100142887 | Ga0070680_1001428872 | 209 |
| 201 | 3300005340 | Ga0070689_100070610 | Ga0070689_1000706104 | 209 |
| 202 | 3300005341 | Ga0070691_10086713 | Ga0070691_100867131 | 209 |
| 203 | 3300005343 | Ga0070687_100114928 | Ga0070687_1001149283 | 209 |
| 204 | 3300005344 | Ga0070661_100329613 | Ga0070661_1003296132 | 209 |
| 205 | 3300005353 | Ga0070669_100309785 | Ga0070669_1003097852 | 209 |
| 206 | 3300005354 | Ga0070675_100082629 | Ga0070675_1000826292 | 209 |
| 207 | 3300005354 | Ga0070675_100211928 | Ga0070675_1002119282 | 209 |
| 208 | 3300005355 | Ga0070671_100235624 | Ga0070671_1002356242 | 209 |
| 209 | 3300005364 | Ga0070673_100008456 | Ga0070673_1000084564 | 209 |
| 210 | 3300005364 | Ga0070673_100268636 | Ga0070673_1002686363 | 209 |
| 211 | 3300005364 | Ga0070673_100480693 | Ga0070673_1004806932 | 209 |
| 212 | 3300005365 | Ga0070688_100410758 | Ga0070688_1004107582 | 209 |
| 213 | 3300005366 | Ga0070659_100027932 | Ga0070659_1000279323 | 209 |
| 214 | 3300005441 | Ga0070700_100157658 | Ga0070700_1001576581 | 209 |
| 215 | 3300005456 | Ga0070678_100184157 | Ga0070678_1001841572 | 209 |
| 216 | 3300005466 | Ga0070685_10012334 | Ga0070685_100123343 | 209 |
| 217 | 3300005518 | Ga0070699_100953537 | Ga0070699_1009535372 | 209 |
| 218 | 3300005543 | Ga0070672_100029390 | Ga0070672_1000293902 | 209 |
| 219 | 3300005543 | Ga0070672_100034927 | Ga0070672_1000349274 | 209 |
| 220 | 3300005544 | Ga0070686_100003559 | Ga0070686_1000035598 | 209 |
| 221 | 3300005564 | Ga0070664_100053287 | Ga0070664_1000532875 | 209 |
| 222 | 3300005564 | Ga0070664_100082437 | Ga0070664_1000824374 | 209 |
| 223 | 3300005578 | Ga0068854_100681944 | Ga0068854_1006819441 | 209 |
| 224 | 3300005617 | Ga0068859_100042252 | Ga0068859_1000422523 | 209 |
| 225 | 3300005618 | Ga0068864_100009474 | Ga0068864_1000094744 | 209 |
| 226 | 3300005618 | Ga0068864_101000370 | Ga0068864_1010003701 | 209 |
| 227 | 3300005719 | Ga0068861_100047695 | Ga0068861_1000476951 | 209 |
| 228 | 3300005842 | Ga0068858_100105508 | Ga0068858_1001055083 | 209 |
| 229 | 3300005844 | Ga0068862_100271823 | Ga0068862_1002718232 | 209 |
| 230 | 3300005844 | Ga0068862_100372854 | Ga0068862_1003728542 | 209 |
| 231 | 3300006358 | Ga0068871_100505326 | Ga0068871_1005053262 | 209 |
| 232 | 3300006847 | Ga0075431_100508026 | Ga0075431_1005080262 | 209 |
| 233 | 3300006931 | Ga0097620_100042254 | Ga0097620_1000422543 | 209 |
| 234 | 3300009176 | Ga0105242_10055443 | Ga0105242_100554433 | 209 |
| 235 | 3300009553 | Ga0105249_10219634 | Ga0105249_102196343 | 209 |
| 236 | 3300013296 | Ga0157374_10020434 | Ga0157374_100204345 | 209 |
| 237 | 3300013306 | Ga0163162_10130752 | Ga0163162_101307522 | 209 |
| 238 | 3300013308 | Ga0157375_10106874 | Ga0157375_101068743 | 209 |
| 239 | 3300014325 | Ga0163163_10005139 | Ga0163163_1000513910 | 209 |
| 240 | 3300014745 | Ga0157377_10030048 | Ga0157377_100300483 | 209 |
| 241 | 3300014969 | Ga0157376_10085325 | Ga0157376_100853252 | 209 |
| 242 | 3300025918 | Ga0207662_10118812 | Ga0207662_101188122 | 209 |
| 243 | 3300025925 | Ga0207650_10001408 | Ga0207650_1000140810 | 209 |
| 244 | 3300025926 | Ga0207659_10047763 | Ga0207659_100477633 | 209 |
| 245 | 3300025926 | Ga0207659_10379876 | Ga0207659_103798761 | 209 |
| 246 | 3300025929 | Ga0207664_10281999 | Ga0207664_102819992 | 209 |
| 247 | 3300025936 | Ga0207670_10154336 | Ga0207670_101543363 | 209 |
| 248 | 3300025940 | Ga0207691_10043780 | Ga0207691_100437802 | 209 |
| 249 | 3300025940 | Ga0207691_10080549 | Ga0207691_100805493 | 209 |
| 250 | 3300025945 | Ga0207679_10166873 | Ga0207679_101668732 | 209 |
| 251 | 3300025960 | Ga0207651_10005383 | Ga0207651_100053835 | 209 |
| 252 | 3300025972 | Ga0207668_10057176 | Ga0207668_100571764 | 209 |
| 253 | 3300026035 | Ga0207703_10114163 | Ga0207703_101141632 | 209 |
| 254 | 3300026095 | Ga0207676_10005175 | Ga0207676_100051755 | 209 |
| 255 | 3300026121 | Ga0207683_10834977 | Ga0207683_108349771 | 209 |
| 256 | 3300028016 | Ga0265354_1000450 | Ga0265354_10004504 | 209 |
| 257 | 3300028380 | Ga0268265_10308423 | Ga0268265_103084232 | 209 |
| 258 | 3300028380 | Ga0268265_10381806 | Ga0268265_103818062 | 209 |
| 259 | 3300028381 | Ga0268264_10411226 | Ga0268264_104112261 | 209 |
| 260 | 3300031548 | Ga0307408_100015580 | Ga0307408_1000155802 | 209 |
| 261 | 3300031548 | Ga0307408_101125577 | Ga0307408_1011255771 | 209 |
| 262 | 3300031731 | Ga0307405_10002372 | Ga0307405_1000237210 | 209 |
| 263 | 3300031731 | Ga0307405_10241361 | Ga0307405_102413612 | 209 |
| 264 | 3300031824 | Ga0307413_10037311 | Ga0307413_100373112 | 209 |
| 265 | 3300031824 | Ga0307413_10056625 | Ga0307413_100566252 | 209 |
| 266 | 3300031901 | Ga0307406_10434351 | Ga0307406_104343512 | 209 |
| 267 | 3300031903 | Ga0307407_10013753 | Ga0307407_100137534 | 209 |
| 268 | 3300031911 | Ga0307412_10025662 | Ga0307412_100256623 | 209 |
| 269 | 3300031911 | Ga0307412_10098662 | Ga0307412_100986621 | 209 |
| 270 | 3300031995 | Ga0307409_100002548 | Ga0307409_1000025483 | 209 |
| 271 | 3300031995 | Ga0307409_100007567 | Ga0307409_1000075675 | 209 |
| 272 | 3300032002 | Ga0307416_100006905 | Ga0307416_1000069054 | 209 |
| 273 | 3300032002 | Ga0307416_100018688 | Ga0307416_1000186882 | 209 |
| 274 | 3300032004 | Ga0307414_10063777 | Ga0307414_100637772 | 209 |
| 275 | 3300032005 | Ga0307411_10016505 | Ga0307411_100165054 | 209 |
| 276 | 3300032126 | Ga0307415_100014091 | Ga0307415_1000140912 | 209 |
| 277 | 3300032126 | Ga0307415_100117518 | Ga0307415_1001175182 | 209 |
| 278 | 3300042461 | Ga0439460_0026035 | Ga0439460_0026035_700_1335 | 209 |
| 279 | 3300046472 | Ga0495580_0595230 | Ga0495580_0595230_30_659 | 209 |
| 280 | 3300046537 | Ga0495598_0012875 | Ga0495598_0012875_629_1261 | 209 |
| 281 | 3300046539 | Ga0495621_0016395 | Ga0495621_0016395_565_1197 | 209 |
| 282 | 3300046558 | Ga0495633_0031518 | Ga0495633_0031518_1809_2441 | 209 |
| 283 | 3300046691 | Ga0495670_0076731 | Ga0495670_0076731_816_1448 | 209 |
| 284 | 3300048905 | Ga0496102_0452170 | Ga0496102_0452170_88_717 | 209 |
| 285 | 3300048909 | Ga0496106_0022018 | Ga0496106_0022018_3912_4541 | 209 |
| 286 | 3300048917 | Ga0496114_0589164 | Ga0496114_0589164_125_754 | 209 |
| 287 | 3300049576 | Ga0501040_0196444 | Ga0501040_0196444_495_1124 | 209 |
| 288 | 3300049582 | Ga0501048_0070819 | Ga0501048_0070819_1505_2134 | 209 |
| 289 | 3300049587 | Ga0501071_0008830 | Ga0501071_0008830_4421_5050 | 209 |
| 290 | 3300049588 | Ga0501072_0097777 | Ga0501072_0097777_700_1329 | 209 |
| 291 | 3300049592 | Ga0501076_0036063 | Ga0501076_0036063_2430_3059 | 209 |
| 292 | 3300049741 | Ga0501079_0116509 | Ga0501079_0116509_833_1462 | 209 |
| 293 | 3300053119 | Ga0500595_012548 | Ga0500595_012548_1458_2090 | 209 |
| 294 | 3300055283 | Ga0500661_002080 | Ga0500661_002080_1078_1710 | 209 |
| 295 | 3300005545 | Ga0070695_100202734 | Ga0070695_1002027342 | 210 |
| 296 | 3300009147 | Ga0114129_10012627 | Ga0114129_100126275 | 210 |
| 297 | 3300014325 | Ga0163163_10012863 | Ga0163163_100128637 | 210 |
| 298 | 3300025915 | Ga0207693_10151681 | Ga0207693_101516812 | 210 |
| 299 | 3300046660 | Ga0495625_0259163 | Ga0495625_0259163_206_841 | 210 |
| 300 | 3300050507 | nmdc:mga05p37_52596_c1 | nmdc:mga05p37_52596_c1_246_878 | 210 |
| 301 | 2162886011 | MRS1b_contig_650282 | MRS1b_0855.00001550 | 211 |
| 302 | 2162886012 | MBSR1b_contig_7203822 | MBSR1b_0326.00004070 | 211 |
| 303 | 2162886012 | MBSR1b_contig_8982173 | MBSR1b_0400.00007320 | 211 |
| 304 | 3300001976 | JGI24752J21851_1002687 | JGI24752J21851_10026874 | 211 |
| 305 | 3300001990 | JGI24737J22298_10025386 | JGI24737J22298_100253862 | 211 |
| 306 | 3300001991 | JGI24743J22301_10003233 | JGI24743J22301_100032335 | 211 |
| 307 | 3300002070 | JGI24750J21931_1023451 | JGI24750J21931_10234512 | 211 |
| 308 | 3300002155 | JGI24033J26618_1003840 | JGI24033J26618_10038401 | 211 |
| 309 | 3300002239 | JGI24034J26672_10004298 | JGI24034J26672_100042982 | 211 |
| 310 | 3300002459 | JGI24751J29686_10001753 | JGI24751J29686_100017535 | 211 |
| 311 | 3300004798 | Ga0058859_11676364 | Ga0058859_116763641 | 211 |
| 312 | 3300004799 | Ga0058863_11434404 | Ga0058863_114344041 | 211 |
| 313 | 3300004800 | Ga0058861_12004268 | Ga0058861_120042681 | 211 |
| 314 | 3300004801 | Ga0058860_11325207 | Ga0058860_113252071 | 211 |
| 315 | 3300005290 | Ga0065712_10149010 | Ga0065712_101490101 | 211 |
| 316 | 3300005293 | Ga0065715_10006312 | Ga0065715_100063124 | 211 |
| 317 | 3300005328 | Ga0070676_10031752 | Ga0070676_100317523 | 211 |
| 318 | 3300005329 | Ga0070683_100006993 | Ga0070683_1000069933 | 211 |
| 319 | 3300005331 | Ga0070670_100074171 | Ga0070670_1000741714 | 211 |
| 320 | 3300005333 | Ga0070677_10014268 | Ga0070677_100142683 | 211 |
| 321 | 3300005334 | Ga0068869_100110422 | Ga0068869_1001104222 | 211 |
| 322 | 3300005335 | Ga0070666_10177451 | Ga0070666_101774511 | 211 |
| 323 | 3300005336 | Ga0070680_100433549 | Ga0070680_1004335493 | 211 |
| 324 | 3300005338 | Ga0068868_100099409 | Ga0068868_1000994092 | 211 |
| 325 | 3300005339 | Ga0070660_100085814 | Ga0070660_1000858144 | 211 |
| 326 | 3300005340 | Ga0070689_100014437 | Ga0070689_1000144376 | 211 |
| 327 | 3300005344 | Ga0070661_100066322 | Ga0070661_1000663224 | 211 |
| 328 | 3300005347 | Ga0070668_100078830 | Ga0070668_1000788304 | 211 |
| 329 | 3300005353 | Ga0070669_100077647 | Ga0070669_1000776472 | 211 |
| 330 | 3300005354 | Ga0070675_100172984 | Ga0070675_1001729841 | 211 |
| 331 | 3300005355 | Ga0070671_100378618 | Ga0070671_1003786182 | 211 |
| 332 | 3300005356 | Ga0070674_100085345 | Ga0070674_1000853451 | 211 |
| 333 | 3300005364 | Ga0070673_100097585 | Ga0070673_1000975852 | 211 |
| 334 | 3300005365 | Ga0070688_100044989 | Ga0070688_1000449891 | 211 |
| 335 | 3300005366 | Ga0070659_100008916 | Ga0070659_1000089167 | 211 |
| 336 | 3300005434 | Ga0070709_10156740 | Ga0070709_101567401 | 211 |
| 337 | 3300005435 | Ga0070714_100099447 | Ga0070714_1000994473 | 211 |
| 338 | 3300005435 | Ga0070714_100284605 | Ga0070714_1002846052 | 211 |
| 339 | 3300005436 | Ga0070713_100000446 | Ga0070713_10000044618 | 211 |
| 340 | 3300005436 | Ga0070713_100004441 | Ga0070713_1000044413 | 211 |
| 341 | 3300005436 | Ga0070713_100570705 | Ga0070713_1005707051 | 211 |
| 342 | 3300005437 | Ga0070710_10169991 | Ga0070710_101699913 | 211 |
| 343 | 3300005438 | Ga0070701_10088921 | Ga0070701_100889212 | 211 |
| 344 | 3300005439 | Ga0070711_100000290 | Ga0070711_1000002906 | 211 |
| 345 | 3300005439 | Ga0070711_100084180 | Ga0070711_1000841803 | 211 |
| 346 | 3300005439 | Ga0070711_100235217 | Ga0070711_1002352172 | 211 |
| 347 | 3300005441 | Ga0070700_100182678 | Ga0070700_1001826782 | 211 |
| 348 | 3300005455 | Ga0070663_100152065 | Ga0070663_1001520651 | 211 |
| 349 | 3300005456 | Ga0070678_100045306 | Ga0070678_1000453065 | 211 |
| 350 | 3300005456 | Ga0070678_100496280 | Ga0070678_1004962802 | 211 |
| 351 | 3300005457 | Ga0070662_100099992 | Ga0070662_1000999923 | 211 |
| 352 | 3300005458 | Ga0070681_10044822 | Ga0070681_100448223 | 211 |
| 353 | 3300005459 | Ga0068867_100003472 | Ga0068867_1000034724 | 211 |
| 354 | 3300005466 | Ga0070685_10001794 | Ga0070685_100017943 | 211 |
| 355 | 3300005466 | Ga0070685_10272288 | Ga0070685_102722882 | 211 |
| 356 | 3300005530 | Ga0070679_100009610 | Ga0070679_1000096103 | 211 |
| 357 | 3300005535 | Ga0070684_100004138 | Ga0070684_10000413813 | 211 |
| 358 | 3300005536 | Ga0070697_100935798 | Ga0070697_1009357981 | 211 |
| 359 | 3300005539 | Ga0068853_100011567 | Ga0068853_1000115676 | 211 |
| 360 | 3300005543 | Ga0070672_100114027 | Ga0070672_1001140273 | 211 |
| 361 | 3300005547 | Ga0070693_100046904 | Ga0070693_1000469042 | 211 |
| 362 | 3300005548 | Ga0070665_100076157 | Ga0070665_1000761572 | 211 |
| 363 | 3300005548 | Ga0070665_100670775 | Ga0070665_1006707752 | 211 |
| 364 | 3300005548 | Ga0070665_100891151 | Ga0070665_1008911511 | 211 |
| 365 | 3300005563 | Ga0068855_100049255 | Ga0068855_1000492555 | 211 |
| 366 | 3300005564 | Ga0070664_100005990 | Ga0070664_10000599012 | 211 |
| 367 | 3300005578 | Ga0068854_100020958 | Ga0068854_1000209584 | 211 |
| 368 | 3300005614 | Ga0068856_100012904 | Ga0068856_1000129049 | 211 |
| 369 | 3300005616 | Ga0068852_100129931 | Ga0068852_1001299315 | 211 |
| 370 | 3300005617 | Ga0068859_100222905 | Ga0068859_1002229054 | 211 |
| 371 | 3300005618 | Ga0068864_100170967 | Ga0068864_1001709674 | 211 |
| 372 | 3300005718 | Ga0068866_10032651 | Ga0068866_100326512 | 211 |
| 373 | 3300005719 | Ga0068861_100032636 | Ga0068861_1000326364 | 211 |
| 374 | 3300005834 | Ga0068851_10009594 | Ga0068851_100095946 | 211 |
| 375 | 3300005840 | Ga0068870_10006412 | Ga0068870_100064125 | 211 |
| 376 | 3300005841 | Ga0068863_100044844 | Ga0068863_1000448444 | 211 |
| 377 | 3300005842 | Ga0068858_100166813 | Ga0068858_1001668134 | 211 |
| 378 | 3300005843 | Ga0068860_100236396 | Ga0068860_1002363961 | 211 |
| 379 | 3300005844 | Ga0068862_100147891 | Ga0068862_1001478911 | 211 |
| 380 | 3300006028 | Ga0070717_10000640 | Ga0070717_1000064015 | 211 |
| 381 | 3300006028 | Ga0070717_10028291 | Ga0070717_100282912 | 211 |
| 382 | 3300006163 | Ga0070715_10006086 | Ga0070715_100060864 | 211 |
| 383 | 3300006173 | Ga0070716_100018178 | Ga0070716_1000181783 | 211 |
| 384 | 3300006175 | Ga0070712_100003988 | Ga0070712_1000039888 | 211 |
| 385 | 3300006175 | Ga0070712_100073097 | Ga0070712_1000730974 | 211 |
| 386 | 3300006175 | Ga0070712_100090640 | Ga0070712_1000906402 | 211 |
| 387 | 3300006237 | Ga0097621_100470731 | Ga0097621_1004707312 | 211 |
| 388 | 3300006358 | Ga0068871_100127951 | Ga0068871_1001279513 | 211 |
| 389 | 3300006871 | Ga0075434_100629677 | Ga0075434_1006296772 | 211 |
| 390 | 3300006881 | Ga0068865_100001611 | Ga0068865_1000016118 | 211 |
| 391 | 3300006931 | Ga0097620_100222905 | Ga0097620_1002229054 | 211 |
| 392 | 3300007265 | Ga0099794_10242377 | Ga0099794_102423772 | 211 |
| 393 | 3300009092 | Ga0105250_10006934 | Ga0105250_100069346 | 211 |
| 394 | 3300009098 | Ga0105245_10005295 | Ga0105245_1000529510 | 211 |
| 395 | 3300009101 | Ga0105247_10021179 | Ga0105247_100211792 | 211 |
| 396 | 3300009174 | Ga0105241_10061881 | Ga0105241_100618815 | 211 |
| 397 | 3300009176 | Ga0105242_10088069 | Ga0105242_100880694 | 211 |
| 398 | 3300009177 | Ga0105248_10567349 | Ga0105248_105673492 | 211 |
| 399 | 3300009545 | Ga0105237_10015273 | Ga0105237_100152739 | 211 |
| 400 | 3300009551 | Ga0105238_10134128 | Ga0105238_101341282 | 211 |
| 401 | 3300009551 | Ga0105238_10245370 | Ga0105238_102453702 | 211 |
| 402 | 3300009553 | Ga0105249_10060525 | Ga0105249_100605254 | 211 |
| 403 | 3300010375 | Ga0105239_10024492 | Ga0105239_100244924 | 211 |
| 404 | 3300011119 | Ga0105246_10024334 | Ga0105246_100243344 | 211 |
| 405 | 3300013100 | Ga0157373_10047337 | Ga0157373_100473374 | 211 |
| 406 | 3300013102 | Ga0157371_10035234 | Ga0157371_100352345 | 211 |
| 407 | 3300013105 | Ga0157369_10400120 | Ga0157369_104001202 | 211 |
| 408 | 3300013296 | Ga0157374_10046186 | Ga0157374_100461861 | 211 |
| 409 | 3300013296 | Ga0157374_10236335 | Ga0157374_102363352 | 211 |
| 410 | 3300013296 | Ga0157374_10465671 | Ga0157374_104656711 | 211 |
| 411 | 3300013297 | Ga0157378_10218492 | Ga0157378_102184922 | 211 |
| 412 | 3300013306 | Ga0163162_10127638 | Ga0163162_101276383 | 211 |
| 413 | 3300013307 | Ga0157372_10190616 | Ga0157372_101906164 | 211 |
| 414 | 3300014325 | Ga0163163_10004565 | Ga0163163_100045657 | 211 |
| 415 | 3300014325 | Ga0163163_10142769 | Ga0163163_101427691 | 211 |
| 416 | 3300014745 | Ga0157377_10008341 | Ga0157377_100083416 | 211 |
| 417 | 3300014968 | Ga0157379_10080723 | Ga0157379_100807233 | 211 |
| 418 | 3300014969 | Ga0157376_10028783 | Ga0157376_100287834 | 211 |
| 419 | 3300014969 | Ga0157376_10086291 | Ga0157376_100862914 | 211 |
| 420 | 3300014969 | Ga0157376_10088980 | Ga0157376_100889803 | 211 |
| 421 | 3300014969 | Ga0157376_10091677 | Ga0157376_100916772 | 211 |
| 422 | 3300014969 | Ga0157376_10531900 | Ga0157376_105319002 | 211 |
| 423 | 3300017792 | Ga0163161_10032686 | Ga0163161_100326862 | 211 |
| 424 | 3300024227 | Ga0228598_1010024 | Ga0228598_10100242 | 211 |
| 425 | 3300025893 | Ga0207682_10015444 | Ga0207682_100154443 | 211 |
| 426 | 3300025899 | Ga0207642_10027177 | Ga0207642_100271772 | 211 |
| 427 | 3300025900 | Ga0207710_10047049 | Ga0207710_100470492 | 211 |
| 428 | 3300025901 | Ga0207688_10001619 | Ga0207688_100016197 | 211 |
| 429 | 3300025903 | Ga0207680_10070369 | Ga0207680_100703694 | 211 |
| 430 | 3300025904 | Ga0207647_10012575 | Ga0207647_100125752 | 211 |
| 431 | 3300025905 | Ga0207685_10003175 | Ga0207685_100031753 | 211 |
| 432 | 3300025907 | Ga0207645_10000423 | Ga0207645_1000042319 | 211 |
| 433 | 3300025908 | Ga0207643_10000124 | Ga0207643_1000012442 | 211 |
| 434 | 3300025909 | Ga0207705_10209431 | Ga0207705_102094312 | 211 |
| 435 | 3300025911 | Ga0207654_10084326 | Ga0207654_100843263 | 211 |
| 436 | 3300025914 | Ga0207671_10269178 | Ga0207671_102691782 | 211 |
| 437 | 3300025915 | Ga0207693_10000012 | Ga0207693_1000001243 | 211 |
| 438 | 3300025915 | Ga0207693_10011931 | Ga0207693_100119313 | 211 |
| 439 | 3300025915 | Ga0207693_10155182 | Ga0207693_101551821 | 211 |
| 440 | 3300025916 | Ga0207663_10001246 | Ga0207663_100012463 | 211 |
| 441 | 3300025916 | Ga0207663_10114196 | Ga0207663_101141962 | 211 |
| 442 | 3300025919 | Ga0207657_10000221 | Ga0207657_1000022135 | 211 |
| 443 | 3300025920 | Ga0207649_10000180 | Ga0207649_100001804 | 211 |
| 444 | 3300025921 | Ga0207652_10402515 | Ga0207652_104025152 | 211 |
| 445 | 3300025923 | Ga0207681_10165469 | Ga0207681_101654692 | 211 |
| 446 | 3300025925 | Ga0207650_10000169 | Ga0207650_1000016928 | 211 |
| 447 | 3300025926 | Ga0207659_10114637 | Ga0207659_101146374 | 211 |
| 448 | 3300025927 | Ga0207687_10193160 | Ga0207687_101931602 | 211 |
| 449 | 3300025928 | Ga0207700_10001077 | Ga0207700_100010773 | 211 |
| 450 | 3300025928 | Ga0207700_10056383 | Ga0207700_100563831 | 211 |
| 451 | 3300025929 | Ga0207664_10096666 | Ga0207664_100966662 | 211 |
| 452 | 3300025931 | Ga0207644_10018027 | Ga0207644_100180273 | 211 |
| 453 | 3300025931 | Ga0207644_10220962 | Ga0207644_102209621 | 211 |
| 454 | 3300025933 | Ga0207706_10000366 | Ga0207706_1000036627 | 211 |
| 455 | 3300025934 | Ga0207686_10106275 | Ga0207686_101062752 | 211 |
| 456 | 3300025936 | Ga0207670_10081043 | Ga0207670_100810434 | 211 |
| 457 | 3300025937 | Ga0207669_10103835 | Ga0207669_101038351 | 211 |
| 458 | 3300025939 | Ga0207665_10021474 | Ga0207665_100214744 | 211 |
| 459 | 3300025939 | Ga0207665_10266423 | Ga0207665_102664232 | 211 |
| 460 | 3300025939 | Ga0207665_10384327 | Ga0207665_103843273 | 211 |
| 461 | 3300025940 | Ga0207691_10062991 | Ga0207691_100629914 | 211 |
| 462 | 3300025941 | Ga0207711_10116368 | Ga0207711_101163683 | 211 |
| 463 | 3300025942 | Ga0207689_10000517 | Ga0207689_1000051731 | 211 |
| 464 | 3300025944 | Ga0207661_10006657 | Ga0207661_100066576 | 211 |
| 465 | 3300025945 | Ga0207679_10000179 | Ga0207679_1000017936 | 211 |
| 466 | 3300025960 | Ga0207651_10275180 | Ga0207651_102751802 | 211 |
| 467 | 3300025972 | Ga0207668_10041648 | Ga0207668_100416486 | 211 |
| 468 | 3300026023 | Ga0207677_10030182 | Ga0207677_100301823 | 211 |
| 469 | 3300026035 | Ga0207703_10007980 | Ga0207703_1000798010 | 211 |
| 470 | 3300026067 | Ga0207678_10000037 | Ga0207678_1000003749 | 211 |
| 471 | 3300026075 | Ga0207708_10304673 | Ga0207708_103046732 | 211 |
| 472 | 3300026078 | Ga0207702_10063066 | Ga0207702_100630662 | 211 |
| 473 | 3300026088 | Ga0207641_10000086 | Ga0207641_1000008656 | 211 |
| 474 | 3300026089 | Ga0207648_10000295 | Ga0207648_1000029548 | 211 |
| 475 | 3300026095 | Ga0207676_10000250 | Ga0207676_100002504 | 211 |
| 476 | 3300026116 | Ga0207674_10000070 | Ga0207674_1000007053 | 211 |
| 477 | 3300026116 | Ga0207674_10465183 | Ga0207674_104651832 | 211 |
| 478 | 3300026118 | Ga0207675_100037764 | Ga0207675_1000377645 | 211 |
| 479 | 3300026121 | Ga0207683_10000062 | Ga0207683_1000006229 | 211 |
| 480 | 3300026121 | Ga0207683_10345498 | Ga0207683_103454981 | 211 |
| 481 | 3300026121 | Ga0207683_10534959 | Ga0207683_105349591 | 211 |
| 482 | 3300026142 | Ga0207698_10555309 | Ga0207698_105553091 | 211 |
| 483 | 3300028379 | Ga0268266_10013719 | Ga0268266_100137194 | 211 |
| 484 | 3300028379 | Ga0268266_10587085 | Ga0268266_105870852 | 211 |
| 485 | 3300028381 | Ga0268264_10225820 | Ga0268264_102258202 | 211 |
| 486 | 3300035089 | Ga0373944_0033688 | Ga0373944_0033688_757_1395 | 211 |
| 487 | 3300035116 | Ga0373945_0015892 | Ga0373945_0015892_1053_1691 | 211 |
| 488 | 3300035117 | Ga0373953_0003091 | Ga0373953_0003091_4039_4677 | 211 |
| 489 | 3300035118 | Ga0373954_0000521 | Ga0373954_0000521_9865_10503 | 211 |
| 490 | 3300035119 | Ga0373956_0030116 | Ga0373956_0030116_976_1614 | 211 |
| 491 | 3300035120 | Ga0373957_0178489 | Ga0373957_0178489_206_844 | 211 |
| 492 | 3300035170 | Ga0373943_0087967 | Ga0373943_0087967_198_836 | 211 |
| 493 | 3300035171 | Ga0373946_0016628 | Ga0373946_0016628_1386_2024 | 211 |
| 494 | 3300035692 | Ga0373935_0263477 | Ga0373935_0263477_256_894 | 211 |
| 495 | 3300035724 | Ga0373933_0009697 | Ga0373933_0009697_535_1173 | 211 |
| 496 | 3300035724 | Ga0373933_0139133 | Ga0373933_0139133_317_955 | 211 |
| 497 | 3300036401 | Ga0373937_0002978 | Ga0373937_0002978_11929_12567 | 211 |
| 498 | 3300037068 | Ga0373925_0034065 | Ga0373925_0034065_316_954 | 211 |
| 499 | 3300046454 | Ga0495592_0037197 | Ga0495592_0037197_2297_2935 | 211 |
| 500 | 3300046462 | Ga0495651_0000387 | Ga0495651_0000387_9276_9914 | 211 |
| 501 | 3300046462 | Ga0495651_0099452 | Ga0495651_0099452_62_700 | 211 |
| 502 | 3300046472 | Ga0495580_0000266 | Ga0495580_0000266_16458_17096 | 211 |
| 503 | 3300046472 | Ga0495580_0344767 | Ga0495580_0344767_32_670 | 211 |
| 504 | 3300046473 | Ga0495582_0002636 | Ga0495582_0002636_2443_3081 | 211 |
| 505 | 3300046529 | Ga0495652_0532952 | Ga0495652_0532952_70_708 | 211 |
| 506 | 3300046531 | Ga0495665_0068730 | Ga0495665_0068730_823_1461 | 211 |
| 507 | 3300046533 | Ga0495640_0067085 | Ga0495640_0067085_966_1604 | 211 |
| 508 | 3300046533 | Ga0495640_0195082 | Ga0495640_0195082_320_958 | 211 |
| 509 | 3300046535 | Ga0495586_0197856 | Ga0495586_0197856_484_1122 | 211 |
| 510 | 3300046536 | Ga0495587_0014393 | Ga0495587_0014393_4032_4670 | 211 |
| 511 | 3300046543 | Ga0495645_0079517 | Ga0495645_0079517_1386_2024 | 211 |
| 512 | 3300046543 | Ga0495645_0459927 | Ga0495645_0459927_142_780 | 211 |
| 513 | 3300046642 | Ga0495634_0040705 | Ga0495634_0040705_905_1543 | 211 |
| 514 | 3300046678 | Ga0495599_0483628 | Ga0495599_0483628_25_663 | 211 |
| 515 | 3300046679 | Ga0495623_0053194 | Ga0495623_0053194_1342_1980 | 211 |
| 516 | 3300046684 | Ga0495669_0034444 | Ga0495669_0034444_381_1019 | 211 |
| 517 | 3300046684 | Ga0495669_0128233 | Ga0495669_0128233_449_1087 | 211 |
| 518 | 3300047315 | Ga0495581_0298589 | Ga0495581_0298589_124_762 | 211 |
| 519 | 3300047317 | Ga0495604_0001638 | Ga0495604_0001638_4429_5067 | 211 |
| 520 | 3300047319 | Ga0495674_0165347 | Ga0495674_0165347_881_1519 | 211 |
| 521 | 3300047321 | Ga0495676_0392607 | Ga0495676_0392607_240_878 | 211 |
| 522 | 3300047471 | Ga0495684_0009523 | Ga0495684_0009523_115_753 | 211 |
| 523 | 3300048088 | Ga0495602_0014394 | Ga0495602_0014394_2778_3416 | 211 |
| 524 | 3300048903 | Ga0496100_0038356 | Ga0496100_0038356_2208_2846 | 211 |
| 525 | 3300048903 | Ga0496100_0192533 | Ga0496100_0192533_418_1056 | 211 |
| 526 | 3300048904 | Ga0496101_0536655 | Ga0496101_0536655_266_904 | 211 |
| 527 | 3300048904 | Ga0496101_0627754 | Ga0496101_0627754_99_737 | 211 |
| 528 | 3300048905 | Ga0496102_0101440 | Ga0496102_0101440_1453_2091 | 211 |
| 529 | 3300048907 | Ga0496104_0195423 | Ga0496104_0195423_464_1102 | 211 |
| 530 | 3300048907 | Ga0496104_0280955 | Ga0496104_0280955_927_1565 | 211 |
| 531 | 3300048909 | Ga0496106_0615474 | Ga0496106_0615474_166_804 | 211 |
| 532 | 3300048911 | Ga0496108_0000346 | Ga0496108_0000346_935_1573 | 211 |
| 533 | 3300048911 | Ga0496108_0063380 | Ga0496108_0063380_681_1319 | 211 |
| 534 | 3300048912 | Ga0496109_0000158 | Ga0496109_0000158_36501_37139 | 211 |
| 535 | 3300048912 | Ga0496109_0086567 | Ga0496109_0086567_1818_2456 | 211 |
| 536 | 3300048913 | Ga0496110_0020022 | Ga0496110_0020022_4601_5239 | 211 |
| 537 | 3300048913 | Ga0496110_0909240 | Ga0496110_0909240_29_667 | 211 |
| 538 | 3300048914 | Ga0496111_0026455 | Ga0496111_0026455_87_725 | 211 |
| 539 | 3300048915 | Ga0496112_0000049 | Ga0496112_0000049_52136_52774 | 211 |
| 540 | 3300048915 | Ga0496112_0169272 | Ga0496112_0169272_388_1026 | 211 |
| 541 | 3300048916 | Ga0496113_0002692 | Ga0496113_0002692_7512_8150 | 211 |
| 542 | 3300048916 | Ga0496113_0048911 | Ga0496113_0048911_2147_2785 | 211 |
| 543 | 3300048918 | Ga0496115_0048441 | Ga0496115_0048441_1723_2361 | 211 |
| 544 | 3300048918 | Ga0496115_0193134 | Ga0496115_0193134_687_1325 | 211 |
| 545 | 3300048918 | Ga0496115_0343198 | Ga0496115_0343198_200_838 | 211 |
| 546 | 3300048929 | Ga0496126_0000004 | Ga0496126_0000004_662488_663126 | 211 |
| 547 | 3300005335 | Ga0070666_10020223 | Ga0070666_100202233 | 212 |
| 548 | 3300005337 | Ga0070682_100676923 | Ga0070682_1006769231 | 212 |
| 549 | 3300005339 | Ga0070660_100039824 | Ga0070660_1000398241 | 212 |
| 550 | 3300005355 | Ga0070671_100005413 | Ga0070671_10000541311 | 212 |
| 551 | 3300005367 | Ga0070667_100286419 | Ga0070667_1002864192 | 212 |
| 552 | 3300005434 | Ga0070709_10021279 | Ga0070709_100212792 | 212 |
| 553 | 3300005435 | Ga0070714_100214890 | Ga0070714_1002148902 | 212 |
| 554 | 3300005436 | Ga0070713_100005822 | Ga0070713_1000058222 | 212 |
| 555 | 3300005436 | Ga0070713_100019679 | Ga0070713_1000196795 | 212 |
| 556 | 3300005436 | Ga0070713_100132076 | Ga0070713_1001320762 | 212 |
| 557 | 3300005436 | Ga0070713_100552992 | Ga0070713_1005529921 | 212 |
| 558 | 3300005437 | Ga0070710_10009202 | Ga0070710_100092024 | 212 |
| 559 | 3300005439 | Ga0070711_100068974 | Ga0070711_1000689742 | 212 |
| 560 | 3300005439 | Ga0070711_100148168 | Ga0070711_1001481683 | 212 |
| 561 | 3300005439 | Ga0070711_100258084 | Ga0070711_1002580842 | 212 |
| 562 | 3300005445 | Ga0070708_100371451 | Ga0070708_1003714511 | 212 |
| 563 | 3300005539 | Ga0068853_100033712 | Ga0068853_1000337121 | 212 |
| 564 | 3300005548 | Ga0070665_100073119 | Ga0070665_1000731193 | 212 |
| 565 | 3300005548 | Ga0070665_100442842 | Ga0070665_1004428422 | 212 |
| 566 | 3300005564 | Ga0070664_100028799 | Ga0070664_1000287991 | 212 |
| 567 | 3300005614 | Ga0068856_100357876 | Ga0068856_1003578762 | 212 |
| 568 | 3300005614 | Ga0068856_100469258 | Ga0068856_1004692582 | 212 |
| 569 | 3300005618 | Ga0068864_100001672 | Ga0068864_10000167213 | 212 |
| 570 | 3300005841 | Ga0068863_100003190 | Ga0068863_1000031902 | 212 |
| 571 | 3300005983 | Ga0081540_1001614 | Ga0081540_100161414 | 212 |
| 572 | 3300005983 | Ga0081540_1011995 | Ga0081540_10119955 | 212 |
| 573 | 3300006028 | Ga0070717_10000457 | Ga0070717_1000045717 | 212 |
| 574 | 3300006028 | Ga0070717_10359903 | Ga0070717_103599033 | 212 |
| 575 | 3300006173 | Ga0070716_100000456 | Ga0070716_1000004563 | 212 |
| 576 | 3300006175 | Ga0070712_100012277 | Ga0070712_1000122773 | 212 |
| 577 | 3300006175 | Ga0070712_100897724 | Ga0070712_1008977241 | 212 |
| 578 | 3300006914 | Ga0075436_100000125 | Ga0075436_10000012530 | 212 |
| 579 | 3300009174 | Ga0105241_10084292 | Ga0105241_100842923 | 212 |
| 580 | 3300009174 | Ga0105241_10284557 | Ga0105241_102845572 | 212 |
| 581 | 3300009177 | Ga0105248_10067628 | Ga0105248_100676283 | 212 |
| 582 | 3300009545 | Ga0105237_10535059 | Ga0105237_105350591 | 212 |
| 583 | 3300009551 | Ga0105238_10338958 | Ga0105238_103389583 | 212 |
| 584 | 3300013102 | Ga0157371_10029266 | Ga0157371_100292663 | 212 |
| 585 | 3300013105 | Ga0157369_10047314 | Ga0157369_100473148 | 212 |
| 586 | 3300013296 | Ga0157374_10001511 | Ga0157374_100015114 | 212 |
| 587 | 3300013296 | Ga0157374_10033741 | Ga0157374_100337418 | 212 |
| 588 | 3300013306 | Ga0163162_10666351 | Ga0163162_106663512 | 212 |
| 589 | 3300013307 | Ga0157372_10469251 | Ga0157372_104692511 | 212 |
| 590 | 3300013308 | Ga0157375_10120104 | Ga0157375_101201042 | 212 |
| 591 | 3300014325 | Ga0163163_10000851 | Ga0163163_100008519 | 212 |
| 592 | 3300014969 | Ga0157376_10101979 | Ga0157376_101019792 | 212 |
| 593 | 3300021377 | Ga0213874_10002459 | Ga0213874_100024592 | 212 |
| 594 | 3300025905 | Ga0207685_10061451 | Ga0207685_100614512 | 212 |
| 595 | 3300025906 | Ga0207699_10001273 | Ga0207699_100012732 | 212 |
| 596 | 3300025914 | Ga0207671_10340218 | Ga0207671_103402182 | 212 |
| 597 | 3300025915 | Ga0207693_10016315 | Ga0207693_100163155 | 212 |
| 598 | 3300025916 | Ga0207663_10515203 | Ga0207663_105152031 | 212 |
| 599 | 3300025916 | Ga0207663_10786263 | Ga0207663_107862631 | 212 |
| 600 | 3300025928 | Ga0207700_10009434 | Ga0207700_100094342 | 212 |
| 601 | 3300025928 | Ga0207700_10130929 | Ga0207700_101309293 | 212 |
| 602 | 3300025928 | Ga0207700_10218240 | Ga0207700_102182401 | 212 |
| 603 | 3300025931 | Ga0207644_10001371 | Ga0207644_100013714 | 212 |
| 604 | 3300025939 | Ga0207665_10005926 | Ga0207665_100059266 | 212 |
| 605 | 3300025941 | Ga0207711_10083079 | Ga0207711_100830793 | 212 |
| 606 | 3300025945 | Ga0207679_10159360 | Ga0207679_101593603 | 212 |
| 607 | 3300025986 | Ga0207658_10155387 | Ga0207658_101553871 | 212 |
| 608 | 3300026041 | Ga0207639_10025268 | Ga0207639_100252687 | 212 |
| 609 | 3300026078 | Ga0207702_10176041 | Ga0207702_101760411 | 212 |
| 610 | 3300026088 | Ga0207641_10178084 | Ga0207641_101780843 | 212 |
| 611 | 3300026095 | Ga0207676_10011556 | Ga0207676_100115563 | 212 |
| 612 | 3300028379 | Ga0268266_10022015 | Ga0268266_100220152 | 212 |
| 613 | 3300028379 | Ga0268266_10153858 | Ga0268266_101538581 | 212 |
| 614 | 3300035083 | Ga0373926_0000496 | Ga0373926_0000496_4476_5117 | 212 |
| 615 | 3300035113 | Ga0373936_0003091 | Ga0373936_0003091_1469_2110 | 212 |
| 616 | 3300035116 | Ga0373945_0063992 | Ga0373945_0063992_119_760 | 212 |
| 617 | 3300035170 | Ga0373943_0006242 | Ga0373943_0006242_3828_4469 | 212 |
| 618 | 3300035171 | Ga0373946_0058360 | Ga0373946_0058360_421_1062 | 212 |
| 619 | 3300035692 | Ga0373935_0008767 | Ga0373935_0008767_3299_3940 | 212 |
| 620 | 3300035692 | Ga0373935_0226042 | Ga0373935_0226042_587_1228 | 212 |
| 621 | 3300035695 | Ga0373927_0019011 | Ga0373927_0019011_3636_4277 | 212 |
| 622 | 3300036401 | Ga0373937_0426274 | Ga0373937_0426274_15_656 | 212 |
| 623 | 3300037068 | Ga0373925_0001055 | Ga0373925_0001055_14491_15132 | 212 |
| 624 | 3300039438 | Ga0436360_1227145 | Ga0436360_1227145_168_809 | 212 |
| 625 | 3300039447 | Ga0436361_0839417 | Ga0436361_0839417_80_721 | 212 |
| 626 | 3300039450 | Ga0436363_0165098 | Ga0436363_0165098_1161_1802 | 212 |
| 627 | 3300039450 | Ga0436363_0931942 | Ga0436363_0931942_354_1007 | 212 |
| 628 | 3300039453 | Ga0436362_1266166 | Ga0436362_1266166_294_935 | 212 |
| 629 | 3300041486 | Ga0451807_1807335 | Ga0451807_1807335_919_1608 | 212 |
| 630 | 3300046472 | Ga0495580_0000558 | Ga0495580_0000558_7551_8192 | 212 |
| 631 | 3300046473 | Ga0495582_0000315 | Ga0495582_0000315_22676_23317 | 212 |
| 632 | 3300046516 | Ga0495628_0085382 | Ga0495628_0085382_525_1166 | 212 |
| 633 | 3300046531 | Ga0495665_0000962 | Ga0495665_0000962_192_833 | 212 |
| 634 | 3300046543 | Ga0495645_0047887 | Ga0495645_0047887_2408_3049 | 212 |
| 635 | 3300046679 | Ga0495623_0028058 | Ga0495623_0028058_2696_3337 | 212 |
| 636 | 3300046684 | Ga0495669_0111259 | Ga0495669_0111259_125_766 | 212 |
| 637 | 3300047315 | Ga0495581_0039645 | Ga0495581_0039645_125_766 | 212 |
| 638 | 3300047319 | Ga0495674_0210635 | Ga0495674_0210635_37_678 | 212 |
| 639 | 3300047319 | Ga0495674_0222977 | Ga0495674_0222977_499_1140 | 212 |
| 640 | 3300047444 | Ga0495675_0023065 | Ga0495675_0023065_689_1330 | 212 |
| 641 | 3300048915 | Ga0496112_0534222 | Ga0496112_0534222_321_962 | 212 |
| 642 | 3300048918 | Ga0496115_0109020 | Ga0496115_0109020_1406_2047 | 212 |
| 643 | 3300050514 | nmdc:mga08x19_439_c1 | nmdc:mga08x19_439_c1_2165_2806 | 212 |
| 644 | 3300053077 | Ga0495601_0274261 | Ga0495601_0274261_149_790 | 212 |
| 645 | 3300053085 | Ga0495619_0029367 | Ga0495619_0029367_1174_1815 | 212 |
| 646 | 3300006871 | Ga0075434_100232013 | Ga0075434_1002320131 | 213 |
| 647 | 3300050512 | nmdc:mga0n895_379057_c1 | nmdc:mga0n895_379057_c1_125_766 | 213 |
| 648 | 3300005546 | Ga0070696_100037178 | Ga0070696_1000371784 | 214 |
| 649 | 3300009177 | Ga0105248_10240083 | Ga0105248_102400833 | 214 |
| 650 | 3300025900 | Ga0207710_10279503 | Ga0207710_102795031 | 214 |
| 651 | 3300025941 | Ga0207711_10068304 | Ga0207711_100683042 | 214 |
| 652 | 3300048907 | Ga0496104_0287984 | Ga0496104_0287984_546_1196 | 214 |
| 653 | 3300048908 | Ga0496105_0256747 | Ga0496105_0256747_245_895 | 214 |
| 654 | 2162886011 | MRS1b_contig_6820307 | MRS1b_0933.00001090 | 215 |
| 655 | 3300002737 | JGI25162J39368_1009987 | JGI25162J39368_10099871 | 215 |
| 656 | 3300004801 | Ga0058860_11635791 | Ga0058860_116357911 | 215 |
| 657 | 3300005293 | Ga0065715_10139294 | Ga0065715_101392942 | 215 |
| 658 | 3300005330 | Ga0070690_100000310 | Ga0070690_1000003108 | 215 |
| 659 | 3300005340 | Ga0070689_100039896 | Ga0070689_1000398963 | 215 |
| 660 | 3300005343 | Ga0070687_100002265 | Ga0070687_1000022653 | 215 |
| 661 | 3300005354 | Ga0070675_100283243 | Ga0070675_1002832431 | 215 |
| 662 | 3300005364 | Ga0070673_100095320 | Ga0070673_1000953204 | 215 |
| 663 | 3300005365 | Ga0070688_100085816 | Ga0070688_1000858161 | 215 |
| 664 | 3300005366 | Ga0070659_100044634 | Ga0070659_1000446342 | 215 |
| 665 | 3300005367 | Ga0070667_100476776 | Ga0070667_1004767761 | 215 |
| 666 | 3300005468 | Ga0070707_101101884 | Ga0070707_1011018841 | 215 |
| 667 | 3300005518 | Ga0070699_100009056 | Ga0070699_1000090563 | 215 |
| 668 | 3300005543 | Ga0070672_100024864 | Ga0070672_1000248643 | 215 |
| 669 | 3300005544 | Ga0070686_100014963 | Ga0070686_1000149633 | 215 |
| 670 | 3300005564 | Ga0070664_100026065 | Ga0070664_1000260651 | 215 |
| 671 | 3300005719 | Ga0068861_100197266 | Ga0068861_1001972662 | 215 |
| 672 | 3300005843 | Ga0068860_100712035 | Ga0068860_1007120351 | 215 |
| 673 | 3300005937 | Ga0081455_10154161 | Ga0081455_101541612 | 215 |
| 674 | 3300006237 | Ga0097621_100116634 | Ga0097621_1001166342 | 215 |
| 675 | 3300006358 | Ga0068871_100147170 | Ga0068871_1001471702 | 215 |
| 676 | 3300006852 | Ga0075433_10087922 | Ga0075433_100879223 | 215 |
| 677 | 3300009094 | Ga0111539_10249666 | Ga0111539_102496663 | 215 |
| 678 | 3300009148 | Ga0105243_10800586 | Ga0105243_108005861 | 215 |
| 679 | 3300013296 | Ga0157374_10050881 | Ga0157374_100508812 | 215 |
| 680 | 3300025233 | Ga0209437_104073 | Ga0209437_1040732 | 215 |
| 681 | 3300025261 | Ga0209233_1009661 | Ga0209233_10096614 | 215 |
| 682 | 3300025918 | Ga0207662_10004785 | Ga0207662_100047853 | 215 |
| 683 | 3300025932 | Ga0207690_10061745 | Ga0207690_100617452 | 215 |
| 684 | 3300025935 | Ga0207709_10467233 | Ga0207709_104672331 | 215 |
| 685 | 3300025936 | Ga0207670_10032756 | Ga0207670_100327563 | 215 |
| 686 | 3300025940 | Ga0207691_10003081 | Ga0207691_1000308119 | 215 |
| 687 | 3300025944 | Ga0207661_10406371 | Ga0207661_104063712 | 215 |
| 688 | 3300025945 | Ga0207679_10005133 | Ga0207679_100051331 | 215 |
| 689 | 3300025986 | Ga0207658_10421333 | Ga0207658_104213331 | 215 |
| 690 | 3300026118 | Ga0207675_100161017 | Ga0207675_1001610172 | 215 |
| 691 | 3300026121 | Ga0207683_10411444 | Ga0207683_104114441 | 215 |
| 692 | 3300035241 | Ga0373961_0041572 | Ga0373961_0041572_530_1177 | 215 |
| 693 | 3300045051 | Ga0451576_0002672 | Ga0451576_0002672_16303_16950 | 215 |
| 694 | 3300045051 | Ga0451576_0355237 | Ga0451576_0355237_168_815 | 215 |
| 695 | 3300049522 | Ga0501299_019713 | Ga0501299_019713_57_704 | 215 |
| 696 | 3300049572 | Ga0501036_0029916 | Ga0501036_0029916_2802_3449 | 215 |
| 697 | 3300049573 | Ga0501037_0058229 | Ga0501037_0058229_1017_1664 | 215 |
| 698 | 3300049575 | Ga0501039_0235272 | Ga0501039_0235272_771_1418 | 215 |
| 699 | 3300049575 | Ga0501039_0247298 | Ga0501039_0247298_266_913 | 215 |
| 700 | 3300049576 | Ga0501040_0249090 | Ga0501040_0249090_310_957 | 215 |
| 701 | 3300049577 | Ga0501041_0053228 | Ga0501041_0053228_1580_2227 | 215 |
| 702 | 3300049578 | Ga0501042_0036246 | Ga0501042_0036246_2707_3354 | 215 |
| 703 | 3300049579 | Ga0501043_0083086 | Ga0501043_0083086_27_674 | 215 |
| 704 | 3300049582 | Ga0501048_0056199 | Ga0501048_0056199_1233_1880 | 215 |
| 705 | 3300049584 | Ga0501068_0010691 | Ga0501068_0010691_3416_4066 | 215 |
| 706 | 3300049584 | Ga0501068_0309076 | Ga0501068_0309076_345_992 | 215 |
| 707 | 3300049587 | Ga0501071_0076448 | Ga0501071_0076448_1206_1853 | 215 |
| 708 | 3300049588 | Ga0501072_0067295 | Ga0501072_0067295_621_1268 | 215 |
| 709 | 3300049589 | Ga0501073_0074000 | Ga0501073_0074000_1415_2062 | 215 |
| 710 | 3300049591 | Ga0501075_0112568 | Ga0501075_0112568_176_823 | 215 |
| 711 | 3300049591 | Ga0501075_0622224 | Ga0501075_0622224_97_744 | 215 |
| 712 | 3300049592 | Ga0501076_0105927 | Ga0501076_0105927_631_1278 | 215 |
| 713 | 3300049593 | Ga0501077_0033062 | Ga0501077_0033062_1057_1704 | 215 |
| 714 | 3300049741 | Ga0501079_0045140 | Ga0501079_0045140_34_681 | 215 |
| 715 | 3300049741 | Ga0501079_0108982 | Ga0501079_0108982_374_1021 | 215 |
| 716 | 3300049742 | Ga0501080_0054428 | Ga0501080_0054428_1369_2016 | 215 |
| 717 | 3300049743 | Ga0501081_0080523 | Ga0501081_0080523_983_1630 | 215 |
| 718 | 3300049744 | Ga0501083_0025403 | Ga0501083_0025403_520_1167 | 215 |
| 719 | 3300049744 | Ga0501083_0315505 | Ga0501083_0315505_334_981 | 215 |
| 720 | 3300049822 | Ga0501035_0072228 | Ga0501035_0072228_1901_2548 | 215 |
| 721 | 3300049824 | Ga0501045_0018409 | Ga0501045_0018409_900_1547 | 215 |
| 722 | 3300050511 | nmdc:mga08y16_290448_c1 | nmdc:mga08y16_290448_c1_189_848 | 215 |
| 723 | 3300050515 | nmdc:mga0a205_167577_c1 | nmdc:mga0a205_167577_c1_587_1246 | 215 |
| 724 | 3300054114 | Ga0501084_0132630 | Ga0501084_0132630_67_714 | 215 |
| 725 | 3300060353 | Ga0501082_0129065 | Ga0501082_0129065_99_746 | 215 |
| 726 | 3300004801 | Ga0058860_11739536 | Ga0058860_117395362 | 216 |
| 727 | 3300006846 | Ga0075430_100006387 | Ga0075430_10000638712 | 216 |
| 728 | 3300006847 | Ga0075431_100082302 | Ga0075431_1000823023 | 216 |
| 729 | 3300006880 | Ga0075429_100055210 | Ga0075429_1000552103 | 216 |
| 730 | 3300027614 | Ga0209970_1005674 | Ga0209970_10056742 | 216 |
| 731 | 3300027876 | Ga0209974_10000042 | Ga0209974_1000004227 | 216 |
| 732 | 3300031548 | Ga0307408_100090530 | Ga0307408_1000905302 | 216 |
| 733 | 3300032005 | Ga0307411_10587004 | Ga0307411_105870042 | 216 |
| 734 | 3300041411 | Ga0439466_0023643 | Ga0439466_0023643_672_1322 | 216 |
| 735 | 3300041997 | Ga0439431_0130234 | Ga0439431_0130234_22_672 | 216 |
| 736 | 3300042006 | Ga0439432_007270 | Ga0439432_007270_1816_2466 | 216 |
| 737 | 3300042156 | Ga0439446_0010583 | Ga0439446_0010583_1752_2402 | 216 |
| 738 | 3300046471 | Ga0495650_0000041 | Ga0495650_0000041_26918_27589 | 216 |
| 739 | 3300050510 | nmdc:mga06r32_100016_c1 | nmdc:mga06r32_100016_c1_1145_1810 | 216 |
| 740 | 3300059421 | Ga0590071_032333 | Ga0590071_032333_263_970 | 216 |
| 741 | 3300013307 | Ga0157372_10247815 | Ga0157372_102478152 | 217 |
| 742 | 3300036401 | Ga0373937_0895208 | Ga0373937_0895208_24_695 | 217 |
| 743 | 2162886007 | SwRhRL2b_contig_3676544 | SwRhRL2b_0831.00003550 | 218 |
| 744 | 3300001990 | JGI24737J22298_10066052 | JGI24737J22298_100660521 | 218 |
| 745 | 3300003347 | JGI26128J50194_1001479 | JGI26128J50194_10014792 | 218 |
| 746 | 3300003349 | JGI26129J50193_1001113 | JGI26129J50193_10011132 | 218 |
| 747 | 3300003371 | JGI26145J50221_1000604 | JGI26145J50221_10006042 | 218 |
| 748 | 3300003383 | JGI26140J50224_100513 | JGI26140J50224_1005132 | 218 |
| 749 | 3300005289 | Ga0065704_10071835 | Ga0065704_100718352 | 218 |
| 750 | 3300005290 | Ga0065712_10138160 | Ga0065712_101381602 | 218 |
| 751 | 3300005295 | Ga0065707_10003017 | Ga0065707_100030172 | 218 |
| 752 | 3300005328 | Ga0070676_10001350 | Ga0070676_1000135014 | 218 |
| 753 | 3300005329 | Ga0070683_100051999 | Ga0070683_1000519994 | 218 |
| 754 | 3300005333 | Ga0070677_10010323 | Ga0070677_100103234 | 218 |
| 755 | 3300005335 | Ga0070666_10222857 | Ga0070666_102228572 | 218 |
| 756 | 3300005336 | Ga0070680_100018896 | Ga0070680_1000188964 | 218 |
| 757 | 3300005337 | Ga0070682_100414863 | Ga0070682_1004148632 | 218 |
| 758 | 3300005338 | Ga0068868_100028184 | Ga0068868_1000281841 | 218 |
| 759 | 3300005339 | Ga0070660_100003327 | Ga0070660_1000033272 | 218 |
| 760 | 3300005340 | Ga0070689_100004859 | Ga0070689_10000485911 | 218 |
| 761 | 3300005341 | Ga0070691_10001905 | Ga0070691_100019055 | 218 |
| 762 | 3300005344 | Ga0070661_100012144 | Ga0070661_1000121442 | 218 |
| 763 | 3300005345 | Ga0070692_10015880 | Ga0070692_100158804 | 218 |
| 764 | 3300005347 | Ga0070668_100010502 | Ga0070668_1000105022 | 218 |
| 765 | 3300005353 | Ga0070669_100017825 | Ga0070669_1000178252 | 218 |
| 766 | 3300005354 | Ga0070675_100001819 | Ga0070675_10000181914 | 218 |
| 767 | 3300005356 | Ga0070674_100000555 | Ga0070674_10000055526 | 218 |
| 768 | 3300005364 | Ga0070673_100003366 | Ga0070673_1000033664 | 218 |
| 769 | 3300005366 | Ga0070659_100028076 | Ga0070659_1000280764 | 218 |
| 770 | 3300005367 | Ga0070667_100004550 | Ga0070667_10000455016 | 218 |
| 771 | 3300005438 | Ga0070701_10015524 | Ga0070701_100155243 | 218 |
| 772 | 3300005439 | Ga0070711_100653018 | Ga0070711_1006530182 | 218 |
| 773 | 3300005440 | Ga0070705_100015260 | Ga0070705_1000152602 | 218 |
| 774 | 3300005441 | Ga0070700_100000432 | Ga0070700_10000043216 | 218 |
| 775 | 3300005444 | Ga0070694_100026224 | Ga0070694_1000262242 | 218 |
| 776 | 3300005456 | Ga0070678_100000013 | Ga0070678_10000001330 | 218 |
| 777 | 3300005457 | Ga0070662_100013995 | Ga0070662_1000139954 | 218 |
| 778 | 3300005458 | Ga0070681_10001666 | Ga0070681_1000166625 | 218 |
| 779 | 3300005459 | Ga0068867_100000203 | Ga0068867_10000020316 | 218 |
| 780 | 3300005466 | Ga0070685_10010123 | Ga0070685_100101237 | 218 |
| 781 | 3300005530 | Ga0070679_100001194 | Ga0070679_1000011944 | 218 |
| 782 | 3300005535 | Ga0070684_100090319 | Ga0070684_1000903193 | 218 |
| 783 | 3300005539 | Ga0068853_100816655 | Ga0068853_1008166552 | 218 |
| 784 | 3300005543 | Ga0070672_100000661 | Ga0070672_10000066118 | 218 |
| 785 | 3300005544 | Ga0070686_100078247 | Ga0070686_1000782473 | 218 |
| 786 | 3300005545 | Ga0070695_100005322 | Ga0070695_1000053224 | 218 |
| 787 | 3300005546 | Ga0070696_100000625 | Ga0070696_1000006254 | 218 |
| 788 | 3300005548 | Ga0070665_100156858 | Ga0070665_1001568582 | 218 |
| 789 | 3300005564 | Ga0070664_100003543 | Ga0070664_1000035439 | 218 |
| 790 | 3300005577 | Ga0068857_100095168 | Ga0068857_1000951684 | 218 |
| 791 | 3300005618 | Ga0068864_100094454 | Ga0068864_1000944544 | 218 |
| 792 | 3300005718 | Ga0068866_10006009 | Ga0068866_100060092 | 218 |
| 793 | 3300005719 | Ga0068861_100015268 | Ga0068861_1000152684 | 218 |
| 794 | 3300005842 | Ga0068858_100783110 | Ga0068858_1007831101 | 218 |
| 795 | 3300005843 | Ga0068860_100028516 | Ga0068860_1000285164 | 218 |
| 796 | 3300005844 | Ga0068862_100139331 | Ga0068862_1001393312 | 218 |
| 797 | 3300005937 | Ga0081455_10000317 | Ga0081455_1000031716 | 218 |
| 798 | 3300006058 | Ga0075432_10001421 | Ga0075432_100014214 | 218 |
| 799 | 3300006237 | Ga0097621_100003757 | Ga0097621_10000375712 | 218 |
| 800 | 3300006358 | Ga0068871_100026581 | Ga0068871_1000265812 | 218 |
| 801 | 3300006844 | Ga0075428_100300288 | Ga0075428_1003002882 | 218 |
| 802 | 3300006846 | Ga0075430_100017058 | Ga0075430_1000170585 | 218 |
| 803 | 3300006847 | Ga0075431_100002813 | Ga0075431_1000028133 | 218 |
| 804 | 3300006880 | Ga0075429_100138859 | Ga0075429_1001388593 | 218 |
| 805 | 3300006881 | Ga0068865_100005765 | Ga0068865_1000057659 | 218 |
| 806 | 3300006914 | Ga0075436_100008160 | Ga0075436_1000081609 | 218 |
| 807 | 3300006914 | Ga0075436_100214558 | Ga0075436_1002145582 | 218 |
| 808 | 3300007076 | Ga0075435_100048583 | Ga0075435_1000485833 | 218 |
| 809 | 3300009098 | Ga0105245_10001382 | Ga0105245_1000138229 | 218 |
| 810 | 3300009147 | Ga0114129_10002913 | Ga0114129_1000291328 | 218 |
| 811 | 3300009148 | Ga0105243_10006158 | Ga0105243_100061584 | 218 |
| 812 | 3300009176 | Ga0105242_10000602 | Ga0105242_100006027 | 218 |
| 813 | 3300009553 | Ga0105249_10008227 | Ga0105249_100082278 | 218 |
| 814 | 3300010375 | Ga0105239_10039827 | Ga0105239_100398274 | 218 |
| 815 | 3300011119 | Ga0105246_10000247 | Ga0105246_1000024716 | 218 |
| 816 | 3300013100 | Ga0157373_10165207 | Ga0157373_101652072 | 218 |
| 817 | 3300013296 | Ga0157374_10093200 | Ga0157374_100932002 | 218 |
| 818 | 3300013297 | Ga0157378_10000734 | Ga0157378_1000073417 | 218 |
| 819 | 3300013308 | Ga0157375_10014212 | Ga0157375_100142127 | 218 |
| 820 | 3300014326 | Ga0157380_10013441 | Ga0157380_100134415 | 218 |
| 821 | 3300014745 | Ga0157377_10004292 | Ga0157377_100042922 | 218 |
| 822 | 3300014969 | Ga0157376_10002681 | Ga0157376_100026815 | 218 |
| 823 | 3300025315 | Ga0207697_10119407 | Ga0207697_101194072 | 218 |
| 824 | 3300025893 | Ga0207682_10009860 | Ga0207682_100098604 | 218 |
| 825 | 3300025899 | Ga0207642_10003372 | Ga0207642_100033726 | 218 |
| 826 | 3300025901 | Ga0207688_10046618 | Ga0207688_100466181 | 218 |
| 827 | 3300025903 | Ga0207680_10210165 | Ga0207680_102101652 | 218 |
| 828 | 3300025904 | Ga0207647_10209736 | Ga0207647_102097362 | 218 |
| 829 | 3300025907 | Ga0207645_10000024 | Ga0207645_1000002433 | 218 |
| 830 | 3300025912 | Ga0207707_10073794 | Ga0207707_100737942 | 218 |
| 831 | 3300025916 | Ga0207663_10550709 | Ga0207663_105507091 | 218 |
| 832 | 3300025917 | Ga0207660_10037799 | Ga0207660_100377992 | 218 |
| 833 | 3300025919 | Ga0207657_10007622 | Ga0207657_1000762214 | 218 |
| 834 | 3300025920 | Ga0207649_10005050 | Ga0207649_100050502 | 218 |
| 835 | 3300025921 | Ga0207652_10145434 | Ga0207652_101454342 | 218 |
| 836 | 3300025923 | Ga0207681_10079641 | Ga0207681_100796412 | 218 |
| 837 | 3300025925 | Ga0207650_10014788 | Ga0207650_100147886 | 218 |
| 838 | 3300025926 | Ga0207659_10015050 | Ga0207659_100150506 | 218 |
| 839 | 3300025927 | Ga0207687_10046903 | Ga0207687_100469032 | 218 |
| 840 | 3300025932 | Ga0207690_10011744 | Ga0207690_100117446 | 218 |
| 841 | 3300025933 | Ga0207706_10000080 | Ga0207706_1000008037 | 218 |
| 842 | 3300025934 | Ga0207686_10013826 | Ga0207686_100138262 | 218 |
| 843 | 3300025935 | Ga0207709_10005246 | Ga0207709_100052463 | 218 |
| 844 | 3300025936 | Ga0207670_10010130 | Ga0207670_100101301 | 218 |
| 845 | 3300025937 | Ga0207669_10015753 | Ga0207669_100157532 | 218 |
| 846 | 3300025938 | Ga0207704_10018158 | Ga0207704_100181584 | 218 |
| 847 | 3300025940 | Ga0207691_10000099 | Ga0207691_1000009974 | 218 |
| 848 | 3300025944 | Ga0207661_10015684 | Ga0207661_100156847 | 218 |
| 849 | 3300025945 | Ga0207679_10100186 | Ga0207679_101001862 | 218 |
| 850 | 3300025949 | Ga0207667_10240803 | Ga0207667_102408033 | 218 |
| 851 | 3300025960 | Ga0207651_10032120 | Ga0207651_100321204 | 218 |
| 852 | 3300025972 | Ga0207668_10086768 | Ga0207668_100867682 | 218 |
| 853 | 3300025986 | Ga0207658_10005794 | Ga0207658_100057942 | 218 |
| 854 | 3300026023 | Ga0207677_10110724 | Ga0207677_101107242 | 218 |
| 855 | 3300026035 | Ga0207703_10698077 | Ga0207703_106980772 | 218 |
| 856 | 3300026041 | Ga0207639_10766950 | Ga0207639_107669501 | 218 |
| 857 | 3300026075 | Ga0207708_10000072 | Ga0207708_1000007241 | 218 |
| 858 | 3300026089 | Ga0207648_10000057 | Ga0207648_1000005741 | 218 |
| 859 | 3300026116 | Ga0207674_10013599 | Ga0207674_100135997 | 218 |
| 860 | 3300026118 | Ga0207675_100093728 | Ga0207675_1000937284 | 218 |
| 861 | 3300026121 | Ga0207683_10000036 | Ga0207683_1000003626 | 218 |
| 862 | 3300027252 | Ga0209973_1002144 | Ga0209973_10021442 | 218 |
| 863 | 3300027360 | Ga0209969_1000031 | Ga0209969_100003120 | 218 |
| 864 | 3300027364 | Ga0209967_1000195 | Ga0209967_10001959 | 218 |
| 865 | 3300027378 | Ga0209981_1000029 | Ga0209981_10000292 | 218 |
| 866 | 3300027395 | Ga0209996_1000032 | Ga0209996_100003212 | 218 |
| 867 | 3300027424 | Ga0209984_1000086 | Ga0209984_10000862 | 218 |
| 868 | 3300027462 | Ga0210000_1000004 | Ga0210000_100000442 | 218 |
| 869 | 3300027471 | Ga0209995_1000199 | Ga0209995_10001996 | 218 |
| 870 | 3300027526 | Ga0209968_1000015 | Ga0209968_10000159 | 218 |
| 871 | 3300027543 | Ga0209999_1000108 | Ga0209999_10001082 | 218 |
| 872 | 3300027552 | Ga0209982_1000941 | Ga0209982_10009414 | 218 |
| 873 | 3300027614 | Ga0209970_1000033 | Ga0209970_100003314 | 218 |
| 874 | 3300027617 | Ga0210002_1000009 | Ga0210002_10000097 | 218 |
| 875 | 3300027665 | Ga0209983_1001657 | Ga0209983_10016574 | 218 |
| 876 | 3300027682 | Ga0209971_1004115 | Ga0209971_10041152 | 218 |
| 877 | 3300027695 | Ga0209966_1000012 | Ga0209966_100001274 | 218 |
| 878 | 3300027717 | Ga0209998_10000174 | Ga0209998_100001749 | 218 |
| 879 | 3300027876 | Ga0209974_10000002 | Ga0209974_1000000218 | 218 |
| 880 | 3300027907 | Ga0207428_10000476 | Ga0207428_1000047632 | 218 |
| 881 | 3300028379 | Ga0268266_10307546 | Ga0268266_103075462 | 218 |
| 882 | 3300028380 | Ga0268265_10119899 | Ga0268265_101198994 | 218 |
| 883 | 3300028381 | Ga0268264_10173486 | Ga0268264_101734863 | 218 |
| 884 | 3300035112 | Ga0373932_0071046 | Ga0373932_0071046_78_734 | 218 |
| 885 | 3300035207 | Ga0373942_0075039 | Ga0373942_0075039_79_735 | 218 |
| 886 | 3300035241 | Ga0373961_0064729 | Ga0373961_0064729_114_770 | 218 |
| 887 | 3300045051 | Ga0451576_0273911 | Ga0451576_0273911_901_1557 | 218 |
| 888 | 3300050507 | nmdc:mga05p37_67642_c1 | nmdc:mga05p37_67642_c1_3383_4039 | 218 |
| 889 | 3300050509 | nmdc:mga0qj67_195942_c1 | nmdc:mga0qj67_195942_c1_879_1535 | 218 |
| 890 | 3300050510 | nmdc:mga06r32_84557_c1 | nmdc:mga06r32_84557_c1_357_1013 | 218 |
| 891 | 3300050511 | nmdc:mga08y16_7332_c1 | nmdc:mga08y16_7332_c1_9272_9928 | 218 |
| 892 | 3300050512 | nmdc:mga0n895_23084_c1 | nmdc:mga0n895_23084_c1_890_1546 | 218 |
| 893 | 3300050513 | nmdc:mga0rr50_49382_c1 | nmdc:mga0rr50_49382_c1_1976_2632 | 218 |
| 894 | 3300050514 | nmdc:mga08x19_25958_c1 | nmdc:mga08x19_25958_c1_23_679 | 218 |
| 895 | 3300050515 | nmdc:mga0a205_335661_c1 | nmdc:mga0a205_335661_c1_86_742 | 218 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ekh-assembly1.cif.gz_Y | crystal structure of activated chey from methanoccocus maripaludis | 0.962 | 3 | 118 |
| 3cz5-assembly2.cif.gz_B | crystal structure of two-component response regulator, luxr family, from aurantimonas sp. si85-9a1 | 0.9608 | 3 | 138 |
| 7od9-assembly1.cif.gz_B | crystal structure of activated chey fused to the c-terminal domain of chef | 0.9543 | 3 | 118 |
| 8a5s-assembly1.cif.gz_AAA | crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. | 0.9531 | 149 | 208 |
| 3hzh-assembly1.cif.gz_A | crystal structure of the chex-chey-bef3-mg+2 complex from borrelia burgdorferi | 0.9472 | 5 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ekhY00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.962 | 3 | 118 | 3.40.50.2300 |
| 3cz5B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9608 | 3 | 138 | 3.40.50.2300 |
| 3hzhA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9472 | 5 | 119 | 3.40.50.2300 |
| 4tmyB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9432 | 4 | 118 | 3.40.50.2300 |
| af_Q2FWH6_1_124_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9405 | 3 | 120 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2T8S5-F1-model_v4 | Response regulatory domain-containing protein | 0.9842 | 1 | 129 |
GO:0000160
GO:0003677 |
| AF-A0A2V8RH29-F1-model_v4 | Response regulatory domain-containing protein | 0.9826 | 3 | 129 |
GO:0000160
|
| AF-A0A2V9VDR3-F1-model_v4 | Response regulatory domain-containing protein | 0.9758 | 1 | 126 |
GO:0000160
GO:0003677 |
| AF-A0A2V8SNV1-F1-model_v4 | Response regulatory domain-containing protein | 0.9752 | 3 | 129 |
GO:0000160
GO:0003677 |
| AF-A0A2W0BRM2-F1-model_v4 | Response regulatory domain-containing protein | 0.9746 | 3 | 129 |
GO:0000160
GO:0003677 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar