F484977
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 895 | 242 | 895 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10047749|Ga0182008_100477492 |
| Length | 213 |
| Sequence | VSVSGTASRPRTGVARPGKLEESELLGRVGGGDLHAFERLYRIYQPRLARFLINLVQRPQLVEEVLNDTMMVVWQTAGKFRGASKPSTWIFSIAYRKAMKAKARWPDPVEEPTDERVSADPAPDEDLDRQRLHDALVNAMDQLSADHRAVVDLTYFHGMGYREIAEIMGCPVDTVKTRMFHARRRLRQSTCVAWPMTTCRSCEMRRTVAPCSD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 114 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 199 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 200 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 201 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 202 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 203 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 204 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 205 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 206 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 207 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 234 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 236 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 242 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0.89 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 2.68 |
| Rhizosphere | 96.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000429 | 3300001904 | Bacteria | 7898 |
| 2 | JGI24740J21852_10023652 | 3300001979 | Unclassified | 2095 |
| 3 | JGI24740J21852_10039507 | 3300001979 | Bacteria | 1438 |
| 4 | JGI24740J21852_10064961 | 3300001979 | Unclassified | 994 |
| 5 | JGI24740J21852_10083333 | 3300001979 | Bacteria | 834 |
| 6 | JGI24739J22299_10000896 | 3300001989 | Bacteria | 11013 |
| 7 | JGI24737J22298_10000355 | 3300001990 | Bacteria | 15479 |
| 8 | JGI24737J22298_10002309 | 3300001990 | Bacteria | 6786 |
| 9 | JGI24737J22298_10008905 | 3300001990 | Bacteria | 3348 |
| 10 | JGI24737J22298_10017460 | 3300001990 | Bacteria | 2310 |
| 11 | JGI24737J22298_10069308 | 3300001990 | Bacteria | 1054 |
| 12 | JGI24735J21928_10002044 | 3300002067 | Bacteria | 7106 |
| 13 | JGI24738J21930_10001455 | 3300002075 | Bacteria | 6579 |
| 14 | JGI24738J21930_10001891 | 3300002075 | Bacteria | 5659 |
| 15 | rootH1_10158387 | 3300003316 | Bacteria | 2119 |
| 16 | rootL2_10051997 | 3300003322 | Bacteria | 18411 |
| 17 | Ga0058859_10020293 | 3300004798 | Bacteria | 2617 |
| 18 | Ga0065712_10180228 | 3300005290 | Bacteria | 1194 |
| 19 | Ga0065715_10017383 | 3300005293 | Bacteria | 2762 |
| 20 | Ga0065715_10167000 | 3300005293 | Bacteria | 1564 |
| 21 | Ga0065707_10321111 | 3300005295 | Bacteria | 966 |
| 22 | Ga0070658_10000107 | 3300005327 | Bacteria | 73895 |
| 23 | Ga0070658_10015142 | 3300005327 | Bacteria | 6172 |
| 24 | Ga0070658_10018716 | 3300005327 | Bacteria | 5548 |
| 25 | Ga0070658_10107558 | 3300005327 | Bacteria | 2308 |
| 26 | Ga0070658_10254386 | 3300005327 | Bacteria | 1490 |
| 27 | Ga0070658_10276256 | 3300005327 | Bacteria | 1429 |
| 28 | Ga0070658_10572032 | 3300005327 | Unclassified | 978 |
| 29 | Ga0070676_10090430 | 3300005328 | Bacteria | 1874 |
| 30 | Ga0070676_10152142 | 3300005328 | Unclassified | 1482 |
| 31 | Ga0070676_10201715 | 3300005328 | Bacteria | 1304 |
| 32 | Ga0070676_10270820 | 3300005328 | Bacteria | 1140 |
| 33 | Ga0070683_100000826 | 3300005329 | Bacteria | 22957 |
| 34 | Ga0070683_100005337 | 3300005329 | Bacteria | 10714 |
| 35 | Ga0070683_100041523 | 3300005329 | Bacteria | 4232 |
| 36 | Ga0070683_100055267 | 3300005329 | Bacteria | 3684 |
| 37 | Ga0070683_100117752 | 3300005329 | Unclassified | 2508 |
| 38 | Ga0070690_100311318 | 3300005330 | Bacteria | 1132 |
| 39 | Ga0070670_100001372 | 3300005331 | Bacteria | 19498 |
| 40 | Ga0070670_100002145 | 3300005331 | Bacteria | 16197 |
| 41 | Ga0070670_100007777 | 3300005331 | Bacteria | 9123 |
| 42 | Ga0070670_100007963 | 3300005331 | Bacteria | 9013 |
| 43 | Ga0070670_100022348 | 3300005331 | Bacteria | 5445 |
| 44 | Ga0070670_100140360 | 3300005331 | Bacteria | 2089 |
| 45 | Ga0068869_100000230 | 3300005334 | Bacteria | 29349 |
| 46 | Ga0068869_100073353 | 3300005334 | Bacteria | 2537 |
| 47 | Ga0070666_10000169 | 3300005335 | Bacteria | 45092 |
| 48 | Ga0070666_10027596 | 3300005335 | Bacteria | 3720 |
| 49 | Ga0070666_10047270 | 3300005335 | Bacteria | 2889 |
| 50 | Ga0070666_10112252 | 3300005335 | Bacteria | 1885 |
| 51 | Ga0070666_10149335 | 3300005335 | Bacteria | 1630 |
| 52 | Ga0070666_10164829 | 3300005335 | Unclassified | 1550 |
| 53 | Ga0070680_100002564 | 3300005336 | Bacteria | 13439 |
| 54 | Ga0070680_100002845 | 3300005336 | Bacteria | 12866 |
| 55 | Ga0070680_100299125 | 3300005336 | Bacteria | 1364 |
| 56 | Ga0070682_100041747 | 3300005337 | Bacteria | 2829 |
| 57 | Ga0070682_100166969 | 3300005337 | Bacteria | 1526 |
| 58 | Ga0068868_100013097 | 3300005338 | Bacteria | 6073 |
| 59 | Ga0068868_100108376 | 3300005338 | Bacteria | 2254 |
| 60 | Ga0068868_100169380 | 3300005338 | Bacteria | 1808 |
| 61 | Ga0070660_100000705 | 3300005339 | Bacteria | 22109 |
| 62 | Ga0070660_100001061 | 3300005339 | Bacteria | 18495 |
| 63 | Ga0070660_100011817 | 3300005339 | Bacteria | 6220 |
| 64 | Ga0070660_100028953 | 3300005339 | Bacteria | 4148 |
| 65 | Ga0070660_100055092 | 3300005339 | Unclassified | 3072 |
| 66 | Ga0070660_100079553 | 3300005339 | Unclassified | 2572 |
| 67 | Ga0070660_100471762 | 3300005339 | Unclassified | 1042 |
| 68 | Ga0070689_100400779 | 3300005340 | Bacteria | 1160 |
| 69 | Ga0070689_101066646 | 3300005340 | Unclassified | 721 |
| 70 | Ga0070691_10009124 | 3300005341 | Bacteria | 4534 |
| 71 | Ga0070687_100085806 | 3300005343 | Bacteria | 1729 |
| 72 | Ga0070661_100000070 | 3300005344 | Bacteria | 82818 |
| 73 | Ga0070661_100001787 | 3300005344 | Bacteria | 14912 |
| 74 | Ga0070661_100012952 | 3300005344 | Bacteria | 5845 |
| 75 | Ga0070661_100013745 | 3300005344 | Bacteria | 5686 |
| 76 | Ga0070661_100022816 | 3300005344 | Bacteria | 4481 |
| 77 | Ga0070661_100049439 | 3300005344 | Bacteria | 3078 |
| 78 | Ga0070661_100147628 | 3300005344 | Bacteria | 1776 |
| 79 | Ga0070661_100182901 | 3300005344 | Bacteria | 1595 |
| 80 | Ga0070692_10011678 | 3300005345 | Bacteria | 4039 |
| 81 | Ga0070692_10012145 | 3300005345 | Bacteria | 3975 |
| 82 | Ga0070692_10017276 | 3300005345 | Unclassified | 3445 |
| 83 | Ga0070692_10216770 | 3300005345 | Unclassified | 1129 |
| 84 | Ga0070692_10237705 | 3300005345 | Bacteria | 1084 |
| 85 | Ga0070692_10318799 | 3300005345 | Bacteria | 955 |
| 86 | Ga0070668_100001895 | 3300005347 | Bacteria | 15294 |
| 87 | Ga0070668_100026740 | 3300005347 | Bacteria | 4380 |
| 88 | Ga0070668_100357678 | 3300005347 | Unclassified | 1237 |
| 89 | Ga0070668_100405204 | 3300005347 | Bacteria | 1165 |
| 90 | Ga0070669_100005470 | 3300005353 | Bacteria | 9167 |
| 91 | Ga0070669_100057112 | 3300005353 | Bacteria | 2863 |
| 92 | Ga0070669_100068084 | 3300005353 | Bacteria | 2627 |
| 93 | Ga0070669_100432002 | 3300005353 | Unclassified | 1082 |
| 94 | Ga0070669_100440128 | 3300005353 | Bacteria | 1073 |
| 95 | Ga0070675_100076235 | 3300005354 | Bacteria | 2789 |
| 96 | Ga0070675_100239461 | 3300005354 | Bacteria | 1585 |
| 97 | Ga0070671_100003153 | 3300005355 | Bacteria | 12853 |
| 98 | Ga0070671_100025514 | 3300005355 | Bacteria | 4850 |
| 99 | Ga0070671_100033882 | 3300005355 | Bacteria | 4226 |
| 100 | Ga0070671_100143805 | 3300005355 | Bacteria | 2013 |
| 101 | Ga0070671_100257883 | 3300005355 | Bacteria | 1482 |
| 102 | Ga0070674_100134573 | 3300005356 | Bacteria | 1847 |
| 103 | Ga0070673_100000535 | 3300005364 | Bacteria | 20475 |
| 104 | Ga0070673_100025088 | 3300005364 | Bacteria | 4382 |
| 105 | Ga0070673_100052062 | 3300005364 | Bacteria | 3211 |
| 106 | Ga0070673_100480694 | 3300005364 | Bacteria | 1121 |
| 107 | Ga0070659_100000045 | 3300005366 | Bacteria | 101520 |
| 108 | Ga0070659_100001166 | 3300005366 | Bacteria | 19212 |
| 109 | Ga0070659_100003703 | 3300005366 | Bacteria | 10905 |
| 110 | Ga0070659_100003728 | 3300005366 | Bacteria | 10871 |
| 111 | Ga0070659_100005162 | 3300005366 | Bacteria | 9365 |
| 112 | Ga0070659_100010096 | 3300005366 | Bacteria | 6950 |
| 113 | Ga0070659_100050724 | 3300005366 | Unclassified | 3262 |
| 114 | Ga0070659_100134715 | 3300005366 | Bacteria | 2008 |
| 115 | Ga0070659_100267616 | 3300005366 | Bacteria | 1419 |
| 116 | Ga0070659_100273396 | 3300005366 | Unclassified | 1404 |
| 117 | Ga0070659_100286720 | 3300005366 | Bacteria | 1370 |
| 118 | Ga0070667_100003638 | 3300005367 | Bacteria | 13121 |
| 119 | Ga0070667_100008232 | 3300005367 | Bacteria | 8643 |
| 120 | Ga0070667_100040943 | 3300005367 | Bacteria | 3886 |
| 121 | Ga0070667_100102216 | 3300005367 | Bacteria | 2476 |
| 122 | Ga0070667_100107881 | 3300005367 | Bacteria | 2411 |
| 123 | Ga0070667_100138264 | 3300005367 | Bacteria | 2131 |
| 124 | Ga0070667_100148793 | 3300005367 | Unclassified | 2055 |
| 125 | Ga0070667_100246053 | 3300005367 | Unclassified | 1598 |
| 126 | Ga0070667_100723793 | 3300005367 | Bacteria | 921 |
| 127 | Ga0070667_100744870 | 3300005367 | Bacteria | 908 |
| 128 | Ga0070709_10023808 | 3300005434 | Bacteria | 3600 |
| 129 | Ga0070714_100030110 | 3300005435 | Bacteria | 4516 |
| 130 | Ga0070714_100039056 | 3300005435 | Bacteria | 3995 |
| 131 | Ga0070714_100064263 | 3300005435 | Bacteria | 3158 |
| 132 | Ga0070714_100153584 | 3300005435 | Bacteria | 2077 |
| 133 | Ga0070714_100282172 | 3300005435 | Bacteria | 1543 |
| 134 | Ga0070713_100005496 | 3300005436 | Bacteria | 8675 |
| 135 | Ga0070713_100108629 | 3300005436 | Bacteria | 2415 |
| 136 | Ga0070700_100110298 | 3300005441 | Bacteria | 1828 |
| 137 | Ga0070694_100003942 | 3300005444 | Bacteria | 8882 |
| 138 | Ga0070694_100056002 | 3300005444 | Bacteria | 2676 |
| 139 | Ga0070694_100426483 | 3300005444 | Bacteria | 1043 |
| 140 | Ga0070663_100001742 | 3300005455 | Bacteria | 12094 |
| 141 | Ga0070663_100005878 | 3300005455 | Bacteria | 7337 |
| 142 | Ga0070663_100023452 | 3300005455 | Bacteria | 4137 |
| 143 | Ga0070663_100043555 | 3300005455 | Bacteria | 3159 |
| 144 | Ga0070663_100053536 | 3300005455 | Bacteria | 2881 |
| 145 | Ga0070663_100239882 | 3300005455 | Bacteria | 1430 |
| 146 | Ga0070663_100415732 | 3300005455 | Unclassified | 1102 |
| 147 | Ga0070663_100424975 | 3300005455 | Bacteria | 1090 |
| 148 | Ga0070678_100184162 | 3300005456 | Bacteria | 1712 |
| 149 | Ga0070678_100246471 | 3300005456 | Bacteria | 1496 |
| 150 | Ga0070678_100367072 | 3300005456 | Bacteria | 1242 |
| 151 | Ga0070662_100000037 | 3300005457 | Bacteria | 76596 |
| 152 | Ga0070662_100000390 | 3300005457 | Bacteria | 26178 |
| 153 | Ga0070662_100002727 | 3300005457 | Bacteria | 10907 |
| 154 | Ga0070662_100005999 | 3300005457 | Bacteria | 7794 |
| 155 | Ga0070662_100044884 | 3300005457 | Bacteria | 3168 |
| 156 | Ga0070662_100110696 | 3300005457 | Bacteria | 2092 |
| 157 | Ga0070662_100117275 | 3300005457 | Unclassified | 2036 |
| 158 | Ga0070681_10031091 | 3300005458 | Bacteria | 5358 |
| 159 | Ga0070681_10149392 | 3300005458 | Unclassified | 2264 |
| 160 | Ga0070681_10383167 | 3300005458 | Bacteria | 1317 |
| 161 | Ga0070681_10901276 | 3300005458 | Bacteria | 803 |
| 162 | Ga0068867_100060922 | 3300005459 | Bacteria | 2801 |
| 163 | Ga0068867_100084021 | 3300005459 | Bacteria | 2404 |
| 164 | Ga0070679_100011099 | 3300005530 | Bacteria | 8573 |
| 165 | Ga0070679_100037875 | 3300005530 | Bacteria | 4792 |
| 166 | Ga0070679_100092415 | 3300005530 | Bacteria | 3013 |
| 167 | Ga0070679_100132242 | 3300005530 | Unclassified | 2476 |
| 168 | Ga0070679_100277052 | 3300005530 | Bacteria | 1630 |
| 169 | Ga0070684_100003373 | 3300005535 | Bacteria | 11965 |
| 170 | Ga0070684_100005950 | 3300005535 | Bacteria | 9394 |
| 171 | Ga0070684_100010973 | 3300005535 | Bacteria | 7205 |
| 172 | Ga0070684_100107284 | 3300005535 | Bacteria | 2501 |
| 173 | Ga0070684_100152039 | 3300005535 | Bacteria | 2097 |
| 174 | Ga0070684_100587889 | 3300005535 | Bacteria | 1035 |
| 175 | Ga0068853_100000213 | 3300005539 | Bacteria | 41255 |
| 176 | Ga0068853_100003747 | 3300005539 | Bacteria | 11661 |
| 177 | Ga0068853_100015106 | 3300005539 | Bacteria | 6348 |
| 178 | Ga0068853_100018643 | 3300005539 | Bacteria | 5745 |
| 179 | Ga0068853_100046718 | 3300005539 | Bacteria | 3713 |
| 180 | Ga0068853_100149028 | 3300005539 | Bacteria | 2105 |
| 181 | Ga0068853_100233391 | 3300005539 | Bacteria | 1684 |
| 182 | Ga0068853_100268309 | 3300005539 | Unclassified | 1571 |
| 183 | Ga0068853_100521135 | 3300005539 | Unclassified | 1124 |
| 184 | Ga0070672_100001092 | 3300005543 | Bacteria | 16526 |
| 185 | Ga0070672_100010946 | 3300005543 | Bacteria | 6311 |
| 186 | Ga0070672_100074990 | 3300005543 | Plasmid | 2699 |
| 187 | Ga0070672_100134828 | 3300005543 | Bacteria | 2033 |
| 188 | Ga0070672_100172853 | 3300005543 | Bacteria | 1797 |
| 189 | Ga0070672_100217224 | 3300005543 | Bacteria | 1603 |
| 190 | Ga0070693_100000168 | 3300005547 | Bacteria | 30586 |
| 191 | Ga0070665_100001821 | 3300005548 | Bacteria | 24189 |
| 192 | Ga0070665_100008990 | 3300005548 | Bacteria | 10117 |
| 193 | Ga0070665_100012284 | 3300005548 | Bacteria | 8633 |
| 194 | Ga0070665_100028422 | 3300005548 | Bacteria | 5631 |
| 195 | Ga0070665_100787518 | 3300005548 | Bacteria | 964 |
| 196 | Ga0070665_100954062 | 3300005548 | Bacteria | 870 |
| 197 | Ga0070665_101157758 | 3300005548 | Bacteria | 784 |
| 198 | Ga0068855_100000751 | 3300005563 | Bacteria | 39807 |
| 199 | Ga0068855_100009251 | 3300005563 | Bacteria | 11904 |
| 200 | Ga0068855_100014603 | 3300005563 | Bacteria | 9459 |
| 201 | Ga0068855_100047326 | 3300005563 | Bacteria | 5081 |
| 202 | Ga0068855_100135459 | 3300005563 | Unclassified | 2810 |
| 203 | Ga0068855_100165247 | 3300005563 | Bacteria | 2510 |
| 204 | Ga0068855_100169163 | 3300005563 | Bacteria | 2476 |
| 205 | Ga0068855_100672131 | 3300005563 | Bacteria | 1110 |
| 206 | Ga0068855_100694892 | 3300005563 | Bacteria | 1089 |
| 207 | Ga0068855_100763135 | 3300005563 | Bacteria | 1030 |
| 208 | Ga0070664_100000027 | 3300005564 | Bacteria | 90881 |
| 209 | Ga0070664_100000464 | 3300005564 | Bacteria | 30816 |
| 210 | Ga0070664_100001296 | 3300005564 | Bacteria | 19984 |
| 211 | Ga0070664_100003499 | 3300005564 | Bacteria | 12689 |
| 212 | Ga0070664_100007726 | 3300005564 | Bacteria | 8683 |
| 213 | Ga0070664_100017421 | 3300005564 | Bacteria | 5898 |
| 214 | Ga0070664_100072242 | 3300005564 | Bacteria | 2959 |
| 215 | Ga0070664_100169764 | 3300005564 | Bacteria | 1935 |
| 216 | Ga0070664_100434173 | 3300005564 | Bacteria | 1204 |
| 217 | Ga0070664_100481912 | 3300005564 | Unclassified | 1141 |
| 218 | Ga0068857_100001454 | 3300005577 | Bacteria | 18809 |
| 219 | Ga0068857_100013811 | 3300005577 | Bacteria | 7033 |
| 220 | Ga0068857_100025701 | 3300005577 | Bacteria | 5185 |
| 221 | Ga0068857_100078293 | 3300005577 | Unclassified | 2951 |
| 222 | Ga0068857_100123519 | 3300005577 | Bacteria | 2332 |
| 223 | Ga0068857_100191577 | 3300005577 | Unclassified | 1862 |
| 224 | Ga0068857_100198801 | 3300005577 | Unclassified | 1827 |
| 225 | Ga0068857_100230281 | 3300005577 | Unclassified | 1694 |
| 226 | Ga0068857_100361838 | 3300005577 | Bacteria | 1345 |
| 227 | Ga0068857_100426765 | 3300005577 | Bacteria | 1237 |
| 228 | Ga0068854_100000919 | 3300005578 | Bacteria | 17679 |
| 229 | Ga0068854_100003625 | 3300005578 | Bacteria | 9661 |
| 230 | Ga0068854_100005197 | 3300005578 | Bacteria | 8209 |
| 231 | Ga0068854_100010605 | 3300005578 | Bacteria | 5980 |
| 232 | Ga0068854_100047223 | 3300005578 | Unclassified | 3068 |
| 233 | Ga0068854_100114548 | 3300005578 | Bacteria | 2038 |
| 234 | Ga0068854_100372822 | 3300005578 | Unclassified | 1174 |
| 235 | Ga0068854_100470359 | 3300005578 | Bacteria | 1053 |
| 236 | Ga0068854_100651782 | 3300005578 | Bacteria | 904 |
| 237 | Ga0068856_100000743 | 3300005614 | Bacteria | 35296 |
| 238 | Ga0068856_100011527 | 3300005614 | Bacteria | 8576 |
| 239 | Ga0068856_100022741 | 3300005614 | Bacteria | 6095 |
| 240 | Ga0068856_100052360 | 3300005614 | Bacteria | 4025 |
| 241 | Ga0068856_100106345 | 3300005614 | Bacteria | 2800 |
| 242 | Ga0068856_100134030 | 3300005614 | Unclassified | 2482 |
| 243 | Ga0068852_100000480 | 3300005616 | Bacteria | 26176 |
| 244 | Ga0068852_100006131 | 3300005616 | Bacteria | 8670 |
| 245 | Ga0068852_100053794 | 3300005616 | Bacteria | 3467 |
| 246 | Ga0068852_100087972 | 3300005616 | Unclassified | 2773 |
| 247 | Ga0068852_100138962 | 3300005616 | Unclassified | 2246 |
| 248 | Ga0068852_100213260 | 3300005616 | Bacteria | 1833 |
| 249 | Ga0068852_100234645 | 3300005616 | Bacteria | 1750 |
| 250 | Ga0068852_100319202 | 3300005616 | Bacteria | 1508 |
| 251 | Ga0068852_100428775 | 3300005616 | Unclassified | 1305 |
| 252 | Ga0068852_100576689 | 3300005616 | Bacteria | 1127 |
| 253 | Ga0068852_100590222 | 3300005616 | Bacteria | 1114 |
| 254 | Ga0068859_100003231 | 3300005617 | Bacteria | 16593 |
| 255 | Ga0068859_100039750 | 3300005617 | Bacteria | 4720 |
| 256 | Ga0068859_100073615 | 3300005617 | Bacteria | 3454 |
| 257 | Ga0068859_100106230 | 3300005617 | Bacteria | 2867 |
| 258 | Ga0068859_100124237 | 3300005617 | Bacteria | 2649 |
| 259 | Ga0068859_100237460 | 3300005617 | Unclassified | 1911 |
| 260 | Ga0068864_100000897 | 3300005618 | Bacteria | 25075 |
| 261 | Ga0068864_100003357 | 3300005618 | Bacteria | 13232 |
| 262 | Ga0068864_100026930 | 3300005618 | Bacteria | 4850 |
| 263 | Ga0068864_100087811 | 3300005618 | Plasmid | 2738 |
| 264 | Ga0068864_100170692 | 3300005618 | Bacteria | 1983 |
| 265 | Ga0068864_100192870 | 3300005618 | Unclassified | 1869 |
| 266 | Ga0068864_100385326 | 3300005618 | Bacteria | 1329 |
| 267 | Ga0068866_10254655 | 3300005718 | Bacteria | 1076 |
| 268 | Ga0068861_100242394 | 3300005719 | Bacteria | 1534 |
| 269 | Ga0068851_10002638 | 3300005834 | Bacteria | 7903 |
| 270 | Ga0068851_10003322 | 3300005834 | Bacteria | 7151 |
| 271 | Ga0068851_10128098 | 3300005834 | Unclassified | 1370 |
| 272 | Ga0068870_10314823 | 3300005840 | Bacteria | 992 |
| 273 | Ga0068870_10465456 | 3300005840 | Unclassified | 836 |
| 274 | Ga0068863_100003418 | 3300005841 | Bacteria | 15652 |
| 275 | Ga0068863_100017105 | 3300005841 | Bacteria | 6956 |
| 276 | Ga0068863_100036360 | 3300005841 | Unclassified | 4691 |
| 277 | Ga0068863_100053201 | 3300005841 | Bacteria | 3837 |
| 278 | Ga0068863_100194707 | 3300005841 | Bacteria | 1949 |
| 279 | Ga0068863_100528722 | 3300005841 | Unclassified | 1163 |
| 280 | Ga0068858_100010567 | 3300005842 | Bacteria | 8743 |
| 281 | Ga0068858_100013259 | 3300005842 | Bacteria | 7768 |
| 282 | Ga0068858_100017615 | 3300005842 | Bacteria | 6696 |
| 283 | Ga0068858_100018417 | 3300005842 | Bacteria | 6537 |
| 284 | Ga0068858_100064108 | 3300005842 | Bacteria | 3400 |
| 285 | Ga0068858_100303237 | 3300005842 | Bacteria | 1524 |
| 286 | Ga0068858_100760785 | 3300005842 | Bacteria | 944 |
| 287 | Ga0068860_100005048 | 3300005843 | Bacteria | 13429 |
| 288 | Ga0068860_100006336 | 3300005843 | Bacteria | 11883 |
| 289 | Ga0068860_100017848 | 3300005843 | Bacteria | 6911 |
| 290 | Ga0068860_100018770 | 3300005843 | Bacteria | 6719 |
| 291 | Ga0068860_100052951 | 3300005843 | Bacteria | 3859 |
| 292 | Ga0068860_100170109 | 3300005843 | Unclassified | 2104 |
| 293 | Ga0068860_100307669 | 3300005843 | Bacteria | 1554 |
| 294 | Ga0068862_100004011 | 3300005844 | Bacteria | 12483 |
| 295 | Ga0068862_100018840 | 3300005844 | Bacteria | 5752 |
| 296 | Ga0068862_100067965 | 3300005844 | Bacteria | 3073 |
| 297 | Ga0068862_100115736 | 3300005844 | Bacteria | 2358 |
| 298 | Ga0068862_100653203 | 3300005844 | Bacteria | 1015 |
| 299 | Ga0070717_10030714 | 3300006028 | Bacteria | 4317 |
| 300 | Ga0070712_100019418 | 3300006175 | Bacteria | 4433 |
| 301 | Ga0097621_100251394 | 3300006237 | Unclassified | 1548 |
| 302 | Ga0097621_100354879 | 3300006237 | Unclassified | 1305 |
| 303 | Ga0097621_100402133 | 3300006237 | Unclassified | 1226 |
| 304 | Ga0068871_100038507 | 3300006358 | Bacteria | 3820 |
| 305 | Ga0068871_100120013 | 3300006358 | Unclassified | 2220 |
| 306 | Ga0075428_100351054 | 3300006844 | Unclassified | 1583 |
| 307 | Ga0075428_100567981 | 3300006844 | Bacteria | 1212 |
| 308 | Ga0075433_10008969 | 3300006852 | Bacteria | 7985 |
| 309 | Ga0075433_10070855 | 3300006852 | Bacteria | 3064 |
| 310 | Ga0075434_100496963 | 3300006871 | Bacteria | 1241 |
| 311 | Ga0068865_100020097 | 3300006881 | Bacteria | 4330 |
| 312 | Ga0068865_100186668 | 3300006881 | Bacteria | 1600 |
| 313 | Ga0097620_100003231 | 3300006931 | Bacteria | 16593 |
| 314 | Ga0097620_100024576 | 3300006931 | Bacteria | 6045 |
| 315 | Ga0097620_100039749 | 3300006931 | Bacteria | 4720 |
| 316 | Ga0097620_100073618 | 3300006931 | Bacteria | 3454 |
| 317 | Ga0097620_100106217 | 3300006931 | Bacteria | 2867 |
| 318 | Ga0097620_100124244 | 3300006931 | Bacteria | 2649 |
| 319 | Ga0097620_100237462 | 3300006931 | Unclassified | 1911 |
| 320 | Ga0075435_100583628 | 3300007076 | Unclassified | 969 |
| 321 | Ga0105250_10087198 | 3300009092 | Bacteria | 1267 |
| 322 | Ga0105250_10126986 | 3300009092 | Bacteria | 1051 |
| 323 | Ga0105240_10019380 | 3300009093 | Bacteria | 9089 |
| 324 | Ga0105240_10065681 | 3300009093 | Bacteria | 4503 |
| 325 | Ga0105240_10114679 | 3300009093 | Bacteria | 3255 |
| 326 | Ga0105240_10116525 | 3300009093 | Bacteria | 3223 |
| 327 | Ga0105240_10166411 | 3300009093 | Unclassified | 2615 |
| 328 | Ga0105240_10243406 | 3300009093 | Bacteria | 2084 |
| 329 | Ga0105240_10288745 | 3300009093 | Bacteria | 1881 |
| 330 | Ga0111539_11658631 | 3300009094 | Bacteria | 741 |
| 331 | Ga0105245_10001947 | 3300009098 | Bacteria | 18731 |
| 332 | Ga0105245_10031880 | 3300009098 | Bacteria | 4667 |
| 333 | Ga0105247_10128837 | 3300009101 | Bacteria | 1647 |
| 334 | Ga0105243_10250746 | 3300009148 | Bacteria | 1580 |
| 335 | Ga0105243_10447926 | 3300009148 | Bacteria | 1211 |
| 336 | Ga0105241_10005313 | 3300009174 | Bacteria | 9514 |
| 337 | Ga0105241_10101656 | 3300009174 | Bacteria | 2286 |
| 338 | Ga0105241_10116724 | 3300009174 | Bacteria | 2144 |
| 339 | Ga0105241_10398531 | 3300009174 | Bacteria | 1206 |
| 340 | Ga0105242_10027715 | 3300009176 | Bacteria | 4502 |
| 341 | Ga0105242_10047939 | 3300009176 | Bacteria | 3471 |
| 342 | Ga0105248_10006665 | 3300009177 | Bacteria | 12669 |
| 343 | Ga0105248_10010146 | 3300009177 | Bacteria | 10375 |
| 344 | Ga0105248_10040397 | 3300009177 | Bacteria | 5229 |
| 345 | Ga0105248_10054079 | 3300009177 | Bacteria | 4503 |
| 346 | Ga0105248_10327376 | 3300009177 | Unclassified | 1726 |
| 347 | Ga0105248_10340645 | 3300009177 | Bacteria | 1688 |
| 348 | Ga0105248_10458189 | 3300009177 | Unclassified | 1437 |
| 349 | Ga0105248_10819462 | 3300009177 | Bacteria | 1050 |
| 350 | Ga0105248_10846177 | 3300009177 | Bacteria | 1033 |
| 351 | Ga0105237_10013446 | 3300009545 | Bacteria | 8583 |
| 352 | Ga0105237_10396280 | 3300009545 | Unclassified | 1385 |
| 353 | Ga0105238_10032849 | 3300009551 | Bacteria | 5282 |
| 354 | Ga0105238_10108986 | 3300009551 | Plasmid | 2751 |
| 355 | Ga0105249_10013203 | 3300009553 | Bacteria | 7289 |
| 356 | Ga0105249_10091563 | 3300009553 | Bacteria | 2845 |
| 357 | Ga0105249_10096755 | 3300009553 | Bacteria | 2770 |
| 358 | Ga0105249_10181325 | 3300009553 | Bacteria | 2049 |
| 359 | Ga0105239_10039562 | 3300010375 | Bacteria | 5166 |
| 360 | Ga0105239_10238101 | 3300010375 | Bacteria | 2043 |
| 361 | Ga0105239_10357312 | 3300010375 | Bacteria | 1649 |
| 362 | Ga0105246_10032838 | 3300011119 | Bacteria | 3446 |
| 363 | Ga0105246_10134046 | 3300011119 | Bacteria | 1854 |
| 364 | Ga0157373_10007319 | 3300013100 | Bacteria | 8220 |
| 365 | Ga0157373_10012534 | 3300013100 | Bacteria | 6233 |
| 366 | Ga0157373_10135577 | 3300013100 | Bacteria | 1731 |
| 367 | Ga0157373_10195871 | 3300013100 | Bacteria | 1424 |
| 368 | Ga0157373_10237173 | 3300013100 | Bacteria | 1289 |
| 369 | Ga0157373_10257573 | 3300013100 | Bacteria | 1234 |
| 370 | Ga0157373_10474380 | 3300013100 | Bacteria | 902 |
| 371 | Ga0157371_10047525 | 3300013102 | Bacteria | 3051 |
| 372 | Ga0157371_10068402 | 3300013102 | Bacteria | 2514 |
| 373 | Ga0157371_10125739 | 3300013102 | Bacteria | 1823 |
| 374 | Ga0157371_10136176 | 3300013102 | Bacteria | 1749 |
| 375 | Ga0157370_10000497 | 3300013104 | Bacteria | 48916 |
| 376 | Ga0157370_10015668 | 3300013104 | Bacteria | 7699 |
| 377 | Ga0157370_10037783 | 3300013104 | Bacteria | 4676 |
| 378 | Ga0157370_10059121 | 3300013104 | Bacteria | 3643 |
| 379 | Ga0157370_10065215 | 3300013104 | Bacteria | 3445 |
| 380 | Ga0157370_10066600 | 3300013104 | Bacteria | 3406 |
| 381 | Ga0157370_10129694 | 3300013104 | Bacteria | 2352 |
| 382 | Ga0157370_10527226 | 3300013104 | Bacteria | 1084 |
| 383 | Ga0157369_10046479 | 3300013105 | Bacteria | 4717 |
| 384 | Ga0157369_10059002 | 3300013105 | Bacteria | 4139 |
| 385 | Ga0157369_10119859 | 3300013105 | Bacteria | 2792 |
| 386 | Ga0157369_10260148 | 3300013105 | Bacteria | 1810 |
| 387 | Ga0157369_10317225 | 3300013105 | Bacteria | 1620 |
| 388 | Ga0157369_10426180 | 3300013105 | Bacteria | 1375 |
| 389 | Ga0157369_10495755 | 3300013105 | Unclassified | 1264 |
| 390 | Ga0157369_10841994 | 3300013105 | Bacteria | 942 |
| 391 | Ga0157374_10003502 | 3300013296 | Bacteria | 13201 |
| 392 | Ga0157374_10377231 | 3300013296 | Unclassified | 1412 |
| 393 | Ga0157378_10014264 | 3300013297 | Bacteria | 6957 |
| 394 | Ga0157378_10406296 | 3300013297 | Unclassified | 1343 |
| 395 | Ga0163162_10061377 | 3300013306 | Bacteria | 3797 |
| 396 | Ga0163162_10218879 | 3300013306 | Bacteria | 2034 |
| 397 | Ga0163162_10369061 | 3300013306 | Bacteria | 1568 |
| 398 | Ga0163162_10566753 | 3300013306 | Bacteria | 1263 |
| 399 | Ga0163162_10791586 | 3300013306 | Bacteria | 1066 |
| 400 | Ga0157372_10260025 | 3300013307 | Unclassified | 2016 |
| 401 | Ga0157372_10330400 | 3300013307 | Bacteria | 1775 |
| 402 | Ga0157372_10375437 | 3300013307 | Bacteria | 1657 |
| 403 | Ga0157372_10504214 | 3300013307 | Unclassified | 1411 |
| 404 | Ga0157372_10697082 | 3300013307 | Bacteria | 1182 |
| 405 | Ga0157372_10733913 | 3300013307 | Bacteria | 1149 |
| 406 | Ga0157375_10009605 | 3300013308 | Bacteria | 8498 |
| 407 | Ga0157375_10022235 | 3300013308 | Bacteria | 5835 |
| 408 | Ga0157375_10225531 | 3300013308 | Bacteria | 2033 |
| 409 | Ga0157375_10944581 | 3300013308 | Bacteria | 1004 |
| 410 | Ga0157375_11314225 | 3300013308 | Unclassified | 850 |
| 411 | Ga0163163_10870712 | 3300014325 | Bacteria | 964 |
| 412 | Ga0157380_10354135 | 3300014326 | Bacteria | 1375 |
| 413 | Ga0157380_10453228 | 3300014326 | Bacteria | 1233 |
| 414 | Ga0182008_10047749 | 3300014497 | Bacteria | 2127 |
| 415 | Ga0157377_10019876 | 3300014745 | Bacteria | 3512 |
| 416 | Ga0157377_10219471 | 3300014745 | Bacteria | 1216 |
| 417 | Ga0157379_10006760 | 3300014968 | Bacteria | 9912 |
| 418 | Ga0157379_10080161 | 3300014968 | Unclassified | 2924 |
| 419 | Ga0157379_10106465 | 3300014968 | Unclassified | 2517 |
| 420 | Ga0163161_10299599 | 3300017792 | Bacteria | 1266 |
| 421 | Ga0163161_10329381 | 3300017792 | Unclassified | 1209 |
| 422 | Ga0197907_11483432 | 3300020069 | Unclassified | 686 |
| 423 | Ga0206356_10308331 | 3300020070 | Unclassified | 854 |
| 424 | Ga0206356_11242570 | 3300020070 | Bacteria | 3767 |
| 425 | Ga0206356_11673347 | 3300020070 | Unclassified | 695 |
| 426 | Ga0206352_11205138 | 3300020078 | Unclassified | 872 |
| 427 | Ga0206350_10308023 | 3300020080 | Bacteria | 1201 |
| 428 | Ga0206353_10924983 | 3300020082 | Unclassified | 1345 |
| 429 | Ga0213872_10206911 | 3300021361 | Unclassified | 839 |
| 430 | Ga0207673_1008721 | 3300025290 | Unclassified | 1288 |
| 431 | Ga0209257_1049869 | 3300025304 | Bacteria | 1189 |
| 432 | Ga0207697_10000082 | 3300025315 | Bacteria | 41919 |
| 433 | Ga0207697_10041776 | 3300025315 | Bacteria | 1883 |
| 434 | Ga0207697_10070286 | 3300025315 | Bacteria | 1466 |
| 435 | Ga0207656_10002169 | 3300025321 | Bacteria | 6561 |
| 436 | Ga0207656_10024729 | 3300025321 | Unclassified | 2432 |
| 437 | Ga0207642_10232549 | 3300025899 | Bacteria | 1036 |
| 438 | Ga0207710_10099888 | 3300025900 | Bacteria | 1367 |
| 439 | Ga0207688_10026523 | 3300025901 | Bacteria | 3187 |
| 440 | Ga0207688_10250549 | 3300025901 | Bacteria | 1073 |
| 441 | Ga0207680_10002046 | 3300025903 | Bacteria | 9452 |
| 442 | Ga0207680_10045712 | 3300025903 | Bacteria | 2583 |
| 443 | Ga0207680_10097002 | 3300025903 | Bacteria | 1887 |
| 444 | Ga0207680_10145911 | 3300025903 | Unclassified | 1573 |
| 445 | Ga0207680_10247598 | 3300025903 | Bacteria | 1230 |
| 446 | Ga0207680_10396140 | 3300025903 | Bacteria | 975 |
| 447 | Ga0207680_10556008 | 3300025903 | Unclassified | 819 |
| 448 | Ga0207647_10000259 | 3300025904 | Bacteria | 43433 |
| 449 | Ga0207647_10001197 | 3300025904 | Bacteria | 19985 |
| 450 | Ga0207647_10003110 | 3300025904 | Bacteria | 12463 |
| 451 | Ga0207647_10005894 | 3300025904 | Bacteria | 8932 |
| 452 | Ga0207647_10007004 | 3300025904 | Bacteria | 8177 |
| 453 | Ga0207647_10024446 | 3300025904 | Bacteria | 3983 |
| 454 | Ga0207647_10041888 | 3300025904 | Bacteria | 2876 |
| 455 | Ga0207647_10077080 | 3300025904 | Bacteria | 2004 |
| 456 | Ga0207647_10092200 | 3300025904 | Bacteria | 1806 |
| 457 | Ga0207699_10371708 | 3300025906 | Unclassified | 1013 |
| 458 | Ga0207699_10423581 | 3300025906 | Unclassified | 951 |
| 459 | Ga0207645_10121125 | 3300025907 | Bacteria | 1698 |
| 460 | Ga0207645_10123540 | 3300025907 | Bacteria | 1682 |
| 461 | Ga0207645_10155625 | 3300025907 | Unclassified | 1493 |
| 462 | Ga0207705_10000086 | 3300025909 | Bacteria | 116132 |
| 463 | Ga0207705_10000123 | 3300025909 | Bacteria | 85382 |
| 464 | Ga0207705_10001490 | 3300025909 | Bacteria | 18620 |
| 465 | Ga0207705_10003112 | 3300025909 | Bacteria | 12660 |
| 466 | Ga0207705_10005892 | 3300025909 | Bacteria | 9112 |
| 467 | Ga0207705_10097794 | 3300025909 | Unclassified | 2156 |
| 468 | Ga0207705_10193140 | 3300025909 | Bacteria | 1540 |
| 469 | Ga0207654_10043613 | 3300025911 | Unclassified | 2543 |
| 470 | Ga0207654_10093829 | 3300025911 | Bacteria | 1836 |
| 471 | Ga0207707_10224089 | 3300025912 | Bacteria | 1636 |
| 472 | Ga0207707_10301106 | 3300025912 | Bacteria | 1386 |
| 473 | Ga0207707_10479375 | 3300025912 | Unclassified | 1063 |
| 474 | Ga0207695_10031219 | 3300025913 | Bacteria | 5848 |
| 475 | Ga0207695_10032631 | 3300025913 | Bacteria | 5696 |
| 476 | Ga0207695_10143752 | 3300025913 | Bacteria | 2332 |
| 477 | Ga0207695_10292690 | 3300025913 | Unclassified | 1520 |
| 478 | Ga0207695_10634306 | 3300025913 | Bacteria | 950 |
| 479 | Ga0207671_10650081 | 3300025914 | Unclassified | 840 |
| 480 | Ga0207693_10031706 | 3300025915 | Bacteria | 4176 |
| 481 | Ga0207693_10037725 | 3300025915 | Bacteria | 3808 |
| 482 | Ga0207660_10009248 | 3300025917 | Bacteria | 6377 |
| 483 | Ga0207660_10237437 | 3300025917 | Bacteria | 1435 |
| 484 | Ga0207660_10456874 | 3300025917 | Bacteria | 1033 |
| 485 | Ga0207660_10493087 | 3300025917 | Bacteria | 993 |
| 486 | Ga0207660_10592670 | 3300025917 | Bacteria | 903 |
| 487 | Ga0207662_10017339 | 3300025918 | Bacteria | 4072 |
| 488 | Ga0207657_10000133 | 3300025919 | Bacteria | 75282 |
| 489 | Ga0207657_10000650 | 3300025919 | Bacteria | 36973 |
| 490 | Ga0207657_10004090 | 3300025919 | Bacteria | 15484 |
| 491 | Ga0207657_10007346 | 3300025919 | Bacteria | 11302 |
| 492 | Ga0207657_10009514 | 3300025919 | Bacteria | 9759 |
| 493 | Ga0207657_10013116 | 3300025919 | Bacteria | 8140 |
| 494 | Ga0207657_10027070 | 3300025919 | Bacteria | 5256 |
| 495 | Ga0207657_10061211 | 3300025919 | Bacteria | 3229 |
| 496 | Ga0207657_10093535 | 3300025919 | Archaea | 2504 |
| 497 | Ga0207657_10335891 | 3300025919 | Bacteria | 1193 |
| 498 | Ga0207649_10000629 | 3300025920 | Bacteria | 23631 |
| 499 | Ga0207649_10005572 | 3300025920 | Bacteria | 6809 |
| 500 | Ga0207649_10036909 | 3300025920 | Bacteria | 2947 |
| 501 | Ga0207649_10039258 | 3300025920 | Bacteria | 2869 |
| 502 | Ga0207649_10120259 | 3300025920 | Bacteria | 1770 |
| 503 | Ga0207649_10149880 | 3300025920 | Bacteria | 1605 |
| 504 | Ga0207649_10175924 | 3300025920 | Unclassified | 1494 |
| 505 | Ga0207649_10294147 | 3300025920 | Bacteria | 1185 |
| 506 | Ga0207649_10415782 | 3300025920 | Bacteria | 1009 |
| 507 | Ga0207652_10000034 | 3300025921 | Bacteria | 138571 |
| 508 | Ga0207652_10179818 | 3300025921 | Bacteria | 1900 |
| 509 | Ga0207652_10256856 | 3300025921 | Bacteria | 1576 |
| 510 | Ga0207652_10288668 | 3300025921 | Bacteria | 1480 |
| 511 | Ga0207681_10044987 | 3300025923 | Bacteria | 2961 |
| 512 | Ga0207681_10059294 | 3300025923 | Bacteria | 2624 |
| 513 | Ga0207681_10079048 | 3300025923 | Bacteria | 2316 |
| 514 | Ga0207681_10299821 | 3300025923 | Unclassified | 1271 |
| 515 | Ga0207681_10509429 | 3300025923 | Bacteria | 986 |
| 516 | Ga0207694_10023725 | 3300025924 | Bacteria | 4658 |
| 517 | Ga0207694_10040576 | 3300025924 | Bacteria | 3584 |
| 518 | Ga0207694_10400242 | 3300025924 | Bacteria | 1141 |
| 519 | Ga0207650_10004067 | 3300025925 | Bacteria | 9999 |
| 520 | Ga0207650_10013303 | 3300025925 | Bacteria | 5695 |
| 521 | Ga0207650_10013753 | 3300025925 | Bacteria | 5612 |
| 522 | Ga0207650_10039279 | 3300025925 | Plasmid | 3459 |
| 523 | Ga0207650_10197287 | 3300025925 | Bacteria | 1611 |
| 524 | Ga0207650_10725893 | 3300025925 | Bacteria | 840 |
| 525 | Ga0207659_10012771 | 3300025926 | Bacteria | 5362 |
| 526 | Ga0207659_10125053 | 3300025926 | Bacteria | 1976 |
| 527 | Ga0207659_10159746 | 3300025926 | Unclassified | 1768 |
| 528 | Ga0207659_10200238 | 3300025926 | Bacteria | 1594 |
| 529 | Ga0207659_10866155 | 3300025926 | Bacteria | 777 |
| 530 | Ga0207700_10067184 | 3300025928 | Bacteria | 2743 |
| 531 | Ga0207700_10112019 | 3300025928 | Bacteria | 2197 |
| 532 | Ga0207700_10138985 | 3300025928 | Bacteria | 1993 |
| 533 | Ga0207664_10039323 | 3300025929 | Bacteria | 3673 |
| 534 | Ga0207664_10075955 | 3300025929 | Bacteria | 2718 |
| 535 | Ga0207644_10002376 | 3300025931 | Bacteria | 12147 |
| 536 | Ga0207644_10023452 | 3300025931 | Bacteria | 4226 |
| 537 | Ga0207644_10210635 | 3300025931 | Bacteria | 1536 |
| 538 | Ga0207690_10000265 | 3300025932 | Bacteria | 37601 |
| 539 | Ga0207690_10005349 | 3300025932 | Bacteria | 7566 |
| 540 | Ga0207690_10007225 | 3300025932 | Bacteria | 6597 |
| 541 | Ga0207690_10011308 | 3300025932 | Bacteria | 5334 |
| 542 | Ga0207690_10019258 | 3300025932 | Bacteria | 4199 |
| 543 | Ga0207690_10027521 | 3300025932 | Bacteria | 3593 |
| 544 | Ga0207690_10027765 | 3300025932 | Bacteria | 3579 |
| 545 | Ga0207690_10030169 | 3300025932 | Bacteria | 3456 |
| 546 | Ga0207690_10034448 | 3300025932 | Unclassified | 3263 |
| 547 | Ga0207690_10137253 | 3300025932 | Unclassified | 1797 |
| 548 | Ga0207690_10169200 | 3300025932 | Unclassified | 1636 |
| 549 | Ga0207690_10387202 | 3300025932 | Bacteria | 1112 |
| 550 | Ga0207706_10000159 | 3300025933 | Bacteria | 75284 |
| 551 | Ga0207706_10001125 | 3300025933 | Bacteria | 27208 |
| 552 | Ga0207706_10010750 | 3300025933 | Bacteria | 8356 |
| 553 | Ga0207706_10015205 | 3300025933 | Bacteria | 6965 |
| 554 | Ga0207706_10033985 | 3300025933 | Bacteria | 4538 |
| 555 | Ga0207706_10065654 | 3300025933 | Bacteria | 3195 |
| 556 | Ga0207706_10125524 | 3300025933 | Bacteria | 2257 |
| 557 | Ga0207706_10434245 | 3300025933 | Unclassified | 1137 |
| 558 | Ga0207686_10112449 | 3300025934 | Unclassified | 1839 |
| 559 | Ga0207709_10075159 | 3300025935 | Unclassified | 2159 |
| 560 | Ga0207709_10167607 | 3300025935 | Bacteria | 1538 |
| 561 | Ga0207670_10459076 | 3300025936 | Bacteria | 1028 |
| 562 | Ga0207670_10468249 | 3300025936 | Unclassified | 1018 |
| 563 | Ga0207669_10039379 | 3300025937 | Bacteria | 2731 |
| 564 | Ga0207704_10019649 | 3300025938 | Bacteria | 3553 |
| 565 | Ga0207691_10002508 | 3300025940 | Bacteria | 17963 |
| 566 | Ga0207691_10017486 | 3300025940 | Bacteria | 6798 |
| 567 | Ga0207691_10048595 | 3300025940 | Unclassified | 3889 |
| 568 | Ga0207691_10091393 | 3300025940 | Bacteria | 2727 |
| 569 | Ga0207691_10124016 | 3300025940 | Bacteria | 2287 |
| 570 | Ga0207691_10397325 | 3300025940 | Bacteria | 1176 |
| 571 | Ga0207711_10000914 | 3300025941 | Bacteria | 28418 |
| 572 | Ga0207711_10016576 | 3300025941 | Bacteria | 6118 |
| 573 | Ga0207711_10198186 | 3300025941 | Bacteria | 1832 |
| 574 | Ga0207711_10226069 | 3300025941 | Unclassified | 1713 |
| 575 | Ga0207711_10530609 | 3300025941 | Bacteria | 1098 |
| 576 | Ga0207711_10876412 | 3300025941 | Bacteria | 835 |
| 577 | Ga0207689_10000561 | 3300025942 | Bacteria | 35545 |
| 578 | Ga0207689_10012090 | 3300025942 | Bacteria | 7392 |
| 579 | Ga0207689_10014133 | 3300025942 | Bacteria | 6794 |
| 580 | Ga0207661_10002539 | 3300025944 | Bacteria | 12565 |
| 581 | Ga0207661_10003613 | 3300025944 | Bacteria | 10762 |
| 582 | Ga0207661_10004214 | 3300025944 | Bacteria | 10061 |
| 583 | Ga0207679_10000321 | 3300025945 | Bacteria | 35822 |
| 584 | Ga0207679_10004415 | 3300025945 | Bacteria | 8759 |
| 585 | Ga0207679_10004860 | 3300025945 | Bacteria | 8380 |
| 586 | Ga0207679_10034202 | 3300025945 | Bacteria | 3583 |
| 587 | Ga0207679_10050807 | 3300025945 | Bacteria | 3032 |
| 588 | Ga0207679_10091640 | 3300025945 | Bacteria | 2352 |
| 589 | Ga0207679_10105411 | 3300025945 | Unclassified | 2214 |
| 590 | Ga0207679_10152575 | 3300025945 | Unclassified | 1882 |
| 591 | Ga0207679_10222062 | 3300025945 | Bacteria | 1590 |
| 592 | Ga0207667_10008316 | 3300025949 | Bacteria | 12344 |
| 593 | Ga0207667_10011837 | 3300025949 | Bacteria | 10104 |
| 594 | Ga0207667_10018472 | 3300025949 | Bacteria | 7818 |
| 595 | Ga0207667_10019245 | 3300025949 | Bacteria | 7632 |
| 596 | Ga0207667_10031787 | 3300025949 | Bacteria | 5695 |
| 597 | Ga0207667_10050596 | 3300025949 | Bacteria | 4383 |
| 598 | Ga0207667_10143974 | 3300025949 | Bacteria | 2454 |
| 599 | Ga0207667_10182548 | 3300025949 | Bacteria | 2154 |
| 600 | Ga0207667_10285351 | 3300025949 | Bacteria | 1687 |
| 601 | Ga0207667_10485026 | 3300025949 | Unclassified | 1254 |
| 602 | Ga0207667_10567793 | 3300025949 | Bacteria | 1146 |
| 603 | Ga0207667_11115720 | 3300025949 | Bacteria | 771 |
| 604 | Ga0207651_10001237 | 3300025960 | Bacteria | 11474 |
| 605 | Ga0207651_10061400 | 3300025960 | Bacteria | 2614 |
| 606 | Ga0207651_10114671 | 3300025960 | Bacteria | 2030 |
| 607 | Ga0207651_10480220 | 3300025960 | Bacteria | 1071 |
| 608 | Ga0207712_10001096 | 3300025961 | Bacteria | 18922 |
| 609 | Ga0207712_10002871 | 3300025961 | Bacteria | 11020 |
| 610 | Ga0207712_10030262 | 3300025961 | Bacteria | 3638 |
| 611 | Ga0207712_10307544 | 3300025961 | Bacteria | 1303 |
| 612 | Ga0207668_10006655 | 3300025972 | Bacteria | 6835 |
| 613 | Ga0207668_10215233 | 3300025972 | Bacteria | 1539 |
| 614 | Ga0207668_10749156 | 3300025972 | Bacteria | 862 |
| 615 | Ga0207640_10000788 | 3300025981 | Bacteria | 18019 |
| 616 | Ga0207640_10001178 | 3300025981 | Bacteria | 14315 |
| 617 | Ga0207640_10001594 | 3300025981 | Bacteria | 12188 |
| 618 | Ga0207640_10020554 | 3300025981 | Bacteria | 3921 |
| 619 | Ga0207640_10021671 | 3300025981 | Bacteria | 3833 |
| 620 | Ga0207640_10072761 | 3300025981 | Bacteria | 2320 |
| 621 | Ga0207640_10329837 | 3300025981 | Unclassified | 1218 |
| 622 | Ga0207640_10448839 | 3300025981 | Bacteria | 1062 |
| 623 | Ga0207640_10648202 | 3300025981 | Bacteria | 900 |
| 624 | Ga0207640_10760349 | 3300025981 | Bacteria | 836 |
| 625 | Ga0207658_10012396 | 3300025986 | Bacteria | 5823 |
| 626 | Ga0207658_10014851 | 3300025986 | Bacteria | 5336 |
| 627 | Ga0207658_10070034 | 3300025986 | Unclassified | 2652 |
| 628 | Ga0207658_10077914 | 3300025986 | Bacteria | 2531 |
| 629 | Ga0207658_10279557 | 3300025986 | Bacteria | 1430 |
| 630 | Ga0207658_10336990 | 3300025986 | Bacteria | 1310 |
| 631 | Ga0207658_10722577 | 3300025986 | Bacteria | 901 |
| 632 | Ga0207677_10014000 | 3300026023 | Bacteria | 4668 |
| 633 | Ga0207677_10156709 | 3300026023 | Bacteria | 1764 |
| 634 | Ga0207677_10260576 | 3300026023 | Bacteria | 1413 |
| 635 | Ga0207703_10005442 | 3300026035 | Bacteria | 10250 |
| 636 | Ga0207703_10013406 | 3300026035 | Bacteria | 6388 |
| 637 | Ga0207703_10148060 | 3300026035 | Bacteria | 2044 |
| 638 | Ga0207703_10179806 | 3300026035 | Bacteria | 1866 |
| 639 | Ga0207703_10268712 | 3300026035 | Bacteria | 1544 |
| 640 | Ga0207639_10000137 | 3300026041 | Bacteria | 54378 |
| 641 | Ga0207639_10010459 | 3300026041 | Bacteria | 6428 |
| 642 | Ga0207639_10022416 | 3300026041 | Bacteria | 4549 |
| 643 | Ga0207639_10025397 | 3300026041 | Bacteria | 4295 |
| 644 | Ga0207639_10105871 | 3300026041 | Bacteria | 2282 |
| 645 | Ga0207639_10167788 | 3300026041 | Archaea | 1856 |
| 646 | Ga0207639_10584797 | 3300026041 | Bacteria | 1028 |
| 647 | Ga0207678_10000530 | 3300026067 | Bacteria | 34763 |
| 648 | Ga0207678_10004220 | 3300026067 | Bacteria | 12888 |
| 649 | Ga0207678_10004502 | 3300026067 | Bacteria | 12525 |
| 650 | Ga0207678_10019805 | 3300026067 | Bacteria | 5917 |
| 651 | Ga0207678_10035181 | 3300026067 | Bacteria | 4361 |
| 652 | Ga0207678_10102494 | 3300026067 | Unclassified | 2443 |
| 653 | Ga0207678_10125516 | 3300026067 | Bacteria | 2189 |
| 654 | Ga0207678_10435364 | 3300026067 | Bacteria | 1138 |
| 655 | Ga0207678_10435673 | 3300026067 | Unclassified | 1138 |
| 656 | Ga0207708_10159989 | 3300026075 | Bacteria | 1778 |
| 657 | Ga0207708_10366312 | 3300026075 | Bacteria | 1185 |
| 658 | Ga0207702_10002212 | 3300026078 | Bacteria | 18638 |
| 659 | Ga0207702_10005348 | 3300026078 | Bacteria | 11256 |
| 660 | Ga0207702_10014217 | 3300026078 | Bacteria | 6611 |
| 661 | Ga0207702_10025220 | 3300026078 | Bacteria | 4933 |
| 662 | Ga0207702_10054567 | 3300026078 | Bacteria | 3387 |
| 663 | Ga0207702_10068484 | 3300026078 | Bacteria | 3049 |
| 664 | Ga0207702_10095930 | 3300026078 | Bacteria | 2607 |
| 665 | Ga0207702_10115257 | 3300026078 | Bacteria | 2396 |
| 666 | Ga0207641_10010994 | 3300026088 | Bacteria | 7421 |
| 667 | Ga0207641_10035574 | 3300026088 | Bacteria | 4150 |
| 668 | Ga0207641_10041216 | 3300026088 | Bacteria | 3869 |
| 669 | Ga0207641_10048376 | 3300026088 | Bacteria | 3589 |
| 670 | Ga0207641_10053253 | 3300026088 | Unclassified | 3429 |
| 671 | Ga0207641_10202650 | 3300026088 | Bacteria | 1830 |
| 672 | Ga0207641_10336430 | 3300026088 | Unclassified | 1435 |
| 673 | Ga0207648_10007119 | 3300026089 | Bacteria | 11033 |
| 674 | Ga0207648_10018823 | 3300026089 | Bacteria | 6242 |
| 675 | Ga0207648_10044397 | 3300026089 | Bacteria | 3899 |
| 676 | Ga0207676_10005455 | 3300026095 | Bacteria | 9002 |
| 677 | Ga0207676_10031712 | 3300026095 | Bacteria | 3976 |
| 678 | Ga0207676_10044425 | 3300026095 | Bacteria | 3428 |
| 679 | Ga0207676_10067865 | 3300026095 | Bacteria | 2850 |
| 680 | Ga0207676_10099267 | 3300026095 | Bacteria | 2409 |
| 681 | Ga0207676_10215112 | 3300026095 | Unclassified | 1708 |
| 682 | Ga0207676_10216504 | 3300026095 | Bacteria | 1703 |
| 683 | Ga0207676_10227979 | 3300026095 | Bacteria | 1664 |
| 684 | Ga0207674_10002685 | 3300026116 | Bacteria | 22206 |
| 685 | Ga0207674_10003442 | 3300026116 | Bacteria | 19365 |
| 686 | Ga0207674_10004250 | 3300026116 | Bacteria | 17276 |
| 687 | Ga0207674_10008633 | 3300026116 | Bacteria | 11740 |
| 688 | Ga0207674_10009133 | 3300026116 | Bacteria | 11375 |
| 689 | Ga0207674_10021572 | 3300026116 | Bacteria | 6934 |
| 690 | Ga0207674_10032449 | 3300026116 | Bacteria | 5478 |
| 691 | Ga0207674_10050377 | 3300026116 | Bacteria | 4254 |
| 692 | Ga0207674_10076134 | 3300026116 | Bacteria | 3364 |
| 693 | Ga0207674_10133998 | 3300026116 | Unclassified | 2440 |
| 694 | Ga0207674_10198690 | 3300026116 | Unclassified | 1955 |
| 695 | Ga0207674_10530885 | 3300026116 | Bacteria | 1137 |
| 696 | Ga0207675_100095478 | 3300026118 | Bacteria | 2797 |
| 697 | Ga0207675_100149547 | 3300026118 | Bacteria | 2222 |
| 698 | Ga0207675_100201396 | 3300026118 | Bacteria | 1912 |
| 699 | Ga0207675_100285167 | 3300026118 | Unclassified | 1605 |
| 700 | Ga0207683_10007475 | 3300026121 | Bacteria | 9374 |
| 701 | Ga0207683_10042173 | 3300026121 | Bacteria | 3985 |
| 702 | Ga0207683_10299257 | 3300026121 | Unclassified | 1472 |
| 703 | Ga0207698_10000443 | 3300026142 | Bacteria | 23827 |
| 704 | Ga0207698_10023009 | 3300026142 | Bacteria | 4346 |
| 705 | Ga0207698_10029189 | 3300026142 | Bacteria | 3945 |
| 706 | Ga0207698_10052923 | 3300026142 | Bacteria | 3113 |
| 707 | Ga0207698_10057009 | 3300026142 | Bacteria | 3019 |
| 708 | Ga0207698_10646483 | 3300026142 | Bacteria | 1047 |
| 709 | Ga0207698_11207869 | 3300026142 | Unclassified | 770 |
| 710 | Ga0209974_10010444 | 3300027876 | Bacteria | 3133 |
| 711 | Ga0268266_10000458 | 3300028379 | Bacteria | 59553 |
| 712 | Ga0268266_10004939 | 3300028379 | Bacteria | 12634 |
| 713 | Ga0268266_10031622 | 3300028379 | Bacteria | 4495 |
| 714 | Ga0268266_10039609 | 3300028379 | Bacteria | 4014 |
| 715 | Ga0268266_10569847 | 3300028379 | Bacteria | 1086 |
| 716 | Ga0268266_10612069 | 3300028379 | Bacteria | 1047 |
| 717 | Ga0268265_10016311 | 3300028380 | Bacteria | 5100 |
| 718 | Ga0268265_10018988 | 3300028380 | Bacteria | 4774 |
| 719 | Ga0268265_10019122 | 3300028380 | Unclassified | 4755 |
| 720 | Ga0268265_10199531 | 3300028380 | Bacteria | 1735 |
| 721 | Ga0268265_11360642 | 3300028380 | Unclassified | 711 |
| 722 | Ga0268264_10002566 | 3300028381 | Bacteria | 15920 |
| 723 | Ga0268264_10007507 | 3300028381 | Bacteria | 9098 |
| 724 | Ga0268264_10043634 | 3300028381 | Bacteria | 3717 |
| 725 | Ga0268264_10096086 | 3300028381 | Bacteria | 2565 |
| 726 | Ga0268264_10153245 | 3300028381 | Unclassified | 2069 |
| 727 | Ga0268264_10369726 | 3300028381 | Bacteria | 1370 |
| 728 | Ga0307516_10000034 | 3300031730 | Bacteria | 155251 |
| 729 | Ga0307405_10120063 | 3300031731 | Bacteria | 1797 |
| 730 | Ga0307413_10303659 | 3300031824 | Bacteria | 1211 |
| 731 | Ga0307410_10006140 | 3300031852 | Bacteria | 6447 |
| 732 | Ga0307410_10008279 | 3300031852 | Bacteria | 5758 |
| 733 | Ga0307410_10072657 | 3300031852 | Bacteria | 2389 |
| 734 | Ga0307406_10069102 | 3300031901 | Bacteria | 2308 |
| 735 | Ga0307407_10003352 | 3300031903 | Bacteria | 6551 |
| 736 | Ga0307412_10026888 | 3300031911 | Bacteria | 3582 |
| 737 | Ga0307412_10278431 | 3300031911 | Bacteria | 1312 |
| 738 | Ga0307412_10371124 | 3300031911 | Bacteria | 1155 |
| 739 | Ga0307409_100238495 | 3300031995 | Bacteria | 1654 |
| 740 | Ga0307409_100841904 | 3300031995 | Unclassified | 927 |
| 741 | Ga0307416_100025110 | 3300032002 | Bacteria | 4363 |
| 742 | Ga0307416_100250908 | 3300032002 | Bacteria | 1722 |
| 743 | Ga0307414_10005643 | 3300032004 | Bacteria | 6906 |
| 744 | Ga0307414_10126883 | 3300032004 | Bacteria | 1973 |
| 745 | Ga0307414_10681570 | 3300032004 | Bacteria | 929 |
| 746 | Ga0307411_10003870 | 3300032005 | Bacteria | 7051 |
| 747 | Ga0307411_10037211 | 3300032005 | Bacteria | 3057 |
| 748 | Ga0307411_10158838 | 3300032005 | Bacteria | 1690 |
| 749 | Ga0307411_10766554 | 3300032005 | Unclassified | 846 |
| 750 | Ga0307415_100709819 | 3300032126 | Bacteria | 908 |
| 751 | Ga0373931_0136058 | 3300035691 | Bacteria | 1419 |
| 752 | Ga0373937_0414737 | 3300036401 | Unclassified | 1278 |
| 753 | Ga0395899_0005069 | 3300037312 | Bacteria | 10250 |
| 754 | Ga0395899_0040322 | 3300037312 | Bacteria | 3492 |
| 755 | Ga0395899_0044176 | 3300037312 | Bacteria | 3321 |
| 756 | Ga0395899_0072470 | 3300037312 | Bacteria | 2520 |
| 757 | Ga0395899_0153108 | 3300037312 | Bacteria | 1633 |
| 758 | Ga0395899_0294297 | 3300037312 | Bacteria | 1100 |
| 759 | Ga0395899_0321871 | 3300037312 | Bacteria | 1041 |
| 760 | Ga0395899_0470830 | 3300037312 | Unclassified | 819 |
| 761 | Ga0395900_0009541 | 3300037418 | Bacteria | 9950 |
| 762 | Ga0395900_0023793 | 3300037418 | Bacteria | 6267 |
| 763 | Ga0395900_0027680 | 3300037418 | Bacteria | 5806 |
| 764 | Ga0395900_0039979 | 3300037418 | Bacteria | 4833 |
| 765 | Ga0395900_0048315 | 3300037418 | Bacteria | 4383 |
| 766 | Ga0395900_0057853 | 3300037418 | Unclassified | 3991 |
| 767 | Ga0395900_0131059 | 3300037418 | Bacteria | 2569 |
| 768 | Ga0395900_0141799 | 3300037418 | Bacteria | 2460 |
| 769 | Ga0395900_0174337 | 3300037418 | Bacteria | 2188 |
| 770 | Ga0395900_0329344 | 3300037418 | Unclassified | 1505 |
| 771 | Ga0395900_0751515 | 3300037418 | Bacteria | 905 |
| 772 | Ga0395900_0993093 | 3300037418 | Bacteria | 759 |
| 773 | Ga0395898_0009377 | 3300037466 | Bacteria | 10281 |
| 774 | Ga0395898_0031990 | 3300037466 | Bacteria | 5252 |
| 775 | Ga0395898_0054987 | 3300037466 | Bacteria | 3883 |
| 776 | Ga0395898_0177987 | 3300037466 | Bacteria | 2032 |
| 777 | Ga0395898_0406293 | 3300037466 | Bacteria | 1298 |
| 778 | Ga0395898_0591212 | 3300037466 | Bacteria | 1052 |
| 779 | Ga0395905_0008355 | 3300037471 | Bacteria | 10211 |
| 780 | Ga0395905_0012839 | 3300037471 | Bacteria | 8051 |
| 781 | Ga0395905_0014010 | 3300037471 | Bacteria | 7669 |
| 782 | Ga0395905_0019482 | 3300037471 | Bacteria | 6431 |
| 783 | Ga0395905_0071910 | 3300037471 | Bacteria | 3242 |
| 784 | Ga0395905_0096505 | 3300037471 | Unclassified | 2775 |
| 785 | Ga0395905_0116205 | 3300037471 | Bacteria | 2514 |
| 786 | Ga0395905_0139764 | 3300037471 | Bacteria | 2279 |
| 787 | Ga0395905_0174149 | 3300037471 | Bacteria | 2020 |
| 788 | Ga0395905_0226442 | 3300037471 | Unclassified | 1749 |
| 789 | Ga0395905_0309355 | 3300037471 | Bacteria | 1468 |
| 790 | Ga0395905_0565623 | 3300037471 | Bacteria | 1038 |
| 791 | Ga0395901_0008267 | 3300038443 | Bacteria | 10510 |
| 792 | Ga0395901_0014740 | 3300038443 | Bacteria | 7946 |
| 793 | Ga0395901_0017022 | 3300038443 | Bacteria | 7408 |
| 794 | Ga0395901_0020134 | 3300038443 | Bacteria | 6827 |
| 795 | Ga0395901_0023308 | 3300038443 | Bacteria | 6344 |
| 796 | Ga0395901_0060208 | 3300038443 | Bacteria | 3951 |
| 797 | Ga0395901_0061862 | 3300038443 | Bacteria | 3895 |
| 798 | Ga0395901_0167628 | 3300038443 | Unclassified | 2305 |
| 799 | Ga0395901_0185106 | 3300038443 | Bacteria | 2184 |
| 800 | Ga0395901_0214642 | 3300038443 | Bacteria | 2012 |
| 801 | Ga0395901_0495231 | 3300038443 | Bacteria | 1245 |
| 802 | Ga0395901_1179432 | 3300038443 | Unclassified | 732 |
| 803 | Ga0436361_1061929 | 3300039447 | Unclassified | 1108 |
| 804 | Ga0439432_027031 | 3300042006 | Bacteria | 1876 |
| 805 | Ga0439449_0028910 | 3300042007 | Bacteria | 2066 |
| 806 | Ga0466969_0097709 | 3300044656 | Bacteria | 1385 |
| 807 | Ga0466969_0147356 | 3300044656 | Bacteria | 1086 |
| 808 | Ga0466972_0145361 | 3300044658 | Bacteria | 1116 |
| 809 | Ga0466972_0297566 | 3300044658 | Unclassified | 754 |
| 810 | Ga0466965_0241139 | 3300044683 | Bacteria | 968 |
| 811 | Ga0466966_0009469 | 3300044684 | Bacteria | 6453 |
| 812 | Ga0466961_0020554 | 3300044693 | Bacteria | 4248 |
| 813 | Ga0466961_0087329 | 3300044693 | Bacteria | 1971 |
| 814 | Ga0466961_0106654 | 3300044693 | Bacteria | 1763 |
| 815 | Ga0466961_0275410 | 3300044693 | Bacteria | 1030 |
| 816 | Ga0466963_0005307 | 3300044694 | Bacteria | 7531 |
| 817 | Ga0466963_0079548 | 3300044694 | Bacteria | 2218 |
| 818 | Ga0466963_0087170 | 3300044694 | Bacteria | 2122 |
| 819 | Ga0466963_0176344 | 3300044694 | Bacteria | 1491 |
| 820 | Ga0466971_0001211 | 3300044719 | Bacteria | 10728 |
| 821 | Ga0466971_0022472 | 3300044719 | Bacteria | 2810 |
| 822 | Ga0466971_0354625 | 3300044719 | Bacteria | 710 |
| 823 | Ga0466970_0051450 | 3300044765 | Bacteria | 2198 |
| 824 | Ga0466970_0138916 | 3300044765 | Bacteria | 1338 |
| 825 | Ga0466970_0331530 | 3300044765 | Bacteria | 861 |
| 826 | Ga0466957_0002399 | 3300044842 | Bacteria | 10056 |
| 827 | Ga0466957_0184671 | 3300044842 | Bacteria | 1363 |
| 828 | Ga0466957_0313671 | 3300044842 | Bacteria | 1056 |
| 829 | Ga0466959_0034632 | 3300045049 | Bacteria | 3736 |
| 830 | Ga0466959_0252933 | 3300045049 | Bacteria | 1215 |
| 831 | Ga0466959_0655970 | 3300045049 | Bacteria | 704 |
| 832 | Ga0466958_0009813 | 3300045836 | Bacteria | 5342 |
| 833 | Ga0466958_0052869 | 3300045836 | Bacteria | 2463 |
| 834 | Ga0466958_0054461 | 3300045836 | Bacteria | 2426 |
| 835 | Ga0466958_0063042 | 3300045836 | Bacteria | 2260 |
| 836 | Ga0466958_0084009 | 3300045836 | Bacteria | 1963 |
| 837 | Ga0466958_0116092 | 3300045836 | Bacteria | 1673 |
| 838 | Ga0466958_0176799 | 3300045836 | Bacteria | 1353 |
| 839 | Ga0466967_0052424 | 3300045976 | Bacteria | 3580 |
| 840 | Ga0466967_0257609 | 3300045976 | Bacteria | 1668 |
| 841 | Ga0466967_0322807 | 3300045976 | Bacteria | 1489 |
| 842 | Ga0466967_0389541 | 3300045976 | Bacteria | 1354 |
| 843 | Ga0466967_1035638 | 3300045976 | Archaea | 817 |
| 844 | Ga0495663_0005710 | 3300046525 | Bacteria | 3446 |
| 845 | Ga0495663_0022592 | 3300046525 | Unclassified | 1818 |
| 846 | Ga0495663_0024465 | 3300046525 | Bacteria | 1756 |
| 847 | Ga0495598_0003569 | 3300046537 | Bacteria | 3317 |
| 848 | Ga0495598_0065361 | 3300046537 | Bacteria | 1132 |
| 849 | Ga0495621_0006280 | 3300046539 | Bacteria | 3459 |
| 850 | Ga0495621_0013166 | 3300046539 | Bacteria | 2594 |
| 851 | Ga0495661_0034543 | 3300046665 | Bacteria | 3181 |
| 852 | Ga0495669_0000854 | 3300046684 | Bacteria | 12893 |
| 853 | Ga0495669_0002396 | 3300046684 | Bacteria | 7693 |
| 854 | Ga0495669_0009878 | 3300046684 | Unclassified | 4033 |
| 855 | Ga0495669_0058298 | 3300046684 | Bacteria | 1742 |
| 856 | Ga0495670_0044687 | 3300046691 | Bacteria | 2211 |
| 857 | Ga0495681_0040590 | 3300047470 | Bacteria | 2265 |
| 858 | Ga0495626_0080692 | 3300048091 | Bacteria | 1446 |
| 859 | Ga0496100_0387020 | 3300048903 | Bacteria | 1063 |
| 860 | Ga0496101_0104913 | 3300048904 | Bacteria | 2120 |
| 861 | Ga0496102_0042910 | 3300048905 | Bacteria | 4099 |
| 862 | Ga0496103_0016347 | 3300048906 | Bacteria | 4428 |
| 863 | Ga0496103_0476318 | 3300048906 | Bacteria | 800 |
| 864 | Ga0496106_0064316 | 3300048909 | Unclassified | 2790 |
| 865 | Ga0496107_0033903 | 3300048910 | Unclassified | 3654 |
| 866 | Ga0496107_0084381 | 3300048910 | Bacteria | 2318 |
| 867 | Ga0496107_0146455 | 3300048910 | Bacteria | 1746 |
| 868 | Ga0496108_0018888 | 3300048911 | Bacteria | 5652 |
| 869 | Ga0496108_0895572 | 3300048911 | Bacteria | 762 |
| 870 | Ga0496109_0006273 | 3300048912 | Bacteria | 10003 |
| 871 | Ga0496109_0044431 | 3300048912 | Bacteria | 4031 |
| 872 | Ga0496109_0142424 | 3300048912 | Bacteria | 2242 |
| 873 | Ga0496109_0642144 | 3300048912 | Bacteria | 998 |
| 874 | Ga0496110_0003604 | 3300048913 | Bacteria | 11911 |
| 875 | Ga0496110_0004039 | 3300048913 | Bacteria | 11323 |
| 876 | Ga0496110_0373279 | 3300048913 | Bacteria | 1300 |
| 877 | Ga0496111_0000244 | 3300048914 | Bacteria | 26061 |
| 878 | Ga0496111_0205274 | 3300048914 | Unclassified | 1464 |
| 879 | Ga0496112_0019061 | 3300048915 | Bacteria | 6467 |
| 880 | Ga0496113_0000515 | 3300048916 | Bacteria | 19121 |
| 881 | Ga0496113_0359648 | 3300048916 | Bacteria | 1168 |
| 882 | Ga0496114_0030559 | 3300048917 | Bacteria | 4433 |
| 883 | Ga0496121_0000061 | 3300048924 | Bacteria | 275757 |
| 884 | Ga0501067_0163403 | 3300049583 | Bacteria | 1240 |
| 885 | Ga0501249_040130 | 3300049679 | Bacteria | 1060 |
| 886 | nmdc:mga09592_913833_c1 | 3300050508 | Bacteria | 737 |
| 887 | nmdc:mga08y16_1456771_c1 | 3300050511 | Bacteria | 646 |
| 888 | nmdc:mga0n895_568992_c1 | 3300050512 | Bacteria | 1138 |
| 889 | nmdc:mga0a205_10273_c1 | 3300050515 | Bacteria | 8600 |
| 890 | nmdc:mga0a205_4191_c1 | 3300050515 | Bacteria | 12927 |
| 891 | Ga0495655_0004664 | 3300053083 | Bacteria | 2365 |
| 892 | Ga0500627_0031294 | 3300053158 | Bacteria | 2234 |
| 893 | Ga0466962_0008758 | 3300061719 | Bacteria | 4850 |
| 894 | Ga0466962_0119706 | 3300061719 | Unclassified | 1270 |
| 895 | Ga0466962_0208054 | 3300061719 | Unclassified | 957 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005441 | Ga0070700_100110298 | Ga0070700_1001102982 | 165 |
| 2 | 3300013306 | Ga0163162_10369061 | Ga0163162_103690611 | 172 |
| 3 | 3300013308 | Ga0157375_10225531 | Ga0157375_102255312 | 172 |
| 4 | 3300014968 | Ga0157379_10106465 | Ga0157379_101064652 | 172 |
| 5 | 3300049679 | Ga0501249_040130 | Ga0501249_040130_377_901 | 174 |
| 6 | 3300013104 | Ga0157370_10015668 | Ga0157370_100156682 | 175 |
| 7 | 3300013105 | Ga0157369_10495755 | Ga0157369_104957552 | 175 |
| 8 | 3300013307 | Ga0157372_10504214 | Ga0157372_105042142 | 175 |
| 9 | 3300031730 | Ga0307516_10000034 | Ga0307516_10000034104 | 175 |
| 10 | 3300037312 | Ga0395899_0005069 | Ga0395899_0005069_6192_6719 | 175 |
| 11 | 3300037312 | Ga0395899_0072470 | Ga0395899_0072470_1677_2204 | 175 |
| 12 | 3300037418 | Ga0395900_0009541 | Ga0395900_0009541_3531_4058 | 175 |
| 13 | 3300037418 | Ga0395900_0027680 | Ga0395900_0027680_1899_2426 | 175 |
| 14 | 3300037466 | Ga0395898_0009377 | Ga0395898_0009377_7048_7575 | 175 |
| 15 | 3300037466 | Ga0395898_0031990 | Ga0395898_0031990_2931_3458 | 175 |
| 16 | 3300037471 | Ga0395905_0008355 | Ga0395905_0008355_5500_6027 | 175 |
| 17 | 3300037471 | Ga0395905_0071910 | Ga0395905_0071910_734_1261 | 175 |
| 18 | 3300038443 | Ga0395901_0008267 | Ga0395901_0008267_7277_7804 | 175 |
| 19 | 3300038443 | Ga0395901_0014740 | Ga0395901_0014740_4967_5494 | 175 |
| 20 | 3300045976 | Ga0466967_1035638 | Ga0466967_1035638_139_684 | 175 |
| 21 | 3300037312 | Ga0395899_0153108 | Ga0395899_0153108_62_595 | 177 |
| 22 | 3300013104 | Ga0157370_10000497 | Ga0157370_1000049726 | 180 |
| 23 | 3300013306 | Ga0163162_10791586 | Ga0163162_107915862 | 180 |
| 24 | 3300044765 | Ga0466970_0051450 | Ga0466970_0051450_371_913 | 180 |
| 25 | 3300013105 | Ga0157369_10260148 | Ga0157369_102601481 | 181 |
| 26 | 3300037471 | Ga0395905_0226442 | Ga0395905_0226442_529_1074 | 181 |
| 27 | 3300050508 | nmdc:mga09592_913833_c1 | nmdc:mga09592_913833_c1_94_669 | 181 |
| 28 | 3300005577 | Ga0068857_100361838 | Ga0068857_1003618382 | 185 |
| 29 | 3300005614 | Ga0068856_100106345 | Ga0068856_1001063452 | 185 |
| 30 | 3300025904 | Ga0207647_10092200 | Ga0207647_100922002 | 185 |
| 31 | 3300026078 | Ga0207702_10095930 | Ga0207702_100959301 | 185 |
| 32 | 3300044683 | Ga0466965_0241139 | Ga0466965_0241139_217_774 | 185 |
| 33 | 3300048903 | Ga0496100_0387020 | Ga0496100_0387020_219_776 | 185 |
| 34 | 3300048904 | Ga0496101_0104913 | Ga0496101_0104913_777_1334 | 185 |
| 35 | 3300048910 | Ga0496107_0146455 | Ga0496107_0146455_347_904 | 185 |
| 36 | 3300048912 | Ga0496109_0642144 | Ga0496109_0642144_258_815 | 185 |
| 37 | 3300048916 | Ga0496113_0359648 | Ga0496113_0359648_155_712 | 185 |
| 38 | 3300049583 | Ga0501067_0163403 | Ga0501067_0163403_483_1040 | 185 |
| 39 | 3300025920 | Ga0207649_10415782 | Ga0207649_104157821 | 186 |
| 40 | 3300014326 | Ga0157380_10453228 | Ga0157380_104532282 | 187 |
| 41 | 3300048091 | Ga0495626_0080692 | Ga0495626_0080692_21_584 | 187 |
| 42 | 3300004798 | Ga0058859_10020293 | Ga0058859_100202934 | 191 |
| 43 | 3300026075 | Ga0207708_10159989 | Ga0207708_101599892 | 191 |
| 44 | 3300009094 | Ga0111539_11658631 | Ga0111539_116586311 | 192 |
| 45 | 3300025926 | Ga0207659_10866155 | Ga0207659_108661551 | 192 |
| 46 | 3300046537 | Ga0495598_0065361 | Ga0495598_0065361_335_928 | 192 |
| 47 | 3300048924 | Ga0496121_0000061 | Ga0496121_0000061_110043_110699 | 192 |
| 48 | 3300050511 | nmdc:mga08y16_1456771_c1 | nmdc:mga08y16_1456771_c1_19_612 | 192 |
| 49 | 3300005327 | Ga0070658_10276256 | Ga0070658_102762562 | 193 |
| 50 | 3300005344 | Ga0070661_100013745 | Ga0070661_1000137456 | 193 |
| 51 | 3300005458 | Ga0070681_10149392 | Ga0070681_101493922 | 193 |
| 52 | 3300005530 | Ga0070679_100092415 | Ga0070679_1000924152 | 193 |
| 53 | 3300013104 | Ga0157370_10037783 | Ga0157370_100377834 | 193 |
| 54 | 3300013105 | Ga0157369_10119859 | Ga0157369_101198593 | 193 |
| 55 | 3300025909 | Ga0207705_10005892 | Ga0207705_1000589210 | 193 |
| 56 | 3300025912 | Ga0207707_10479375 | Ga0207707_104793752 | 193 |
| 57 | 3300025917 | Ga0207660_10237437 | Ga0207660_102374371 | 193 |
| 58 | 3300025919 | Ga0207657_10013116 | Ga0207657_100131164 | 193 |
| 59 | 3300025920 | Ga0207649_10036909 | Ga0207649_100369092 | 193 |
| 60 | 3300025921 | Ga0207652_10256856 | Ga0207652_102568562 | 193 |
| 61 | 3300026067 | Ga0207678_10035181 | Ga0207678_100351812 | 193 |
| 62 | 3300005841 | Ga0068863_100036360 | Ga0068863_1000363605 | 194 |
| 63 | 3300006931 | Ga0097620_100024576 | Ga0097620_1000245767 | 194 |
| 64 | 3300009101 | Ga0105247_10128837 | Ga0105247_101288372 | 194 |
| 65 | 3300009177 | Ga0105248_10054079 | Ga0105248_100540794 | 194 |
| 66 | 3300025900 | Ga0207710_10099888 | Ga0207710_100998882 | 194 |
| 67 | 3300025941 | Ga0207711_10198186 | Ga0207711_101981863 | 194 |
| 68 | 3300037418 | Ga0395900_0174337 | Ga0395900_0174337_1260_1844 | 194 |
| 69 | 3300037466 | Ga0395898_0406293 | Ga0395898_0406293_37_621 | 194 |
| 70 | 3300037471 | Ga0395905_0014010 | Ga0395905_0014010_4744_5328 | 194 |
| 71 | 3300038443 | Ga0395901_0060208 | Ga0395901_0060208_1901_2485 | 194 |
| 72 | 3300014497 | Ga0182008_10047749 | Ga0182008_100477492 | 195 |
| 73 | 3300021361 | Ga0213872_10206911 | Ga0213872_102069112 | 195 |
| 74 | 3300039447 | Ga0436361_1061929 | Ga0436361_1061929_248_865 | 195 |
| 75 | 3300005335 | Ga0070666_10149335 | Ga0070666_101493352 | 196 |
| 76 | 3300005345 | Ga0070692_10237705 | Ga0070692_102377052 | 196 |
| 77 | 3300005618 | Ga0068864_100385326 | Ga0068864_1003853262 | 196 |
| 78 | 3300005840 | Ga0068870_10314823 | Ga0068870_103148231 | 196 |
| 79 | 3300005844 | Ga0068862_100018840 | Ga0068862_1000188403 | 196 |
| 80 | 3300026095 | Ga0207676_10067865 | Ga0207676_100678653 | 196 |
| 81 | 3300028380 | Ga0268265_10019122 | Ga0268265_100191223 | 196 |
| 82 | 3300044658 | Ga0466972_0297566 | Ga0466972_0297566_82_681 | 197 |
| 83 | 3300046684 | Ga0495669_0009878 | Ga0495669_0009878_3274_3867 | 197 |
| 84 | 3300003316 | rootH1_10158387 | rootH1_101583872 | 198 |
| 85 | 3300003322 | rootL2_10051997 | rootL2_1005199714 | 198 |
| 86 | 3300005355 | Ga0070671_100143805 | Ga0070671_1001438052 | 198 |
| 87 | 3300005366 | Ga0070659_100003728 | Ga0070659_1000037289 | 198 |
| 88 | 3300005366 | Ga0070659_100286720 | Ga0070659_1002867202 | 198 |
| 89 | 3300005367 | Ga0070667_100008232 | Ga0070667_1000082327 | 198 |
| 90 | 3300005435 | Ga0070714_100064263 | Ga0070714_1000642633 | 198 |
| 91 | 3300005436 | Ga0070713_100005496 | Ga0070713_1000054962 | 198 |
| 92 | 3300005457 | Ga0070662_100117275 | Ga0070662_1001172752 | 198 |
| 93 | 3300005458 | Ga0070681_10383167 | Ga0070681_103831671 | 198 |
| 94 | 3300005539 | Ga0068853_100268309 | Ga0068853_1002683092 | 198 |
| 95 | 3300005543 | Ga0070672_100217224 | Ga0070672_1002172242 | 198 |
| 96 | 3300005563 | Ga0068855_100169163 | Ga0068855_1001691633 | 198 |
| 97 | 3300005577 | Ga0068857_100001454 | Ga0068857_10000145412 | 198 |
| 98 | 3300005577 | Ga0068857_100426765 | Ga0068857_1004267652 | 198 |
| 99 | 3300005578 | Ga0068854_100372822 | Ga0068854_1003728222 | 198 |
| 100 | 3300005616 | Ga0068852_100087972 | Ga0068852_1000879722 | 198 |
| 101 | 3300005617 | Ga0068859_100237460 | Ga0068859_1002374602 | 198 |
| 102 | 3300005618 | Ga0068864_100000897 | Ga0068864_1000008978 | 198 |
| 103 | 3300005841 | Ga0068863_100003418 | Ga0068863_1000034188 | 198 |
| 104 | 3300005842 | Ga0068858_100018417 | Ga0068858_1000184172 | 198 |
| 105 | 3300005843 | Ga0068860_100170109 | Ga0068860_1001701092 | 198 |
| 106 | 3300006237 | Ga0097621_100354879 | Ga0097621_1003548791 | 198 |
| 107 | 3300006358 | Ga0068871_100038507 | Ga0068871_1000385074 | 198 |
| 108 | 3300006931 | Ga0097620_100237462 | Ga0097620_1002374622 | 198 |
| 109 | 3300009177 | Ga0105248_10040397 | Ga0105248_100403972 | 198 |
| 110 | 3300013296 | Ga0157374_10377231 | Ga0157374_103772312 | 198 |
| 111 | 3300014968 | Ga0157379_10006760 | Ga0157379_100067608 | 198 |
| 112 | 3300025923 | Ga0207681_10059294 | Ga0207681_100592943 | 198 |
| 113 | 3300025925 | Ga0207650_10725893 | Ga0207650_107258931 | 198 |
| 114 | 3300025926 | Ga0207659_10125053 | Ga0207659_101250533 | 198 |
| 115 | 3300025928 | Ga0207700_10112019 | Ga0207700_101120191 | 198 |
| 116 | 3300025929 | Ga0207664_10039323 | Ga0207664_100393233 | 198 |
| 117 | 3300025931 | Ga0207644_10002376 | Ga0207644_100023762 | 198 |
| 118 | 3300025932 | Ga0207690_10019258 | Ga0207690_100192584 | 198 |
| 119 | 3300025933 | Ga0207706_10125524 | Ga0207706_101255243 | 198 |
| 120 | 3300025945 | Ga0207679_10034202 | Ga0207679_100342024 | 198 |
| 121 | 3300025945 | Ga0207679_10050807 | Ga0207679_100508073 | 198 |
| 122 | 3300025949 | Ga0207667_10485026 | Ga0207667_104850262 | 198 |
| 123 | 3300025986 | Ga0207658_10070034 | Ga0207658_100700343 | 198 |
| 124 | 3300026078 | Ga0207702_10005348 | Ga0207702_100053482 | 198 |
| 125 | 3300026088 | Ga0207641_10053253 | Ga0207641_100532532 | 198 |
| 126 | 3300026095 | Ga0207676_10005455 | Ga0207676_100054558 | 198 |
| 127 | 3300026095 | Ga0207676_10216504 | Ga0207676_102165042 | 198 |
| 128 | 3300026116 | Ga0207674_10003442 | Ga0207674_100034428 | 198 |
| 129 | 3300026116 | Ga0207674_10050377 | Ga0207674_100503772 | 198 |
| 130 | 3300026142 | Ga0207698_11207869 | Ga0207698_112078692 | 198 |
| 131 | 3300027876 | Ga0209974_10010444 | Ga0209974_100104442 | 198 |
| 132 | 3300028380 | Ga0268265_10199531 | Ga0268265_101995312 | 198 |
| 133 | 3300028381 | Ga0268264_10153245 | Ga0268264_101532452 | 198 |
| 134 | 3300031911 | Ga0307412_10371124 | Ga0307412_103711242 | 198 |
| 135 | 3300031995 | Ga0307409_100238495 | Ga0307409_1002384951 | 198 |
| 136 | 3300032002 | Ga0307416_100250908 | Ga0307416_1002509082 | 198 |
| 137 | 3300032004 | Ga0307414_10126883 | Ga0307414_101268833 | 198 |
| 138 | 3300032005 | Ga0307411_10158838 | Ga0307411_101588382 | 198 |
| 139 | 3300048905 | Ga0496102_0042910 | Ga0496102_0042910_1588_2184 | 198 |
| 140 | 3300048906 | Ga0496103_0016347 | Ga0496103_0016347_2517_3113 | 198 |
| 141 | 3300048909 | Ga0496106_0064316 | Ga0496106_0064316_1436_2032 | 198 |
| 142 | 3300048910 | Ga0496107_0033903 | Ga0496107_0033903_877_1473 | 198 |
| 143 | 3300048911 | Ga0496108_0018888 | Ga0496108_0018888_2976_3572 | 198 |
| 144 | 3300048912 | Ga0496109_0006273 | Ga0496109_0006273_3203_3799 | 198 |
| 145 | 3300048913 | Ga0496110_0004039 | Ga0496110_0004039_3162_3758 | 198 |
| 146 | 3300048914 | Ga0496111_0000244 | Ga0496111_0000244_18014_18610 | 198 |
| 147 | 3300048915 | Ga0496112_0019061 | Ga0496112_0019061_271_867 | 198 |
| 148 | 3300048916 | Ga0496113_0000515 | Ga0496113_0000515_13955_14551 | 198 |
| 149 | 3300001979 | JGI24740J21852_10039507 | JGI24740J21852_100395072 | 199 |
| 150 | 3300001979 | JGI24740J21852_10064961 | JGI24740J21852_100649612 | 199 |
| 151 | 3300001979 | JGI24740J21852_10083333 | JGI24740J21852_100833331 | 199 |
| 152 | 3300001989 | JGI24739J22299_10000896 | JGI24739J22299_100008965 | 199 |
| 153 | 3300001990 | JGI24737J22298_10000355 | JGI24737J22298_1000035516 | 199 |
| 154 | 3300001990 | JGI24737J22298_10017460 | JGI24737J22298_100174602 | 199 |
| 155 | 3300001990 | JGI24737J22298_10069308 | JGI24737J22298_100693082 | 199 |
| 156 | 3300002067 | JGI24735J21928_10002044 | JGI24735J21928_100020444 | 199 |
| 157 | 3300002075 | JGI24738J21930_10001455 | JGI24738J21930_100014552 | 199 |
| 158 | 3300005293 | Ga0065715_10017383 | Ga0065715_100173832 | 199 |
| 159 | 3300005327 | Ga0070658_10015142 | Ga0070658_100151421 | 199 |
| 160 | 3300005327 | Ga0070658_10572032 | Ga0070658_105720322 | 199 |
| 161 | 3300005328 | Ga0070676_10090430 | Ga0070676_100904302 | 199 |
| 162 | 3300005328 | Ga0070676_10152142 | Ga0070676_101521422 | 199 |
| 163 | 3300005329 | Ga0070683_100005337 | Ga0070683_1000053378 | 199 |
| 164 | 3300005329 | Ga0070683_100117752 | Ga0070683_1001177523 | 199 |
| 165 | 3300005331 | Ga0070670_100002145 | Ga0070670_10000214512 | 199 |
| 166 | 3300005331 | Ga0070670_100140360 | Ga0070670_1001403602 | 199 |
| 167 | 3300005334 | Ga0068869_100000230 | Ga0068869_10000023010 | 199 |
| 168 | 3300005334 | Ga0068869_100073353 | Ga0068869_1000733532 | 199 |
| 169 | 3300005335 | Ga0070666_10027596 | Ga0070666_100275962 | 199 |
| 170 | 3300005335 | Ga0070666_10112252 | Ga0070666_101122521 | 199 |
| 171 | 3300005336 | Ga0070680_100002564 | Ga0070680_10000256410 | 199 |
| 172 | 3300005336 | Ga0070680_100002845 | Ga0070680_1000028453 | 199 |
| 173 | 3300005338 | Ga0068868_100013097 | Ga0068868_1000130975 | 199 |
| 174 | 3300005339 | Ga0070660_100001061 | Ga0070660_10000106110 | 199 |
| 175 | 3300005339 | Ga0070660_100011817 | Ga0070660_1000118172 | 199 |
| 176 | 3300005339 | Ga0070660_100079553 | Ga0070660_1000795532 | 199 |
| 177 | 3300005340 | Ga0070689_101066646 | Ga0070689_1010666461 | 199 |
| 178 | 3300005341 | Ga0070691_10009124 | Ga0070691_100091244 | 199 |
| 179 | 3300005344 | Ga0070661_100001787 | Ga0070661_1000017871 | 199 |
| 180 | 3300005344 | Ga0070661_100022816 | Ga0070661_1000228164 | 199 |
| 181 | 3300005344 | Ga0070661_100049439 | Ga0070661_1000494394 | 199 |
| 182 | 3300005344 | Ga0070661_100147628 | Ga0070661_1001476282 | 199 |
| 183 | 3300005345 | Ga0070692_10011678 | Ga0070692_100116786 | 199 |
| 184 | 3300005345 | Ga0070692_10017276 | Ga0070692_100172764 | 199 |
| 185 | 3300005347 | Ga0070668_100026740 | Ga0070668_1000267404 | 199 |
| 186 | 3300005347 | Ga0070668_100357678 | Ga0070668_1003576782 | 199 |
| 187 | 3300005353 | Ga0070669_100005470 | Ga0070669_1000054705 | 199 |
| 188 | 3300005354 | Ga0070675_100076235 | Ga0070675_1000762353 | 199 |
| 189 | 3300005354 | Ga0070675_100239461 | Ga0070675_1002394612 | 199 |
| 190 | 3300005355 | Ga0070671_100025514 | Ga0070671_1000255142 | 199 |
| 191 | 3300005364 | Ga0070673_100000535 | Ga0070673_10000053512 | 199 |
| 192 | 3300005366 | Ga0070659_100001166 | Ga0070659_10000116617 | 199 |
| 193 | 3300005366 | Ga0070659_100005162 | Ga0070659_1000051629 | 199 |
| 194 | 3300005367 | Ga0070667_100107881 | Ga0070667_1001078812 | 199 |
| 195 | 3300005434 | Ga0070709_10023808 | Ga0070709_100238081 | 199 |
| 196 | 3300005435 | Ga0070714_100030110 | Ga0070714_1000301102 | 199 |
| 197 | 3300005435 | Ga0070714_100039056 | Ga0070714_1000390564 | 199 |
| 198 | 3300005435 | Ga0070714_100153584 | Ga0070714_1001535843 | 199 |
| 199 | 3300005435 | Ga0070714_100282172 | Ga0070714_1002821722 | 199 |
| 200 | 3300005436 | Ga0070713_100108629 | Ga0070713_1001086292 | 199 |
| 201 | 3300005444 | Ga0070694_100056002 | Ga0070694_1000560022 | 199 |
| 202 | 3300005455 | Ga0070663_100005878 | Ga0070663_1000058787 | 199 |
| 203 | 3300005455 | Ga0070663_100239882 | Ga0070663_1002398822 | 199 |
| 204 | 3300005455 | Ga0070663_100424975 | Ga0070663_1004249752 | 199 |
| 205 | 3300005456 | Ga0070678_100367072 | Ga0070678_1003670722 | 199 |
| 206 | 3300005457 | Ga0070662_100000390 | Ga0070662_10000039019 | 199 |
| 207 | 3300005457 | Ga0070662_100005999 | Ga0070662_1000059993 | 199 |
| 208 | 3300005457 | Ga0070662_100044884 | Ga0070662_1000448842 | 199 |
| 209 | 3300005458 | Ga0070681_10031091 | Ga0070681_100310914 | 199 |
| 210 | 3300005459 | Ga0068867_100084021 | Ga0068867_1000840213 | 199 |
| 211 | 3300005530 | Ga0070679_100011099 | Ga0070679_1000110994 | 199 |
| 212 | 3300005530 | Ga0070679_100037875 | Ga0070679_1000378754 | 199 |
| 213 | 3300005535 | Ga0070684_100005950 | Ga0070684_10000595012 | 199 |
| 214 | 3300005535 | Ga0070684_100107284 | Ga0070684_1001072842 | 199 |
| 215 | 3300005535 | Ga0070684_100587889 | Ga0070684_1005878892 | 199 |
| 216 | 3300005539 | Ga0068853_100003747 | Ga0068853_1000037472 | 199 |
| 217 | 3300005539 | Ga0068853_100015106 | Ga0068853_1000151065 | 199 |
| 218 | 3300005539 | Ga0068853_100018643 | Ga0068853_1000186434 | 199 |
| 219 | 3300005539 | Ga0068853_100233391 | Ga0068853_1002333911 | 199 |
| 220 | 3300005539 | Ga0068853_100521135 | Ga0068853_1005211352 | 199 |
| 221 | 3300005543 | Ga0070672_100001092 | Ga0070672_1000010928 | 199 |
| 222 | 3300005543 | Ga0070672_100010946 | Ga0070672_1000109465 | 199 |
| 223 | 3300005543 | Ga0070672_100134828 | Ga0070672_1001348283 | 199 |
| 224 | 3300005548 | Ga0070665_100008990 | Ga0070665_1000089905 | 199 |
| 225 | 3300005548 | Ga0070665_101157758 | Ga0070665_1011577581 | 199 |
| 226 | 3300005563 | Ga0068855_100009251 | Ga0068855_1000092517 | 199 |
| 227 | 3300005563 | Ga0068855_100014603 | Ga0068855_1000146033 | 199 |
| 228 | 3300005563 | Ga0068855_100135459 | Ga0068855_1001354592 | 199 |
| 229 | 3300005563 | Ga0068855_100165247 | Ga0068855_1001652473 | 199 |
| 230 | 3300005563 | Ga0068855_100694892 | Ga0068855_1006948922 | 199 |
| 231 | 3300005564 | Ga0070664_100001296 | Ga0070664_1000012962 | 199 |
| 232 | 3300005564 | Ga0070664_100007726 | Ga0070664_1000077264 | 199 |
| 233 | 3300005564 | Ga0070664_100169764 | Ga0070664_1001697642 | 199 |
| 234 | 3300005577 | Ga0068857_100078293 | Ga0068857_1000782933 | 199 |
| 235 | 3300005577 | Ga0068857_100123519 | Ga0068857_1001235191 | 199 |
| 236 | 3300005577 | Ga0068857_100191577 | Ga0068857_1001915772 | 199 |
| 237 | 3300005577 | Ga0068857_100230281 | Ga0068857_1002302812 | 199 |
| 238 | 3300005578 | Ga0068854_100000919 | Ga0068854_10000091917 | 199 |
| 239 | 3300005578 | Ga0068854_100003625 | Ga0068854_1000036257 | 199 |
| 240 | 3300005578 | Ga0068854_100470359 | Ga0068854_1004703592 | 199 |
| 241 | 3300005578 | Ga0068854_100651782 | Ga0068854_1006517821 | 199 |
| 242 | 3300005614 | Ga0068856_100011527 | Ga0068856_1000115274 | 199 |
| 243 | 3300005614 | Ga0068856_100022741 | Ga0068856_1000227414 | 199 |
| 244 | 3300005614 | Ga0068856_100134030 | Ga0068856_1001340301 | 199 |
| 245 | 3300005616 | Ga0068852_100006131 | Ga0068852_1000061316 | 199 |
| 246 | 3300005616 | Ga0068852_100053794 | Ga0068852_1000537943 | 199 |
| 247 | 3300005616 | Ga0068852_100138962 | Ga0068852_1001389623 | 199 |
| 248 | 3300005616 | Ga0068852_100319202 | Ga0068852_1003192022 | 199 |
| 249 | 3300005616 | Ga0068852_100590222 | Ga0068852_1005902221 | 199 |
| 250 | 3300005617 | Ga0068859_100106230 | Ga0068859_1001062302 | 199 |
| 251 | 3300005618 | Ga0068864_100003357 | Ga0068864_1000033578 | 199 |
| 252 | 3300005618 | Ga0068864_100192870 | Ga0068864_1001928702 | 199 |
| 253 | 3300005718 | Ga0068866_10254655 | Ga0068866_102546552 | 199 |
| 254 | 3300005719 | Ga0068861_100242394 | Ga0068861_1002423942 | 199 |
| 255 | 3300005834 | Ga0068851_10003322 | Ga0068851_100033227 | 199 |
| 256 | 3300005841 | Ga0068863_100194707 | Ga0068863_1001947072 | 199 |
| 257 | 3300005842 | Ga0068858_100013259 | Ga0068858_1000132594 | 199 |
| 258 | 3300005842 | Ga0068858_100017615 | Ga0068858_1000176152 | 199 |
| 259 | 3300005843 | Ga0068860_100017848 | Ga0068860_1000178483 | 199 |
| 260 | 3300005843 | Ga0068860_100052951 | Ga0068860_1000529515 | 199 |
| 261 | 3300005844 | Ga0068862_100115736 | Ga0068862_1001157363 | 199 |
| 262 | 3300005844 | Ga0068862_100653203 | Ga0068862_1006532032 | 199 |
| 263 | 3300006028 | Ga0070717_10030714 | Ga0070717_100307145 | 199 |
| 264 | 3300006175 | Ga0070712_100019418 | Ga0070712_1000194185 | 199 |
| 265 | 3300006844 | Ga0075428_100351054 | Ga0075428_1003510542 | 199 |
| 266 | 3300006881 | Ga0068865_100020097 | Ga0068865_1000200972 | 199 |
| 267 | 3300006931 | Ga0097620_100106217 | Ga0097620_1001062173 | 199 |
| 268 | 3300009092 | Ga0105250_10087198 | Ga0105250_100871982 | 199 |
| 269 | 3300009093 | Ga0105240_10019380 | Ga0105240_100193802 | 199 |
| 270 | 3300009093 | Ga0105240_10065681 | Ga0105240_100656813 | 199 |
| 271 | 3300009093 | Ga0105240_10166411 | Ga0105240_101664112 | 199 |
| 272 | 3300009093 | Ga0105240_10288745 | Ga0105240_102887452 | 199 |
| 273 | 3300009098 | Ga0105245_10001947 | Ga0105245_1000194716 | 199 |
| 274 | 3300009098 | Ga0105245_10031880 | Ga0105245_100318802 | 199 |
| 275 | 3300009174 | Ga0105241_10116724 | Ga0105241_101167243 | 199 |
| 276 | 3300009176 | Ga0105242_10027715 | Ga0105242_100277152 | 199 |
| 277 | 3300009177 | Ga0105248_10010146 | Ga0105248_100101466 | 199 |
| 278 | 3300009177 | Ga0105248_10327376 | Ga0105248_103273761 | 199 |
| 279 | 3300009545 | Ga0105237_10013446 | Ga0105237_100134463 | 199 |
| 280 | 3300009551 | Ga0105238_10032849 | Ga0105238_100328496 | 199 |
| 281 | 3300009553 | Ga0105249_10096755 | Ga0105249_100967552 | 199 |
| 282 | 3300010375 | Ga0105239_10357312 | Ga0105239_103573122 | 199 |
| 283 | 3300013100 | Ga0157373_10007319 | Ga0157373_1000731910 | 199 |
| 284 | 3300013100 | Ga0157373_10012534 | Ga0157373_100125347 | 199 |
| 285 | 3300013100 | Ga0157373_10135577 | Ga0157373_101355772 | 199 |
| 286 | 3300013100 | Ga0157373_10195871 | Ga0157373_101958712 | 199 |
| 287 | 3300013100 | Ga0157373_10237173 | Ga0157373_102371732 | 199 |
| 288 | 3300013102 | Ga0157371_10068402 | Ga0157371_100684023 | 199 |
| 289 | 3300013102 | Ga0157371_10136176 | Ga0157371_101361763 | 199 |
| 290 | 3300013104 | Ga0157370_10059121 | Ga0157370_100591215 | 199 |
| 291 | 3300013104 | Ga0157370_10065215 | Ga0157370_100652151 | 199 |
| 292 | 3300013104 | Ga0157370_10066600 | Ga0157370_100666005 | 199 |
| 293 | 3300013104 | Ga0157370_10129694 | Ga0157370_101296943 | 199 |
| 294 | 3300013104 | Ga0157370_10527226 | Ga0157370_105272262 | 199 |
| 295 | 3300013105 | Ga0157369_10046479 | Ga0157369_100464792 | 199 |
| 296 | 3300013105 | Ga0157369_10059002 | Ga0157369_100590023 | 199 |
| 297 | 3300013105 | Ga0157369_10317225 | Ga0157369_103172251 | 199 |
| 298 | 3300013105 | Ga0157369_10426180 | Ga0157369_104261802 | 199 |
| 299 | 3300013105 | Ga0157369_10841994 | Ga0157369_108419942 | 199 |
| 300 | 3300013297 | Ga0157378_10014264 | Ga0157378_100142648 | 199 |
| 301 | 3300013297 | Ga0157378_10406296 | Ga0157378_104062962 | 199 |
| 302 | 3300013306 | Ga0163162_10061377 | Ga0163162_100613772 | 199 |
| 303 | 3300013307 | Ga0157372_10330400 | Ga0157372_103304003 | 199 |
| 304 | 3300013307 | Ga0157372_10375437 | Ga0157372_103754372 | 199 |
| 305 | 3300013307 | Ga0157372_10697082 | Ga0157372_106970822 | 199 |
| 306 | 3300013308 | Ga0157375_10022235 | Ga0157375_100222357 | 199 |
| 307 | 3300014326 | Ga0157380_10354135 | Ga0157380_103541352 | 199 |
| 308 | 3300014745 | Ga0157377_10019876 | Ga0157377_100198763 | 199 |
| 309 | 3300014968 | Ga0157379_10080161 | Ga0157379_100801611 | 199 |
| 310 | 3300020069 | Ga0197907_11483432 | Ga0197907_114834321 | 199 |
| 311 | 3300020070 | Ga0206356_10308331 | Ga0206356_103083311 | 199 |
| 312 | 3300020070 | Ga0206356_11242570 | Ga0206356_112425702 | 199 |
| 313 | 3300020078 | Ga0206352_11205138 | Ga0206352_112051381 | 199 |
| 314 | 3300020080 | Ga0206350_10308023 | Ga0206350_103080232 | 199 |
| 315 | 3300020082 | Ga0206353_10924983 | Ga0206353_109249831 | 199 |
| 316 | 3300025290 | Ga0207673_1008721 | Ga0207673_10087212 | 199 |
| 317 | 3300025315 | Ga0207697_10000082 | Ga0207697_1000008223 | 199 |
| 318 | 3300025321 | Ga0207656_10002169 | Ga0207656_100021692 | 199 |
| 319 | 3300025899 | Ga0207642_10232549 | Ga0207642_102325491 | 199 |
| 320 | 3300025901 | Ga0207688_10026523 | Ga0207688_100265232 | 199 |
| 321 | 3300025901 | Ga0207688_10250549 | Ga0207688_102505492 | 199 |
| 322 | 3300025903 | Ga0207680_10045712 | Ga0207680_100457123 | 199 |
| 323 | 3300025903 | Ga0207680_10097002 | Ga0207680_100970022 | 199 |
| 324 | 3300025904 | Ga0207647_10000259 | Ga0207647_100002598 | 199 |
| 325 | 3300025904 | Ga0207647_10001197 | Ga0207647_1000119715 | 199 |
| 326 | 3300025904 | Ga0207647_10003110 | Ga0207647_100031106 | 199 |
| 327 | 3300025904 | Ga0207647_10041888 | Ga0207647_100418882 | 199 |
| 328 | 3300025906 | Ga0207699_10371708 | Ga0207699_103717082 | 199 |
| 329 | 3300025906 | Ga0207699_10423581 | Ga0207699_104235812 | 199 |
| 330 | 3300025907 | Ga0207645_10155625 | Ga0207645_101556252 | 199 |
| 331 | 3300025909 | Ga0207705_10000123 | Ga0207705_1000012341 | 199 |
| 332 | 3300025909 | Ga0207705_10003112 | Ga0207705_1000311215 | 199 |
| 333 | 3300025912 | Ga0207707_10224089 | Ga0207707_102240891 | 199 |
| 334 | 3300025913 | Ga0207695_10031219 | Ga0207695_100312193 | 199 |
| 335 | 3300025913 | Ga0207695_10032631 | Ga0207695_100326314 | 199 |
| 336 | 3300025913 | Ga0207695_10292690 | Ga0207695_102926902 | 199 |
| 337 | 3300025913 | Ga0207695_10634306 | Ga0207695_106343062 | 199 |
| 338 | 3300025914 | Ga0207671_10650081 | Ga0207671_106500811 | 199 |
| 339 | 3300025915 | Ga0207693_10031706 | Ga0207693_100317063 | 199 |
| 340 | 3300025915 | Ga0207693_10037725 | Ga0207693_100377254 | 199 |
| 341 | 3300025917 | Ga0207660_10009248 | Ga0207660_100092484 | 199 |
| 342 | 3300025917 | Ga0207660_10592670 | Ga0207660_105926701 | 199 |
| 343 | 3300025919 | Ga0207657_10000650 | Ga0207657_1000065033 | 199 |
| 344 | 3300025919 | Ga0207657_10004090 | Ga0207657_100040908 | 199 |
| 345 | 3300025919 | Ga0207657_10009514 | Ga0207657_1000951411 | 199 |
| 346 | 3300025919 | Ga0207657_10027070 | Ga0207657_100270706 | 199 |
| 347 | 3300025919 | Ga0207657_10335891 | Ga0207657_103358912 | 199 |
| 348 | 3300025920 | Ga0207649_10039258 | Ga0207649_100392582 | 199 |
| 349 | 3300025920 | Ga0207649_10120259 | Ga0207649_101202592 | 199 |
| 350 | 3300025921 | Ga0207652_10000034 | Ga0207652_1000003473 | 199 |
| 351 | 3300025921 | Ga0207652_10288668 | Ga0207652_102886682 | 199 |
| 352 | 3300025924 | Ga0207694_10040576 | Ga0207694_100405763 | 199 |
| 353 | 3300025924 | Ga0207694_10400242 | Ga0207694_104002422 | 199 |
| 354 | 3300025925 | Ga0207650_10004067 | Ga0207650_1000406711 | 199 |
| 355 | 3300025926 | Ga0207659_10012771 | Ga0207659_100127713 | 199 |
| 356 | 3300025926 | Ga0207659_10200238 | Ga0207659_102002382 | 199 |
| 357 | 3300025928 | Ga0207700_10067184 | Ga0207700_100671843 | 199 |
| 358 | 3300025928 | Ga0207700_10138985 | Ga0207700_101389854 | 199 |
| 359 | 3300025929 | Ga0207664_10075955 | Ga0207664_100759555 | 199 |
| 360 | 3300025932 | Ga0207690_10011308 | Ga0207690_100113081 | 199 |
| 361 | 3300025932 | Ga0207690_10027521 | Ga0207690_100275215 | 199 |
| 362 | 3300025932 | Ga0207690_10030169 | Ga0207690_100301693 | 199 |
| 363 | 3300025932 | Ga0207690_10137253 | Ga0207690_101372532 | 199 |
| 364 | 3300025933 | Ga0207706_10001125 | Ga0207706_1000112526 | 199 |
| 365 | 3300025933 | Ga0207706_10033985 | Ga0207706_100339853 | 199 |
| 366 | 3300025933 | Ga0207706_10065654 | Ga0207706_100656542 | 199 |
| 367 | 3300025934 | Ga0207686_10112449 | Ga0207686_101124493 | 199 |
| 368 | 3300025935 | Ga0207709_10075159 | Ga0207709_100751592 | 199 |
| 369 | 3300025936 | Ga0207670_10468249 | Ga0207670_104682492 | 199 |
| 370 | 3300025938 | Ga0207704_10019649 | Ga0207704_100196492 | 199 |
| 371 | 3300025940 | Ga0207691_10017486 | Ga0207691_100174868 | 199 |
| 372 | 3300025940 | Ga0207691_10048595 | Ga0207691_100485954 | 199 |
| 373 | 3300025941 | Ga0207711_10016576 | Ga0207711_100165768 | 199 |
| 374 | 3300025942 | Ga0207689_10000561 | Ga0207689_100005618 | 199 |
| 375 | 3300025942 | Ga0207689_10014133 | Ga0207689_100141333 | 199 |
| 376 | 3300025944 | Ga0207661_10003613 | Ga0207661_100036138 | 199 |
| 377 | 3300025945 | Ga0207679_10004860 | Ga0207679_100048602 | 199 |
| 378 | 3300025949 | Ga0207667_10008316 | Ga0207667_100083163 | 199 |
| 379 | 3300025949 | Ga0207667_10031787 | Ga0207667_100317873 | 199 |
| 380 | 3300025949 | Ga0207667_10050596 | Ga0207667_100505963 | 199 |
| 381 | 3300025960 | Ga0207651_10001237 | Ga0207651_100012377 | 199 |
| 382 | 3300025960 | Ga0207651_10480220 | Ga0207651_104802202 | 199 |
| 383 | 3300025961 | Ga0207712_10001096 | Ga0207712_1000109620 | 199 |
| 384 | 3300025981 | Ga0207640_10000788 | Ga0207640_1000078816 | 199 |
| 385 | 3300025981 | Ga0207640_10001178 | Ga0207640_100011789 | 199 |
| 386 | 3300025981 | Ga0207640_10020554 | Ga0207640_100205544 | 199 |
| 387 | 3300025981 | Ga0207640_10021671 | Ga0207640_100216712 | 199 |
| 388 | 3300025981 | Ga0207640_10648202 | Ga0207640_106482021 | 199 |
| 389 | 3300025981 | Ga0207640_10760349 | Ga0207640_107603491 | 199 |
| 390 | 3300025986 | Ga0207658_10279557 | Ga0207658_102795571 | 199 |
| 391 | 3300026023 | Ga0207677_10014000 | Ga0207677_100140002 | 199 |
| 392 | 3300026035 | Ga0207703_10013406 | Ga0207703_100134062 | 199 |
| 393 | 3300026041 | Ga0207639_10010459 | Ga0207639_100104597 | 199 |
| 394 | 3300026041 | Ga0207639_10025397 | Ga0207639_100253975 | 199 |
| 395 | 3300026067 | Ga0207678_10000530 | Ga0207678_1000053012 | 199 |
| 396 | 3300026067 | Ga0207678_10102494 | Ga0207678_101024942 | 199 |
| 397 | 3300026067 | Ga0207678_10125516 | Ga0207678_101255162 | 199 |
| 398 | 3300026075 | Ga0207708_10366312 | Ga0207708_103663122 | 199 |
| 399 | 3300026078 | Ga0207702_10025220 | Ga0207702_100252203 | 199 |
| 400 | 3300026078 | Ga0207702_10068484 | Ga0207702_100684842 | 199 |
| 401 | 3300026078 | Ga0207702_10115257 | Ga0207702_101152573 | 199 |
| 402 | 3300026088 | Ga0207641_10035574 | Ga0207641_100355744 | 199 |
| 403 | 3300026088 | Ga0207641_10202650 | Ga0207641_102026502 | 199 |
| 404 | 3300026089 | Ga0207648_10007119 | Ga0207648_100071198 | 199 |
| 405 | 3300026089 | Ga0207648_10044397 | Ga0207648_100443972 | 199 |
| 406 | 3300026095 | Ga0207676_10031712 | Ga0207676_100317125 | 199 |
| 407 | 3300026095 | Ga0207676_10099267 | Ga0207676_100992672 | 199 |
| 408 | 3300026095 | Ga0207676_10227979 | Ga0207676_102279792 | 199 |
| 409 | 3300026116 | Ga0207674_10002685 | Ga0207674_100026858 | 199 |
| 410 | 3300026116 | Ga0207674_10004250 | Ga0207674_100042506 | 199 |
| 411 | 3300026116 | Ga0207674_10076134 | Ga0207674_100761342 | 199 |
| 412 | 3300026116 | Ga0207674_10133998 | Ga0207674_101339983 | 199 |
| 413 | 3300026116 | Ga0207674_10198690 | Ga0207674_101986903 | 199 |
| 414 | 3300026118 | Ga0207675_100201396 | Ga0207675_1002013962 | 199 |
| 415 | 3300026118 | Ga0207675_100285167 | Ga0207675_1002851672 | 199 |
| 416 | 3300026121 | Ga0207683_10042173 | Ga0207683_100421734 | 199 |
| 417 | 3300026121 | Ga0207683_10299257 | Ga0207683_102992572 | 199 |
| 418 | 3300026142 | Ga0207698_10023009 | Ga0207698_100230092 | 199 |
| 419 | 3300026142 | Ga0207698_10052923 | Ga0207698_100529232 | 199 |
| 420 | 3300026142 | Ga0207698_10646483 | Ga0207698_106464832 | 199 |
| 421 | 3300028379 | Ga0268266_10000458 | Ga0268266_1000045842 | 199 |
| 422 | 3300028379 | Ga0268266_10031622 | Ga0268266_100316223 | 199 |
| 423 | 3300028379 | Ga0268266_10569847 | Ga0268266_105698472 | 199 |
| 424 | 3300028380 | Ga0268265_10016311 | Ga0268265_100163116 | 199 |
| 425 | 3300028381 | Ga0268264_10007507 | Ga0268264_100075077 | 199 |
| 426 | 3300028381 | Ga0268264_10096086 | Ga0268264_100960863 | 199 |
| 427 | 3300031911 | Ga0307412_10026888 | Ga0307412_100268883 | 199 |
| 428 | 3300036401 | Ga0373937_0414737 | Ga0373937_0414737_122_721 | 199 |
| 429 | 3300037312 | Ga0395899_0040322 | Ga0395899_0040322_2658_3257 | 199 |
| 430 | 3300037312 | Ga0395899_0044176 | Ga0395899_0044176_2324_2923 | 199 |
| 431 | 3300037312 | Ga0395899_0294297 | Ga0395899_0294297_113_712 | 199 |
| 432 | 3300037312 | Ga0395899_0470830 | Ga0395899_0470830_174_773 | 199 |
| 433 | 3300037418 | Ga0395900_0023793 | Ga0395900_0023793_1170_1769 | 199 |
| 434 | 3300037418 | Ga0395900_0039979 | Ga0395900_0039979_3842_4441 | 199 |
| 435 | 3300037418 | Ga0395900_0048315 | Ga0395900_0048315_1449_2048 | 199 |
| 436 | 3300037418 | Ga0395900_0141799 | Ga0395900_0141799_1817_2416 | 199 |
| 437 | 3300037418 | Ga0395900_0329344 | Ga0395900_0329344_621_1220 | 199 |
| 438 | 3300037418 | Ga0395900_0751515 | Ga0395900_0751515_192_791 | 199 |
| 439 | 3300037418 | Ga0395900_0993093 | Ga0395900_0993093_36_635 | 199 |
| 440 | 3300037466 | Ga0395898_0054987 | Ga0395898_0054987_3085_3684 | 199 |
| 441 | 3300037471 | Ga0395905_0012839 | Ga0395905_0012839_4523_5122 | 199 |
| 442 | 3300037471 | Ga0395905_0019482 | Ga0395905_0019482_641_1240 | 199 |
| 443 | 3300037471 | Ga0395905_0116205 | Ga0395905_0116205_387_986 | 199 |
| 444 | 3300037471 | Ga0395905_0139764 | Ga0395905_0139764_63_662 | 199 |
| 445 | 3300037471 | Ga0395905_0309355 | Ga0395905_0309355_229_828 | 199 |
| 446 | 3300038443 | Ga0395901_0017022 | Ga0395901_0017022_5688_6287 | 199 |
| 447 | 3300038443 | Ga0395901_0020134 | Ga0395901_0020134_1690_2289 | 199 |
| 448 | 3300038443 | Ga0395901_0023308 | Ga0395901_0023308_2882_3481 | 199 |
| 449 | 3300038443 | Ga0395901_0495231 | Ga0395901_0495231_623_1222 | 199 |
| 450 | 3300038443 | Ga0395901_1179432 | Ga0395901_1179432_123_722 | 199 |
| 451 | 3300044656 | Ga0466969_0097709 | Ga0466969_0097709_142_741 | 199 |
| 452 | 3300044656 | Ga0466969_0147356 | Ga0466969_0147356_410_1009 | 199 |
| 453 | 3300044658 | Ga0466972_0145361 | Ga0466972_0145361_63_680 | 199 |
| 454 | 3300044684 | Ga0466966_0009469 | Ga0466966_0009469_35_634 | 199 |
| 455 | 3300044693 | Ga0466961_0020554 | Ga0466961_0020554_60_659 | 199 |
| 456 | 3300044693 | Ga0466961_0106654 | Ga0466961_0106654_1021_1620 | 199 |
| 457 | 3300044693 | Ga0466961_0275410 | Ga0466961_0275410_107_706 | 199 |
| 458 | 3300044694 | Ga0466963_0005307 | Ga0466963_0005307_4476_5075 | 199 |
| 459 | 3300044694 | Ga0466963_0079548 | Ga0466963_0079548_85_684 | 199 |
| 460 | 3300044694 | Ga0466963_0087170 | Ga0466963_0087170_84_683 | 199 |
| 461 | 3300044719 | Ga0466971_0001211 | Ga0466971_0001211_4777_5376 | 199 |
| 462 | 3300044719 | Ga0466971_0022472 | Ga0466971_0022472_136_735 | 199 |
| 463 | 3300044719 | Ga0466971_0354625 | Ga0466971_0354625_54_653 | 199 |
| 464 | 3300044765 | Ga0466970_0138916 | Ga0466970_0138916_453_1052 | 199 |
| 465 | 3300044765 | Ga0466970_0331530 | Ga0466970_0331530_217_816 | 199 |
| 466 | 3300044842 | Ga0466957_0002399 | Ga0466957_0002399_4146_4745 | 199 |
| 467 | 3300044842 | Ga0466957_0184671 | Ga0466957_0184671_305_904 | 199 |
| 468 | 3300044842 | Ga0466957_0313671 | Ga0466957_0313671_306_905 | 199 |
| 469 | 3300045049 | Ga0466959_0252933 | Ga0466959_0252933_517_1116 | 199 |
| 470 | 3300045049 | Ga0466959_0655970 | Ga0466959_0655970_26_625 | 199 |
| 471 | 3300045836 | Ga0466958_0009813 | Ga0466958_0009813_2477_3076 | 199 |
| 472 | 3300045836 | Ga0466958_0054461 | Ga0466958_0054461_1518_2117 | 199 |
| 473 | 3300045836 | Ga0466958_0063042 | Ga0466958_0063042_523_1122 | 199 |
| 474 | 3300045836 | Ga0466958_0084009 | Ga0466958_0084009_957_1556 | 199 |
| 475 | 3300045836 | Ga0466958_0116092 | Ga0466958_0116092_261_860 | 199 |
| 476 | 3300045836 | Ga0466958_0176799 | Ga0466958_0176799_321_920 | 199 |
| 477 | 3300045976 | Ga0466967_0052424 | Ga0466967_0052424_901_1500 | 199 |
| 478 | 3300045976 | Ga0466967_0257609 | Ga0466967_0257609_1056_1655 | 199 |
| 479 | 3300045976 | Ga0466967_0322807 | Ga0466967_0322807_753_1352 | 199 |
| 480 | 3300045976 | Ga0466967_0389541 | Ga0466967_0389541_256_870 | 199 |
| 481 | 3300046537 | Ga0495598_0003569 | Ga0495598_0003569_1593_2192 | 199 |
| 482 | 3300046539 | Ga0495621_0006280 | Ga0495621_0006280_2138_2737 | 199 |
| 483 | 3300048906 | Ga0496103_0476318 | Ga0496103_0476318_153_752 | 199 |
| 484 | 3300061719 | Ga0466962_0008758 | Ga0466962_0008758_1961_2560 | 199 |
| 485 | 3300061719 | Ga0466962_0208054 | Ga0466962_0208054_318_917 | 199 |
| 486 | 3300001904 | JGI24736J21556_1000429 | JGI24736J21556_10004291 | 200 |
| 487 | 3300001979 | JGI24740J21852_10023652 | JGI24740J21852_100236521 | 200 |
| 488 | 3300001990 | JGI24737J22298_10002309 | JGI24737J22298_100023098 | 200 |
| 489 | 3300001990 | JGI24737J22298_10008905 | JGI24737J22298_100089052 | 200 |
| 490 | 3300002075 | JGI24738J21930_10001891 | JGI24738J21930_100018914 | 200 |
| 491 | 3300005290 | Ga0065712_10180228 | Ga0065712_101802282 | 200 |
| 492 | 3300005293 | Ga0065715_10167000 | Ga0065715_101670001 | 200 |
| 493 | 3300005295 | Ga0065707_10321111 | Ga0065707_103211111 | 200 |
| 494 | 3300005327 | Ga0070658_10000107 | Ga0070658_1000010752 | 200 |
| 495 | 3300005327 | Ga0070658_10018716 | Ga0070658_100187162 | 200 |
| 496 | 3300005327 | Ga0070658_10107558 | Ga0070658_101075583 | 200 |
| 497 | 3300005327 | Ga0070658_10254386 | Ga0070658_102543862 | 200 |
| 498 | 3300005328 | Ga0070676_10201715 | Ga0070676_102017151 | 200 |
| 499 | 3300005328 | Ga0070676_10270820 | Ga0070676_102708202 | 200 |
| 500 | 3300005329 | Ga0070683_100000826 | Ga0070683_10000082616 | 200 |
| 501 | 3300005329 | Ga0070683_100041523 | Ga0070683_1000415232 | 200 |
| 502 | 3300005329 | Ga0070683_100055267 | Ga0070683_1000552672 | 200 |
| 503 | 3300005330 | Ga0070690_100311318 | Ga0070690_1003113181 | 200 |
| 504 | 3300005331 | Ga0070670_100001372 | Ga0070670_1000013729 | 200 |
| 505 | 3300005331 | Ga0070670_100007777 | Ga0070670_10000777710 | 200 |
| 506 | 3300005331 | Ga0070670_100007963 | Ga0070670_1000079634 | 200 |
| 507 | 3300005331 | Ga0070670_100022348 | Ga0070670_1000223486 | 200 |
| 508 | 3300005335 | Ga0070666_10000169 | Ga0070666_1000016922 | 200 |
| 509 | 3300005335 | Ga0070666_10047270 | Ga0070666_100472702 | 200 |
| 510 | 3300005335 | Ga0070666_10164829 | Ga0070666_101648292 | 200 |
| 511 | 3300005336 | Ga0070680_100299125 | Ga0070680_1002991252 | 200 |
| 512 | 3300005337 | Ga0070682_100041747 | Ga0070682_1000417473 | 200 |
| 513 | 3300005337 | Ga0070682_100166969 | Ga0070682_1001669692 | 200 |
| 514 | 3300005338 | Ga0068868_100108376 | Ga0068868_1001083763 | 200 |
| 515 | 3300005338 | Ga0068868_100169380 | Ga0068868_1001693801 | 200 |
| 516 | 3300005339 | Ga0070660_100000705 | Ga0070660_10000070519 | 200 |
| 517 | 3300005339 | Ga0070660_100028953 | Ga0070660_1000289532 | 200 |
| 518 | 3300005339 | Ga0070660_100055092 | Ga0070660_1000550921 | 200 |
| 519 | 3300005339 | Ga0070660_100471762 | Ga0070660_1004717622 | 200 |
| 520 | 3300005340 | Ga0070689_100400779 | Ga0070689_1004007792 | 200 |
| 521 | 3300005343 | Ga0070687_100085806 | Ga0070687_1000858062 | 200 |
| 522 | 3300005344 | Ga0070661_100000070 | Ga0070661_10000007014 | 200 |
| 523 | 3300005344 | Ga0070661_100012952 | Ga0070661_1000129526 | 200 |
| 524 | 3300005344 | Ga0070661_100182901 | Ga0070661_1001829012 | 200 |
| 525 | 3300005345 | Ga0070692_10012145 | Ga0070692_100121455 | 200 |
| 526 | 3300005345 | Ga0070692_10216770 | Ga0070692_102167702 | 200 |
| 527 | 3300005345 | Ga0070692_10318799 | Ga0070692_103187991 | 200 |
| 528 | 3300005347 | Ga0070668_100001895 | Ga0070668_1000018955 | 200 |
| 529 | 3300005347 | Ga0070668_100405204 | Ga0070668_1004052042 | 200 |
| 530 | 3300005353 | Ga0070669_100057112 | Ga0070669_1000571123 | 200 |
| 531 | 3300005353 | Ga0070669_100068084 | Ga0070669_1000680842 | 200 |
| 532 | 3300005353 | Ga0070669_100432002 | Ga0070669_1004320021 | 200 |
| 533 | 3300005353 | Ga0070669_100440128 | Ga0070669_1004401281 | 200 |
| 534 | 3300005355 | Ga0070671_100003153 | Ga0070671_10000315310 | 200 |
| 535 | 3300005355 | Ga0070671_100033882 | Ga0070671_1000338824 | 200 |
| 536 | 3300005355 | Ga0070671_100257883 | Ga0070671_1002578832 | 200 |
| 537 | 3300005356 | Ga0070674_100134573 | Ga0070674_1001345731 | 200 |
| 538 | 3300005364 | Ga0070673_100025088 | Ga0070673_1000250882 | 200 |
| 539 | 3300005364 | Ga0070673_100052062 | Ga0070673_1000520623 | 200 |
| 540 | 3300005364 | Ga0070673_100480694 | Ga0070673_1004806941 | 200 |
| 541 | 3300005366 | Ga0070659_100000045 | Ga0070659_10000004525 | 200 |
| 542 | 3300005366 | Ga0070659_100003703 | Ga0070659_1000037035 | 200 |
| 543 | 3300005366 | Ga0070659_100010096 | Ga0070659_1000100962 | 200 |
| 544 | 3300005366 | Ga0070659_100050724 | Ga0070659_1000507242 | 200 |
| 545 | 3300005366 | Ga0070659_100134715 | Ga0070659_1001347152 | 200 |
| 546 | 3300005366 | Ga0070659_100267616 | Ga0070659_1002676162 | 200 |
| 547 | 3300005366 | Ga0070659_100273396 | Ga0070659_1002733962 | 200 |
| 548 | 3300005367 | Ga0070667_100003638 | Ga0070667_1000036389 | 200 |
| 549 | 3300005367 | Ga0070667_100040943 | Ga0070667_1000409434 | 200 |
| 550 | 3300005367 | Ga0070667_100102216 | Ga0070667_1001022162 | 200 |
| 551 | 3300005367 | Ga0070667_100138264 | Ga0070667_1001382642 | 200 |
| 552 | 3300005367 | Ga0070667_100148793 | Ga0070667_1001487932 | 200 |
| 553 | 3300005367 | Ga0070667_100246053 | Ga0070667_1002460533 | 200 |
| 554 | 3300005367 | Ga0070667_100723793 | Ga0070667_1007237931 | 200 |
| 555 | 3300005367 | Ga0070667_100744870 | Ga0070667_1007448701 | 200 |
| 556 | 3300005444 | Ga0070694_100003942 | Ga0070694_1000039424 | 200 |
| 557 | 3300005444 | Ga0070694_100426483 | Ga0070694_1004264831 | 200 |
| 558 | 3300005455 | Ga0070663_100001742 | Ga0070663_10000174216 | 200 |
| 559 | 3300005455 | Ga0070663_100023452 | Ga0070663_1000234525 | 200 |
| 560 | 3300005455 | Ga0070663_100043555 | Ga0070663_1000435552 | 200 |
| 561 | 3300005455 | Ga0070663_100053536 | Ga0070663_1000535364 | 200 |
| 562 | 3300005455 | Ga0070663_100415732 | Ga0070663_1004157322 | 200 |
| 563 | 3300005456 | Ga0070678_100184162 | Ga0070678_1001841622 | 200 |
| 564 | 3300005456 | Ga0070678_100246471 | Ga0070678_1002464712 | 200 |
| 565 | 3300005457 | Ga0070662_100000037 | Ga0070662_1000000374 | 200 |
| 566 | 3300005457 | Ga0070662_100002727 | Ga0070662_1000027274 | 200 |
| 567 | 3300005457 | Ga0070662_100110696 | Ga0070662_1001106962 | 200 |
| 568 | 3300005458 | Ga0070681_10901276 | Ga0070681_109012761 | 200 |
| 569 | 3300005459 | Ga0068867_100060922 | Ga0068867_1000609223 | 200 |
| 570 | 3300005530 | Ga0070679_100132242 | Ga0070679_1001322421 | 200 |
| 571 | 3300005530 | Ga0070679_100277052 | Ga0070679_1002770522 | 200 |
| 572 | 3300005535 | Ga0070684_100003373 | Ga0070684_10000337315 | 200 |
| 573 | 3300005535 | Ga0070684_100010973 | Ga0070684_1000109734 | 200 |
| 574 | 3300005535 | Ga0070684_100152039 | Ga0070684_1001520391 | 200 |
| 575 | 3300005539 | Ga0068853_100000213 | Ga0068853_1000002134 | 200 |
| 576 | 3300005539 | Ga0068853_100046718 | Ga0068853_1000467185 | 200 |
| 577 | 3300005539 | Ga0068853_100149028 | Ga0068853_1001490282 | 200 |
| 578 | 3300005543 | Ga0070672_100074990 | Ga0070672_1000749902 | 200 |
| 579 | 3300005543 | Ga0070672_100172853 | Ga0070672_1001728532 | 200 |
| 580 | 3300005547 | Ga0070693_100000168 | Ga0070693_10000016812 | 200 |
| 581 | 3300005548 | Ga0070665_100001821 | Ga0070665_1000018219 | 200 |
| 582 | 3300005548 | Ga0070665_100012284 | Ga0070665_1000122849 | 200 |
| 583 | 3300005548 | Ga0070665_100028422 | Ga0070665_1000284223 | 200 |
| 584 | 3300005548 | Ga0070665_100787518 | Ga0070665_1007875182 | 200 |
| 585 | 3300005548 | Ga0070665_100954062 | Ga0070665_1009540621 | 200 |
| 586 | 3300005563 | Ga0068855_100000751 | Ga0068855_1000007516 | 200 |
| 587 | 3300005563 | Ga0068855_100047326 | Ga0068855_1000473263 | 200 |
| 588 | 3300005563 | Ga0068855_100672131 | Ga0068855_1006721312 | 200 |
| 589 | 3300005563 | Ga0068855_100763135 | Ga0068855_1007631352 | 200 |
| 590 | 3300005564 | Ga0070664_100000027 | Ga0070664_10000002796 | 200 |
| 591 | 3300005564 | Ga0070664_100000464 | Ga0070664_10000046436 | 200 |
| 592 | 3300005564 | Ga0070664_100003499 | Ga0070664_1000034997 | 200 |
| 593 | 3300005564 | Ga0070664_100017421 | Ga0070664_1000174214 | 200 |
| 594 | 3300005564 | Ga0070664_100072242 | Ga0070664_1000722423 | 200 |
| 595 | 3300005564 | Ga0070664_100434173 | Ga0070664_1004341731 | 200 |
| 596 | 3300005564 | Ga0070664_100481912 | Ga0070664_1004819122 | 200 |
| 597 | 3300005577 | Ga0068857_100013811 | Ga0068857_1000138115 | 200 |
| 598 | 3300005577 | Ga0068857_100025701 | Ga0068857_1000257016 | 200 |
| 599 | 3300005577 | Ga0068857_100198801 | Ga0068857_1001988013 | 200 |
| 600 | 3300005578 | Ga0068854_100005197 | Ga0068854_1000051971 | 200 |
| 601 | 3300005578 | Ga0068854_100010605 | Ga0068854_1000106055 | 200 |
| 602 | 3300005578 | Ga0068854_100047223 | Ga0068854_1000472231 | 200 |
| 603 | 3300005578 | Ga0068854_100114548 | Ga0068854_1001145482 | 200 |
| 604 | 3300005614 | Ga0068856_100000743 | Ga0068856_10000074313 | 200 |
| 605 | 3300005614 | Ga0068856_100052360 | Ga0068856_1000523603 | 200 |
| 606 | 3300005616 | Ga0068852_100000480 | Ga0068852_10000048017 | 200 |
| 607 | 3300005616 | Ga0068852_100213260 | Ga0068852_1002132603 | 200 |
| 608 | 3300005616 | Ga0068852_100234645 | Ga0068852_1002346453 | 200 |
| 609 | 3300005616 | Ga0068852_100428775 | Ga0068852_1004287752 | 200 |
| 610 | 3300005616 | Ga0068852_100576689 | Ga0068852_1005766892 | 200 |
| 611 | 3300005617 | Ga0068859_100003231 | Ga0068859_10000323110 | 200 |
| 612 | 3300005617 | Ga0068859_100039750 | Ga0068859_1000397502 | 200 |
| 613 | 3300005617 | Ga0068859_100073615 | Ga0068859_1000736154 | 200 |
| 614 | 3300005617 | Ga0068859_100124237 | Ga0068859_1001242373 | 200 |
| 615 | 3300005618 | Ga0068864_100026930 | Ga0068864_1000269305 | 200 |
| 616 | 3300005618 | Ga0068864_100087811 | Ga0068864_1000878112 | 200 |
| 617 | 3300005618 | Ga0068864_100170692 | Ga0068864_1001706922 | 200 |
| 618 | 3300005834 | Ga0068851_10002638 | Ga0068851_100026384 | 200 |
| 619 | 3300005834 | Ga0068851_10128098 | Ga0068851_101280982 | 200 |
| 620 | 3300005840 | Ga0068870_10465456 | Ga0068870_104654562 | 200 |
| 621 | 3300005841 | Ga0068863_100017105 | Ga0068863_1000171053 | 200 |
| 622 | 3300005841 | Ga0068863_100053201 | Ga0068863_1000532012 | 200 |
| 623 | 3300005841 | Ga0068863_100528722 | Ga0068863_1005287221 | 200 |
| 624 | 3300005842 | Ga0068858_100010567 | Ga0068858_1000105677 | 200 |
| 625 | 3300005842 | Ga0068858_100064108 | Ga0068858_1000641084 | 200 |
| 626 | 3300005842 | Ga0068858_100303237 | Ga0068858_1003032373 | 200 |
| 627 | 3300005842 | Ga0068858_100760785 | Ga0068858_1007607852 | 200 |
| 628 | 3300005843 | Ga0068860_100005048 | Ga0068860_10000504813 | 200 |
| 629 | 3300005843 | Ga0068860_100006336 | Ga0068860_1000063364 | 200 |
| 630 | 3300005843 | Ga0068860_100018770 | Ga0068860_1000187708 | 200 |
| 631 | 3300005843 | Ga0068860_100307669 | Ga0068860_1003076692 | 200 |
| 632 | 3300005844 | Ga0068862_100004011 | Ga0068862_10000401113 | 200 |
| 633 | 3300005844 | Ga0068862_100067965 | Ga0068862_1000679654 | 200 |
| 634 | 3300006237 | Ga0097621_100251394 | Ga0097621_1002513942 | 200 |
| 635 | 3300006237 | Ga0097621_100402133 | Ga0097621_1004021332 | 200 |
| 636 | 3300006358 | Ga0068871_100120013 | Ga0068871_1001200132 | 200 |
| 637 | 3300006844 | Ga0075428_100567981 | Ga0075428_1005679811 | 200 |
| 638 | 3300006852 | Ga0075433_10008969 | Ga0075433_100089699 | 200 |
| 639 | 3300006852 | Ga0075433_10070855 | Ga0075433_100708551 | 200 |
| 640 | 3300006871 | Ga0075434_100496963 | Ga0075434_1004969632 | 200 |
| 641 | 3300006881 | Ga0068865_100186668 | Ga0068865_1001866681 | 200 |
| 642 | 3300006931 | Ga0097620_100003231 | Ga0097620_10000323110 | 200 |
| 643 | 3300006931 | Ga0097620_100039749 | Ga0097620_1000397492 | 200 |
| 644 | 3300006931 | Ga0097620_100073618 | Ga0097620_1000736184 | 200 |
| 645 | 3300006931 | Ga0097620_100124244 | Ga0097620_1001242443 | 200 |
| 646 | 3300007076 | Ga0075435_100583628 | Ga0075435_1005836281 | 200 |
| 647 | 3300009092 | Ga0105250_10126986 | Ga0105250_101269862 | 200 |
| 648 | 3300009093 | Ga0105240_10114679 | Ga0105240_101146792 | 200 |
| 649 | 3300009093 | Ga0105240_10116525 | Ga0105240_101165252 | 200 |
| 650 | 3300009093 | Ga0105240_10243406 | Ga0105240_102434062 | 200 |
| 651 | 3300009148 | Ga0105243_10250746 | Ga0105243_102507461 | 200 |
| 652 | 3300009148 | Ga0105243_10447926 | Ga0105243_104479261 | 200 |
| 653 | 3300009174 | Ga0105241_10005313 | Ga0105241_100053136 | 200 |
| 654 | 3300009174 | Ga0105241_10101656 | Ga0105241_101016562 | 200 |
| 655 | 3300009174 | Ga0105241_10398531 | Ga0105241_103985311 | 200 |
| 656 | 3300009176 | Ga0105242_10047939 | Ga0105242_100479392 | 200 |
| 657 | 3300009177 | Ga0105248_10006665 | Ga0105248_100066657 | 200 |
| 658 | 3300009177 | Ga0105248_10340645 | Ga0105248_103406452 | 200 |
| 659 | 3300009177 | Ga0105248_10458189 | Ga0105248_104581892 | 200 |
| 660 | 3300009177 | Ga0105248_10819462 | Ga0105248_108194622 | 200 |
| 661 | 3300009177 | Ga0105248_10846177 | Ga0105248_108461771 | 200 |
| 662 | 3300009545 | Ga0105237_10396280 | Ga0105237_103962801 | 200 |
| 663 | 3300009551 | Ga0105238_10108986 | Ga0105238_101089864 | 200 |
| 664 | 3300009553 | Ga0105249_10013203 | Ga0105249_100132036 | 200 |
| 665 | 3300009553 | Ga0105249_10091563 | Ga0105249_100915632 | 200 |
| 666 | 3300009553 | Ga0105249_10181325 | Ga0105249_101813252 | 200 |
| 667 | 3300010375 | Ga0105239_10039562 | Ga0105239_100395625 | 200 |
| 668 | 3300010375 | Ga0105239_10238101 | Ga0105239_102381013 | 200 |
| 669 | 3300011119 | Ga0105246_10032838 | Ga0105246_100328381 | 200 |
| 670 | 3300011119 | Ga0105246_10134046 | Ga0105246_101340462 | 200 |
| 671 | 3300013100 | Ga0157373_10257573 | Ga0157373_102575732 | 200 |
| 672 | 3300013100 | Ga0157373_10474380 | Ga0157373_104743802 | 200 |
| 673 | 3300013102 | Ga0157371_10047525 | Ga0157371_100475252 | 200 |
| 674 | 3300013102 | Ga0157371_10125739 | Ga0157371_101257393 | 200 |
| 675 | 3300013296 | Ga0157374_10003502 | Ga0157374_1000350211 | 200 |
| 676 | 3300013306 | Ga0163162_10218879 | Ga0163162_102188793 | 200 |
| 677 | 3300013306 | Ga0163162_10566753 | Ga0163162_105667532 | 200 |
| 678 | 3300013307 | Ga0157372_10260025 | Ga0157372_102600252 | 200 |
| 679 | 3300013307 | Ga0157372_10733913 | Ga0157372_107339131 | 200 |
| 680 | 3300013308 | Ga0157375_10009605 | Ga0157375_100096054 | 200 |
| 681 | 3300013308 | Ga0157375_10944581 | Ga0157375_109445811 | 200 |
| 682 | 3300013308 | Ga0157375_11314225 | Ga0157375_113142252 | 200 |
| 683 | 3300014325 | Ga0163163_10870712 | Ga0163163_108707122 | 200 |
| 684 | 3300014745 | Ga0157377_10219471 | Ga0157377_102194712 | 200 |
| 685 | 3300017792 | Ga0163161_10299599 | Ga0163161_102995991 | 200 |
| 686 | 3300017792 | Ga0163161_10329381 | Ga0163161_103293812 | 200 |
| 687 | 3300020070 | Ga0206356_11673347 | Ga0206356_116733471 | 200 |
| 688 | 3300025304 | Ga0209257_1049869 | Ga0209257_10498692 | 200 |
| 689 | 3300025315 | Ga0207697_10041776 | Ga0207697_100417762 | 200 |
| 690 | 3300025315 | Ga0207697_10070286 | Ga0207697_100702862 | 200 |
| 691 | 3300025321 | Ga0207656_10024729 | Ga0207656_100247293 | 200 |
| 692 | 3300025903 | Ga0207680_10002046 | Ga0207680_1000204610 | 200 |
| 693 | 3300025903 | Ga0207680_10145911 | Ga0207680_101459112 | 200 |
| 694 | 3300025903 | Ga0207680_10247598 | Ga0207680_102475981 | 200 |
| 695 | 3300025903 | Ga0207680_10396140 | Ga0207680_103961401 | 200 |
| 696 | 3300025903 | Ga0207680_10556008 | Ga0207680_105560081 | 200 |
| 697 | 3300025904 | Ga0207647_10005894 | Ga0207647_100058946 | 200 |
| 698 | 3300025904 | Ga0207647_10007004 | Ga0207647_100070049 | 200 |
| 699 | 3300025904 | Ga0207647_10024446 | Ga0207647_100244465 | 200 |
| 700 | 3300025904 | Ga0207647_10077080 | Ga0207647_100770802 | 200 |
| 701 | 3300025907 | Ga0207645_10121125 | Ga0207645_101211252 | 200 |
| 702 | 3300025907 | Ga0207645_10123540 | Ga0207645_101235402 | 200 |
| 703 | 3300025909 | Ga0207705_10000086 | Ga0207705_1000008676 | 200 |
| 704 | 3300025909 | Ga0207705_10001490 | Ga0207705_1000149015 | 200 |
| 705 | 3300025909 | Ga0207705_10097794 | Ga0207705_100977942 | 200 |
| 706 | 3300025909 | Ga0207705_10193140 | Ga0207705_101931402 | 200 |
| 707 | 3300025911 | Ga0207654_10043613 | Ga0207654_100436134 | 200 |
| 708 | 3300025911 | Ga0207654_10093829 | Ga0207654_100938292 | 200 |
| 709 | 3300025912 | Ga0207707_10301106 | Ga0207707_103011061 | 200 |
| 710 | 3300025913 | Ga0207695_10143752 | Ga0207695_101437523 | 200 |
| 711 | 3300025917 | Ga0207660_10456874 | Ga0207660_104568742 | 200 |
| 712 | 3300025917 | Ga0207660_10493087 | Ga0207660_104930872 | 200 |
| 713 | 3300025918 | Ga0207662_10017339 | Ga0207662_100173391 | 200 |
| 714 | 3300025919 | Ga0207657_10000133 | Ga0207657_100001338 | 200 |
| 715 | 3300025919 | Ga0207657_10007346 | Ga0207657_100073468 | 200 |
| 716 | 3300025919 | Ga0207657_10061211 | Ga0207657_100612114 | 200 |
| 717 | 3300025919 | Ga0207657_10093535 | Ga0207657_100935352 | 200 |
| 718 | 3300025920 | Ga0207649_10000629 | Ga0207649_1000062920 | 200 |
| 719 | 3300025920 | Ga0207649_10005572 | Ga0207649_100055724 | 200 |
| 720 | 3300025920 | Ga0207649_10149880 | Ga0207649_101498802 | 200 |
| 721 | 3300025920 | Ga0207649_10175924 | Ga0207649_101759241 | 200 |
| 722 | 3300025920 | Ga0207649_10294147 | Ga0207649_102941472 | 200 |
| 723 | 3300025921 | Ga0207652_10179818 | Ga0207652_101798182 | 200 |
| 724 | 3300025923 | Ga0207681_10044987 | Ga0207681_100449872 | 200 |
| 725 | 3300025923 | Ga0207681_10079048 | Ga0207681_100790482 | 200 |
| 726 | 3300025923 | Ga0207681_10299821 | Ga0207681_102998212 | 200 |
| 727 | 3300025923 | Ga0207681_10509429 | Ga0207681_105094291 | 200 |
| 728 | 3300025924 | Ga0207694_10023725 | Ga0207694_100237255 | 200 |
| 729 | 3300025925 | Ga0207650_10013303 | Ga0207650_100133032 | 200 |
| 730 | 3300025925 | Ga0207650_10013753 | Ga0207650_100137532 | 200 |
| 731 | 3300025925 | Ga0207650_10039279 | Ga0207650_100392793 | 200 |
| 732 | 3300025925 | Ga0207650_10197287 | Ga0207650_101972872 | 200 |
| 733 | 3300025926 | Ga0207659_10159746 | Ga0207659_101597462 | 200 |
| 734 | 3300025931 | Ga0207644_10023452 | Ga0207644_100234525 | 200 |
| 735 | 3300025931 | Ga0207644_10210635 | Ga0207644_102106352 | 200 |
| 736 | 3300025932 | Ga0207690_10000265 | Ga0207690_1000026535 | 200 |
| 737 | 3300025932 | Ga0207690_10005349 | Ga0207690_100053498 | 200 |
| 738 | 3300025932 | Ga0207690_10007225 | Ga0207690_100072257 | 200 |
| 739 | 3300025932 | Ga0207690_10027765 | Ga0207690_100277655 | 200 |
| 740 | 3300025932 | Ga0207690_10034448 | Ga0207690_100344483 | 200 |
| 741 | 3300025932 | Ga0207690_10169200 | Ga0207690_101692002 | 200 |
| 742 | 3300025932 | Ga0207690_10387202 | Ga0207690_103872022 | 200 |
| 743 | 3300025933 | Ga0207706_10000159 | Ga0207706_100001598 | 200 |
| 744 | 3300025933 | Ga0207706_10010750 | Ga0207706_100107504 | 200 |
| 745 | 3300025933 | Ga0207706_10015205 | Ga0207706_100152052 | 200 |
| 746 | 3300025933 | Ga0207706_10434245 | Ga0207706_104342452 | 200 |
| 747 | 3300025935 | Ga0207709_10167607 | Ga0207709_101676071 | 200 |
| 748 | 3300025936 | Ga0207670_10459076 | Ga0207670_104590761 | 200 |
| 749 | 3300025937 | Ga0207669_10039379 | Ga0207669_100393793 | 200 |
| 750 | 3300025940 | Ga0207691_10002508 | Ga0207691_1000250810 | 200 |
| 751 | 3300025940 | Ga0207691_10091393 | Ga0207691_100913932 | 200 |
| 752 | 3300025940 | Ga0207691_10124016 | Ga0207691_101240162 | 200 |
| 753 | 3300025940 | Ga0207691_10397325 | Ga0207691_103973252 | 200 |
| 754 | 3300025941 | Ga0207711_10000914 | Ga0207711_1000091417 | 200 |
| 755 | 3300025941 | Ga0207711_10226069 | Ga0207711_102260692 | 200 |
| 756 | 3300025941 | Ga0207711_10530609 | Ga0207711_105306092 | 200 |
| 757 | 3300025941 | Ga0207711_10876412 | Ga0207711_108764122 | 200 |
| 758 | 3300025942 | Ga0207689_10012090 | Ga0207689_100120907 | 200 |
| 759 | 3300025944 | Ga0207661_10002539 | Ga0207661_100025392 | 200 |
| 760 | 3300025944 | Ga0207661_10004214 | Ga0207661_100042147 | 200 |
| 761 | 3300025945 | Ga0207679_10000321 | Ga0207679_1000032128 | 200 |
| 762 | 3300025945 | Ga0207679_10004415 | Ga0207679_100044152 | 200 |
| 763 | 3300025945 | Ga0207679_10091640 | Ga0207679_100916402 | 200 |
| 764 | 3300025945 | Ga0207679_10105411 | Ga0207679_101054113 | 200 |
| 765 | 3300025945 | Ga0207679_10152575 | Ga0207679_101525752 | 200 |
| 766 | 3300025945 | Ga0207679_10222062 | Ga0207679_102220622 | 200 |
| 767 | 3300025949 | Ga0207667_10011837 | Ga0207667_1001183710 | 200 |
| 768 | 3300025949 | Ga0207667_10018472 | Ga0207667_100184726 | 200 |
| 769 | 3300025949 | Ga0207667_10019245 | Ga0207667_100192455 | 200 |
| 770 | 3300025949 | Ga0207667_10143974 | Ga0207667_101439742 | 200 |
| 771 | 3300025949 | Ga0207667_10182548 | Ga0207667_101825482 | 200 |
| 772 | 3300025949 | Ga0207667_10285351 | Ga0207667_102853512 | 200 |
| 773 | 3300025949 | Ga0207667_10567793 | Ga0207667_105677931 | 200 |
| 774 | 3300025949 | Ga0207667_11115720 | Ga0207667_111157201 | 200 |
| 775 | 3300025960 | Ga0207651_10061400 | Ga0207651_100614003 | 200 |
| 776 | 3300025960 | Ga0207651_10114671 | Ga0207651_101146712 | 200 |
| 777 | 3300025961 | Ga0207712_10002871 | Ga0207712_1000287111 | 200 |
| 778 | 3300025961 | Ga0207712_10030262 | Ga0207712_100302624 | 200 |
| 779 | 3300025961 | Ga0207712_10307544 | Ga0207712_103075443 | 200 |
| 780 | 3300025972 | Ga0207668_10006655 | Ga0207668_100066552 | 200 |
| 781 | 3300025972 | Ga0207668_10215233 | Ga0207668_102152331 | 200 |
| 782 | 3300025972 | Ga0207668_10749156 | Ga0207668_107491561 | 200 |
| 783 | 3300025981 | Ga0207640_10001594 | Ga0207640_100015946 | 200 |
| 784 | 3300025981 | Ga0207640_10072761 | Ga0207640_100727611 | 200 |
| 785 | 3300025981 | Ga0207640_10329837 | Ga0207640_103298372 | 200 |
| 786 | 3300025981 | Ga0207640_10448839 | Ga0207640_104488391 | 200 |
| 787 | 3300025986 | Ga0207658_10012396 | Ga0207658_1001239610 | 200 |
| 788 | 3300025986 | Ga0207658_10014851 | Ga0207658_100148513 | 200 |
| 789 | 3300025986 | Ga0207658_10077914 | Ga0207658_100779143 | 200 |
| 790 | 3300025986 | Ga0207658_10336990 | Ga0207658_103369902 | 200 |
| 791 | 3300025986 | Ga0207658_10722577 | Ga0207658_107225771 | 200 |
| 792 | 3300026023 | Ga0207677_10156709 | Ga0207677_101567091 | 200 |
| 793 | 3300026023 | Ga0207677_10260576 | Ga0207677_102605763 | 200 |
| 794 | 3300026035 | Ga0207703_10005442 | Ga0207703_100054422 | 200 |
| 795 | 3300026035 | Ga0207703_10148060 | Ga0207703_101480603 | 200 |
| 796 | 3300026035 | Ga0207703_10179806 | Ga0207703_101798061 | 200 |
| 797 | 3300026035 | Ga0207703_10268712 | Ga0207703_102687121 | 200 |
| 798 | 3300026041 | Ga0207639_10000137 | Ga0207639_1000013749 | 200 |
| 799 | 3300026041 | Ga0207639_10022416 | Ga0207639_100224164 | 200 |
| 800 | 3300026041 | Ga0207639_10105871 | Ga0207639_101058712 | 200 |
| 801 | 3300026041 | Ga0207639_10167788 | Ga0207639_101677881 | 200 |
| 802 | 3300026041 | Ga0207639_10584797 | Ga0207639_105847972 | 200 |
| 803 | 3300026067 | Ga0207678_10004220 | Ga0207678_100042205 | 200 |
| 804 | 3300026067 | Ga0207678_10004502 | Ga0207678_1000450216 | 200 |
| 805 | 3300026067 | Ga0207678_10019805 | Ga0207678_100198052 | 200 |
| 806 | 3300026067 | Ga0207678_10435364 | Ga0207678_104353642 | 200 |
| 807 | 3300026067 | Ga0207678_10435673 | Ga0207678_104356732 | 200 |
| 808 | 3300026078 | Ga0207702_10002212 | Ga0207702_1000221212 | 200 |
| 809 | 3300026078 | Ga0207702_10014217 | Ga0207702_100142174 | 200 |
| 810 | 3300026078 | Ga0207702_10054567 | Ga0207702_100545675 | 200 |
| 811 | 3300026088 | Ga0207641_10010994 | Ga0207641_100109942 | 200 |
| 812 | 3300026088 | Ga0207641_10041216 | Ga0207641_100412163 | 200 |
| 813 | 3300026088 | Ga0207641_10048376 | Ga0207641_100483762 | 200 |
| 814 | 3300026088 | Ga0207641_10336430 | Ga0207641_103364301 | 200 |
| 815 | 3300026089 | Ga0207648_10018823 | Ga0207648_100188236 | 200 |
| 816 | 3300026095 | Ga0207676_10044425 | Ga0207676_100444252 | 200 |
| 817 | 3300026095 | Ga0207676_10215112 | Ga0207676_102151122 | 200 |
| 818 | 3300026116 | Ga0207674_10008633 | Ga0207674_100086336 | 200 |
| 819 | 3300026116 | Ga0207674_10009133 | Ga0207674_1000913315 | 200 |
| 820 | 3300026116 | Ga0207674_10021572 | Ga0207674_100215722 | 200 |
| 821 | 3300026116 | Ga0207674_10032449 | Ga0207674_100324494 | 200 |
| 822 | 3300026116 | Ga0207674_10530885 | Ga0207674_105308851 | 200 |
| 823 | 3300026118 | Ga0207675_100095478 | Ga0207675_1000954783 | 200 |
| 824 | 3300026118 | Ga0207675_100149547 | Ga0207675_1001495472 | 200 |
| 825 | 3300026121 | Ga0207683_10007475 | Ga0207683_100074753 | 200 |
| 826 | 3300026142 | Ga0207698_10000443 | Ga0207698_100004436 | 200 |
| 827 | 3300026142 | Ga0207698_10029189 | Ga0207698_100291893 | 200 |
| 828 | 3300026142 | Ga0207698_10057009 | Ga0207698_100570092 | 200 |
| 829 | 3300028379 | Ga0268266_10004939 | Ga0268266_1000493914 | 200 |
| 830 | 3300028379 | Ga0268266_10039609 | Ga0268266_100396094 | 200 |
| 831 | 3300028379 | Ga0268266_10612069 | Ga0268266_106120692 | 200 |
| 832 | 3300028380 | Ga0268265_10018988 | Ga0268265_100189885 | 200 |
| 833 | 3300028380 | Ga0268265_11360642 | Ga0268265_113606421 | 200 |
| 834 | 3300028381 | Ga0268264_10002566 | Ga0268264_1000256614 | 200 |
| 835 | 3300028381 | Ga0268264_10043634 | Ga0268264_100436343 | 200 |
| 836 | 3300028381 | Ga0268264_10369726 | Ga0268264_103697262 | 200 |
| 837 | 3300031731 | Ga0307405_10120063 | Ga0307405_101200631 | 200 |
| 838 | 3300031824 | Ga0307413_10303659 | Ga0307413_103036592 | 200 |
| 839 | 3300031852 | Ga0307410_10006140 | Ga0307410_100061404 | 200 |
| 840 | 3300031852 | Ga0307410_10008279 | Ga0307410_100082792 | 200 |
| 841 | 3300031852 | Ga0307410_10072657 | Ga0307410_100726572 | 200 |
| 842 | 3300031901 | Ga0307406_10069102 | Ga0307406_100691022 | 200 |
| 843 | 3300031903 | Ga0307407_10003352 | Ga0307407_100033529 | 200 |
| 844 | 3300031911 | Ga0307412_10278431 | Ga0307412_102784312 | 200 |
| 845 | 3300031995 | Ga0307409_100841904 | Ga0307409_1008419041 | 200 |
| 846 | 3300032002 | Ga0307416_100025110 | Ga0307416_1000251102 | 200 |
| 847 | 3300032004 | Ga0307414_10005643 | Ga0307414_100056434 | 200 |
| 848 | 3300032004 | Ga0307414_10681570 | Ga0307414_106815701 | 200 |
| 849 | 3300032005 | Ga0307411_10003870 | Ga0307411_100038703 | 200 |
| 850 | 3300032005 | Ga0307411_10037211 | Ga0307411_100372112 | 200 |
| 851 | 3300032005 | Ga0307411_10766554 | Ga0307411_107665541 | 200 |
| 852 | 3300032126 | Ga0307415_100709819 | Ga0307415_1007098191 | 200 |
| 853 | 3300035691 | Ga0373931_0136058 | Ga0373931_0136058_331_954 | 200 |
| 854 | 3300037312 | Ga0395899_0321871 | Ga0395899_0321871_412_1014 | 200 |
| 855 | 3300037418 | Ga0395900_0057853 | Ga0395900_0057853_2671_3288 | 200 |
| 856 | 3300037418 | Ga0395900_0131059 | Ga0395900_0131059_1470_2087 | 200 |
| 857 | 3300037466 | Ga0395898_0177987 | Ga0395898_0177987_261_878 | 200 |
| 858 | 3300037466 | Ga0395898_0591212 | Ga0395898_0591212_129_746 | 200 |
| 859 | 3300037471 | Ga0395905_0096505 | Ga0395905_0096505_537_1154 | 200 |
| 860 | 3300037471 | Ga0395905_0174149 | Ga0395905_0174149_1155_1772 | 200 |
| 861 | 3300037471 | Ga0395905_0565623 | Ga0395905_0565623_44_646 | 200 |
| 862 | 3300038443 | Ga0395901_0061862 | Ga0395901_0061862_2691_3308 | 200 |
| 863 | 3300038443 | Ga0395901_0167628 | Ga0395901_0167628_1514_2131 | 200 |
| 864 | 3300038443 | Ga0395901_0185106 | Ga0395901_0185106_484_1086 | 200 |
| 865 | 3300038443 | Ga0395901_0214642 | Ga0395901_0214642_989_1606 | 200 |
| 866 | 3300042006 | Ga0439432_027031 | Ga0439432_027031_260_877 | 200 |
| 867 | 3300042007 | Ga0439449_0028910 | Ga0439449_0028910_974_1591 | 200 |
| 868 | 3300044693 | Ga0466961_0087329 | Ga0466961_0087329_1018_1653 | 200 |
| 869 | 3300044694 | Ga0466963_0176344 | Ga0466963_0176344_597_1199 | 200 |
| 870 | 3300045049 | Ga0466959_0034632 | Ga0466959_0034632_2092_2727 | 200 |
| 871 | 3300045836 | Ga0466958_0052869 | Ga0466958_0052869_445_1080 | 200 |
| 872 | 3300046525 | Ga0495663_0005710 | Ga0495663_0005710_134_751 | 200 |
| 873 | 3300046525 | Ga0495663_0022592 | Ga0495663_0022592_221_838 | 200 |
| 874 | 3300046525 | Ga0495663_0024465 | Ga0495663_0024465_714_1331 | 200 |
| 875 | 3300046539 | Ga0495621_0013166 | Ga0495621_0013166_1886_2503 | 200 |
| 876 | 3300046665 | Ga0495661_0034543 | Ga0495661_0034543_81_698 | 200 |
| 877 | 3300046684 | Ga0495669_0000854 | Ga0495669_0000854_11938_12555 | 200 |
| 878 | 3300046684 | Ga0495669_0002396 | Ga0495669_0002396_1361_1978 | 200 |
| 879 | 3300046684 | Ga0495669_0058298 | Ga0495669_0058298_824_1441 | 200 |
| 880 | 3300046691 | Ga0495670_0044687 | Ga0495670_0044687_490_1107 | 200 |
| 881 | 3300047470 | Ga0495681_0040590 | Ga0495681_0040590_911_1528 | 200 |
| 882 | 3300048910 | Ga0496107_0084381 | Ga0496107_0084381_327_944 | 200 |
| 883 | 3300048911 | Ga0496108_0895572 | Ga0496108_0895572_106_747 | 200 |
| 884 | 3300048912 | Ga0496109_0044431 | Ga0496109_0044431_3292_3933 | 200 |
| 885 | 3300048912 | Ga0496109_0142424 | Ga0496109_0142424_272_889 | 200 |
| 886 | 3300048913 | Ga0496110_0003604 | Ga0496110_0003604_5821_6438 | 200 |
| 887 | 3300048913 | Ga0496110_0373279 | Ga0496110_0373279_146_763 | 200 |
| 888 | 3300048914 | Ga0496111_0205274 | Ga0496111_0205274_154_771 | 200 |
| 889 | 3300048917 | Ga0496114_0030559 | Ga0496114_0030559_3587_4204 | 200 |
| 890 | 3300050512 | nmdc:mga0n895_568992_c1 | nmdc:mga0n895_568992_c1_373_1011 | 200 |
| 891 | 3300050515 | nmdc:mga0a205_10273_c1 | nmdc:mga0a205_10273_c1_3925_4548 | 200 |
| 892 | 3300050515 | nmdc:mga0a205_4191_c1 | nmdc:mga0a205_4191_c1_7599_8216 | 200 |
| 893 | 3300053083 | Ga0495655_0004664 | Ga0495655_0004664_1412_2029 | 200 |
| 894 | 3300053158 | Ga0500627_0031294 | Ga0500627_0031294_288_905 | 200 |
| 895 | 3300061719 | Ga0466962_0119706 | Ga0466962_0119706_287_922 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar