F484976

General Info

Members Datasets Scaffolds Average Seq Length
895 384 895 213

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10012863|Ga0163163_100128637
Length 243
Sequence VEALFAAQVTDGPLQQLSFWALQFQIVSEAGRMARTRLLLADDHTLLVDAFRKLLEPEFEIVGTASDGRTLLAGALQLRPDVVVVDLGLPLLNGMDAGRELKKLMPQIKLLVVTMSEDVGVAAEALREWASGYLLKKSAGTELTHAIREVIKGRTYVTPHVAQQLVDQFIREPEHARRALTSRQREVLQLLAEGRTMKETADILKLTTRTIAFHKYRIMQEFGLQNNSELLKLAIREHLVPPV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
13 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
14 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
15 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
16 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
153 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
154 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
243 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
244 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
256 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
257 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
258 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
260 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
261 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
262 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
263 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
264 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
268 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
269 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
271 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
272 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
273 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
281 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
282 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
283 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
284 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
285 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
286 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
302 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
338 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
339 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
356 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
357 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
358 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
380 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
383 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 4.36
Rhizosphere 92.85
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3676544 2162886007 Bacteria 2524
2 MRS1b_contig_650282 2162886011 Bacteria 1433
3 MRS1b_contig_6820307 2162886011 Unclassified 851
4 MBSR1b_contig_7203822 2162886012 Bacteria 1502
5 MBSR1b_contig_8982173 2162886012 Unclassified 1498
6 JGI24752J21851_1002687 3300001976 Bacteria 2364
7 JGI24737J22298_10025386 3300001990 Bacteria 1874
8 JGI24737J22298_10066052 3300001990 Bacteria 1083
9 JGI24743J22301_10003233 3300001991 Bacteria 2560
10 JGI24750J21931_1023451 3300002070 Unclassified 876
11 JGI24033J26618_1003840 3300002155 Bacteria 1599
12 JGI24034J26672_10004298 3300002239 Bacteria 2013
13 JGI24751J29686_10001753 3300002459 Bacteria 4460
14 JGI24751J29686_10033813 3300002459 Bacteria 1060
15 JGI25162J39368_1009987 3300002737 Bacteria 1229
16 JGI26128J50194_1001479 3300003347 Bacteria 1496
17 JGI26129J50193_1001113 3300003349 Bacteria 1794
18 JGI26145J50221_1000604 3300003371 Unclassified 3056
19 JGI26140J50224_100513 3300003383 Bacteria 1655
20 Ga0058859_11676364 3300004798 Unclassified 856
21 Ga0058863_11434404 3300004799 Unclassified 877
22 Ga0058861_12004268 3300004800 Unclassified 1375
23 Ga0058860_11325207 3300004801 Unclassified 1005
24 Ga0058860_11635791 3300004801 Unclassified 860
25 Ga0058860_11739536 3300004801 Bacteria 1720
26 Ga0058862_10044413 3300004803 Bacteria 1711
27 Ga0065704_10071835 3300005289 Bacteria 9791
28 Ga0065712_10071490 3300005290 Bacteria 5234
29 Ga0065712_10089919 3300005290 Bacteria 2447
30 Ga0065712_10138160 3300005290 Unclassified 1468
31 Ga0065712_10149010 3300005290 Bacteria 1385
32 Ga0065715_10006312 3300005293 Bacteria 3474
33 Ga0065715_10017945 3300005293 Bacteria 2257
34 Ga0065715_10135651 3300005293 Bacteria 1935
35 Ga0065715_10139294 3300005293 Bacteria 1879
36 Ga0065715_10407023 3300005293 Unclassified 874
37 Ga0065707_10003017 3300005295 Bacteria 4389
38 Ga0065707_10107130 3300005295 Bacteria 2568
39 Ga0065707_10124507 3300005295 Unclassified 2042
40 Ga0065707_10154527 3300005295 Unclassified 1622
41 Ga0065707_10164315 3300005295 Unclassified 1536
42 Ga0070658_10666313 3300005327 Bacteria 903
43 Ga0070676_10001350 3300005328 Bacteria 12334
44 Ga0070676_10031752 3300005328 Bacteria 3021
45 Ga0070676_10110356 3300005328 Unclassified 1712
46 Ga0070676_10551809 3300005328 Bacteria 825
47 Ga0070683_100006993 3300005329 Bacteria 9494
48 Ga0070683_100051999 3300005329 Bacteria 3795
49 Ga0070690_100000310 3300005330 Bacteria 25176
50 Ga0070690_100015219 3300005330 Bacteria 4584
51 Ga0070670_100004761 3300005331 Bacteria 11398
52 Ga0070670_100074171 3300005331 Bacteria 2922
53 Ga0070677_10010323 3300005333 Bacteria 3191
54 Ga0070677_10014268 3300005333 Bacteria 2795
55 Ga0068869_100014772 3300005334 Bacteria 5223
56 Ga0068869_100110422 3300005334 Bacteria 2091
57 Ga0068869_100531267 3300005334 Bacteria 986
58 Ga0070666_10020223 3300005335 Unclassified 4302
59 Ga0070666_10177451 3300005335 Bacteria 1493
60 Ga0070666_10222857 3300005335 Bacteria 1330
61 Ga0070680_100018896 3300005336 Bacteria 5451
62 Ga0070680_100035842 3300005336 Bacteria 4006
63 Ga0070680_100142887 3300005336 Bacteria 2007
64 Ga0070680_100433549 3300005336 Unclassified 1122
65 Ga0070680_100436723 3300005336 Unclassified 1117
66 Ga0070680_100912499 3300005336 Unclassified 758
67 Ga0070682_100414863 3300005337 Bacteria 1022
68 Ga0070682_100676923 3300005337 Unclassified 824
69 Ga0068868_100028184 3300005338 Bacteria 4291
70 Ga0068868_100099409 3300005338 Bacteria 2353
71 Ga0070660_100003327 3300005339 Bacteria 11047
72 Ga0070660_100039824 3300005339 Unclassified 3573
73 Ga0070660_100085814 3300005339 Bacteria 2476
74 Ga0070689_100004859 3300005340 Bacteria 9123
75 Ga0070689_100014437 3300005340 Bacteria 5738
76 Ga0070689_100039896 3300005340 Bacteria 3597
77 Ga0070689_100070610 3300005340 Bacteria 2727
78 Ga0070689_100218750 3300005340 Bacteria 1561
79 Ga0070691_10001905 3300005341 Bacteria 9147
80 Ga0070691_10086713 3300005341 Bacteria 1539
81 Ga0070691_10107514 3300005341 Bacteria 1392
82 Ga0070687_100002265 3300005343 Bacteria 7147
83 Ga0070687_100114928 3300005343 Bacteria 1529
84 Ga0070661_100012144 3300005344 Bacteria 6022
85 Ga0070661_100033766 3300005344 Bacteria 3708
86 Ga0070661_100066322 3300005344 Bacteria 2652
87 Ga0070661_100329613 3300005344 Bacteria 1194
88 Ga0070661_100563048 3300005344 Bacteria 918
89 Ga0070692_10015880 3300005345 Bacteria 3571
90 Ga0070692_10072168 3300005345 Bacteria 1841
91 Ga0070668_100010502 3300005347 Bacteria 6884
92 Ga0070668_100078830 3300005347 Bacteria 2577
93 Ga0070668_100334386 3300005347 Unclassified 1278
94 Ga0070669_100017825 3300005353 Bacteria 5068
95 Ga0070669_100077647 3300005353 Bacteria 2467
96 Ga0070669_100309785 3300005353 Bacteria 1272
97 Ga0070669_100379060 3300005353 Unclassified 1153
98 Ga0070669_100525458 3300005353 Bacteria 984
99 Ga0070675_100001819 3300005354 Bacteria 15788
100 Ga0070675_100011171 3300005354 Bacteria 7026
101 Ga0070675_100082629 3300005354 Bacteria 2680
102 Ga0070675_100172984 3300005354 Bacteria 1863
103 Ga0070675_100211928 3300005354 Bacteria 1684
104 Ga0070675_100283243 3300005354 Bacteria 1457
105 Ga0070671_100005413 3300005355 Bacteria 10183
106 Ga0070671_100235624 3300005355 Bacteria 1553
107 Ga0070671_100378618 3300005355 Unclassified 1209
108 Ga0070674_100000555 3300005356 Bacteria 18749
109 Ga0070674_100012998 3300005356 Bacteria 5130
110 Ga0070674_100085345 3300005356 Bacteria 2266
111 Ga0070674_100280492 3300005356 Bacteria 1320
112 Ga0070674_101008616 3300005356 Unclassified 731
113 Ga0070673_100003366 3300005364 Bacteria 9946
114 Ga0070673_100008456 3300005364 Bacteria 6844
115 Ga0070673_100064718 3300005364 Bacteria 2914
116 Ga0070673_100095320 3300005364 Unclassified 2441
117 Ga0070673_100097585 3300005364 Bacteria 2413
118 Ga0070673_100268636 3300005364 Bacteria 1492
119 Ga0070673_100480693 3300005364 Unclassified 1121
120 Ga0070688_100044989 3300005365 Bacteria 2725
121 Ga0070688_100085816 3300005365 Bacteria 2047
122 Ga0070688_100410758 3300005365 Bacteria 1004
123 Ga0070659_100006001 3300005366 Bacteria 8760
124 Ga0070659_100008916 3300005366 Bacteria 7351
125 Ga0070659_100027932 3300005366 Unclassified 4352
126 Ga0070659_100028076 3300005366 Bacteria 4342
127 Ga0070659_100044634 3300005366 Bacteria 3471
128 Ga0070667_100004550 3300005367 Bacteria 11671
129 Ga0070667_100286419 3300005367 Bacteria 1481
130 Ga0070667_100459554 3300005367 Bacteria 1164
131 Ga0070667_100476776 3300005367 Unclassified 1142
132 Ga0070667_101300591 3300005367 Bacteria 681
133 Ga0070709_10021279 3300005434 Unclassified 3775
134 Ga0070709_10156740 3300005434 Bacteria 1579
135 Ga0070714_100099447 3300005435 Bacteria 2560
136 Ga0070714_100214890 3300005435 Unclassified 1764
137 Ga0070714_100284605 3300005435 Unclassified 1537
138 Ga0070713_100000446 3300005436 Bacteria 26332
139 Ga0070713_100004441 3300005436 Bacteria 9424
140 Ga0070713_100005822 3300005436 Bacteria 8474
141 Ga0070713_100019679 3300005436 Bacteria 5162
142 Ga0070713_100132076 3300005436 Unclassified 2203
143 Ga0070713_100552992 3300005436 Bacteria 1090
144 Ga0070713_100570705 3300005436 Bacteria 1073
145 Ga0070710_10009202 3300005437 Unclassified 4829
146 Ga0070710_10169991 3300005437 Unclassified 1358
147 Ga0070701_10015524 3300005438 Bacteria 3520
148 Ga0070701_10088921 3300005438 Bacteria 1688
149 Ga0070701_10551466 3300005438 Bacteria 756
150 Ga0070711_100000290 3300005439 Bacteria 26042
151 Ga0070711_100068974 3300005439 Unclassified 2486
152 Ga0070711_100084180 3300005439 Unclassified 2274
153 Ga0070711_100148168 3300005439 Unclassified 1767
154 Ga0070711_100235217 3300005439 Bacteria 1430
155 Ga0070711_100258084 3300005439 Bacteria 1370
156 Ga0070711_100653018 3300005439 Unclassified 882
157 Ga0070705_100015260 3300005440 Bacteria 3967
158 Ga0070700_100000432 3300005441 Bacteria 21239
159 Ga0070700_100157658 3300005441 Bacteria 1559
160 Ga0070700_100169810 3300005441 Unclassified 1509
161 Ga0070700_100182678 3300005441 Unclassified 1461
162 Ga0070694_100026224 3300005444 Bacteria 3776
163 Ga0070694_100083877 3300005444 Unclassified 2222
164 Ga0070708_100371451 3300005445 Unclassified 1348
165 Ga0070663_100152065 3300005455 Bacteria 1775
166 Ga0070678_100000013 3300005456 Bacteria 57048
167 Ga0070678_100045306 3300005456 Bacteria 3146
168 Ga0070678_100184157 3300005456 Bacteria 1712
169 Ga0070678_100496280 3300005456 Bacteria 1076
170 Ga0070662_100013995 3300005457 Bacteria 5346
171 Ga0070662_100099992 3300005457 Bacteria 2193
172 Ga0070681_10001666 3300005458 Bacteria 19826
173 Ga0070681_10014004 3300005458 Bacteria 7982
174 Ga0070681_10044822 3300005458 Bacteria 4428
175 Ga0068867_100000203 3300005459 Bacteria 39550
176 Ga0068867_100003472 3300005459 Bacteria 11083
177 Ga0070685_10001794 3300005466 Bacteria 11204
178 Ga0070685_10010123 3300005466 Bacteria 4893
179 Ga0070685_10012334 3300005466 Bacteria 4490
180 Ga0070685_10272288 3300005466 Bacteria 1130
181 Ga0070706_100024489 3300005467 Bacteria 5556
182 Ga0070707_101101884 3300005468 Unclassified 760
183 Ga0070698_100001691 3300005471 Bacteria 24608
184 Ga0070699_100001008 3300005518 Bacteria 26211
185 Ga0070699_100009056 3300005518 Bacteria 8626
186 Ga0070699_100953537 3300005518 Bacteria 786
187 Ga0070679_100001194 3300005530 Bacteria 22826
188 Ga0070679_100009610 3300005530 Bacteria 9149
189 Ga0070679_100621969 3300005530 Unclassified 1023
190 Ga0070684_100004138 3300005535 Bacteria 10982
191 Ga0070684_100090319 3300005535 Bacteria 2724
192 Ga0070697_100001902 3300005536 Bacteria 15967
193 Ga0070697_100935798 3300005536 Unclassified 769
194 Ga0068853_100011567 3300005539 Bacteria 7175
195 Ga0068853_100029389 3300005539 Bacteria 4633
196 Ga0068853_100033712 3300005539 Unclassified 4344
197 Ga0068853_100816655 3300005539 Bacteria 893
198 Ga0070672_100000661 3300005543 Bacteria 20203
199 Ga0070672_100024864 3300005543 Bacteria 4434
200 Ga0070672_100029390 3300005543 Bacteria 4121
201 Ga0070672_100034927 3300005543 Bacteria 3818
202 Ga0070672_100114027 3300005543 Bacteria 2206
203 Ga0070686_100003559 3300005544 Bacteria 8547
204 Ga0070686_100014963 3300005544 Bacteria 4482
205 Ga0070686_100078247 3300005544 Bacteria 2183
206 Ga0070695_100005322 3300005545 Bacteria 7578
207 Ga0070695_100202734 3300005545 Bacteria 1419
208 Ga0070696_100000625 3300005546 Bacteria 22572
209 Ga0070696_100037178 3300005546 Bacteria 3358
210 Ga0070696_100664609 3300005546 Bacteria 846
211 Ga0070693_100046904 3300005547 Bacteria 2456
212 Ga0070665_100073119 3300005548 Unclassified 3435
213 Ga0070665_100076157 3300005548 Unclassified 3362
214 Ga0070665_100156858 3300005548 Bacteria 2278
215 Ga0070665_100442842 3300005548 Unclassified 1308
216 Ga0070665_100670775 3300005548 Unclassified 1050
217 Ga0070665_100891151 3300005548 Unclassified 902
218 Ga0070704_100029699 3300005549 Bacteria 3654
219 Ga0068855_100049255 3300005563 Bacteria 4969
220 Ga0070664_100003168 3300005564 Bacteria 13296
221 Ga0070664_100003543 3300005564 Bacteria 12610
222 Ga0070664_100005990 3300005564 Bacteria 9829
223 Ga0070664_100026065 3300005564 Bacteria 4847
224 Ga0070664_100028799 3300005564 Unclassified 4625
225 Ga0070664_100053287 3300005564 Bacteria 3428
226 Ga0070664_100082437 3300005564 Unclassified 2774
227 Ga0068857_100007847 3300005577 Bacteria 9205
228 Ga0068857_100095168 3300005577 Bacteria 2668
229 Ga0068854_100020958 3300005578 Bacteria 4429
230 Ga0068854_100681944 3300005578 Bacteria 885
231 Ga0068856_100012904 3300005614 Bacteria 8086
232 Ga0068856_100357876 3300005614 Unclassified 1478
233 Ga0068856_100469258 3300005614 Bacteria 1279
234 Ga0068852_100129931 3300005616 Bacteria 2318
235 Ga0068859_100042252 3300005617 Bacteria 4579
236 Ga0068859_100146076 3300005617 Unclassified 2440
237 Ga0068859_100175726 3300005617 Bacteria 2223
238 Ga0068859_100222905 3300005617 Bacteria 1973
239 Ga0068859_100303296 3300005617 Bacteria 1690
240 Ga0068864_100001672 3300005618 Bacteria 18248
241 Ga0068864_100009474 3300005618 Bacteria 8036
242 Ga0068864_100019584 3300005618 Bacteria 5660
243 Ga0068864_100094454 3300005618 Bacteria 2643
244 Ga0068864_100170967 3300005618 Bacteria 1981
245 Ga0068864_101000370 3300005618 Bacteria 829
246 Ga0068866_10006009 3300005718 Bacteria 5051
247 Ga0068866_10032651 3300005718 Bacteria 2519
248 Ga0068861_100015268 3300005719 Bacteria 5408
249 Ga0068861_100032636 3300005719 Bacteria 3835
250 Ga0068861_100047695 3300005719 Bacteria 3235
251 Ga0068861_100197266 3300005719 Bacteria 1687
252 Ga0068851_10009594 3300005834 Bacteria 4507
253 Ga0068870_10006412 3300005840 Bacteria 5185
254 Ga0068863_100003190 3300005841 Bacteria 16219
255 Ga0068863_100044844 3300005841 Bacteria 4196
256 Ga0068858_100105508 3300005842 Bacteria 2629
257 Ga0068858_100166813 3300005842 Bacteria 2075
258 Ga0068858_100783110 3300005842 Bacteria 930
259 Ga0068860_100028516 3300005843 Bacteria 5374
260 Ga0068860_100236396 3300005843 Bacteria 1776
261 Ga0068860_100712035 3300005843 Unclassified 1014
262 Ga0068862_100139331 3300005844 Bacteria 2152
263 Ga0068862_100147891 3300005844 Bacteria 2089
264 Ga0068862_100271823 3300005844 Bacteria 1550
265 Ga0068862_100372854 3300005844 Unclassified 1329
266 Ga0068862_100647899 3300005844 Unclassified 1019
267 Ga0081455_10000317 3300005937 Bacteria 63219
268 Ga0081455_10154161 3300005937 Bacteria 1768
269 Ga0081538_10135380 3300005981 Bacteria 1148
270 Ga0081540_1001614 3300005983 Bacteria 19225
271 Ga0081540_1011995 3300005983 Bacteria 5742
272 Ga0081539_10008569 3300005985 Bacteria 8845
273 Ga0070717_10000457 3300006028 Bacteria 25932
274 Ga0070717_10000640 3300006028 Bacteria 22510
275 Ga0070717_10028291 3300006028 Unclassified 4485
276 Ga0070717_10359903 3300006028 Bacteria 1302
277 Ga0075365_10264685 3300006038 Bacteria 1209
278 Ga0075364_10030978 3300006051 Bacteria 3436
279 Ga0075364_10260225 3300006051 Bacteria 1179
280 Ga0075432_10001421 3300006058 Bacteria 7794
281 Ga0070715_10006086 3300006163 Bacteria 4077
282 Ga0070716_100000456 3300006173 Bacteria 16938
283 Ga0070716_100018178 3300006173 Bacteria 3658
284 Ga0070712_100003988 3300006175 Bacteria 9072
285 Ga0070712_100012277 3300006175 Bacteria 5445
286 Ga0070712_100073097 3300006175 Bacteria 2458
287 Ga0070712_100090640 3300006175 Unclassified 2238
288 Ga0070712_100897724 3300006175 Unclassified 764
289 Ga0075367_10006970 3300006178 Bacteria 5756
290 Ga0097621_100003757 3300006237 Bacteria 10520
291 Ga0097621_100116634 3300006237 Bacteria 2261
292 Ga0097621_100470731 3300006237 Bacteria 1134
293 Ga0075370_10366342 3300006353 Bacteria 862
294 Ga0068871_100026581 3300006358 Bacteria 4518
295 Ga0068871_100127951 3300006358 Bacteria 2151
296 Ga0068871_100147170 3300006358 Bacteria 2006
297 Ga0068871_100505326 3300006358 Unclassified 1090
298 Ga0075428_100016539 3300006844 Bacteria 8145
299 Ga0075428_100050123 3300006844 Unclassified 4579
300 Ga0075428_100300288 3300006844 Bacteria 1726
301 Ga0075428_100693233 3300006844 Bacteria 1085
302 Ga0075430_100006387 3300006846 Bacteria 9938
303 Ga0075430_100017058 3300006846 Bacteria 6185
304 Ga0075430_100070526 3300006846 Bacteria 2931
305 Ga0075430_100138300 3300006846 Unclassified 2028
306 Ga0075430_100249948 3300006846 Bacteria 1469
307 Ga0075431_100002813 3300006847 Bacteria 16835
308 Ga0075431_100006181 3300006847 Bacteria 11885
309 Ga0075431_100011175 3300006847 Bacteria 9040
310 Ga0075431_100020745 3300006847 Bacteria 6714
311 Ga0075431_100082302 3300006847 Bacteria 3322
312 Ga0075431_100126092 3300006847 Unclassified 2641
313 Ga0075431_100508026 3300006847 Bacteria 1196
314 Ga0075433_10087922 3300006852 Bacteria 2745
315 Ga0075433_10237061 3300006852 Bacteria 1620
316 Ga0075434_100232013 3300006871 Bacteria 1865
317 Ga0075434_100629677 3300006871 Unclassified 1091
318 Ga0075429_100001748 3300006880 Bacteria 17994
319 Ga0075429_100055210 3300006880 Bacteria 3456
320 Ga0075429_100138859 3300006880 Bacteria 2127
321 Ga0075429_100141131 3300006880 Bacteria 2109
322 Ga0075429_100316892 3300006880 Unclassified 1365
323 Ga0068865_100001611 3300006881 Bacteria 13222
324 Ga0068865_100005765 3300006881 Bacteria 7528
325 Ga0075436_100000125 3300006914 Bacteria 45485
326 Ga0075436_100008160 3300006914 Bacteria 7169
327 Ga0075436_100214558 3300006914 Unclassified 1365
328 Ga0097620_100042254 3300006931 Bacteria 4579
329 Ga0097620_100146070 3300006931 Unclassified 2440
330 Ga0097620_100175715 3300006931 Bacteria 2223
331 Ga0097620_100222905 3300006931 Bacteria 1973
332 Ga0097620_100303296 3300006931 Bacteria 1690
333 Ga0075435_100048583 3300007076 Bacteria 3409
334 Ga0075435_100562231 3300007076 Unclassified 988
335 Ga0099794_10007589 3300007265 Unclassified 4462
336 Ga0099794_10242377 3300007265 Bacteria 929
337 Ga0105250_10006934 3300009092 Bacteria 4905
338 Ga0111539_10005667 3300009094 Bacteria 16156
339 Ga0111539_10096679 3300009094 Bacteria 3469
340 Ga0111539_10167164 3300009094 Unclassified 2571
341 Ga0111539_10249666 3300009094 Bacteria 2066
342 Ga0105245_10001382 3300009098 Bacteria 21973
343 Ga0105245_10005295 3300009098 Bacteria 11336
344 Ga0105247_10021179 3300009101 Bacteria 3912
345 Ga0105247_10054329 3300009101 Bacteria 2471
346 Ga0114129_10001427 3300009147 Bacteria 32269
347 Ga0114129_10002913 3300009147 Bacteria 23937
348 Ga0114129_10012627 3300009147 Bacteria 12025
349 Ga0114129_10032531 3300009147 Bacteria 7370
350 Ga0114129_10087188 3300009147 Unclassified 4329
351 Ga0114129_10100200 3300009147 Bacteria 4008
352 Ga0114129_10596540 3300009147 Bacteria 1432
353 Ga0105243_10006158 3300009148 Bacteria 9275
354 Ga0105243_10700356 3300009148 Unclassified 987
355 Ga0105243_10800586 3300009148 Unclassified 929
356 Ga0105241_10061881 3300009174 Bacteria 2884
357 Ga0105241_10084292 3300009174 Unclassified 2495
358 Ga0105241_10284557 3300009174 Bacteria 1413
359 Ga0105241_10427869 3300009174 Bacteria 1166
360 Ga0105242_10000602 3300009176 Bacteria 28181
361 Ga0105242_10055443 3300009176 Bacteria 3242
362 Ga0105242_10088069 3300009176 Bacteria 2607
363 Ga0105248_10067628 3300009177 Unclassified 4011
364 Ga0105248_10240083 3300009177 Unclassified 2040
365 Ga0105248_10567349 3300009177 Unclassified 1280
366 Ga0105237_10015273 3300009545 Bacteria 7998
367 Ga0105237_10535059 3300009545 Unclassified 1178
368 Ga0105238_10134128 3300009551 Bacteria 2454
369 Ga0105238_10245370 3300009551 Bacteria 1769
370 Ga0105238_10338958 3300009551 Unclassified 1491
371 Ga0105249_10008227 3300009553 Bacteria 9083
372 Ga0105249_10060525 3300009553 Bacteria 3474
373 Ga0105249_10219634 3300009553 Bacteria 1870
374 Ga0105239_10024492 3300010375 Bacteria 6649
375 Ga0105239_10039827 3300010375 Bacteria 5148
376 Ga0105246_10000247 3300011119 Bacteria 27878
377 Ga0105246_10024334 3300011119 Bacteria 3932
378 Ga0157373_10047337 3300013100 Bacteria 3067
379 Ga0157373_10165207 3300013100 Bacteria 1558
380 Ga0157371_10029266 3300013102 Bacteria 3985
381 Ga0157371_10035234 3300013102 Bacteria 3587
382 Ga0157369_10047314 3300013105 Unclassified 4671
383 Ga0157369_10400120 3300013105 Bacteria 1425
384 Ga0157374_10001511 3300013296 Bacteria 19594
385 Ga0157374_10020434 3300013296 Bacteria 5875
386 Ga0157374_10033741 3300013296 Unclassified 4671
387 Ga0157374_10046186 3300013296 Unclassified 4032
388 Ga0157374_10050881 3300013296 Bacteria 3853
389 Ga0157374_10093200 3300013296 Bacteria 2875
390 Ga0157374_10236335 3300013296 Bacteria 1796
391 Ga0157374_10465671 3300013296 Bacteria 1266
392 Ga0157378_10000734 3300013297 Bacteria 30654
393 Ga0157378_10218492 3300013297 Bacteria 1811
394 Ga0163162_10127638 3300013306 Bacteria 2651
395 Ga0163162_10130752 3300013306 Unclassified 2619
396 Ga0163162_10666351 3300013306 Bacteria 1164
397 Ga0157372_10129699 3300013307 Bacteria 2900
398 Ga0157372_10190616 3300013307 Bacteria 2375
399 Ga0157372_10247815 3300013307 Unclassified 2067
400 Ga0157372_10469251 3300013307 Unclassified 1467
401 Ga0157375_10014212 3300013308 Bacteria 7096
402 Ga0157375_10106874 3300013308 Bacteria 2891
403 Ga0157375_10120104 3300013308 Unclassified 2736
404 Ga0163163_10000851 3300014325 Bacteria 25945
405 Ga0163163_10003753 3300014325 Bacteria 12934
406 Ga0163163_10004565 3300014325 Bacteria 11820
407 Ga0163163_10005139 3300014325 Bacteria 11281
408 Ga0163163_10012863 3300014325 Bacteria 7638
409 Ga0163163_10032241 3300014325 Bacteria 5060
410 Ga0163163_10053430 3300014325 Unclassified 3987
411 Ga0163163_10064502 3300014325 Unclassified 3634
412 Ga0163163_10142769 3300014325 Unclassified 2437
413 Ga0157380_10013441 3300014326 Bacteria 5967
414 Ga0157377_10004292 3300014745 Bacteria 6539
415 Ga0157377_10008341 3300014745 Bacteria 5050
416 Ga0157377_10030048 3300014745 Bacteria 2940
417 Ga0157379_10080723 3300014968 Bacteria 2914
418 Ga0157379_10218159 3300014968 Bacteria 1728
419 Ga0157376_10002681 3300014969 Bacteria 12101
420 Ga0157376_10028783 3300014969 Bacteria 4420
421 Ga0157376_10085325 3300014969 Bacteria 2720
422 Ga0157376_10086291 3300014969 Bacteria 2706
423 Ga0157376_10088980 3300014969 Bacteria 2669
424 Ga0157376_10091677 3300014969 Bacteria 2633
425 Ga0157376_10101979 3300014969 Unclassified 2509
426 Ga0157376_10531900 3300014969 Bacteria 1160
427 Ga0163161_10032686 3300017792 Bacteria 3716
428 Ga0213874_10002459 3300021377 Bacteria 3996
429 Ga0228598_1010024 3300024227 Bacteria 1890
430 Ga0209437_104073 3300025233 Bacteria 2590
431 Ga0209233_1009661 3300025261 Bacteria 2927
432 Ga0207697_10119407 3300025315 Bacteria 1134
433 Ga0207656_10258178 3300025321 Bacteria 855
434 Ga0207682_10009860 3300025893 Bacteria 3756
435 Ga0207682_10015444 3300025893 Bacteria 2972
436 Ga0207682_10078681 3300025893 Bacteria 1409
437 Ga0207642_10003372 3300025899 Bacteria 5035
438 Ga0207642_10027177 3300025899 Bacteria 2339
439 Ga0207710_10041483 3300025900 Unclassified 2041
440 Ga0207710_10047049 3300025900 Bacteria 1927
441 Ga0207710_10279503 3300025900 Bacteria 840
442 Ga0207688_10001619 3300025901 Bacteria 11878
443 Ga0207688_10046618 3300025901 Unclassified 2420
444 Ga0207680_10070369 3300025903 Bacteria 2165
445 Ga0207680_10210165 3300025903 Bacteria 1330
446 Ga0207647_10012575 3300025904 Bacteria 5886
447 Ga0207647_10209736 3300025904 Bacteria 1125
448 Ga0207685_10003175 3300025905 Bacteria 3945
449 Ga0207685_10061451 3300025905 Unclassified 1489
450 Ga0207699_10001273 3300025906 Bacteria 11974
451 Ga0207645_10000024 3300025907 Bacteria 98683
452 Ga0207645_10000423 3300025907 Bacteria 35040
453 Ga0207645_10062283 3300025907 Unclassified 2383
454 Ga0207643_10000124 3300025908 Bacteria 53060
455 Ga0207643_10180174 3300025908 Bacteria 1278
456 Ga0207705_10209431 3300025909 Unclassified 1479
457 Ga0207684_10075169 3300025910 Bacteria 2871
458 Ga0207654_10084326 3300025911 Bacteria 1921
459 Ga0207707_10073794 3300025912 Bacteria 2975
460 Ga0207671_10269178 3300025914 Bacteria 1342
461 Ga0207671_10340218 3300025914 Unclassified 1189
462 Ga0207693_10000012 3300025915 Bacteria 154708
463 Ga0207693_10011931 3300025915 Bacteria 7023
464 Ga0207693_10016315 3300025915 Bacteria 5938
465 Ga0207693_10151681 3300025915 Bacteria 1823
466 Ga0207693_10155182 3300025915 Unclassified 1800
467 Ga0207663_10001246 3300025916 Bacteria 11776
468 Ga0207663_10114196 3300025916 Unclassified 1838
469 Ga0207663_10515203 3300025916 Unclassified 931
470 Ga0207663_10550709 3300025916 Unclassified 902
471 Ga0207663_10786263 3300025916 Unclassified 757
472 Ga0207660_10037799 3300025917 Bacteria 3366
473 Ga0207662_10004785 3300025918 Bacteria 7155
474 Ga0207662_10118812 3300025918 Bacteria 1656
475 Ga0207657_10000221 3300025919 Bacteria 59396
476 Ga0207657_10007622 3300025919 Bacteria 11076
477 Ga0207657_10051804 3300025919 Bacteria 3566
478 Ga0207649_10000180 3300025920 Bacteria 52042
479 Ga0207649_10005050 3300025920 Bacteria 7136
480 Ga0207652_10032513 3300025921 Bacteria 4387
481 Ga0207652_10145434 3300025921 Bacteria 2121
482 Ga0207652_10402515 3300025921 Unclassified 1235
483 Ga0207646_10004882 3300025922 Bacteria 14364
484 Ga0207681_10079641 3300025923 Bacteria 2308
485 Ga0207681_10165469 3300025923 Bacteria 1671
486 Ga0207681_10330573 3300025923 Unclassified 1215
487 Ga0207681_10340972 3300025923 Unclassified 1197
488 Ga0207650_10000169 3300025925 Bacteria 77854
489 Ga0207650_10001408 3300025925 Bacteria 17336
490 Ga0207650_10014788 3300025925 Bacteria 5427
491 Ga0207659_10015050 3300025926 Bacteria 5003
492 Ga0207659_10043489 3300025926 Bacteria 3155
493 Ga0207659_10047763 3300025926 Bacteria 3029
494 Ga0207659_10114637 3300025926 Bacteria 2054
495 Ga0207659_10379876 3300025926 Unclassified 1178
496 Ga0207687_10046903 3300025927 Bacteria 2993
497 Ga0207687_10193160 3300025927 Bacteria 1586
498 Ga0207700_10001077 3300025928 Bacteria 15752
499 Ga0207700_10009434 3300025928 Bacteria 6095
500 Ga0207700_10056383 3300025928 Bacteria 2958
501 Ga0207700_10130929 3300025928 Bacteria 2048
502 Ga0207700_10218240 3300025928 Unclassified 1615
503 Ga0207664_10096666 3300025929 Bacteria 2432
504 Ga0207664_10281999 3300025929 Unclassified 1458
505 Ga0207644_10001371 3300025931 Bacteria 15674
506 Ga0207644_10018027 3300025931 Bacteria 4772
507 Ga0207644_10220962 3300025931 Unclassified 1502
508 Ga0207690_10011744 3300025932 Bacteria 5238
509 Ga0207690_10061745 3300025932 Bacteria 2549
510 Ga0207706_10000080 3300025933 Bacteria 99912
511 Ga0207706_10000366 3300025933 Bacteria 48929
512 Ga0207686_10013826 3300025934 Bacteria 4477
513 Ga0207686_10106275 3300025934 Bacteria 1884
514 Ga0207709_10005246 3300025935 Bacteria 7373
515 Ga0207709_10467233 3300025935 Unclassified 978
516 Ga0207670_10010130 3300025936 Bacteria 5412
517 Ga0207670_10032756 3300025936 Bacteria 3344
518 Ga0207670_10081043 3300025936 Bacteria 2270
519 Ga0207670_10154336 3300025936 Bacteria 1707
520 Ga0207669_10015753 3300025937 Bacteria 3821
521 Ga0207669_10046738 3300025937 Bacteria 2560
522 Ga0207669_10103835 3300025937 Bacteria 1886
523 Ga0207669_10283784 3300025937 Bacteria 1250
524 Ga0207704_10018158 3300025938 Bacteria 3666
525 Ga0207665_10005926 3300025939 Bacteria 8135
526 Ga0207665_10021474 3300025939 Bacteria 4245
527 Ga0207665_10266423 3300025939 Unclassified 1271
528 Ga0207665_10384327 3300025939 Bacteria 1066
529 Ga0207691_10000099 3300025940 Bacteria 76056
530 Ga0207691_10003081 3300025940 Bacteria 16266
531 Ga0207691_10043780 3300025940 Bacteria 4124
532 Ga0207691_10062991 3300025940 Bacteria 3364
533 Ga0207691_10080549 3300025940 Bacteria 2928
534 Ga0207711_10068304 3300025941 Bacteria 3078
535 Ga0207711_10083079 3300025941 Unclassified 2801
536 Ga0207711_10116368 3300025941 Bacteria 2383
537 Ga0207689_10000517 3300025942 Bacteria 36643
538 Ga0207689_10142992 3300025942 Unclassified 1971
539 Ga0207661_10006657 3300025944 Bacteria 8170
540 Ga0207661_10015684 3300025944 Bacteria 5582
541 Ga0207661_10406371 3300025944 Bacteria 1235
542 Ga0207679_10000179 3300025945 Bacteria 52312
543 Ga0207679_10005133 3300025945 Bacteria 8196
544 Ga0207679_10033358 3300025945 Bacteria 3622
545 Ga0207679_10100186 3300025945 Bacteria 2264
546 Ga0207679_10159360 3300025945 Unclassified 1846
547 Ga0207679_10166873 3300025945 Bacteria 1808
548 Ga0207667_10165114 3300025949 Bacteria 2276
549 Ga0207667_10240803 3300025949 Bacteria 1851
550 Ga0207651_10005383 3300025960 Bacteria 6565
551 Ga0207651_10032120 3300025960 Bacteria 3367
552 Ga0207651_10275180 3300025960 Bacteria 1388
553 Ga0207668_10041648 3300025972 Bacteria 3106
554 Ga0207668_10057176 3300025972 Bacteria 2720
555 Ga0207668_10086768 3300025972 Bacteria 2287
556 Ga0207668_10165379 3300025972 Unclassified 1729
557 Ga0207658_10005794 3300025986 Bacteria 8455
558 Ga0207658_10155387 3300025986 Bacteria 1869
559 Ga0207658_10421333 3300025986 Unclassified 1177
560 Ga0207677_10030182 3300026023 Bacteria 3456
561 Ga0207677_10110724 3300026023 Bacteria 2044
562 Ga0207703_10007980 3300026035 Bacteria 8366
563 Ga0207703_10114163 3300026035 Bacteria 2309
564 Ga0207703_10511531 3300026035 Bacteria 1128
565 Ga0207703_10698077 3300026035 Bacteria 965
566 Ga0207639_10020765 3300026041 Bacteria 4707
567 Ga0207639_10025268 3300026041 Unclassified 4306
568 Ga0207639_10766950 3300026041 Bacteria 897
569 Ga0207678_10000037 3300026067 Bacteria 102480
570 Ga0207708_10000072 3300026075 Bacteria 81023
571 Ga0207708_10304673 3300026075 Unclassified 1297
572 Ga0207702_10063066 3300026078 Bacteria 3168
573 Ga0207702_10176041 3300026078 Unclassified 1966
574 Ga0207641_10000086 3300026088 Bacteria 133444
575 Ga0207641_10178084 3300026088 Bacteria 1945
576 Ga0207648_10000057 3300026089 Bacteria 104605
577 Ga0207648_10000295 3300026089 Bacteria 54257
578 Ga0207676_10000250 3300026095 Bacteria 46725
579 Ga0207676_10005175 3300026095 Bacteria 9225
580 Ga0207676_10011556 3300026095 Bacteria 6315
581 Ga0207676_10068919 3300026095 Bacteria 2831
582 Ga0207676_10297141 3300026095 Unclassified 1473
583 Ga0207674_10000070 3300026116 Bacteria 106245
584 Ga0207674_10000115 3300026116 Bacteria 93114
585 Ga0207674_10013599 3300026116 Bacteria 9017
586 Ga0207674_10465183 3300026116 Bacteria 1222
587 Ga0207675_100037764 3300026118 Bacteria 4505
588 Ga0207675_100093728 3300026118 Bacteria 2825
589 Ga0207675_100161017 3300026118 Bacteria 2140
590 Ga0207675_100757936 3300026118 Bacteria 982
591 Ga0207683_10000036 3300026121 Bacteria 101173
592 Ga0207683_10000062 3300026121 Bacteria 81362
593 Ga0207683_10345498 3300026121 Bacteria 1365
594 Ga0207683_10411444 3300026121 Bacteria 1245
595 Ga0207683_10534959 3300026121 Bacteria 1083
596 Ga0207683_10834977 3300026121 Bacteria 855
597 Ga0207698_10555309 3300026142 Bacteria 1126
598 Ga0209973_1002144 3300027252 Bacteria 1811
599 Ga0209969_1000031 3300027360 Bacteria 17279
600 Ga0209967_1000195 3300027364 Bacteria 8586
601 Ga0209981_1000029 3300027378 Bacteria 14346
602 Ga0209996_1000032 3300027395 Bacteria 21561
603 Ga0209984_1000086 3300027424 Bacteria 10244
604 Ga0210000_1000004 3300027462 Bacteria 39716
605 Ga0209995_1000199 3300027471 Bacteria 9581
606 Ga0209968_1000015 3300027526 Bacteria 36548
607 Ga0209999_1000108 3300027543 Bacteria 10159
608 Ga0209982_1000941 3300027552 Bacteria 3839
609 Ga0209970_1000033 3300027614 Bacteria 18012
610 Ga0209970_1005674 3300027614 Bacteria 2056
611 Ga0210002_1000009 3300027617 Bacteria 29971
612 Ga0209983_1001657 3300027665 Bacteria 4929
613 Ga0209588_1040555 3300027671 Bacteria 1502
614 Ga0209971_1004115 3300027682 Bacteria 3445
615 Ga0209966_1000012 3300027695 Bacteria 83147
616 Ga0209998_10000174 3300027717 Bacteria 23823
617 Ga0209974_10000002 3300027876 Bacteria 70010
618 Ga0209974_10000042 3300027876 Bacteria 31277
619 Ga0207428_10000476 3300027907 Bacteria 48340
620 Ga0207428_10015716 3300027907 Bacteria 6538
621 Ga0265354_1000450 3300028016 Bacteria 7156
622 Ga0268266_10013719 3300028379 Bacteria 6978
623 Ga0268266_10022015 3300028379 Bacteria 5433
624 Ga0268266_10153858 3300028379 Unclassified 2075
625 Ga0268266_10307546 3300028379 Bacteria 1480
626 Ga0268266_10587085 3300028379 Bacteria 1069
627 Ga0268265_10119899 3300028380 Bacteria 2165
628 Ga0268265_10308423 3300028380 Bacteria 1428
629 Ga0268265_10381806 3300028380 Bacteria 1296
630 Ga0268264_10173486 3300028381 Bacteria 1952
631 Ga0268264_10225820 3300028381 Bacteria 1726
632 Ga0268264_10411226 3300028381 Bacteria 1302
633 Ga0307511_10315651 3300030521 Bacteria 695
634 Ga0307408_100015580 3300031548 Bacteria 5063
635 Ga0307408_100039816 3300031548 Unclassified 3325
636 Ga0307408_100090530 3300031548 Unclassified 2309
637 Ga0307408_101125577 3300031548 Bacteria 729
638 Ga0307405_10002372 3300031731 Bacteria 8290
639 Ga0307405_10082369 3300031731 Bacteria 2106
640 Ga0307405_10241361 3300031731 Unclassified 1338
641 Ga0307413_10037311 3300031824 Unclassified 2806
642 Ga0307413_10056625 3300031824 Bacteria 2392
643 Ga0307413_10447019 3300031824 Bacteria 1025
644 Ga0307413_10528424 3300031824 Bacteria 953
645 Ga0307410_10090755 3300031852 Bacteria 2168
646 Ga0307406_10434351 3300031901 Bacteria 1049
647 Ga0307407_10013753 3300031903 Bacteria 3939
648 Ga0307412_10025662 3300031911 Bacteria 3652
649 Ga0307412_10098662 3300031911 Unclassified 2060
650 Ga0307409_100002548 3300031995 Bacteria 9560
651 Ga0307409_100007567 3300031995 Bacteria 6509
652 Ga0307409_100647469 3300031995 Bacteria 1050
653 Ga0307409_100957791 3300031995 Unclassified 872
654 Ga0307416_100006905 3300032002 Bacteria 7150
655 Ga0307416_100010002 3300032002 Bacteria 6244
656 Ga0307416_100018688 3300032002 Bacteria 4892
657 Ga0307416_100304964 3300032002 Bacteria 1585
658 Ga0307416_100949170 3300032002 Bacteria 962
659 Ga0307414_10063777 3300032004 Bacteria 2620
660 Ga0307414_10365529 3300032004 Bacteria 1243
661 Ga0307414_10423846 3300032004 Bacteria 1161
662 Ga0307411_10016505 3300032005 Bacteria 4181
663 Ga0307411_10049832 3300032005 Unclassified 2724
664 Ga0307411_10107907 3300032005 Bacteria 1985
665 Ga0307411_10587004 3300032005 Unclassified 956
666 Ga0307415_100014091 3300032126 Unclassified 4687
667 Ga0307415_100019282 3300032126 Unclassified 4139
668 Ga0307415_100117518 3300032126 Bacteria 1986
669 Ga0307415_100123424 3300032126 Unclassified 1947
670 Ga0373926_0000496 3300035083 Bacteria 10450
671 Ga0373944_0033688 3300035089 Unclassified 1553
672 Ga0373932_0071046 3300035112 Bacteria 1080
673 Ga0373936_0003091 3300035113 Bacteria 6231
674 Ga0373945_0015892 3300035116 Bacteria 2536
675 Ga0373945_0063992 3300035116 Unclassified 1378
676 Ga0373953_0003091 3300035117 Bacteria 5118
677 Ga0373954_0000521 3300035118 Bacteria 14444
678 Ga0373956_0030116 3300035119 Unclassified 2370
679 Ga0373957_0178489 3300035120 Unclassified 879
680 Ga0373960_0049852 3300035121 Bacteria 1239
681 Ga0373943_0006242 3300035170 Bacteria 5353
682 Ga0373943_0087967 3300035170 Bacteria 1604
683 Ga0373946_0016628 3300035171 Bacteria 2805
684 Ga0373946_0058360 3300035171 Unclassified 1635
685 Ga0373942_0075039 3300035207 Unclassified 994
686 Ga0373961_0041572 3300035241 Bacteria 1329
687 Ga0373961_0064729 3300035241 Bacteria 1118
688 Ga0373935_0008767 3300035692 Bacteria 6060
689 Ga0373935_0226042 3300035692 Bacteria 1302
690 Ga0373935_0263477 3300035692 Unclassified 1209
691 Ga0373927_0019011 3300035695 Unclassified 4507
692 Ga0373933_0009697 3300035724 Bacteria 5267
693 Ga0373933_0139133 3300035724 Bacteria 1532
694 Ga0373947_0529287 3300035725 Bacteria 802
695 Ga0373937_0002978 3300036401 Bacteria 14186
696 Ga0373937_0426274 3300036401 Unclassified 1259
697 Ga0373937_0895208 3300036401 Bacteria 836
698 Ga0373937_1052574 3300036401 Bacteria 762
699 Ga0373925_0001055 3300037068 Bacteria 24976
700 Ga0373925_0034065 3300037068 Bacteria 3754
701 Ga0395901_0931028 3300038443 Unclassified 849
702 Ga0436365_0249650 3300039437 Bacteria 1032
703 Ga0436365_1320079 3300039437 Bacteria 721
704 Ga0436360_1227145 3300039438 Bacteria 1639
705 Ga0436361_0839417 3300039447 Unclassified 796
706 Ga0436363_0165098 3300039450 Bacteria 4747
707 Ga0436363_0931942 3300039450 Unclassified 1095
708 Ga0436362_1266166 3300039453 Unclassified 1050
709 Ga0439466_0023643 3300041411 Archaea 2160
710 Ga0451807_1807335 3300041486 Bacteria 1933
711 Ga0439431_0130234 3300041997 Unclassified 706
712 Ga0439432_007270 3300042006 Bacteria 3932
713 Ga0439446_0010583 3300042156 Unclassified 2487
714 Ga0439460_0026035 3300042461 Bacteria 1634
715 Ga0451576_0002672 3300045051 Bacteria 25967
716 Ga0451576_0273911 3300045051 Bacteria 1764
717 Ga0451576_0355237 3300045051 Unclassified 1534
718 Ga0495592_0037197 3300046454 Unclassified 3665
719 Ga0495651_0000387 3300046462 Bacteria 34039
720 Ga0495651_0099452 3300046462 Unclassified 2169
721 Ga0495650_0000041 3300046471 Bacteria 363945
722 Ga0495580_0000266 3300046472 Bacteria 41949
723 Ga0495580_0000558 3300046472 Bacteria 31485
724 Ga0495580_0277544 3300046472 Unclassified 1144
725 Ga0495580_0344767 3300046472 Unclassified 1010
726 Ga0495580_0595230 3300046472 Bacteria 731
727 Ga0495582_0000315 3300046473 Bacteria 26627
728 Ga0495582_0002636 3300046473 Bacteria 9999
729 Ga0495605_0191138 3300046474 Unclassified 896
730 Ga0495594_0032636 3300046499 Bacteria 2827
731 Ga0495628_0085382 3300046516 Bacteria 2449
732 Ga0495652_0532952 3300046529 Unclassified 810
733 Ga0495665_0000962 3300046531 Bacteria 15239
734 Ga0495665_0068730 3300046531 Bacteria 1868
735 Ga0495640_0067085 3300046533 Bacteria 2418
736 Ga0495640_0195082 3300046533 Bacteria 1286
737 Ga0495586_0197856 3300046535 Bacteria 1139
738 Ga0495586_0309838 3300046535 Unclassified 905
739 Ga0495587_0014393 3300046536 Unclassified 4964
740 Ga0495598_0012875 3300046537 Bacteria 2063
741 Ga0495621_0016395 3300046539 Bacteria 2378
742 Ga0495645_0047887 3300046543 Bacteria 3114
743 Ga0495645_0079517 3300046543 Bacteria 2355
744 Ga0495645_0459927 3300046543 Bacteria 801
745 Ga0495622_0430712 3300046557 Unclassified 566
746 Ga0495633_0031518 3300046558 Bacteria 2569
747 Ga0495667_0298798 3300046559 Unclassified 1020
748 Ga0495634_0040705 3300046642 Bacteria 3158
749 Ga0495625_0259163 3300046660 Bacteria 1126
750 Ga0495599_0483628 3300046678 Unclassified 730
751 Ga0495623_0028058 3300046679 Bacteria 3624
752 Ga0495623_0053194 3300046679 Unclassified 2557
753 Ga0495658_0197002 3300046683 Unclassified 1254
754 Ga0495669_0017460 3300046684 Bacteria 3081
755 Ga0495669_0034444 3300046684 Bacteria 2233
756 Ga0495669_0111259 3300046684 Bacteria 1279
757 Ga0495669_0128233 3300046684 Unclassified 1193
758 Ga0495670_0076731 3300046691 Bacteria 1698
759 Ga0495581_0039645 3300047315 Unclassified 2727
760 Ga0495581_0298589 3300047315 Unclassified 941
761 Ga0495604_0001638 3300047317 Bacteria 18396
762 Ga0495674_0165347 3300047319 Bacteria 1849
763 Ga0495674_0210635 3300047319 Bacteria 1610
764 Ga0495674_0222977 3300047319 Bacteria 1558
765 Ga0495674_0545820 3300047319 Unclassified 923
766 Ga0495676_0392607 3300047321 Unclassified 922
767 Ga0495675_0023065 3300047444 Unclassified 3967
768 Ga0495684_0009523 3300047471 Bacteria 7491
769 Ga0495602_0014394 3300048088 Bacteria 8033
770 Ga0496100_0038356 3300048903 Unclassified 3036
771 Ga0496100_0192533 3300048903 Unclassified 1481
772 Ga0496101_0536655 3300048904 Unclassified 925
773 Ga0496101_0627754 3300048904 Bacteria 849
774 Ga0496101_1190484 3300048904 Unclassified 597
775 Ga0496102_0098126 3300048905 Bacteria 2718
776 Ga0496102_0101440 3300048905 Unclassified 2674
777 Ga0496102_0452170 3300048905 Bacteria 1205
778 Ga0496103_0308997 3300048906 Bacteria 1017
779 Ga0496103_0309422 3300048906 Unclassified 1016
780 Ga0496104_0195423 3300048907 Unclassified 1935
781 Ga0496104_0204003 3300048907 Bacteria 1889
782 Ga0496104_0280955 3300048907 Bacteria 1578
783 Ga0496104_0287984 3300048907 Bacteria 1555
784 Ga0496105_0256747 3300048908 Bacteria 1415
785 Ga0496106_0022018 3300048909 Bacteria 4735
786 Ga0496106_0615474 3300048909 Unclassified 869
787 Ga0496108_0000346 3300048911 Bacteria 39125
788 Ga0496108_0063380 3300048911 Unclassified 3113
789 Ga0496109_0000158 3300048912 Bacteria 66126
790 Ga0496109_0068190 3300048912 Bacteria 3261
791 Ga0496109_0086567 3300048912 Unclassified 2894
792 Ga0496110_0020022 3300048913 Bacteria 5641
793 Ga0496110_0100980 3300048913 Bacteria 2586
794 Ga0496110_0909240 3300048913 Unclassified 786
795 Ga0496111_0026455 3300048914 Bacteria 4098
796 Ga0496112_0000049 3300048915 Bacteria 83780
797 Ga0496112_0109001 3300048915 Bacteria 2739
798 Ga0496112_0169272 3300048915 Unclassified 2150
799 Ga0496112_0534222 3300048915 Unclassified 1107
800 Ga0496113_0002692 3300048916 Bacteria 10423
801 Ga0496113_0048911 3300048916 Unclassified 3147
802 Ga0496113_0151470 3300048916 Bacteria 1830
803 Ga0496114_0589164 3300048917 Unclassified 981
804 Ga0496115_0048441 3300048918 Bacteria 3399
805 Ga0496115_0109020 3300048918 Unclassified 2273
806 Ga0496115_0193134 3300048918 Unclassified 1682
807 Ga0496115_0343198 3300048918 Bacteria 1218
808 Ga0496126_0000004 3300048929 Bacteria 925026
809 Ga0501291_034360 3300049514 Unclassified 868
810 Ga0501299_019713 3300049522 Bacteria 1223
811 Ga0501299_030814 3300049522 Bacteria 1034
812 Ga0501303_019074 3300049526 Bacteria 716
813 Ga0501036_0029916 3300049572 Bacteria 4602
814 Ga0501037_0058229 3300049573 Bacteria 2820
815 Ga0501039_0235272 3300049575 Bacteria 1440
816 Ga0501039_0247298 3300049575 Bacteria 1402
817 Ga0501040_0196444 3300049576 Bacteria 1432
818 Ga0501040_0249090 3300049576 Bacteria 1267
819 Ga0501041_0053228 3300049577 Bacteria 2468
820 Ga0501041_0141115 3300049577 Bacteria 1502
821 Ga0501042_0036246 3300049578 Bacteria 3499
822 Ga0501043_0083086 3300049579 Bacteria 2518
823 Ga0501048_0056199 3300049582 Bacteria 2793
824 Ga0501048_0070819 3300049582 Bacteria 2462
825 Ga0501068_0010691 3300049584 Bacteria 5162
826 Ga0501068_0309076 3300049584 Bacteria 1012
827 Ga0501069_0335858 3300049585 Unclassified 889
828 Ga0501071_0008830 3300049587 Bacteria 6680
829 Ga0501071_0076448 3300049587 Bacteria 2445
830 Ga0501072_0067295 3300049588 Bacteria 2826
831 Ga0501072_0097777 3300049588 Bacteria 2333
832 Ga0501073_0074000 3300049589 Bacteria 2372
833 Ga0501075_0112568 3300049591 Bacteria 2069
834 Ga0501075_0622224 3300049591 Bacteria 823
835 Ga0501076_0036063 3300049592 Bacteria 3873
836 Ga0501076_0105927 3300049592 Bacteria 2269
837 Ga0501077_0033062 3300049593 Bacteria 3293
838 Ga0501233_084630 3300049668 Unclassified 821
839 Ga0501247_027627 3300049677 Unclassified 762
840 Ga0501261_012459 3300049690 Unclassified 1145
841 Ga0501079_0045140 3300049741 Bacteria 3401
842 Ga0501079_0108982 3300049741 Bacteria 2151
843 Ga0501079_0116509 3300049741 Bacteria 2077
844 Ga0501080_0054428 3300049742 Bacteria 3726
845 Ga0501081_0080523 3300049743 Bacteria 2280
846 Ga0501083_0025403 3300049744 Bacteria 4101
847 Ga0501083_0315505 3300049744 Bacteria 1017
848 Ga0501035_0072228 3300049822 Bacteria 3055
849 Ga0501045_0018409 3300049824 Bacteria 4969
850 Ga0501045_0344178 3300049824 Unclassified 1110
851 nmdc:mga00v17_187301_c1 3300050491 Bacteria 1336
852 nmdc:mga0yw44_112294_c1 3300050492 Bacteria 1747
853 nmdc:mga06z11_8725_c1 3300050494 Bacteria 4245
854 nmdc:mga05p37_2994_c1 3300050507 Bacteria 19614
855 nmdc:mga05p37_324165_c1 3300050507 Bacteria 1822
856 nmdc:mga05p37_348744_c1 3300050507 Bacteria 1743
857 nmdc:mga05p37_475416_c1 3300050507 Bacteria 1441
858 nmdc:mga05p37_52596_c1 3300050507 Bacteria 5007
859 nmdc:mga05p37_67642_c1 3300050507 Bacteria 4395
860 nmdc:mga05p37_772351_c1 3300050507 Bacteria 1056
861 nmdc:mga09592_169090_c1 3300050508 Unclassified 1890
862 nmdc:mga09592_23131_c1 3300050508 Bacteria 5130
863 nmdc:mga09592_254475_c1 3300050508 Bacteria 1522
864 nmdc:mga0qj67_195942_c1 3300050509 Bacteria 1642
865 nmdc:mga0qj67_411011_c1 3300050509 Unclassified 1092
866 nmdc:mga0qj67_74111_c1 3300050509 Bacteria 2720
867 nmdc:mga0qj67_81544_c1 3300050509 Bacteria 2594
868 nmdc:mga06r32_100016_c1 3300050510 Bacteria 2845
869 nmdc:mga06r32_13414_c1 3300050510 Bacteria 7419
870 nmdc:mga06r32_14125_c1 3300050510 Bacteria 7242
871 nmdc:mga06r32_255559_c1 3300050510 Unclassified 1740
872 nmdc:mga06r32_84557_c1 3300050510 Bacteria 3093
873 nmdc:mga06r32_94400_c1 3300050510 Unclassified 2927
874 nmdc:mga08y16_1289752_c1 3300050511 Unclassified 697
875 nmdc:mga08y16_2263_c1 3300050511 Bacteria 19735
876 nmdc:mga08y16_290448_c1 3300050511 Bacteria 1686
877 nmdc:mga08y16_7332_c1 3300050511 Bacteria 11569
878 nmdc:mga08y16_78431_c1 3300050511 Bacteria 3443
879 nmdc:mga0n895_23084_c1 3300050512 Bacteria 5843
880 nmdc:mga0n895_379057_c1 3300050512 Bacteria 1431
881 nmdc:mga0rr50_49382_c1 3300050513 Bacteria 3115
882 nmdc:mga08x19_25958_c1 3300050514 Bacteria 3653
883 nmdc:mga08x19_439_c1 3300050514 Bacteria 28578
884 nmdc:mga0a205_167577_c1 3300050515 Bacteria 2092
885 nmdc:mga0a205_266665_c1 3300050515 Bacteria 1590
886 nmdc:mga0a205_335661_c1 3300050515 Bacteria 1381
887 Ga0495601_0274261 3300053077 Unclassified 1100
888 Ga0495619_0029367 3300053085 Bacteria 3551
889 Ga0500555_000078 3300053103 Bacteria 46576
890 Ga0500595_012548 3300053119 Bacteria 3274
891 Ga0501084_0036765 3300054114 Unclassified 4092
892 Ga0501084_0132630 3300054114 Bacteria 2097
893 Ga0500661_002080 3300055283 Bacteria 3783
894 Ga0590071_032333 3300059421 Bacteria 1249
895 Ga0501082_0129065 3300060353 Bacteria 2193

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046535 Ga0495586_0309838 Ga0495586_0309838_338_853 170
2 3300046557 Ga0495622_0430712 Ga0495622_0430712_38_553 170
3 3300050511 nmdc:mga08y16_1289752_c1 nmdc:mga08y16_1289752_c1_165_680 171
4 3300035725 Ga0373947_0529287 Ga0373947_0529287_247_780 177
5 3300048904 Ga0496101_1190484 Ga0496101_1190484_17_562 180
6 3300046683 Ga0495658_0197002 Ga0495658_0197002_689_1234 181
7 3300004803 Ga0058862_10044413 Ga0058862_100444132 185
8 3300009147 Ga0114129_10100200 Ga0114129_101002002 191
9 3300039437 Ga0436365_1320079 Ga0436365_1320079_24_602 191
10 3300050507 nmdc:mga05p37_772351_c1 nmdc:mga05p37_772351_c1_307_939 191
11 3300006051 Ga0075364_10260225 Ga0075364_102602252 195
12 3300007076 Ga0075435_100562231 Ga0075435_1005622312 195
13 3300007265 Ga0099794_10007589 Ga0099794_100075893 196
14 3300048906 Ga0496103_0309422 Ga0496103_0309422_17_616 198
15 3300039437 Ga0436365_0249650 Ga0436365_0249650_406_1008 199
16 3300046472 Ga0495580_0277544 Ga0495580_0277544_37_639 199
17 3300009094 Ga0111539_10167164 Ga0111539_101671641 200
18 3300009147 Ga0114129_10596540 Ga0114129_105965401 200
19 3300048916 Ga0496113_0151470 Ga0496113_0151470_392_994 200
20 3300050507 nmdc:mga05p37_475416_c1 nmdc:mga05p37_475416_c1_76_678 200
21 3300050515 nmdc:mga0a205_266665_c1 nmdc:mga0a205_266665_c1_874_1476 200
22 3300009148 Ga0105243_10700356 Ga0105243_107003561 201
23 3300047319 Ga0495674_0545820 Ga0495674_0545820_233_841 201
24 3300049585 Ga0501069_0335858 Ga0501069_0335858_71_676 201
25 3300049690 Ga0501261_012459 Ga0501261_012459_380_985 201
26 3300050508 nmdc:mga09592_254475_c1 nmdc:mga09592_254475_c1_185_790 201
27 3300050509 nmdc:mga0qj67_74111_c1 nmdc:mga0qj67_74111_c1_369_974 201
28 3300050510 nmdc:mga06r32_14125_c1 nmdc:mga06r32_14125_c1_2537_3142 201
29 3300005336 Ga0070680_100912499 Ga0070680_1009124991 202
30 3300005341 Ga0070691_10107514 Ga0070691_101075143 202
31 3300005438 Ga0070701_10551466 Ga0070701_105514661 202
32 3300048905 Ga0496102_0098126 Ga0496102_0098126_1541_2152 203
33 3300048906 Ga0496103_0308997 Ga0496103_0308997_332_943 203
34 3300048907 Ga0496104_0204003 Ga0496104_0204003_533_1144 203
35 3300048912 Ga0496109_0068190 Ga0496109_0068190_911_1522 203
36 3300048913 Ga0496110_0100980 Ga0496110_0100980_1705_2316 203
37 3300048915 Ga0496112_0109001 Ga0496112_0109001_1641_2252 203
38 3300027671 Ga0209588_1040555 Ga0209588_10405552 204
39 3300046559 Ga0495667_0298798 Ga0495667_0298798_317_937 205
40 3300005334 Ga0068869_100014772 Ga0068869_1000147723 206
41 3300005290 Ga0065712_10071490 Ga0065712_100714906 207
42 3300005293 Ga0065715_10135651 Ga0065715_101356512 207
43 3300005295 Ga0065707_10107130 Ga0065707_101071303 207
44 3300005334 Ga0068869_100531267 Ga0068869_1005312671 207
45 3300005340 Ga0070689_100218750 Ga0070689_1002187502 207
46 3300005353 Ga0070669_100525458 Ga0070669_1005254581 207
47 3300005354 Ga0070675_100011171 Ga0070675_1000111713 207
48 3300005530 Ga0070679_100621969 Ga0070679_1006219692 207
49 3300005617 Ga0068859_100303296 Ga0068859_1003032963 207
50 3300005844 Ga0068862_100647899 Ga0068862_1006478992 207
51 3300005985 Ga0081539_10008569 Ga0081539_100085699 207
52 3300006038 Ga0075365_10264685 Ga0075365_102646852 207
53 3300006051 Ga0075364_10030978 Ga0075364_100309785 207
54 3300006178 Ga0075367_10006970 Ga0075367_100069705 207
55 3300006353 Ga0075370_10366342 Ga0075370_103663422 207
56 3300006852 Ga0075433_10237061 Ga0075433_102370611 207
57 3300006931 Ga0097620_100303296 Ga0097620_1003032963 207
58 3300025908 Ga0207643_10180174 Ga0207643_101801741 207
59 3300025926 Ga0207659_10043489 Ga0207659_100434892 207
60 3300025942 Ga0207689_10142992 Ga0207689_101429922 207
61 3300026095 Ga0207676_10297141 Ga0207676_102971412 207
62 3300026118 Ga0207675_100757936 Ga0207675_1007579362 207
63 3300036401 Ga0373937_1052574 Ga0373937_1052574_70_723 207
64 3300038443 Ga0395901_0931028 Ga0395901_0931028_20_646 207
65 3300050491 nmdc:mga00v17_187301_c1 nmdc:mga00v17_187301_c1_393_1016 207
66 3300050492 nmdc:mga0yw44_112294_c1 nmdc:mga0yw44_112294_c1_317_940 207
67 3300050494 nmdc:mga06z11_8725_c1 nmdc:mga06z11_8725_c1_246_869 207
68 3300005293 Ga0065715_10407023 Ga0065715_104070231 208
69 3300005295 Ga0065707_10154527 Ga0065707_101545272 208
70 3300005328 Ga0070676_10110356 Ga0070676_101103562 208
71 3300005336 Ga0070680_100035842 Ga0070680_1000358423 208
72 3300005336 Ga0070680_100436723 Ga0070680_1004367232 208
73 3300005344 Ga0070661_100033766 Ga0070661_1000337663 208
74 3300005344 Ga0070661_100563048 Ga0070661_1005630482 208
75 3300005345 Ga0070692_10072168 Ga0070692_100721682 208
76 3300005347 Ga0070668_100334386 Ga0070668_1003343862 208
77 3300005353 Ga0070669_100379060 Ga0070669_1003790602 208
78 3300005356 Ga0070674_100012998 Ga0070674_1000129984 208
79 3300005356 Ga0070674_100280492 Ga0070674_1002804922 208
80 3300005356 Ga0070674_101008616 Ga0070674_1010086161 208
81 3300005364 Ga0070673_100064718 Ga0070673_1000647182 208
82 3300005366 Ga0070659_100006001 Ga0070659_1000060013 208
83 3300005367 Ga0070667_100459554 Ga0070667_1004595541 208
84 3300005367 Ga0070667_101300591 Ga0070667_1013005911 208
85 3300005441 Ga0070700_100169810 Ga0070700_1001698101 208
86 3300005444 Ga0070694_100083877 Ga0070694_1000838773 208
87 3300005458 Ga0070681_10014004 Ga0070681_100140047 208
88 3300005467 Ga0070706_100024489 Ga0070706_1000244892 208
89 3300005471 Ga0070698_100001691 Ga0070698_10000169127 208
90 3300005518 Ga0070699_100001008 Ga0070699_10000100817 208
91 3300005536 Ga0070697_100001902 Ga0070697_10000190215 208
92 3300005539 Ga0068853_100029389 Ga0068853_1000293893 208
93 3300005546 Ga0070696_100664609 Ga0070696_1006646091 208
94 3300005549 Ga0070704_100029699 Ga0070704_1000296992 208
95 3300005564 Ga0070664_100003168 Ga0070664_1000031688 208
96 3300005577 Ga0068857_100007847 Ga0068857_1000078474 208
97 3300005617 Ga0068859_100146076 Ga0068859_1001460762 208
98 3300005617 Ga0068859_100175726 Ga0068859_1001757262 208
99 3300005618 Ga0068864_100019584 Ga0068864_1000195843 208
100 3300005981 Ga0081538_10135380 Ga0081538_101353802 208
101 3300006844 Ga0075428_100016539 Ga0075428_1000165392 208
102 3300006844 Ga0075428_100050123 Ga0075428_1000501237 208
103 3300006844 Ga0075428_100693233 Ga0075428_1006932331 208
104 3300006846 Ga0075430_100070526 Ga0075430_1000705262 208
105 3300006846 Ga0075430_100138300 Ga0075430_1001383002 208
106 3300006846 Ga0075430_100249948 Ga0075430_1002499482 208
107 3300006847 Ga0075431_100006181 Ga0075431_1000061816 208
108 3300006847 Ga0075431_100011175 Ga0075431_10001117510 208
109 3300006847 Ga0075431_100020745 Ga0075431_1000207454 208
110 3300006847 Ga0075431_100126092 Ga0075431_1001260923 208
111 3300006880 Ga0075429_100001748 Ga0075429_1000017482 208
112 3300006880 Ga0075429_100141131 Ga0075429_1001411313 208
113 3300006880 Ga0075429_100316892 Ga0075429_1003168922 208
114 3300006931 Ga0097620_100146070 Ga0097620_1001460702 208
115 3300006931 Ga0097620_100175715 Ga0097620_1001757152 208
116 3300009094 Ga0111539_10005667 Ga0111539_100056679 208
117 3300009094 Ga0111539_10096679 Ga0111539_100966791 208
118 3300009101 Ga0105247_10054329 Ga0105247_100543293 208
119 3300009147 Ga0114129_10001427 Ga0114129_1000142724 208
120 3300009147 Ga0114129_10032531 Ga0114129_100325319 208
121 3300009147 Ga0114129_10087188 Ga0114129_100871882 208
122 3300009174 Ga0105241_10427869 Ga0105241_104278691 208
123 3300013307 Ga0157372_10129699 Ga0157372_101296992 208
124 3300014325 Ga0163163_10003753 Ga0163163_100037538 208
125 3300014325 Ga0163163_10032241 Ga0163163_100322415 208
126 3300014325 Ga0163163_10053430 Ga0163163_100534303 208
127 3300014325 Ga0163163_10064502 Ga0163163_100645022 208
128 3300014968 Ga0157379_10218159 Ga0157379_102181592 208
129 3300025321 Ga0207656_10258178 Ga0207656_102581782 208
130 3300025893 Ga0207682_10078681 Ga0207682_100786812 208
131 3300025900 Ga0207710_10041483 Ga0207710_100414832 208
132 3300025907 Ga0207645_10062283 Ga0207645_100622833 208
133 3300025910 Ga0207684_10075169 Ga0207684_100751692 208
134 3300025919 Ga0207657_10051804 Ga0207657_100518044 208
135 3300025921 Ga0207652_10032513 Ga0207652_100325131 208
136 3300025922 Ga0207646_10004882 Ga0207646_1000488212 208
137 3300025923 Ga0207681_10330573 Ga0207681_103305732 208
138 3300025923 Ga0207681_10340972 Ga0207681_103409722 208
139 3300025937 Ga0207669_10046738 Ga0207669_100467382 208
140 3300025937 Ga0207669_10283784 Ga0207669_102837842 208
141 3300025945 Ga0207679_10033358 Ga0207679_100333583 208
142 3300025949 Ga0207667_10165114 Ga0207667_101651143 208
143 3300025972 Ga0207668_10165379 Ga0207668_101653792 208
144 3300026035 Ga0207703_10511531 Ga0207703_105115312 208
145 3300026041 Ga0207639_10020765 Ga0207639_100207653 208
146 3300026095 Ga0207676_10068919 Ga0207676_100689193 208
147 3300026116 Ga0207674_10000115 Ga0207674_1000011557 208
148 3300027907 Ga0207428_10015716 Ga0207428_100157164 208
149 3300030521 Ga0307511_10315651 Ga0307511_103156511 208
150 3300031548 Ga0307408_100039816 Ga0307408_1000398162 208
151 3300031731 Ga0307405_10082369 Ga0307405_100823693 208
152 3300031824 Ga0307413_10447019 Ga0307413_104470192 208
153 3300031824 Ga0307413_10528424 Ga0307413_105284242 208
154 3300031852 Ga0307410_10090755 Ga0307410_100907553 208
155 3300031995 Ga0307409_100647469 Ga0307409_1006474691 208
156 3300031995 Ga0307409_100957791 Ga0307409_1009577911 208
157 3300032002 Ga0307416_100010002 Ga0307416_1000100024 208
158 3300032002 Ga0307416_100304964 Ga0307416_1003049642 208
159 3300032002 Ga0307416_100949170 Ga0307416_1009491702 208
160 3300032004 Ga0307414_10365529 Ga0307414_103655291 208
161 3300032004 Ga0307414_10423846 Ga0307414_104238461 208
162 3300032005 Ga0307411_10049832 Ga0307411_100498322 208
163 3300032005 Ga0307411_10107907 Ga0307411_101079073 208
164 3300032126 Ga0307415_100019282 Ga0307415_1000192822 208
165 3300032126 Ga0307415_100123424 Ga0307415_1001234242 208
166 3300035121 Ga0373960_0049852 Ga0373960_0049852_157_789 208
167 3300046474 Ga0495605_0191138 Ga0495605_0191138_215_844 208
168 3300046499 Ga0495594_0032636 Ga0495594_0032636_2092_2721 208
169 3300046684 Ga0495669_0017460 Ga0495669_0017460_1889_2518 208
170 3300049514 Ga0501291_034360 Ga0501291_034360_96_725 208
171 3300049522 Ga0501299_030814 Ga0501299_030814_102_731 208
172 3300049526 Ga0501303_019074 Ga0501303_019074_56_685 208
173 3300049577 Ga0501041_0141115 Ga0501041_0141115_612_1238 208
174 3300049668 Ga0501233_084630 Ga0501233_084630_142_768 208
175 3300049677 Ga0501247_027627 Ga0501247_027627_23_652 208
176 3300049824 Ga0501045_0344178 Ga0501045_0344178_369_995 208
177 3300050507 nmdc:mga05p37_2994_c1 nmdc:mga05p37_2994_c1_2982_3608 208
178 3300050507 nmdc:mga05p37_324165_c1 nmdc:mga05p37_324165_c1_803_1435 208
179 3300050507 nmdc:mga05p37_348744_c1 nmdc:mga05p37_348744_c1_345_971 208
180 3300050508 nmdc:mga09592_169090_c1 nmdc:mga09592_169090_c1_764_1390 208
181 3300050508 nmdc:mga09592_23131_c1 nmdc:mga09592_23131_c1_3923_4549 208
182 3300050509 nmdc:mga0qj67_411011_c1 nmdc:mga0qj67_411011_c1_353_979 208
183 3300050509 nmdc:mga0qj67_81544_c1 nmdc:mga0qj67_81544_c1_1729_2355 208
184 3300050510 nmdc:mga06r32_13414_c1 nmdc:mga06r32_13414_c1_3069_3698 208
185 3300050510 nmdc:mga06r32_255559_c1 nmdc:mga06r32_255559_c1_137_763 208
186 3300050510 nmdc:mga06r32_94400_c1 nmdc:mga06r32_94400_c1_836_1462 208
187 3300050511 nmdc:mga08y16_2263_c1 nmdc:mga08y16_2263_c1_17072_17698 208
188 3300050511 nmdc:mga08y16_78431_c1 nmdc:mga08y16_78431_c1_2646_3272 208
189 3300053103 Ga0500555_000078 Ga0500555_000078_37462_38088 208
190 3300054114 Ga0501084_0036765 Ga0501084_0036765_2529_3155 208
191 3300002459 JGI24751J29686_10033813 JGI24751J29686_100338132 209
192 3300005290 Ga0065712_10089919 Ga0065712_100899192 209
193 3300005293 Ga0065715_10017945 Ga0065715_100179452 209
194 3300005295 Ga0065707_10124507 Ga0065707_101245073 209
195 3300005295 Ga0065707_10164315 Ga0065707_101643152 209
196 3300005327 Ga0070658_10666313 Ga0070658_106663131 209
197 3300005328 Ga0070676_10551809 Ga0070676_105518091 209
198 3300005330 Ga0070690_100015219 Ga0070690_1000152195 209
199 3300005331 Ga0070670_100004761 Ga0070670_1000047618 209
200 3300005336 Ga0070680_100142887 Ga0070680_1001428872 209
201 3300005340 Ga0070689_100070610 Ga0070689_1000706104 209
202 3300005341 Ga0070691_10086713 Ga0070691_100867131 209
203 3300005343 Ga0070687_100114928 Ga0070687_1001149283 209
204 3300005344 Ga0070661_100329613 Ga0070661_1003296132 209
205 3300005353 Ga0070669_100309785 Ga0070669_1003097852 209
206 3300005354 Ga0070675_100082629 Ga0070675_1000826292 209
207 3300005354 Ga0070675_100211928 Ga0070675_1002119282 209
208 3300005355 Ga0070671_100235624 Ga0070671_1002356242 209
209 3300005364 Ga0070673_100008456 Ga0070673_1000084564 209
210 3300005364 Ga0070673_100268636 Ga0070673_1002686363 209
211 3300005364 Ga0070673_100480693 Ga0070673_1004806932 209
212 3300005365 Ga0070688_100410758 Ga0070688_1004107582 209
213 3300005366 Ga0070659_100027932 Ga0070659_1000279323 209
214 3300005441 Ga0070700_100157658 Ga0070700_1001576581 209
215 3300005456 Ga0070678_100184157 Ga0070678_1001841572 209
216 3300005466 Ga0070685_10012334 Ga0070685_100123343 209
217 3300005518 Ga0070699_100953537 Ga0070699_1009535372 209
218 3300005543 Ga0070672_100029390 Ga0070672_1000293902 209
219 3300005543 Ga0070672_100034927 Ga0070672_1000349274 209
220 3300005544 Ga0070686_100003559 Ga0070686_1000035598 209
221 3300005564 Ga0070664_100053287 Ga0070664_1000532875 209
222 3300005564 Ga0070664_100082437 Ga0070664_1000824374 209
223 3300005578 Ga0068854_100681944 Ga0068854_1006819441 209
224 3300005617 Ga0068859_100042252 Ga0068859_1000422523 209
225 3300005618 Ga0068864_100009474 Ga0068864_1000094744 209
226 3300005618 Ga0068864_101000370 Ga0068864_1010003701 209
227 3300005719 Ga0068861_100047695 Ga0068861_1000476951 209
228 3300005842 Ga0068858_100105508 Ga0068858_1001055083 209
229 3300005844 Ga0068862_100271823 Ga0068862_1002718232 209
230 3300005844 Ga0068862_100372854 Ga0068862_1003728542 209
231 3300006358 Ga0068871_100505326 Ga0068871_1005053262 209
232 3300006847 Ga0075431_100508026 Ga0075431_1005080262 209
233 3300006931 Ga0097620_100042254 Ga0097620_1000422543 209
234 3300009176 Ga0105242_10055443 Ga0105242_100554433 209
235 3300009553 Ga0105249_10219634 Ga0105249_102196343 209
236 3300013296 Ga0157374_10020434 Ga0157374_100204345 209
237 3300013306 Ga0163162_10130752 Ga0163162_101307522 209
238 3300013308 Ga0157375_10106874 Ga0157375_101068743 209
239 3300014325 Ga0163163_10005139 Ga0163163_1000513910 209
240 3300014745 Ga0157377_10030048 Ga0157377_100300483 209
241 3300014969 Ga0157376_10085325 Ga0157376_100853252 209
242 3300025918 Ga0207662_10118812 Ga0207662_101188122 209
243 3300025925 Ga0207650_10001408 Ga0207650_1000140810 209
244 3300025926 Ga0207659_10047763 Ga0207659_100477633 209
245 3300025926 Ga0207659_10379876 Ga0207659_103798761 209
246 3300025929 Ga0207664_10281999 Ga0207664_102819992 209
247 3300025936 Ga0207670_10154336 Ga0207670_101543363 209
248 3300025940 Ga0207691_10043780 Ga0207691_100437802 209
249 3300025940 Ga0207691_10080549 Ga0207691_100805493 209
250 3300025945 Ga0207679_10166873 Ga0207679_101668732 209
251 3300025960 Ga0207651_10005383 Ga0207651_100053835 209
252 3300025972 Ga0207668_10057176 Ga0207668_100571764 209
253 3300026035 Ga0207703_10114163 Ga0207703_101141632 209
254 3300026095 Ga0207676_10005175 Ga0207676_100051755 209
255 3300026121 Ga0207683_10834977 Ga0207683_108349771 209
256 3300028016 Ga0265354_1000450 Ga0265354_10004504 209
257 3300028380 Ga0268265_10308423 Ga0268265_103084232 209
258 3300028380 Ga0268265_10381806 Ga0268265_103818062 209
259 3300028381 Ga0268264_10411226 Ga0268264_104112261 209
260 3300031548 Ga0307408_100015580 Ga0307408_1000155802 209
261 3300031548 Ga0307408_101125577 Ga0307408_1011255771 209
262 3300031731 Ga0307405_10002372 Ga0307405_1000237210 209
263 3300031731 Ga0307405_10241361 Ga0307405_102413612 209
264 3300031824 Ga0307413_10037311 Ga0307413_100373112 209
265 3300031824 Ga0307413_10056625 Ga0307413_100566252 209
266 3300031901 Ga0307406_10434351 Ga0307406_104343512 209
267 3300031903 Ga0307407_10013753 Ga0307407_100137534 209
268 3300031911 Ga0307412_10025662 Ga0307412_100256623 209
269 3300031911 Ga0307412_10098662 Ga0307412_100986621 209
270 3300031995 Ga0307409_100002548 Ga0307409_1000025483 209
271 3300031995 Ga0307409_100007567 Ga0307409_1000075675 209
272 3300032002 Ga0307416_100006905 Ga0307416_1000069054 209
273 3300032002 Ga0307416_100018688 Ga0307416_1000186882 209
274 3300032004 Ga0307414_10063777 Ga0307414_100637772 209
275 3300032005 Ga0307411_10016505 Ga0307411_100165054 209
276 3300032126 Ga0307415_100014091 Ga0307415_1000140912 209
277 3300032126 Ga0307415_100117518 Ga0307415_1001175182 209
278 3300042461 Ga0439460_0026035 Ga0439460_0026035_700_1335 209
279 3300046472 Ga0495580_0595230 Ga0495580_0595230_30_659 209
280 3300046537 Ga0495598_0012875 Ga0495598_0012875_629_1261 209
281 3300046539 Ga0495621_0016395 Ga0495621_0016395_565_1197 209
282 3300046558 Ga0495633_0031518 Ga0495633_0031518_1809_2441 209
283 3300046691 Ga0495670_0076731 Ga0495670_0076731_816_1448 209
284 3300048905 Ga0496102_0452170 Ga0496102_0452170_88_717 209
285 3300048909 Ga0496106_0022018 Ga0496106_0022018_3912_4541 209
286 3300048917 Ga0496114_0589164 Ga0496114_0589164_125_754 209
287 3300049576 Ga0501040_0196444 Ga0501040_0196444_495_1124 209
288 3300049582 Ga0501048_0070819 Ga0501048_0070819_1505_2134 209
289 3300049587 Ga0501071_0008830 Ga0501071_0008830_4421_5050 209
290 3300049588 Ga0501072_0097777 Ga0501072_0097777_700_1329 209
291 3300049592 Ga0501076_0036063 Ga0501076_0036063_2430_3059 209
292 3300049741 Ga0501079_0116509 Ga0501079_0116509_833_1462 209
293 3300053119 Ga0500595_012548 Ga0500595_012548_1458_2090 209
294 3300055283 Ga0500661_002080 Ga0500661_002080_1078_1710 209
295 3300005545 Ga0070695_100202734 Ga0070695_1002027342 210
296 3300009147 Ga0114129_10012627 Ga0114129_100126275 210
297 3300014325 Ga0163163_10012863 Ga0163163_100128637 210
298 3300025915 Ga0207693_10151681 Ga0207693_101516812 210
299 3300046660 Ga0495625_0259163 Ga0495625_0259163_206_841 210
300 3300050507 nmdc:mga05p37_52596_c1 nmdc:mga05p37_52596_c1_246_878 210
301 2162886011 MRS1b_contig_650282 MRS1b_0855.00001550 211
302 2162886012 MBSR1b_contig_7203822 MBSR1b_0326.00004070 211
303 2162886012 MBSR1b_contig_8982173 MBSR1b_0400.00007320 211
304 3300001976 JGI24752J21851_1002687 JGI24752J21851_10026874 211
305 3300001990 JGI24737J22298_10025386 JGI24737J22298_100253862 211
306 3300001991 JGI24743J22301_10003233 JGI24743J22301_100032335 211
307 3300002070 JGI24750J21931_1023451 JGI24750J21931_10234512 211
308 3300002155 JGI24033J26618_1003840 JGI24033J26618_10038401 211
309 3300002239 JGI24034J26672_10004298 JGI24034J26672_100042982 211
310 3300002459 JGI24751J29686_10001753 JGI24751J29686_100017535 211
311 3300004798 Ga0058859_11676364 Ga0058859_116763641 211
312 3300004799 Ga0058863_11434404 Ga0058863_114344041 211
313 3300004800 Ga0058861_12004268 Ga0058861_120042681 211
314 3300004801 Ga0058860_11325207 Ga0058860_113252071 211
315 3300005290 Ga0065712_10149010 Ga0065712_101490101 211
316 3300005293 Ga0065715_10006312 Ga0065715_100063124 211
317 3300005328 Ga0070676_10031752 Ga0070676_100317523 211
318 3300005329 Ga0070683_100006993 Ga0070683_1000069933 211
319 3300005331 Ga0070670_100074171 Ga0070670_1000741714 211
320 3300005333 Ga0070677_10014268 Ga0070677_100142683 211
321 3300005334 Ga0068869_100110422 Ga0068869_1001104222 211
322 3300005335 Ga0070666_10177451 Ga0070666_101774511 211
323 3300005336 Ga0070680_100433549 Ga0070680_1004335493 211
324 3300005338 Ga0068868_100099409 Ga0068868_1000994092 211
325 3300005339 Ga0070660_100085814 Ga0070660_1000858144 211
326 3300005340 Ga0070689_100014437 Ga0070689_1000144376 211
327 3300005344 Ga0070661_100066322 Ga0070661_1000663224 211
328 3300005347 Ga0070668_100078830 Ga0070668_1000788304 211
329 3300005353 Ga0070669_100077647 Ga0070669_1000776472 211
330 3300005354 Ga0070675_100172984 Ga0070675_1001729841 211
331 3300005355 Ga0070671_100378618 Ga0070671_1003786182 211
332 3300005356 Ga0070674_100085345 Ga0070674_1000853451 211
333 3300005364 Ga0070673_100097585 Ga0070673_1000975852 211
334 3300005365 Ga0070688_100044989 Ga0070688_1000449891 211
335 3300005366 Ga0070659_100008916 Ga0070659_1000089167 211
336 3300005434 Ga0070709_10156740 Ga0070709_101567401 211
337 3300005435 Ga0070714_100099447 Ga0070714_1000994473 211
338 3300005435 Ga0070714_100284605 Ga0070714_1002846052 211
339 3300005436 Ga0070713_100000446 Ga0070713_10000044618 211
340 3300005436 Ga0070713_100004441 Ga0070713_1000044413 211
341 3300005436 Ga0070713_100570705 Ga0070713_1005707051 211
342 3300005437 Ga0070710_10169991 Ga0070710_101699913 211
343 3300005438 Ga0070701_10088921 Ga0070701_100889212 211
344 3300005439 Ga0070711_100000290 Ga0070711_1000002906 211
345 3300005439 Ga0070711_100084180 Ga0070711_1000841803 211
346 3300005439 Ga0070711_100235217 Ga0070711_1002352172 211
347 3300005441 Ga0070700_100182678 Ga0070700_1001826782 211
348 3300005455 Ga0070663_100152065 Ga0070663_1001520651 211
349 3300005456 Ga0070678_100045306 Ga0070678_1000453065 211
350 3300005456 Ga0070678_100496280 Ga0070678_1004962802 211
351 3300005457 Ga0070662_100099992 Ga0070662_1000999923 211
352 3300005458 Ga0070681_10044822 Ga0070681_100448223 211
353 3300005459 Ga0068867_100003472 Ga0068867_1000034724 211
354 3300005466 Ga0070685_10001794 Ga0070685_100017943 211
355 3300005466 Ga0070685_10272288 Ga0070685_102722882 211
356 3300005530 Ga0070679_100009610 Ga0070679_1000096103 211
357 3300005535 Ga0070684_100004138 Ga0070684_10000413813 211
358 3300005536 Ga0070697_100935798 Ga0070697_1009357981 211
359 3300005539 Ga0068853_100011567 Ga0068853_1000115676 211
360 3300005543 Ga0070672_100114027 Ga0070672_1001140273 211
361 3300005547 Ga0070693_100046904 Ga0070693_1000469042 211
362 3300005548 Ga0070665_100076157 Ga0070665_1000761572 211
363 3300005548 Ga0070665_100670775 Ga0070665_1006707752 211
364 3300005548 Ga0070665_100891151 Ga0070665_1008911511 211
365 3300005563 Ga0068855_100049255 Ga0068855_1000492555 211
366 3300005564 Ga0070664_100005990 Ga0070664_10000599012 211
367 3300005578 Ga0068854_100020958 Ga0068854_1000209584 211
368 3300005614 Ga0068856_100012904 Ga0068856_1000129049 211
369 3300005616 Ga0068852_100129931 Ga0068852_1001299315 211
370 3300005617 Ga0068859_100222905 Ga0068859_1002229054 211
371 3300005618 Ga0068864_100170967 Ga0068864_1001709674 211
372 3300005718 Ga0068866_10032651 Ga0068866_100326512 211
373 3300005719 Ga0068861_100032636 Ga0068861_1000326364 211
374 3300005834 Ga0068851_10009594 Ga0068851_100095946 211
375 3300005840 Ga0068870_10006412 Ga0068870_100064125 211
376 3300005841 Ga0068863_100044844 Ga0068863_1000448444 211
377 3300005842 Ga0068858_100166813 Ga0068858_1001668134 211
378 3300005843 Ga0068860_100236396 Ga0068860_1002363961 211
379 3300005844 Ga0068862_100147891 Ga0068862_1001478911 211
380 3300006028 Ga0070717_10000640 Ga0070717_1000064015 211
381 3300006028 Ga0070717_10028291 Ga0070717_100282912 211
382 3300006163 Ga0070715_10006086 Ga0070715_100060864 211
383 3300006173 Ga0070716_100018178 Ga0070716_1000181783 211
384 3300006175 Ga0070712_100003988 Ga0070712_1000039888 211
385 3300006175 Ga0070712_100073097 Ga0070712_1000730974 211
386 3300006175 Ga0070712_100090640 Ga0070712_1000906402 211
387 3300006237 Ga0097621_100470731 Ga0097621_1004707312 211
388 3300006358 Ga0068871_100127951 Ga0068871_1001279513 211
389 3300006871 Ga0075434_100629677 Ga0075434_1006296772 211
390 3300006881 Ga0068865_100001611 Ga0068865_1000016118 211
391 3300006931 Ga0097620_100222905 Ga0097620_1002229054 211
392 3300007265 Ga0099794_10242377 Ga0099794_102423772 211
393 3300009092 Ga0105250_10006934 Ga0105250_100069346 211
394 3300009098 Ga0105245_10005295 Ga0105245_1000529510 211
395 3300009101 Ga0105247_10021179 Ga0105247_100211792 211
396 3300009174 Ga0105241_10061881 Ga0105241_100618815 211
397 3300009176 Ga0105242_10088069 Ga0105242_100880694 211
398 3300009177 Ga0105248_10567349 Ga0105248_105673492 211
399 3300009545 Ga0105237_10015273 Ga0105237_100152739 211
400 3300009551 Ga0105238_10134128 Ga0105238_101341282 211
401 3300009551 Ga0105238_10245370 Ga0105238_102453702 211
402 3300009553 Ga0105249_10060525 Ga0105249_100605254 211
403 3300010375 Ga0105239_10024492 Ga0105239_100244924 211
404 3300011119 Ga0105246_10024334 Ga0105246_100243344 211
405 3300013100 Ga0157373_10047337 Ga0157373_100473374 211
406 3300013102 Ga0157371_10035234 Ga0157371_100352345 211
407 3300013105 Ga0157369_10400120 Ga0157369_104001202 211
408 3300013296 Ga0157374_10046186 Ga0157374_100461861 211
409 3300013296 Ga0157374_10236335 Ga0157374_102363352 211
410 3300013296 Ga0157374_10465671 Ga0157374_104656711 211
411 3300013297 Ga0157378_10218492 Ga0157378_102184922 211
412 3300013306 Ga0163162_10127638 Ga0163162_101276383 211
413 3300013307 Ga0157372_10190616 Ga0157372_101906164 211
414 3300014325 Ga0163163_10004565 Ga0163163_100045657 211
415 3300014325 Ga0163163_10142769 Ga0163163_101427691 211
416 3300014745 Ga0157377_10008341 Ga0157377_100083416 211
417 3300014968 Ga0157379_10080723 Ga0157379_100807233 211
418 3300014969 Ga0157376_10028783 Ga0157376_100287834 211
419 3300014969 Ga0157376_10086291 Ga0157376_100862914 211
420 3300014969 Ga0157376_10088980 Ga0157376_100889803 211
421 3300014969 Ga0157376_10091677 Ga0157376_100916772 211
422 3300014969 Ga0157376_10531900 Ga0157376_105319002 211
423 3300017792 Ga0163161_10032686 Ga0163161_100326862 211
424 3300024227 Ga0228598_1010024 Ga0228598_10100242 211
425 3300025893 Ga0207682_10015444 Ga0207682_100154443 211
426 3300025899 Ga0207642_10027177 Ga0207642_100271772 211
427 3300025900 Ga0207710_10047049 Ga0207710_100470492 211
428 3300025901 Ga0207688_10001619 Ga0207688_100016197 211
429 3300025903 Ga0207680_10070369 Ga0207680_100703694 211
430 3300025904 Ga0207647_10012575 Ga0207647_100125752 211
431 3300025905 Ga0207685_10003175 Ga0207685_100031753 211
432 3300025907 Ga0207645_10000423 Ga0207645_1000042319 211
433 3300025908 Ga0207643_10000124 Ga0207643_1000012442 211
434 3300025909 Ga0207705_10209431 Ga0207705_102094312 211
435 3300025911 Ga0207654_10084326 Ga0207654_100843263 211
436 3300025914 Ga0207671_10269178 Ga0207671_102691782 211
437 3300025915 Ga0207693_10000012 Ga0207693_1000001243 211
438 3300025915 Ga0207693_10011931 Ga0207693_100119313 211
439 3300025915 Ga0207693_10155182 Ga0207693_101551821 211
440 3300025916 Ga0207663_10001246 Ga0207663_100012463 211
441 3300025916 Ga0207663_10114196 Ga0207663_101141962 211
442 3300025919 Ga0207657_10000221 Ga0207657_1000022135 211
443 3300025920 Ga0207649_10000180 Ga0207649_100001804 211
444 3300025921 Ga0207652_10402515 Ga0207652_104025152 211
445 3300025923 Ga0207681_10165469 Ga0207681_101654692 211
446 3300025925 Ga0207650_10000169 Ga0207650_1000016928 211
447 3300025926 Ga0207659_10114637 Ga0207659_101146374 211
448 3300025927 Ga0207687_10193160 Ga0207687_101931602 211
449 3300025928 Ga0207700_10001077 Ga0207700_100010773 211
450 3300025928 Ga0207700_10056383 Ga0207700_100563831 211
451 3300025929 Ga0207664_10096666 Ga0207664_100966662 211
452 3300025931 Ga0207644_10018027 Ga0207644_100180273 211
453 3300025931 Ga0207644_10220962 Ga0207644_102209621 211
454 3300025933 Ga0207706_10000366 Ga0207706_1000036627 211
455 3300025934 Ga0207686_10106275 Ga0207686_101062752 211
456 3300025936 Ga0207670_10081043 Ga0207670_100810434 211
457 3300025937 Ga0207669_10103835 Ga0207669_101038351 211
458 3300025939 Ga0207665_10021474 Ga0207665_100214744 211
459 3300025939 Ga0207665_10266423 Ga0207665_102664232 211
460 3300025939 Ga0207665_10384327 Ga0207665_103843273 211
461 3300025940 Ga0207691_10062991 Ga0207691_100629914 211
462 3300025941 Ga0207711_10116368 Ga0207711_101163683 211
463 3300025942 Ga0207689_10000517 Ga0207689_1000051731 211
464 3300025944 Ga0207661_10006657 Ga0207661_100066576 211
465 3300025945 Ga0207679_10000179 Ga0207679_1000017936 211
466 3300025960 Ga0207651_10275180 Ga0207651_102751802 211
467 3300025972 Ga0207668_10041648 Ga0207668_100416486 211
468 3300026023 Ga0207677_10030182 Ga0207677_100301823 211
469 3300026035 Ga0207703_10007980 Ga0207703_1000798010 211
470 3300026067 Ga0207678_10000037 Ga0207678_1000003749 211
471 3300026075 Ga0207708_10304673 Ga0207708_103046732 211
472 3300026078 Ga0207702_10063066 Ga0207702_100630662 211
473 3300026088 Ga0207641_10000086 Ga0207641_1000008656 211
474 3300026089 Ga0207648_10000295 Ga0207648_1000029548 211
475 3300026095 Ga0207676_10000250 Ga0207676_100002504 211
476 3300026116 Ga0207674_10000070 Ga0207674_1000007053 211
477 3300026116 Ga0207674_10465183 Ga0207674_104651832 211
478 3300026118 Ga0207675_100037764 Ga0207675_1000377645 211
479 3300026121 Ga0207683_10000062 Ga0207683_1000006229 211
480 3300026121 Ga0207683_10345498 Ga0207683_103454981 211
481 3300026121 Ga0207683_10534959 Ga0207683_105349591 211
482 3300026142 Ga0207698_10555309 Ga0207698_105553091 211
483 3300028379 Ga0268266_10013719 Ga0268266_100137194 211
484 3300028379 Ga0268266_10587085 Ga0268266_105870852 211
485 3300028381 Ga0268264_10225820 Ga0268264_102258202 211
486 3300035089 Ga0373944_0033688 Ga0373944_0033688_757_1395 211
487 3300035116 Ga0373945_0015892 Ga0373945_0015892_1053_1691 211
488 3300035117 Ga0373953_0003091 Ga0373953_0003091_4039_4677 211
489 3300035118 Ga0373954_0000521 Ga0373954_0000521_9865_10503 211
490 3300035119 Ga0373956_0030116 Ga0373956_0030116_976_1614 211
491 3300035120 Ga0373957_0178489 Ga0373957_0178489_206_844 211
492 3300035170 Ga0373943_0087967 Ga0373943_0087967_198_836 211
493 3300035171 Ga0373946_0016628 Ga0373946_0016628_1386_2024 211
494 3300035692 Ga0373935_0263477 Ga0373935_0263477_256_894 211
495 3300035724 Ga0373933_0009697 Ga0373933_0009697_535_1173 211
496 3300035724 Ga0373933_0139133 Ga0373933_0139133_317_955 211
497 3300036401 Ga0373937_0002978 Ga0373937_0002978_11929_12567 211
498 3300037068 Ga0373925_0034065 Ga0373925_0034065_316_954 211
499 3300046454 Ga0495592_0037197 Ga0495592_0037197_2297_2935 211
500 3300046462 Ga0495651_0000387 Ga0495651_0000387_9276_9914 211
501 3300046462 Ga0495651_0099452 Ga0495651_0099452_62_700 211
502 3300046472 Ga0495580_0000266 Ga0495580_0000266_16458_17096 211
503 3300046472 Ga0495580_0344767 Ga0495580_0344767_32_670 211
504 3300046473 Ga0495582_0002636 Ga0495582_0002636_2443_3081 211
505 3300046529 Ga0495652_0532952 Ga0495652_0532952_70_708 211
506 3300046531 Ga0495665_0068730 Ga0495665_0068730_823_1461 211
507 3300046533 Ga0495640_0067085 Ga0495640_0067085_966_1604 211
508 3300046533 Ga0495640_0195082 Ga0495640_0195082_320_958 211
509 3300046535 Ga0495586_0197856 Ga0495586_0197856_484_1122 211
510 3300046536 Ga0495587_0014393 Ga0495587_0014393_4032_4670 211
511 3300046543 Ga0495645_0079517 Ga0495645_0079517_1386_2024 211
512 3300046543 Ga0495645_0459927 Ga0495645_0459927_142_780 211
513 3300046642 Ga0495634_0040705 Ga0495634_0040705_905_1543 211
514 3300046678 Ga0495599_0483628 Ga0495599_0483628_25_663 211
515 3300046679 Ga0495623_0053194 Ga0495623_0053194_1342_1980 211
516 3300046684 Ga0495669_0034444 Ga0495669_0034444_381_1019 211
517 3300046684 Ga0495669_0128233 Ga0495669_0128233_449_1087 211
518 3300047315 Ga0495581_0298589 Ga0495581_0298589_124_762 211
519 3300047317 Ga0495604_0001638 Ga0495604_0001638_4429_5067 211
520 3300047319 Ga0495674_0165347 Ga0495674_0165347_881_1519 211
521 3300047321 Ga0495676_0392607 Ga0495676_0392607_240_878 211
522 3300047471 Ga0495684_0009523 Ga0495684_0009523_115_753 211
523 3300048088 Ga0495602_0014394 Ga0495602_0014394_2778_3416 211
524 3300048903 Ga0496100_0038356 Ga0496100_0038356_2208_2846 211
525 3300048903 Ga0496100_0192533 Ga0496100_0192533_418_1056 211
526 3300048904 Ga0496101_0536655 Ga0496101_0536655_266_904 211
527 3300048904 Ga0496101_0627754 Ga0496101_0627754_99_737 211
528 3300048905 Ga0496102_0101440 Ga0496102_0101440_1453_2091 211
529 3300048907 Ga0496104_0195423 Ga0496104_0195423_464_1102 211
530 3300048907 Ga0496104_0280955 Ga0496104_0280955_927_1565 211
531 3300048909 Ga0496106_0615474 Ga0496106_0615474_166_804 211
532 3300048911 Ga0496108_0000346 Ga0496108_0000346_935_1573 211
533 3300048911 Ga0496108_0063380 Ga0496108_0063380_681_1319 211
534 3300048912 Ga0496109_0000158 Ga0496109_0000158_36501_37139 211
535 3300048912 Ga0496109_0086567 Ga0496109_0086567_1818_2456 211
536 3300048913 Ga0496110_0020022 Ga0496110_0020022_4601_5239 211
537 3300048913 Ga0496110_0909240 Ga0496110_0909240_29_667 211
538 3300048914 Ga0496111_0026455 Ga0496111_0026455_87_725 211
539 3300048915 Ga0496112_0000049 Ga0496112_0000049_52136_52774 211
540 3300048915 Ga0496112_0169272 Ga0496112_0169272_388_1026 211
541 3300048916 Ga0496113_0002692 Ga0496113_0002692_7512_8150 211
542 3300048916 Ga0496113_0048911 Ga0496113_0048911_2147_2785 211
543 3300048918 Ga0496115_0048441 Ga0496115_0048441_1723_2361 211
544 3300048918 Ga0496115_0193134 Ga0496115_0193134_687_1325 211
545 3300048918 Ga0496115_0343198 Ga0496115_0343198_200_838 211
546 3300048929 Ga0496126_0000004 Ga0496126_0000004_662488_663126 211
547 3300005335 Ga0070666_10020223 Ga0070666_100202233 212
548 3300005337 Ga0070682_100676923 Ga0070682_1006769231 212
549 3300005339 Ga0070660_100039824 Ga0070660_1000398241 212
550 3300005355 Ga0070671_100005413 Ga0070671_10000541311 212
551 3300005367 Ga0070667_100286419 Ga0070667_1002864192 212
552 3300005434 Ga0070709_10021279 Ga0070709_100212792 212
553 3300005435 Ga0070714_100214890 Ga0070714_1002148902 212
554 3300005436 Ga0070713_100005822 Ga0070713_1000058222 212
555 3300005436 Ga0070713_100019679 Ga0070713_1000196795 212
556 3300005436 Ga0070713_100132076 Ga0070713_1001320762 212
557 3300005436 Ga0070713_100552992 Ga0070713_1005529921 212
558 3300005437 Ga0070710_10009202 Ga0070710_100092024 212
559 3300005439 Ga0070711_100068974 Ga0070711_1000689742 212
560 3300005439 Ga0070711_100148168 Ga0070711_1001481683 212
561 3300005439 Ga0070711_100258084 Ga0070711_1002580842 212
562 3300005445 Ga0070708_100371451 Ga0070708_1003714511 212
563 3300005539 Ga0068853_100033712 Ga0068853_1000337121 212
564 3300005548 Ga0070665_100073119 Ga0070665_1000731193 212
565 3300005548 Ga0070665_100442842 Ga0070665_1004428422 212
566 3300005564 Ga0070664_100028799 Ga0070664_1000287991 212
567 3300005614 Ga0068856_100357876 Ga0068856_1003578762 212
568 3300005614 Ga0068856_100469258 Ga0068856_1004692582 212
569 3300005618 Ga0068864_100001672 Ga0068864_10000167213 212
570 3300005841 Ga0068863_100003190 Ga0068863_1000031902 212
571 3300005983 Ga0081540_1001614 Ga0081540_100161414 212
572 3300005983 Ga0081540_1011995 Ga0081540_10119955 212
573 3300006028 Ga0070717_10000457 Ga0070717_1000045717 212
574 3300006028 Ga0070717_10359903 Ga0070717_103599033 212
575 3300006173 Ga0070716_100000456 Ga0070716_1000004563 212
576 3300006175 Ga0070712_100012277 Ga0070712_1000122773 212
577 3300006175 Ga0070712_100897724 Ga0070712_1008977241 212
578 3300006914 Ga0075436_100000125 Ga0075436_10000012530 212
579 3300009174 Ga0105241_10084292 Ga0105241_100842923 212
580 3300009174 Ga0105241_10284557 Ga0105241_102845572 212
581 3300009177 Ga0105248_10067628 Ga0105248_100676283 212
582 3300009545 Ga0105237_10535059 Ga0105237_105350591 212
583 3300009551 Ga0105238_10338958 Ga0105238_103389583 212
584 3300013102 Ga0157371_10029266 Ga0157371_100292663 212
585 3300013105 Ga0157369_10047314 Ga0157369_100473148 212
586 3300013296 Ga0157374_10001511 Ga0157374_100015114 212
587 3300013296 Ga0157374_10033741 Ga0157374_100337418 212
588 3300013306 Ga0163162_10666351 Ga0163162_106663512 212
589 3300013307 Ga0157372_10469251 Ga0157372_104692511 212
590 3300013308 Ga0157375_10120104 Ga0157375_101201042 212
591 3300014325 Ga0163163_10000851 Ga0163163_100008519 212
592 3300014969 Ga0157376_10101979 Ga0157376_101019792 212
593 3300021377 Ga0213874_10002459 Ga0213874_100024592 212
594 3300025905 Ga0207685_10061451 Ga0207685_100614512 212
595 3300025906 Ga0207699_10001273 Ga0207699_100012732 212
596 3300025914 Ga0207671_10340218 Ga0207671_103402182 212
597 3300025915 Ga0207693_10016315 Ga0207693_100163155 212
598 3300025916 Ga0207663_10515203 Ga0207663_105152031 212
599 3300025916 Ga0207663_10786263 Ga0207663_107862631 212
600 3300025928 Ga0207700_10009434 Ga0207700_100094342 212
601 3300025928 Ga0207700_10130929 Ga0207700_101309293 212
602 3300025928 Ga0207700_10218240 Ga0207700_102182401 212
603 3300025931 Ga0207644_10001371 Ga0207644_100013714 212
604 3300025939 Ga0207665_10005926 Ga0207665_100059266 212
605 3300025941 Ga0207711_10083079 Ga0207711_100830793 212
606 3300025945 Ga0207679_10159360 Ga0207679_101593603 212
607 3300025986 Ga0207658_10155387 Ga0207658_101553871 212
608 3300026041 Ga0207639_10025268 Ga0207639_100252687 212
609 3300026078 Ga0207702_10176041 Ga0207702_101760411 212
610 3300026088 Ga0207641_10178084 Ga0207641_101780843 212
611 3300026095 Ga0207676_10011556 Ga0207676_100115563 212
612 3300028379 Ga0268266_10022015 Ga0268266_100220152 212
613 3300028379 Ga0268266_10153858 Ga0268266_101538581 212
614 3300035083 Ga0373926_0000496 Ga0373926_0000496_4476_5117 212
615 3300035113 Ga0373936_0003091 Ga0373936_0003091_1469_2110 212
616 3300035116 Ga0373945_0063992 Ga0373945_0063992_119_760 212
617 3300035170 Ga0373943_0006242 Ga0373943_0006242_3828_4469 212
618 3300035171 Ga0373946_0058360 Ga0373946_0058360_421_1062 212
619 3300035692 Ga0373935_0008767 Ga0373935_0008767_3299_3940 212
620 3300035692 Ga0373935_0226042 Ga0373935_0226042_587_1228 212
621 3300035695 Ga0373927_0019011 Ga0373927_0019011_3636_4277 212
622 3300036401 Ga0373937_0426274 Ga0373937_0426274_15_656 212
623 3300037068 Ga0373925_0001055 Ga0373925_0001055_14491_15132 212
624 3300039438 Ga0436360_1227145 Ga0436360_1227145_168_809 212
625 3300039447 Ga0436361_0839417 Ga0436361_0839417_80_721 212
626 3300039450 Ga0436363_0165098 Ga0436363_0165098_1161_1802 212
627 3300039450 Ga0436363_0931942 Ga0436363_0931942_354_1007 212
628 3300039453 Ga0436362_1266166 Ga0436362_1266166_294_935 212
629 3300041486 Ga0451807_1807335 Ga0451807_1807335_919_1608 212
630 3300046472 Ga0495580_0000558 Ga0495580_0000558_7551_8192 212
631 3300046473 Ga0495582_0000315 Ga0495582_0000315_22676_23317 212
632 3300046516 Ga0495628_0085382 Ga0495628_0085382_525_1166 212
633 3300046531 Ga0495665_0000962 Ga0495665_0000962_192_833 212
634 3300046543 Ga0495645_0047887 Ga0495645_0047887_2408_3049 212
635 3300046679 Ga0495623_0028058 Ga0495623_0028058_2696_3337 212
636 3300046684 Ga0495669_0111259 Ga0495669_0111259_125_766 212
637 3300047315 Ga0495581_0039645 Ga0495581_0039645_125_766 212
638 3300047319 Ga0495674_0210635 Ga0495674_0210635_37_678 212
639 3300047319 Ga0495674_0222977 Ga0495674_0222977_499_1140 212
640 3300047444 Ga0495675_0023065 Ga0495675_0023065_689_1330 212
641 3300048915 Ga0496112_0534222 Ga0496112_0534222_321_962 212
642 3300048918 Ga0496115_0109020 Ga0496115_0109020_1406_2047 212
643 3300050514 nmdc:mga08x19_439_c1 nmdc:mga08x19_439_c1_2165_2806 212
644 3300053077 Ga0495601_0274261 Ga0495601_0274261_149_790 212
645 3300053085 Ga0495619_0029367 Ga0495619_0029367_1174_1815 212
646 3300006871 Ga0075434_100232013 Ga0075434_1002320131 213
647 3300050512 nmdc:mga0n895_379057_c1 nmdc:mga0n895_379057_c1_125_766 213
648 3300005546 Ga0070696_100037178 Ga0070696_1000371784 214
649 3300009177 Ga0105248_10240083 Ga0105248_102400833 214
650 3300025900 Ga0207710_10279503 Ga0207710_102795031 214
651 3300025941 Ga0207711_10068304 Ga0207711_100683042 214
652 3300048907 Ga0496104_0287984 Ga0496104_0287984_546_1196 214
653 3300048908 Ga0496105_0256747 Ga0496105_0256747_245_895 214
654 2162886011 MRS1b_contig_6820307 MRS1b_0933.00001090 215
655 3300002737 JGI25162J39368_1009987 JGI25162J39368_10099871 215
656 3300004801 Ga0058860_11635791 Ga0058860_116357911 215
657 3300005293 Ga0065715_10139294 Ga0065715_101392942 215
658 3300005330 Ga0070690_100000310 Ga0070690_1000003108 215
659 3300005340 Ga0070689_100039896 Ga0070689_1000398963 215
660 3300005343 Ga0070687_100002265 Ga0070687_1000022653 215
661 3300005354 Ga0070675_100283243 Ga0070675_1002832431 215
662 3300005364 Ga0070673_100095320 Ga0070673_1000953204 215
663 3300005365 Ga0070688_100085816 Ga0070688_1000858161 215
664 3300005366 Ga0070659_100044634 Ga0070659_1000446342 215
665 3300005367 Ga0070667_100476776 Ga0070667_1004767761 215
666 3300005468 Ga0070707_101101884 Ga0070707_1011018841 215
667 3300005518 Ga0070699_100009056 Ga0070699_1000090563 215
668 3300005543 Ga0070672_100024864 Ga0070672_1000248643 215
669 3300005544 Ga0070686_100014963 Ga0070686_1000149633 215
670 3300005564 Ga0070664_100026065 Ga0070664_1000260651 215
671 3300005719 Ga0068861_100197266 Ga0068861_1001972662 215
672 3300005843 Ga0068860_100712035 Ga0068860_1007120351 215
673 3300005937 Ga0081455_10154161 Ga0081455_101541612 215
674 3300006237 Ga0097621_100116634 Ga0097621_1001166342 215
675 3300006358 Ga0068871_100147170 Ga0068871_1001471702 215
676 3300006852 Ga0075433_10087922 Ga0075433_100879223 215
677 3300009094 Ga0111539_10249666 Ga0111539_102496663 215
678 3300009148 Ga0105243_10800586 Ga0105243_108005861 215
679 3300013296 Ga0157374_10050881 Ga0157374_100508812 215
680 3300025233 Ga0209437_104073 Ga0209437_1040732 215
681 3300025261 Ga0209233_1009661 Ga0209233_10096614 215
682 3300025918 Ga0207662_10004785 Ga0207662_100047853 215
683 3300025932 Ga0207690_10061745 Ga0207690_100617452 215
684 3300025935 Ga0207709_10467233 Ga0207709_104672331 215
685 3300025936 Ga0207670_10032756 Ga0207670_100327563 215
686 3300025940 Ga0207691_10003081 Ga0207691_1000308119 215
687 3300025944 Ga0207661_10406371 Ga0207661_104063712 215
688 3300025945 Ga0207679_10005133 Ga0207679_100051331 215
689 3300025986 Ga0207658_10421333 Ga0207658_104213331 215
690 3300026118 Ga0207675_100161017 Ga0207675_1001610172 215
691 3300026121 Ga0207683_10411444 Ga0207683_104114441 215
692 3300035241 Ga0373961_0041572 Ga0373961_0041572_530_1177 215
693 3300045051 Ga0451576_0002672 Ga0451576_0002672_16303_16950 215
694 3300045051 Ga0451576_0355237 Ga0451576_0355237_168_815 215
695 3300049522 Ga0501299_019713 Ga0501299_019713_57_704 215
696 3300049572 Ga0501036_0029916 Ga0501036_0029916_2802_3449 215
697 3300049573 Ga0501037_0058229 Ga0501037_0058229_1017_1664 215
698 3300049575 Ga0501039_0235272 Ga0501039_0235272_771_1418 215
699 3300049575 Ga0501039_0247298 Ga0501039_0247298_266_913 215
700 3300049576 Ga0501040_0249090 Ga0501040_0249090_310_957 215
701 3300049577 Ga0501041_0053228 Ga0501041_0053228_1580_2227 215
702 3300049578 Ga0501042_0036246 Ga0501042_0036246_2707_3354 215
703 3300049579 Ga0501043_0083086 Ga0501043_0083086_27_674 215
704 3300049582 Ga0501048_0056199 Ga0501048_0056199_1233_1880 215
705 3300049584 Ga0501068_0010691 Ga0501068_0010691_3416_4066 215
706 3300049584 Ga0501068_0309076 Ga0501068_0309076_345_992 215
707 3300049587 Ga0501071_0076448 Ga0501071_0076448_1206_1853 215
708 3300049588 Ga0501072_0067295 Ga0501072_0067295_621_1268 215
709 3300049589 Ga0501073_0074000 Ga0501073_0074000_1415_2062 215
710 3300049591 Ga0501075_0112568 Ga0501075_0112568_176_823 215
711 3300049591 Ga0501075_0622224 Ga0501075_0622224_97_744 215
712 3300049592 Ga0501076_0105927 Ga0501076_0105927_631_1278 215
713 3300049593 Ga0501077_0033062 Ga0501077_0033062_1057_1704 215
714 3300049741 Ga0501079_0045140 Ga0501079_0045140_34_681 215
715 3300049741 Ga0501079_0108982 Ga0501079_0108982_374_1021 215
716 3300049742 Ga0501080_0054428 Ga0501080_0054428_1369_2016 215
717 3300049743 Ga0501081_0080523 Ga0501081_0080523_983_1630 215
718 3300049744 Ga0501083_0025403 Ga0501083_0025403_520_1167 215
719 3300049744 Ga0501083_0315505 Ga0501083_0315505_334_981 215
720 3300049822 Ga0501035_0072228 Ga0501035_0072228_1901_2548 215
721 3300049824 Ga0501045_0018409 Ga0501045_0018409_900_1547 215
722 3300050511 nmdc:mga08y16_290448_c1 nmdc:mga08y16_290448_c1_189_848 215
723 3300050515 nmdc:mga0a205_167577_c1 nmdc:mga0a205_167577_c1_587_1246 215
724 3300054114 Ga0501084_0132630 Ga0501084_0132630_67_714 215
725 3300060353 Ga0501082_0129065 Ga0501082_0129065_99_746 215
726 3300004801 Ga0058860_11739536 Ga0058860_117395362 216
727 3300006846 Ga0075430_100006387 Ga0075430_10000638712 216
728 3300006847 Ga0075431_100082302 Ga0075431_1000823023 216
729 3300006880 Ga0075429_100055210 Ga0075429_1000552103 216
730 3300027614 Ga0209970_1005674 Ga0209970_10056742 216
731 3300027876 Ga0209974_10000042 Ga0209974_1000004227 216
732 3300031548 Ga0307408_100090530 Ga0307408_1000905302 216
733 3300032005 Ga0307411_10587004 Ga0307411_105870042 216
734 3300041411 Ga0439466_0023643 Ga0439466_0023643_672_1322 216
735 3300041997 Ga0439431_0130234 Ga0439431_0130234_22_672 216
736 3300042006 Ga0439432_007270 Ga0439432_007270_1816_2466 216
737 3300042156 Ga0439446_0010583 Ga0439446_0010583_1752_2402 216
738 3300046471 Ga0495650_0000041 Ga0495650_0000041_26918_27589 216
739 3300050510 nmdc:mga06r32_100016_c1 nmdc:mga06r32_100016_c1_1145_1810 216
740 3300059421 Ga0590071_032333 Ga0590071_032333_263_970 216
741 3300013307 Ga0157372_10247815 Ga0157372_102478152 217
742 3300036401 Ga0373937_0895208 Ga0373937_0895208_24_695 217
743 2162886007 SwRhRL2b_contig_3676544 SwRhRL2b_0831.00003550 218
744 3300001990 JGI24737J22298_10066052 JGI24737J22298_100660521 218
745 3300003347 JGI26128J50194_1001479 JGI26128J50194_10014792 218
746 3300003349 JGI26129J50193_1001113 JGI26129J50193_10011132 218
747 3300003371 JGI26145J50221_1000604 JGI26145J50221_10006042 218
748 3300003383 JGI26140J50224_100513 JGI26140J50224_1005132 218
749 3300005289 Ga0065704_10071835 Ga0065704_100718352 218
750 3300005290 Ga0065712_10138160 Ga0065712_101381602 218
751 3300005295 Ga0065707_10003017 Ga0065707_100030172 218
752 3300005328 Ga0070676_10001350 Ga0070676_1000135014 218
753 3300005329 Ga0070683_100051999 Ga0070683_1000519994 218
754 3300005333 Ga0070677_10010323 Ga0070677_100103234 218
755 3300005335 Ga0070666_10222857 Ga0070666_102228572 218
756 3300005336 Ga0070680_100018896 Ga0070680_1000188964 218
757 3300005337 Ga0070682_100414863 Ga0070682_1004148632 218
758 3300005338 Ga0068868_100028184 Ga0068868_1000281841 218
759 3300005339 Ga0070660_100003327 Ga0070660_1000033272 218
760 3300005340 Ga0070689_100004859 Ga0070689_10000485911 218
761 3300005341 Ga0070691_10001905 Ga0070691_100019055 218
762 3300005344 Ga0070661_100012144 Ga0070661_1000121442 218
763 3300005345 Ga0070692_10015880 Ga0070692_100158804 218
764 3300005347 Ga0070668_100010502 Ga0070668_1000105022 218
765 3300005353 Ga0070669_100017825 Ga0070669_1000178252 218
766 3300005354 Ga0070675_100001819 Ga0070675_10000181914 218
767 3300005356 Ga0070674_100000555 Ga0070674_10000055526 218
768 3300005364 Ga0070673_100003366 Ga0070673_1000033664 218
769 3300005366 Ga0070659_100028076 Ga0070659_1000280764 218
770 3300005367 Ga0070667_100004550 Ga0070667_10000455016 218
771 3300005438 Ga0070701_10015524 Ga0070701_100155243 218
772 3300005439 Ga0070711_100653018 Ga0070711_1006530182 218
773 3300005440 Ga0070705_100015260 Ga0070705_1000152602 218
774 3300005441 Ga0070700_100000432 Ga0070700_10000043216 218
775 3300005444 Ga0070694_100026224 Ga0070694_1000262242 218
776 3300005456 Ga0070678_100000013 Ga0070678_10000001330 218
777 3300005457 Ga0070662_100013995 Ga0070662_1000139954 218
778 3300005458 Ga0070681_10001666 Ga0070681_1000166625 218
779 3300005459 Ga0068867_100000203 Ga0068867_10000020316 218
780 3300005466 Ga0070685_10010123 Ga0070685_100101237 218
781 3300005530 Ga0070679_100001194 Ga0070679_1000011944 218
782 3300005535 Ga0070684_100090319 Ga0070684_1000903193 218
783 3300005539 Ga0068853_100816655 Ga0068853_1008166552 218
784 3300005543 Ga0070672_100000661 Ga0070672_10000066118 218
785 3300005544 Ga0070686_100078247 Ga0070686_1000782473 218
786 3300005545 Ga0070695_100005322 Ga0070695_1000053224 218
787 3300005546 Ga0070696_100000625 Ga0070696_1000006254 218
788 3300005548 Ga0070665_100156858 Ga0070665_1001568582 218
789 3300005564 Ga0070664_100003543 Ga0070664_1000035439 218
790 3300005577 Ga0068857_100095168 Ga0068857_1000951684 218
791 3300005618 Ga0068864_100094454 Ga0068864_1000944544 218
792 3300005718 Ga0068866_10006009 Ga0068866_100060092 218
793 3300005719 Ga0068861_100015268 Ga0068861_1000152684 218
794 3300005842 Ga0068858_100783110 Ga0068858_1007831101 218
795 3300005843 Ga0068860_100028516 Ga0068860_1000285164 218
796 3300005844 Ga0068862_100139331 Ga0068862_1001393312 218
797 3300005937 Ga0081455_10000317 Ga0081455_1000031716 218
798 3300006058 Ga0075432_10001421 Ga0075432_100014214 218
799 3300006237 Ga0097621_100003757 Ga0097621_10000375712 218
800 3300006358 Ga0068871_100026581 Ga0068871_1000265812 218
801 3300006844 Ga0075428_100300288 Ga0075428_1003002882 218
802 3300006846 Ga0075430_100017058 Ga0075430_1000170585 218
803 3300006847 Ga0075431_100002813 Ga0075431_1000028133 218
804 3300006880 Ga0075429_100138859 Ga0075429_1001388593 218
805 3300006881 Ga0068865_100005765 Ga0068865_1000057659 218
806 3300006914 Ga0075436_100008160 Ga0075436_1000081609 218
807 3300006914 Ga0075436_100214558 Ga0075436_1002145582 218
808 3300007076 Ga0075435_100048583 Ga0075435_1000485833 218
809 3300009098 Ga0105245_10001382 Ga0105245_1000138229 218
810 3300009147 Ga0114129_10002913 Ga0114129_1000291328 218
811 3300009148 Ga0105243_10006158 Ga0105243_100061584 218
812 3300009176 Ga0105242_10000602 Ga0105242_100006027 218
813 3300009553 Ga0105249_10008227 Ga0105249_100082278 218
814 3300010375 Ga0105239_10039827 Ga0105239_100398274 218
815 3300011119 Ga0105246_10000247 Ga0105246_1000024716 218
816 3300013100 Ga0157373_10165207 Ga0157373_101652072 218
817 3300013296 Ga0157374_10093200 Ga0157374_100932002 218
818 3300013297 Ga0157378_10000734 Ga0157378_1000073417 218
819 3300013308 Ga0157375_10014212 Ga0157375_100142127 218
820 3300014326 Ga0157380_10013441 Ga0157380_100134415 218
821 3300014745 Ga0157377_10004292 Ga0157377_100042922 218
822 3300014969 Ga0157376_10002681 Ga0157376_100026815 218
823 3300025315 Ga0207697_10119407 Ga0207697_101194072 218
824 3300025893 Ga0207682_10009860 Ga0207682_100098604 218
825 3300025899 Ga0207642_10003372 Ga0207642_100033726 218
826 3300025901 Ga0207688_10046618 Ga0207688_100466181 218
827 3300025903 Ga0207680_10210165 Ga0207680_102101652 218
828 3300025904 Ga0207647_10209736 Ga0207647_102097362 218
829 3300025907 Ga0207645_10000024 Ga0207645_1000002433 218
830 3300025912 Ga0207707_10073794 Ga0207707_100737942 218
831 3300025916 Ga0207663_10550709 Ga0207663_105507091 218
832 3300025917 Ga0207660_10037799 Ga0207660_100377992 218
833 3300025919 Ga0207657_10007622 Ga0207657_1000762214 218
834 3300025920 Ga0207649_10005050 Ga0207649_100050502 218
835 3300025921 Ga0207652_10145434 Ga0207652_101454342 218
836 3300025923 Ga0207681_10079641 Ga0207681_100796412 218
837 3300025925 Ga0207650_10014788 Ga0207650_100147886 218
838 3300025926 Ga0207659_10015050 Ga0207659_100150506 218
839 3300025927 Ga0207687_10046903 Ga0207687_100469032 218
840 3300025932 Ga0207690_10011744 Ga0207690_100117446 218
841 3300025933 Ga0207706_10000080 Ga0207706_1000008037 218
842 3300025934 Ga0207686_10013826 Ga0207686_100138262 218
843 3300025935 Ga0207709_10005246 Ga0207709_100052463 218
844 3300025936 Ga0207670_10010130 Ga0207670_100101301 218
845 3300025937 Ga0207669_10015753 Ga0207669_100157532 218
846 3300025938 Ga0207704_10018158 Ga0207704_100181584 218
847 3300025940 Ga0207691_10000099 Ga0207691_1000009974 218
848 3300025944 Ga0207661_10015684 Ga0207661_100156847 218
849 3300025945 Ga0207679_10100186 Ga0207679_101001862 218
850 3300025949 Ga0207667_10240803 Ga0207667_102408033 218
851 3300025960 Ga0207651_10032120 Ga0207651_100321204 218
852 3300025972 Ga0207668_10086768 Ga0207668_100867682 218
853 3300025986 Ga0207658_10005794 Ga0207658_100057942 218
854 3300026023 Ga0207677_10110724 Ga0207677_101107242 218
855 3300026035 Ga0207703_10698077 Ga0207703_106980772 218
856 3300026041 Ga0207639_10766950 Ga0207639_107669501 218
857 3300026075 Ga0207708_10000072 Ga0207708_1000007241 218
858 3300026089 Ga0207648_10000057 Ga0207648_1000005741 218
859 3300026116 Ga0207674_10013599 Ga0207674_100135997 218
860 3300026118 Ga0207675_100093728 Ga0207675_1000937284 218
861 3300026121 Ga0207683_10000036 Ga0207683_1000003626 218
862 3300027252 Ga0209973_1002144 Ga0209973_10021442 218
863 3300027360 Ga0209969_1000031 Ga0209969_100003120 218
864 3300027364 Ga0209967_1000195 Ga0209967_10001959 218
865 3300027378 Ga0209981_1000029 Ga0209981_10000292 218
866 3300027395 Ga0209996_1000032 Ga0209996_100003212 218
867 3300027424 Ga0209984_1000086 Ga0209984_10000862 218
868 3300027462 Ga0210000_1000004 Ga0210000_100000442 218
869 3300027471 Ga0209995_1000199 Ga0209995_10001996 218
870 3300027526 Ga0209968_1000015 Ga0209968_10000159 218
871 3300027543 Ga0209999_1000108 Ga0209999_10001082 218
872 3300027552 Ga0209982_1000941 Ga0209982_10009414 218
873 3300027614 Ga0209970_1000033 Ga0209970_100003314 218
874 3300027617 Ga0210002_1000009 Ga0210002_10000097 218
875 3300027665 Ga0209983_1001657 Ga0209983_10016574 218
876 3300027682 Ga0209971_1004115 Ga0209971_10041152 218
877 3300027695 Ga0209966_1000012 Ga0209966_100001274 218
878 3300027717 Ga0209998_10000174 Ga0209998_100001749 218
879 3300027876 Ga0209974_10000002 Ga0209974_1000000218 218
880 3300027907 Ga0207428_10000476 Ga0207428_1000047632 218
881 3300028379 Ga0268266_10307546 Ga0268266_103075462 218
882 3300028380 Ga0268265_10119899 Ga0268265_101198994 218
883 3300028381 Ga0268264_10173486 Ga0268264_101734863 218
884 3300035112 Ga0373932_0071046 Ga0373932_0071046_78_734 218
885 3300035207 Ga0373942_0075039 Ga0373942_0075039_79_735 218
886 3300035241 Ga0373961_0064729 Ga0373961_0064729_114_770 218
887 3300045051 Ga0451576_0273911 Ga0451576_0273911_901_1557 218
888 3300050507 nmdc:mga05p37_67642_c1 nmdc:mga05p37_67642_c1_3383_4039 218
889 3300050509 nmdc:mga0qj67_195942_c1 nmdc:mga0qj67_195942_c1_879_1535 218
890 3300050510 nmdc:mga06r32_84557_c1 nmdc:mga06r32_84557_c1_357_1013 218
891 3300050511 nmdc:mga08y16_7332_c1 nmdc:mga08y16_7332_c1_9272_9928 218
892 3300050512 nmdc:mga0n895_23084_c1 nmdc:mga0n895_23084_c1_890_1546 218
893 3300050513 nmdc:mga0rr50_49382_c1 nmdc:mga0rr50_49382_c1_1976_2632 218
894 3300050514 nmdc:mga08x19_25958_c1 nmdc:mga08x19_25958_c1_23_679 218
895 3300050515 nmdc:mga0a205_335661_c1 nmdc:mga0a205_335661_c1_86_742 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

38

148

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

178

234

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.962 3 118
3cz5-assembly2.cif.gz_B crystal structure of two-component response regulator, luxr family, from aurantimonas sp. si85-9a1 0.9608 3 138
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9543 3 118
8a5s-assembly1.cif.gz_AAA crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. 0.9531 149 208
3hzh-assembly1.cif.gz_A crystal structure of the chex-chey-bef3-mg+2 complex from borrelia burgdorferi 0.9472 5 119
ID Description Score Start End Superfamily
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.962 3 118 3.40.50.2300
3cz5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9608 3 138 3.40.50.2300
3hzhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9472 5 119 3.40.50.2300
4tmyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9432 4 118 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9405 3 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1F2T8S5-F1-model_v4 Response regulatory domain-containing protein 0.9842 1 129 GO:0000160
GO:0003677
AF-A0A2V8RH29-F1-model_v4 Response regulatory domain-containing protein 0.9826 3 129 GO:0000160
AF-A0A2V9VDR3-F1-model_v4 Response regulatory domain-containing protein 0.9758 1 126 GO:0000160
GO:0003677
AF-A0A2V8SNV1-F1-model_v4 Response regulatory domain-containing protein 0.9752 3 129 GO:0000160
GO:0003677
AF-A0A2W0BRM2-F1-model_v4 Response regulatory domain-containing protein 0.9746 3 129 GO:0000160
GO:0003677

Feature Viewer

pLDDT pTM Quality
85.93 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map