F484977

General Info

Members Datasets Scaffolds Average Seq Length
895 242 895 201

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10047749|Ga0182008_100477492
Length 213
Sequence VSVSGTASRPRTGVARPGKLEESELLGRVGGGDLHAFERLYRIYQPRLARFLINLVQRPQLVEEVLNDTMMVVWQTAGKFRGASKPSTWIFSIAYRKAMKAKARWPDPVEEPTDERVSADPAPDEDLDRQRLHDALVNAMDQLSADHRAVVDLTYFHGMGYREIAEIMGCPVDTVKTRMFHARRRLRQSTCVAWPMTTCRSCEMRRTVAPCSD

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
199 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
241 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 2.68
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000429 3300001904 Bacteria 7898
2 JGI24740J21852_10023652 3300001979 Unclassified 2095
3 JGI24740J21852_10039507 3300001979 Bacteria 1438
4 JGI24740J21852_10064961 3300001979 Unclassified 994
5 JGI24740J21852_10083333 3300001979 Bacteria 834
6 JGI24739J22299_10000896 3300001989 Bacteria 11013
7 JGI24737J22298_10000355 3300001990 Bacteria 15479
8 JGI24737J22298_10002309 3300001990 Bacteria 6786
9 JGI24737J22298_10008905 3300001990 Bacteria 3348
10 JGI24737J22298_10017460 3300001990 Bacteria 2310
11 JGI24737J22298_10069308 3300001990 Bacteria 1054
12 JGI24735J21928_10002044 3300002067 Bacteria 7106
13 JGI24738J21930_10001455 3300002075 Bacteria 6579
14 JGI24738J21930_10001891 3300002075 Bacteria 5659
15 rootH1_10158387 3300003316 Bacteria 2119
16 rootL2_10051997 3300003322 Bacteria 18411
17 Ga0058859_10020293 3300004798 Bacteria 2617
18 Ga0065712_10180228 3300005290 Bacteria 1194
19 Ga0065715_10017383 3300005293 Bacteria 2762
20 Ga0065715_10167000 3300005293 Bacteria 1564
21 Ga0065707_10321111 3300005295 Bacteria 966
22 Ga0070658_10000107 3300005327 Bacteria 73895
23 Ga0070658_10015142 3300005327 Bacteria 6172
24 Ga0070658_10018716 3300005327 Bacteria 5548
25 Ga0070658_10107558 3300005327 Bacteria 2308
26 Ga0070658_10254386 3300005327 Bacteria 1490
27 Ga0070658_10276256 3300005327 Bacteria 1429
28 Ga0070658_10572032 3300005327 Unclassified 978
29 Ga0070676_10090430 3300005328 Bacteria 1874
30 Ga0070676_10152142 3300005328 Unclassified 1482
31 Ga0070676_10201715 3300005328 Bacteria 1304
32 Ga0070676_10270820 3300005328 Bacteria 1140
33 Ga0070683_100000826 3300005329 Bacteria 22957
34 Ga0070683_100005337 3300005329 Bacteria 10714
35 Ga0070683_100041523 3300005329 Bacteria 4232
36 Ga0070683_100055267 3300005329 Bacteria 3684
37 Ga0070683_100117752 3300005329 Unclassified 2508
38 Ga0070690_100311318 3300005330 Bacteria 1132
39 Ga0070670_100001372 3300005331 Bacteria 19498
40 Ga0070670_100002145 3300005331 Bacteria 16197
41 Ga0070670_100007777 3300005331 Bacteria 9123
42 Ga0070670_100007963 3300005331 Bacteria 9013
43 Ga0070670_100022348 3300005331 Bacteria 5445
44 Ga0070670_100140360 3300005331 Bacteria 2089
45 Ga0068869_100000230 3300005334 Bacteria 29349
46 Ga0068869_100073353 3300005334 Bacteria 2537
47 Ga0070666_10000169 3300005335 Bacteria 45092
48 Ga0070666_10027596 3300005335 Bacteria 3720
49 Ga0070666_10047270 3300005335 Bacteria 2889
50 Ga0070666_10112252 3300005335 Bacteria 1885
51 Ga0070666_10149335 3300005335 Bacteria 1630
52 Ga0070666_10164829 3300005335 Unclassified 1550
53 Ga0070680_100002564 3300005336 Bacteria 13439
54 Ga0070680_100002845 3300005336 Bacteria 12866
55 Ga0070680_100299125 3300005336 Bacteria 1364
56 Ga0070682_100041747 3300005337 Bacteria 2829
57 Ga0070682_100166969 3300005337 Bacteria 1526
58 Ga0068868_100013097 3300005338 Bacteria 6073
59 Ga0068868_100108376 3300005338 Bacteria 2254
60 Ga0068868_100169380 3300005338 Bacteria 1808
61 Ga0070660_100000705 3300005339 Bacteria 22109
62 Ga0070660_100001061 3300005339 Bacteria 18495
63 Ga0070660_100011817 3300005339 Bacteria 6220
64 Ga0070660_100028953 3300005339 Bacteria 4148
65 Ga0070660_100055092 3300005339 Unclassified 3072
66 Ga0070660_100079553 3300005339 Unclassified 2572
67 Ga0070660_100471762 3300005339 Unclassified 1042
68 Ga0070689_100400779 3300005340 Bacteria 1160
69 Ga0070689_101066646 3300005340 Unclassified 721
70 Ga0070691_10009124 3300005341 Bacteria 4534
71 Ga0070687_100085806 3300005343 Bacteria 1729
72 Ga0070661_100000070 3300005344 Bacteria 82818
73 Ga0070661_100001787 3300005344 Bacteria 14912
74 Ga0070661_100012952 3300005344 Bacteria 5845
75 Ga0070661_100013745 3300005344 Bacteria 5686
76 Ga0070661_100022816 3300005344 Bacteria 4481
77 Ga0070661_100049439 3300005344 Bacteria 3078
78 Ga0070661_100147628 3300005344 Bacteria 1776
79 Ga0070661_100182901 3300005344 Bacteria 1595
80 Ga0070692_10011678 3300005345 Bacteria 4039
81 Ga0070692_10012145 3300005345 Bacteria 3975
82 Ga0070692_10017276 3300005345 Unclassified 3445
83 Ga0070692_10216770 3300005345 Unclassified 1129
84 Ga0070692_10237705 3300005345 Bacteria 1084
85 Ga0070692_10318799 3300005345 Bacteria 955
86 Ga0070668_100001895 3300005347 Bacteria 15294
87 Ga0070668_100026740 3300005347 Bacteria 4380
88 Ga0070668_100357678 3300005347 Unclassified 1237
89 Ga0070668_100405204 3300005347 Bacteria 1165
90 Ga0070669_100005470 3300005353 Bacteria 9167
91 Ga0070669_100057112 3300005353 Bacteria 2863
92 Ga0070669_100068084 3300005353 Bacteria 2627
93 Ga0070669_100432002 3300005353 Unclassified 1082
94 Ga0070669_100440128 3300005353 Bacteria 1073
95 Ga0070675_100076235 3300005354 Bacteria 2789
96 Ga0070675_100239461 3300005354 Bacteria 1585
97 Ga0070671_100003153 3300005355 Bacteria 12853
98 Ga0070671_100025514 3300005355 Bacteria 4850
99 Ga0070671_100033882 3300005355 Bacteria 4226
100 Ga0070671_100143805 3300005355 Bacteria 2013
101 Ga0070671_100257883 3300005355 Bacteria 1482
102 Ga0070674_100134573 3300005356 Bacteria 1847
103 Ga0070673_100000535 3300005364 Bacteria 20475
104 Ga0070673_100025088 3300005364 Bacteria 4382
105 Ga0070673_100052062 3300005364 Bacteria 3211
106 Ga0070673_100480694 3300005364 Bacteria 1121
107 Ga0070659_100000045 3300005366 Bacteria 101520
108 Ga0070659_100001166 3300005366 Bacteria 19212
109 Ga0070659_100003703 3300005366 Bacteria 10905
110 Ga0070659_100003728 3300005366 Bacteria 10871
111 Ga0070659_100005162 3300005366 Bacteria 9365
112 Ga0070659_100010096 3300005366 Bacteria 6950
113 Ga0070659_100050724 3300005366 Unclassified 3262
114 Ga0070659_100134715 3300005366 Bacteria 2008
115 Ga0070659_100267616 3300005366 Bacteria 1419
116 Ga0070659_100273396 3300005366 Unclassified 1404
117 Ga0070659_100286720 3300005366 Bacteria 1370
118 Ga0070667_100003638 3300005367 Bacteria 13121
119 Ga0070667_100008232 3300005367 Bacteria 8643
120 Ga0070667_100040943 3300005367 Bacteria 3886
121 Ga0070667_100102216 3300005367 Bacteria 2476
122 Ga0070667_100107881 3300005367 Bacteria 2411
123 Ga0070667_100138264 3300005367 Bacteria 2131
124 Ga0070667_100148793 3300005367 Unclassified 2055
125 Ga0070667_100246053 3300005367 Unclassified 1598
126 Ga0070667_100723793 3300005367 Bacteria 921
127 Ga0070667_100744870 3300005367 Bacteria 908
128 Ga0070709_10023808 3300005434 Bacteria 3600
129 Ga0070714_100030110 3300005435 Bacteria 4516
130 Ga0070714_100039056 3300005435 Bacteria 3995
131 Ga0070714_100064263 3300005435 Bacteria 3158
132 Ga0070714_100153584 3300005435 Bacteria 2077
133 Ga0070714_100282172 3300005435 Bacteria 1543
134 Ga0070713_100005496 3300005436 Bacteria 8675
135 Ga0070713_100108629 3300005436 Bacteria 2415
136 Ga0070700_100110298 3300005441 Bacteria 1828
137 Ga0070694_100003942 3300005444 Bacteria 8882
138 Ga0070694_100056002 3300005444 Bacteria 2676
139 Ga0070694_100426483 3300005444 Bacteria 1043
140 Ga0070663_100001742 3300005455 Bacteria 12094
141 Ga0070663_100005878 3300005455 Bacteria 7337
142 Ga0070663_100023452 3300005455 Bacteria 4137
143 Ga0070663_100043555 3300005455 Bacteria 3159
144 Ga0070663_100053536 3300005455 Bacteria 2881
145 Ga0070663_100239882 3300005455 Bacteria 1430
146 Ga0070663_100415732 3300005455 Unclassified 1102
147 Ga0070663_100424975 3300005455 Bacteria 1090
148 Ga0070678_100184162 3300005456 Bacteria 1712
149 Ga0070678_100246471 3300005456 Bacteria 1496
150 Ga0070678_100367072 3300005456 Bacteria 1242
151 Ga0070662_100000037 3300005457 Bacteria 76596
152 Ga0070662_100000390 3300005457 Bacteria 26178
153 Ga0070662_100002727 3300005457 Bacteria 10907
154 Ga0070662_100005999 3300005457 Bacteria 7794
155 Ga0070662_100044884 3300005457 Bacteria 3168
156 Ga0070662_100110696 3300005457 Bacteria 2092
157 Ga0070662_100117275 3300005457 Unclassified 2036
158 Ga0070681_10031091 3300005458 Bacteria 5358
159 Ga0070681_10149392 3300005458 Unclassified 2264
160 Ga0070681_10383167 3300005458 Bacteria 1317
161 Ga0070681_10901276 3300005458 Bacteria 803
162 Ga0068867_100060922 3300005459 Bacteria 2801
163 Ga0068867_100084021 3300005459 Bacteria 2404
164 Ga0070679_100011099 3300005530 Bacteria 8573
165 Ga0070679_100037875 3300005530 Bacteria 4792
166 Ga0070679_100092415 3300005530 Bacteria 3013
167 Ga0070679_100132242 3300005530 Unclassified 2476
168 Ga0070679_100277052 3300005530 Bacteria 1630
169 Ga0070684_100003373 3300005535 Bacteria 11965
170 Ga0070684_100005950 3300005535 Bacteria 9394
171 Ga0070684_100010973 3300005535 Bacteria 7205
172 Ga0070684_100107284 3300005535 Bacteria 2501
173 Ga0070684_100152039 3300005535 Bacteria 2097
174 Ga0070684_100587889 3300005535 Bacteria 1035
175 Ga0068853_100000213 3300005539 Bacteria 41255
176 Ga0068853_100003747 3300005539 Bacteria 11661
177 Ga0068853_100015106 3300005539 Bacteria 6348
178 Ga0068853_100018643 3300005539 Bacteria 5745
179 Ga0068853_100046718 3300005539 Bacteria 3713
180 Ga0068853_100149028 3300005539 Bacteria 2105
181 Ga0068853_100233391 3300005539 Bacteria 1684
182 Ga0068853_100268309 3300005539 Unclassified 1571
183 Ga0068853_100521135 3300005539 Unclassified 1124
184 Ga0070672_100001092 3300005543 Bacteria 16526
185 Ga0070672_100010946 3300005543 Bacteria 6311
186 Ga0070672_100074990 3300005543 Plasmid 2699
187 Ga0070672_100134828 3300005543 Bacteria 2033
188 Ga0070672_100172853 3300005543 Bacteria 1797
189 Ga0070672_100217224 3300005543 Bacteria 1603
190 Ga0070693_100000168 3300005547 Bacteria 30586
191 Ga0070665_100001821 3300005548 Bacteria 24189
192 Ga0070665_100008990 3300005548 Bacteria 10117
193 Ga0070665_100012284 3300005548 Bacteria 8633
194 Ga0070665_100028422 3300005548 Bacteria 5631
195 Ga0070665_100787518 3300005548 Bacteria 964
196 Ga0070665_100954062 3300005548 Bacteria 870
197 Ga0070665_101157758 3300005548 Bacteria 784
198 Ga0068855_100000751 3300005563 Bacteria 39807
199 Ga0068855_100009251 3300005563 Bacteria 11904
200 Ga0068855_100014603 3300005563 Bacteria 9459
201 Ga0068855_100047326 3300005563 Bacteria 5081
202 Ga0068855_100135459 3300005563 Unclassified 2810
203 Ga0068855_100165247 3300005563 Bacteria 2510
204 Ga0068855_100169163 3300005563 Bacteria 2476
205 Ga0068855_100672131 3300005563 Bacteria 1110
206 Ga0068855_100694892 3300005563 Bacteria 1089
207 Ga0068855_100763135 3300005563 Bacteria 1030
208 Ga0070664_100000027 3300005564 Bacteria 90881
209 Ga0070664_100000464 3300005564 Bacteria 30816
210 Ga0070664_100001296 3300005564 Bacteria 19984
211 Ga0070664_100003499 3300005564 Bacteria 12689
212 Ga0070664_100007726 3300005564 Bacteria 8683
213 Ga0070664_100017421 3300005564 Bacteria 5898
214 Ga0070664_100072242 3300005564 Bacteria 2959
215 Ga0070664_100169764 3300005564 Bacteria 1935
216 Ga0070664_100434173 3300005564 Bacteria 1204
217 Ga0070664_100481912 3300005564 Unclassified 1141
218 Ga0068857_100001454 3300005577 Bacteria 18809
219 Ga0068857_100013811 3300005577 Bacteria 7033
220 Ga0068857_100025701 3300005577 Bacteria 5185
221 Ga0068857_100078293 3300005577 Unclassified 2951
222 Ga0068857_100123519 3300005577 Bacteria 2332
223 Ga0068857_100191577 3300005577 Unclassified 1862
224 Ga0068857_100198801 3300005577 Unclassified 1827
225 Ga0068857_100230281 3300005577 Unclassified 1694
226 Ga0068857_100361838 3300005577 Bacteria 1345
227 Ga0068857_100426765 3300005577 Bacteria 1237
228 Ga0068854_100000919 3300005578 Bacteria 17679
229 Ga0068854_100003625 3300005578 Bacteria 9661
230 Ga0068854_100005197 3300005578 Bacteria 8209
231 Ga0068854_100010605 3300005578 Bacteria 5980
232 Ga0068854_100047223 3300005578 Unclassified 3068
233 Ga0068854_100114548 3300005578 Bacteria 2038
234 Ga0068854_100372822 3300005578 Unclassified 1174
235 Ga0068854_100470359 3300005578 Bacteria 1053
236 Ga0068854_100651782 3300005578 Bacteria 904
237 Ga0068856_100000743 3300005614 Bacteria 35296
238 Ga0068856_100011527 3300005614 Bacteria 8576
239 Ga0068856_100022741 3300005614 Bacteria 6095
240 Ga0068856_100052360 3300005614 Bacteria 4025
241 Ga0068856_100106345 3300005614 Bacteria 2800
242 Ga0068856_100134030 3300005614 Unclassified 2482
243 Ga0068852_100000480 3300005616 Bacteria 26176
244 Ga0068852_100006131 3300005616 Bacteria 8670
245 Ga0068852_100053794 3300005616 Bacteria 3467
246 Ga0068852_100087972 3300005616 Unclassified 2773
247 Ga0068852_100138962 3300005616 Unclassified 2246
248 Ga0068852_100213260 3300005616 Bacteria 1833
249 Ga0068852_100234645 3300005616 Bacteria 1750
250 Ga0068852_100319202 3300005616 Bacteria 1508
251 Ga0068852_100428775 3300005616 Unclassified 1305
252 Ga0068852_100576689 3300005616 Bacteria 1127
253 Ga0068852_100590222 3300005616 Bacteria 1114
254 Ga0068859_100003231 3300005617 Bacteria 16593
255 Ga0068859_100039750 3300005617 Bacteria 4720
256 Ga0068859_100073615 3300005617 Bacteria 3454
257 Ga0068859_100106230 3300005617 Bacteria 2867
258 Ga0068859_100124237 3300005617 Bacteria 2649
259 Ga0068859_100237460 3300005617 Unclassified 1911
260 Ga0068864_100000897 3300005618 Bacteria 25075
261 Ga0068864_100003357 3300005618 Bacteria 13232
262 Ga0068864_100026930 3300005618 Bacteria 4850
263 Ga0068864_100087811 3300005618 Plasmid 2738
264 Ga0068864_100170692 3300005618 Bacteria 1983
265 Ga0068864_100192870 3300005618 Unclassified 1869
266 Ga0068864_100385326 3300005618 Bacteria 1329
267 Ga0068866_10254655 3300005718 Bacteria 1076
268 Ga0068861_100242394 3300005719 Bacteria 1534
269 Ga0068851_10002638 3300005834 Bacteria 7903
270 Ga0068851_10003322 3300005834 Bacteria 7151
271 Ga0068851_10128098 3300005834 Unclassified 1370
272 Ga0068870_10314823 3300005840 Bacteria 992
273 Ga0068870_10465456 3300005840 Unclassified 836
274 Ga0068863_100003418 3300005841 Bacteria 15652
275 Ga0068863_100017105 3300005841 Bacteria 6956
276 Ga0068863_100036360 3300005841 Unclassified 4691
277 Ga0068863_100053201 3300005841 Bacteria 3837
278 Ga0068863_100194707 3300005841 Bacteria 1949
279 Ga0068863_100528722 3300005841 Unclassified 1163
280 Ga0068858_100010567 3300005842 Bacteria 8743
281 Ga0068858_100013259 3300005842 Bacteria 7768
282 Ga0068858_100017615 3300005842 Bacteria 6696
283 Ga0068858_100018417 3300005842 Bacteria 6537
284 Ga0068858_100064108 3300005842 Bacteria 3400
285 Ga0068858_100303237 3300005842 Bacteria 1524
286 Ga0068858_100760785 3300005842 Bacteria 944
287 Ga0068860_100005048 3300005843 Bacteria 13429
288 Ga0068860_100006336 3300005843 Bacteria 11883
289 Ga0068860_100017848 3300005843 Bacteria 6911
290 Ga0068860_100018770 3300005843 Bacteria 6719
291 Ga0068860_100052951 3300005843 Bacteria 3859
292 Ga0068860_100170109 3300005843 Unclassified 2104
293 Ga0068860_100307669 3300005843 Bacteria 1554
294 Ga0068862_100004011 3300005844 Bacteria 12483
295 Ga0068862_100018840 3300005844 Bacteria 5752
296 Ga0068862_100067965 3300005844 Bacteria 3073
297 Ga0068862_100115736 3300005844 Bacteria 2358
298 Ga0068862_100653203 3300005844 Bacteria 1015
299 Ga0070717_10030714 3300006028 Bacteria 4317
300 Ga0070712_100019418 3300006175 Bacteria 4433
301 Ga0097621_100251394 3300006237 Unclassified 1548
302 Ga0097621_100354879 3300006237 Unclassified 1305
303 Ga0097621_100402133 3300006237 Unclassified 1226
304 Ga0068871_100038507 3300006358 Bacteria 3820
305 Ga0068871_100120013 3300006358 Unclassified 2220
306 Ga0075428_100351054 3300006844 Unclassified 1583
307 Ga0075428_100567981 3300006844 Bacteria 1212
308 Ga0075433_10008969 3300006852 Bacteria 7985
309 Ga0075433_10070855 3300006852 Bacteria 3064
310 Ga0075434_100496963 3300006871 Bacteria 1241
311 Ga0068865_100020097 3300006881 Bacteria 4330
312 Ga0068865_100186668 3300006881 Bacteria 1600
313 Ga0097620_100003231 3300006931 Bacteria 16593
314 Ga0097620_100024576 3300006931 Bacteria 6045
315 Ga0097620_100039749 3300006931 Bacteria 4720
316 Ga0097620_100073618 3300006931 Bacteria 3454
317 Ga0097620_100106217 3300006931 Bacteria 2867
318 Ga0097620_100124244 3300006931 Bacteria 2649
319 Ga0097620_100237462 3300006931 Unclassified 1911
320 Ga0075435_100583628 3300007076 Unclassified 969
321 Ga0105250_10087198 3300009092 Bacteria 1267
322 Ga0105250_10126986 3300009092 Bacteria 1051
323 Ga0105240_10019380 3300009093 Bacteria 9089
324 Ga0105240_10065681 3300009093 Bacteria 4503
325 Ga0105240_10114679 3300009093 Bacteria 3255
326 Ga0105240_10116525 3300009093 Bacteria 3223
327 Ga0105240_10166411 3300009093 Unclassified 2615
328 Ga0105240_10243406 3300009093 Bacteria 2084
329 Ga0105240_10288745 3300009093 Bacteria 1881
330 Ga0111539_11658631 3300009094 Bacteria 741
331 Ga0105245_10001947 3300009098 Bacteria 18731
332 Ga0105245_10031880 3300009098 Bacteria 4667
333 Ga0105247_10128837 3300009101 Bacteria 1647
334 Ga0105243_10250746 3300009148 Bacteria 1580
335 Ga0105243_10447926 3300009148 Bacteria 1211
336 Ga0105241_10005313 3300009174 Bacteria 9514
337 Ga0105241_10101656 3300009174 Bacteria 2286
338 Ga0105241_10116724 3300009174 Bacteria 2144
339 Ga0105241_10398531 3300009174 Bacteria 1206
340 Ga0105242_10027715 3300009176 Bacteria 4502
341 Ga0105242_10047939 3300009176 Bacteria 3471
342 Ga0105248_10006665 3300009177 Bacteria 12669
343 Ga0105248_10010146 3300009177 Bacteria 10375
344 Ga0105248_10040397 3300009177 Bacteria 5229
345 Ga0105248_10054079 3300009177 Bacteria 4503
346 Ga0105248_10327376 3300009177 Unclassified 1726
347 Ga0105248_10340645 3300009177 Bacteria 1688
348 Ga0105248_10458189 3300009177 Unclassified 1437
349 Ga0105248_10819462 3300009177 Bacteria 1050
350 Ga0105248_10846177 3300009177 Bacteria 1033
351 Ga0105237_10013446 3300009545 Bacteria 8583
352 Ga0105237_10396280 3300009545 Unclassified 1385
353 Ga0105238_10032849 3300009551 Bacteria 5282
354 Ga0105238_10108986 3300009551 Plasmid 2751
355 Ga0105249_10013203 3300009553 Bacteria 7289
356 Ga0105249_10091563 3300009553 Bacteria 2845
357 Ga0105249_10096755 3300009553 Bacteria 2770
358 Ga0105249_10181325 3300009553 Bacteria 2049
359 Ga0105239_10039562 3300010375 Bacteria 5166
360 Ga0105239_10238101 3300010375 Bacteria 2043
361 Ga0105239_10357312 3300010375 Bacteria 1649
362 Ga0105246_10032838 3300011119 Bacteria 3446
363 Ga0105246_10134046 3300011119 Bacteria 1854
364 Ga0157373_10007319 3300013100 Bacteria 8220
365 Ga0157373_10012534 3300013100 Bacteria 6233
366 Ga0157373_10135577 3300013100 Bacteria 1731
367 Ga0157373_10195871 3300013100 Bacteria 1424
368 Ga0157373_10237173 3300013100 Bacteria 1289
369 Ga0157373_10257573 3300013100 Bacteria 1234
370 Ga0157373_10474380 3300013100 Bacteria 902
371 Ga0157371_10047525 3300013102 Bacteria 3051
372 Ga0157371_10068402 3300013102 Bacteria 2514
373 Ga0157371_10125739 3300013102 Bacteria 1823
374 Ga0157371_10136176 3300013102 Bacteria 1749
375 Ga0157370_10000497 3300013104 Bacteria 48916
376 Ga0157370_10015668 3300013104 Bacteria 7699
377 Ga0157370_10037783 3300013104 Bacteria 4676
378 Ga0157370_10059121 3300013104 Bacteria 3643
379 Ga0157370_10065215 3300013104 Bacteria 3445
380 Ga0157370_10066600 3300013104 Bacteria 3406
381 Ga0157370_10129694 3300013104 Bacteria 2352
382 Ga0157370_10527226 3300013104 Bacteria 1084
383 Ga0157369_10046479 3300013105 Bacteria 4717
384 Ga0157369_10059002 3300013105 Bacteria 4139
385 Ga0157369_10119859 3300013105 Bacteria 2792
386 Ga0157369_10260148 3300013105 Bacteria 1810
387 Ga0157369_10317225 3300013105 Bacteria 1620
388 Ga0157369_10426180 3300013105 Bacteria 1375
389 Ga0157369_10495755 3300013105 Unclassified 1264
390 Ga0157369_10841994 3300013105 Bacteria 942
391 Ga0157374_10003502 3300013296 Bacteria 13201
392 Ga0157374_10377231 3300013296 Unclassified 1412
393 Ga0157378_10014264 3300013297 Bacteria 6957
394 Ga0157378_10406296 3300013297 Unclassified 1343
395 Ga0163162_10061377 3300013306 Bacteria 3797
396 Ga0163162_10218879 3300013306 Bacteria 2034
397 Ga0163162_10369061 3300013306 Bacteria 1568
398 Ga0163162_10566753 3300013306 Bacteria 1263
399 Ga0163162_10791586 3300013306 Bacteria 1066
400 Ga0157372_10260025 3300013307 Unclassified 2016
401 Ga0157372_10330400 3300013307 Bacteria 1775
402 Ga0157372_10375437 3300013307 Bacteria 1657
403 Ga0157372_10504214 3300013307 Unclassified 1411
404 Ga0157372_10697082 3300013307 Bacteria 1182
405 Ga0157372_10733913 3300013307 Bacteria 1149
406 Ga0157375_10009605 3300013308 Bacteria 8498
407 Ga0157375_10022235 3300013308 Bacteria 5835
408 Ga0157375_10225531 3300013308 Bacteria 2033
409 Ga0157375_10944581 3300013308 Bacteria 1004
410 Ga0157375_11314225 3300013308 Unclassified 850
411 Ga0163163_10870712 3300014325 Bacteria 964
412 Ga0157380_10354135 3300014326 Bacteria 1375
413 Ga0157380_10453228 3300014326 Bacteria 1233
414 Ga0182008_10047749 3300014497 Bacteria 2127
415 Ga0157377_10019876 3300014745 Bacteria 3512
416 Ga0157377_10219471 3300014745 Bacteria 1216
417 Ga0157379_10006760 3300014968 Bacteria 9912
418 Ga0157379_10080161 3300014968 Unclassified 2924
419 Ga0157379_10106465 3300014968 Unclassified 2517
420 Ga0163161_10299599 3300017792 Bacteria 1266
421 Ga0163161_10329381 3300017792 Unclassified 1209
422 Ga0197907_11483432 3300020069 Unclassified 686
423 Ga0206356_10308331 3300020070 Unclassified 854
424 Ga0206356_11242570 3300020070 Bacteria 3767
425 Ga0206356_11673347 3300020070 Unclassified 695
426 Ga0206352_11205138 3300020078 Unclassified 872
427 Ga0206350_10308023 3300020080 Bacteria 1201
428 Ga0206353_10924983 3300020082 Unclassified 1345
429 Ga0213872_10206911 3300021361 Unclassified 839
430 Ga0207673_1008721 3300025290 Unclassified 1288
431 Ga0209257_1049869 3300025304 Bacteria 1189
432 Ga0207697_10000082 3300025315 Bacteria 41919
433 Ga0207697_10041776 3300025315 Bacteria 1883
434 Ga0207697_10070286 3300025315 Bacteria 1466
435 Ga0207656_10002169 3300025321 Bacteria 6561
436 Ga0207656_10024729 3300025321 Unclassified 2432
437 Ga0207642_10232549 3300025899 Bacteria 1036
438 Ga0207710_10099888 3300025900 Bacteria 1367
439 Ga0207688_10026523 3300025901 Bacteria 3187
440 Ga0207688_10250549 3300025901 Bacteria 1073
441 Ga0207680_10002046 3300025903 Bacteria 9452
442 Ga0207680_10045712 3300025903 Bacteria 2583
443 Ga0207680_10097002 3300025903 Bacteria 1887
444 Ga0207680_10145911 3300025903 Unclassified 1573
445 Ga0207680_10247598 3300025903 Bacteria 1230
446 Ga0207680_10396140 3300025903 Bacteria 975
447 Ga0207680_10556008 3300025903 Unclassified 819
448 Ga0207647_10000259 3300025904 Bacteria 43433
449 Ga0207647_10001197 3300025904 Bacteria 19985
450 Ga0207647_10003110 3300025904 Bacteria 12463
451 Ga0207647_10005894 3300025904 Bacteria 8932
452 Ga0207647_10007004 3300025904 Bacteria 8177
453 Ga0207647_10024446 3300025904 Bacteria 3983
454 Ga0207647_10041888 3300025904 Bacteria 2876
455 Ga0207647_10077080 3300025904 Bacteria 2004
456 Ga0207647_10092200 3300025904 Bacteria 1806
457 Ga0207699_10371708 3300025906 Unclassified 1013
458 Ga0207699_10423581 3300025906 Unclassified 951
459 Ga0207645_10121125 3300025907 Bacteria 1698
460 Ga0207645_10123540 3300025907 Bacteria 1682
461 Ga0207645_10155625 3300025907 Unclassified 1493
462 Ga0207705_10000086 3300025909 Bacteria 116132
463 Ga0207705_10000123 3300025909 Bacteria 85382
464 Ga0207705_10001490 3300025909 Bacteria 18620
465 Ga0207705_10003112 3300025909 Bacteria 12660
466 Ga0207705_10005892 3300025909 Bacteria 9112
467 Ga0207705_10097794 3300025909 Unclassified 2156
468 Ga0207705_10193140 3300025909 Bacteria 1540
469 Ga0207654_10043613 3300025911 Unclassified 2543
470 Ga0207654_10093829 3300025911 Bacteria 1836
471 Ga0207707_10224089 3300025912 Bacteria 1636
472 Ga0207707_10301106 3300025912 Bacteria 1386
473 Ga0207707_10479375 3300025912 Unclassified 1063
474 Ga0207695_10031219 3300025913 Bacteria 5848
475 Ga0207695_10032631 3300025913 Bacteria 5696
476 Ga0207695_10143752 3300025913 Bacteria 2332
477 Ga0207695_10292690 3300025913 Unclassified 1520
478 Ga0207695_10634306 3300025913 Bacteria 950
479 Ga0207671_10650081 3300025914 Unclassified 840
480 Ga0207693_10031706 3300025915 Bacteria 4176
481 Ga0207693_10037725 3300025915 Bacteria 3808
482 Ga0207660_10009248 3300025917 Bacteria 6377
483 Ga0207660_10237437 3300025917 Bacteria 1435
484 Ga0207660_10456874 3300025917 Bacteria 1033
485 Ga0207660_10493087 3300025917 Bacteria 993
486 Ga0207660_10592670 3300025917 Bacteria 903
487 Ga0207662_10017339 3300025918 Bacteria 4072
488 Ga0207657_10000133 3300025919 Bacteria 75282
489 Ga0207657_10000650 3300025919 Bacteria 36973
490 Ga0207657_10004090 3300025919 Bacteria 15484
491 Ga0207657_10007346 3300025919 Bacteria 11302
492 Ga0207657_10009514 3300025919 Bacteria 9759
493 Ga0207657_10013116 3300025919 Bacteria 8140
494 Ga0207657_10027070 3300025919 Bacteria 5256
495 Ga0207657_10061211 3300025919 Bacteria 3229
496 Ga0207657_10093535 3300025919 Archaea 2504
497 Ga0207657_10335891 3300025919 Bacteria 1193
498 Ga0207649_10000629 3300025920 Bacteria 23631
499 Ga0207649_10005572 3300025920 Bacteria 6809
500 Ga0207649_10036909 3300025920 Bacteria 2947
501 Ga0207649_10039258 3300025920 Bacteria 2869
502 Ga0207649_10120259 3300025920 Bacteria 1770
503 Ga0207649_10149880 3300025920 Bacteria 1605
504 Ga0207649_10175924 3300025920 Unclassified 1494
505 Ga0207649_10294147 3300025920 Bacteria 1185
506 Ga0207649_10415782 3300025920 Bacteria 1009
507 Ga0207652_10000034 3300025921 Bacteria 138571
508 Ga0207652_10179818 3300025921 Bacteria 1900
509 Ga0207652_10256856 3300025921 Bacteria 1576
510 Ga0207652_10288668 3300025921 Bacteria 1480
511 Ga0207681_10044987 3300025923 Bacteria 2961
512 Ga0207681_10059294 3300025923 Bacteria 2624
513 Ga0207681_10079048 3300025923 Bacteria 2316
514 Ga0207681_10299821 3300025923 Unclassified 1271
515 Ga0207681_10509429 3300025923 Bacteria 986
516 Ga0207694_10023725 3300025924 Bacteria 4658
517 Ga0207694_10040576 3300025924 Bacteria 3584
518 Ga0207694_10400242 3300025924 Bacteria 1141
519 Ga0207650_10004067 3300025925 Bacteria 9999
520 Ga0207650_10013303 3300025925 Bacteria 5695
521 Ga0207650_10013753 3300025925 Bacteria 5612
522 Ga0207650_10039279 3300025925 Plasmid 3459
523 Ga0207650_10197287 3300025925 Bacteria 1611
524 Ga0207650_10725893 3300025925 Bacteria 840
525 Ga0207659_10012771 3300025926 Bacteria 5362
526 Ga0207659_10125053 3300025926 Bacteria 1976
527 Ga0207659_10159746 3300025926 Unclassified 1768
528 Ga0207659_10200238 3300025926 Bacteria 1594
529 Ga0207659_10866155 3300025926 Bacteria 777
530 Ga0207700_10067184 3300025928 Bacteria 2743
531 Ga0207700_10112019 3300025928 Bacteria 2197
532 Ga0207700_10138985 3300025928 Bacteria 1993
533 Ga0207664_10039323 3300025929 Bacteria 3673
534 Ga0207664_10075955 3300025929 Bacteria 2718
535 Ga0207644_10002376 3300025931 Bacteria 12147
536 Ga0207644_10023452 3300025931 Bacteria 4226
537 Ga0207644_10210635 3300025931 Bacteria 1536
538 Ga0207690_10000265 3300025932 Bacteria 37601
539 Ga0207690_10005349 3300025932 Bacteria 7566
540 Ga0207690_10007225 3300025932 Bacteria 6597
541 Ga0207690_10011308 3300025932 Bacteria 5334
542 Ga0207690_10019258 3300025932 Bacteria 4199
543 Ga0207690_10027521 3300025932 Bacteria 3593
544 Ga0207690_10027765 3300025932 Bacteria 3579
545 Ga0207690_10030169 3300025932 Bacteria 3456
546 Ga0207690_10034448 3300025932 Unclassified 3263
547 Ga0207690_10137253 3300025932 Unclassified 1797
548 Ga0207690_10169200 3300025932 Unclassified 1636
549 Ga0207690_10387202 3300025932 Bacteria 1112
550 Ga0207706_10000159 3300025933 Bacteria 75284
551 Ga0207706_10001125 3300025933 Bacteria 27208
552 Ga0207706_10010750 3300025933 Bacteria 8356
553 Ga0207706_10015205 3300025933 Bacteria 6965
554 Ga0207706_10033985 3300025933 Bacteria 4538
555 Ga0207706_10065654 3300025933 Bacteria 3195
556 Ga0207706_10125524 3300025933 Bacteria 2257
557 Ga0207706_10434245 3300025933 Unclassified 1137
558 Ga0207686_10112449 3300025934 Unclassified 1839
559 Ga0207709_10075159 3300025935 Unclassified 2159
560 Ga0207709_10167607 3300025935 Bacteria 1538
561 Ga0207670_10459076 3300025936 Bacteria 1028
562 Ga0207670_10468249 3300025936 Unclassified 1018
563 Ga0207669_10039379 3300025937 Bacteria 2731
564 Ga0207704_10019649 3300025938 Bacteria 3553
565 Ga0207691_10002508 3300025940 Bacteria 17963
566 Ga0207691_10017486 3300025940 Bacteria 6798
567 Ga0207691_10048595 3300025940 Unclassified 3889
568 Ga0207691_10091393 3300025940 Bacteria 2727
569 Ga0207691_10124016 3300025940 Bacteria 2287
570 Ga0207691_10397325 3300025940 Bacteria 1176
571 Ga0207711_10000914 3300025941 Bacteria 28418
572 Ga0207711_10016576 3300025941 Bacteria 6118
573 Ga0207711_10198186 3300025941 Bacteria 1832
574 Ga0207711_10226069 3300025941 Unclassified 1713
575 Ga0207711_10530609 3300025941 Bacteria 1098
576 Ga0207711_10876412 3300025941 Bacteria 835
577 Ga0207689_10000561 3300025942 Bacteria 35545
578 Ga0207689_10012090 3300025942 Bacteria 7392
579 Ga0207689_10014133 3300025942 Bacteria 6794
580 Ga0207661_10002539 3300025944 Bacteria 12565
581 Ga0207661_10003613 3300025944 Bacteria 10762
582 Ga0207661_10004214 3300025944 Bacteria 10061
583 Ga0207679_10000321 3300025945 Bacteria 35822
584 Ga0207679_10004415 3300025945 Bacteria 8759
585 Ga0207679_10004860 3300025945 Bacteria 8380
586 Ga0207679_10034202 3300025945 Bacteria 3583
587 Ga0207679_10050807 3300025945 Bacteria 3032
588 Ga0207679_10091640 3300025945 Bacteria 2352
589 Ga0207679_10105411 3300025945 Unclassified 2214
590 Ga0207679_10152575 3300025945 Unclassified 1882
591 Ga0207679_10222062 3300025945 Bacteria 1590
592 Ga0207667_10008316 3300025949 Bacteria 12344
593 Ga0207667_10011837 3300025949 Bacteria 10104
594 Ga0207667_10018472 3300025949 Bacteria 7818
595 Ga0207667_10019245 3300025949 Bacteria 7632
596 Ga0207667_10031787 3300025949 Bacteria 5695
597 Ga0207667_10050596 3300025949 Bacteria 4383
598 Ga0207667_10143974 3300025949 Bacteria 2454
599 Ga0207667_10182548 3300025949 Bacteria 2154
600 Ga0207667_10285351 3300025949 Bacteria 1687
601 Ga0207667_10485026 3300025949 Unclassified 1254
602 Ga0207667_10567793 3300025949 Bacteria 1146
603 Ga0207667_11115720 3300025949 Bacteria 771
604 Ga0207651_10001237 3300025960 Bacteria 11474
605 Ga0207651_10061400 3300025960 Bacteria 2614
606 Ga0207651_10114671 3300025960 Bacteria 2030
607 Ga0207651_10480220 3300025960 Bacteria 1071
608 Ga0207712_10001096 3300025961 Bacteria 18922
609 Ga0207712_10002871 3300025961 Bacteria 11020
610 Ga0207712_10030262 3300025961 Bacteria 3638
611 Ga0207712_10307544 3300025961 Bacteria 1303
612 Ga0207668_10006655 3300025972 Bacteria 6835
613 Ga0207668_10215233 3300025972 Bacteria 1539
614 Ga0207668_10749156 3300025972 Bacteria 862
615 Ga0207640_10000788 3300025981 Bacteria 18019
616 Ga0207640_10001178 3300025981 Bacteria 14315
617 Ga0207640_10001594 3300025981 Bacteria 12188
618 Ga0207640_10020554 3300025981 Bacteria 3921
619 Ga0207640_10021671 3300025981 Bacteria 3833
620 Ga0207640_10072761 3300025981 Bacteria 2320
621 Ga0207640_10329837 3300025981 Unclassified 1218
622 Ga0207640_10448839 3300025981 Bacteria 1062
623 Ga0207640_10648202 3300025981 Bacteria 900
624 Ga0207640_10760349 3300025981 Bacteria 836
625 Ga0207658_10012396 3300025986 Bacteria 5823
626 Ga0207658_10014851 3300025986 Bacteria 5336
627 Ga0207658_10070034 3300025986 Unclassified 2652
628 Ga0207658_10077914 3300025986 Bacteria 2531
629 Ga0207658_10279557 3300025986 Bacteria 1430
630 Ga0207658_10336990 3300025986 Bacteria 1310
631 Ga0207658_10722577 3300025986 Bacteria 901
632 Ga0207677_10014000 3300026023 Bacteria 4668
633 Ga0207677_10156709 3300026023 Bacteria 1764
634 Ga0207677_10260576 3300026023 Bacteria 1413
635 Ga0207703_10005442 3300026035 Bacteria 10250
636 Ga0207703_10013406 3300026035 Bacteria 6388
637 Ga0207703_10148060 3300026035 Bacteria 2044
638 Ga0207703_10179806 3300026035 Bacteria 1866
639 Ga0207703_10268712 3300026035 Bacteria 1544
640 Ga0207639_10000137 3300026041 Bacteria 54378
641 Ga0207639_10010459 3300026041 Bacteria 6428
642 Ga0207639_10022416 3300026041 Bacteria 4549
643 Ga0207639_10025397 3300026041 Bacteria 4295
644 Ga0207639_10105871 3300026041 Bacteria 2282
645 Ga0207639_10167788 3300026041 Archaea 1856
646 Ga0207639_10584797 3300026041 Bacteria 1028
647 Ga0207678_10000530 3300026067 Bacteria 34763
648 Ga0207678_10004220 3300026067 Bacteria 12888
649 Ga0207678_10004502 3300026067 Bacteria 12525
650 Ga0207678_10019805 3300026067 Bacteria 5917
651 Ga0207678_10035181 3300026067 Bacteria 4361
652 Ga0207678_10102494 3300026067 Unclassified 2443
653 Ga0207678_10125516 3300026067 Bacteria 2189
654 Ga0207678_10435364 3300026067 Bacteria 1138
655 Ga0207678_10435673 3300026067 Unclassified 1138
656 Ga0207708_10159989 3300026075 Bacteria 1778
657 Ga0207708_10366312 3300026075 Bacteria 1185
658 Ga0207702_10002212 3300026078 Bacteria 18638
659 Ga0207702_10005348 3300026078 Bacteria 11256
660 Ga0207702_10014217 3300026078 Bacteria 6611
661 Ga0207702_10025220 3300026078 Bacteria 4933
662 Ga0207702_10054567 3300026078 Bacteria 3387
663 Ga0207702_10068484 3300026078 Bacteria 3049
664 Ga0207702_10095930 3300026078 Bacteria 2607
665 Ga0207702_10115257 3300026078 Bacteria 2396
666 Ga0207641_10010994 3300026088 Bacteria 7421
667 Ga0207641_10035574 3300026088 Bacteria 4150
668 Ga0207641_10041216 3300026088 Bacteria 3869
669 Ga0207641_10048376 3300026088 Bacteria 3589
670 Ga0207641_10053253 3300026088 Unclassified 3429
671 Ga0207641_10202650 3300026088 Bacteria 1830
672 Ga0207641_10336430 3300026088 Unclassified 1435
673 Ga0207648_10007119 3300026089 Bacteria 11033
674 Ga0207648_10018823 3300026089 Bacteria 6242
675 Ga0207648_10044397 3300026089 Bacteria 3899
676 Ga0207676_10005455 3300026095 Bacteria 9002
677 Ga0207676_10031712 3300026095 Bacteria 3976
678 Ga0207676_10044425 3300026095 Bacteria 3428
679 Ga0207676_10067865 3300026095 Bacteria 2850
680 Ga0207676_10099267 3300026095 Bacteria 2409
681 Ga0207676_10215112 3300026095 Unclassified 1708
682 Ga0207676_10216504 3300026095 Bacteria 1703
683 Ga0207676_10227979 3300026095 Bacteria 1664
684 Ga0207674_10002685 3300026116 Bacteria 22206
685 Ga0207674_10003442 3300026116 Bacteria 19365
686 Ga0207674_10004250 3300026116 Bacteria 17276
687 Ga0207674_10008633 3300026116 Bacteria 11740
688 Ga0207674_10009133 3300026116 Bacteria 11375
689 Ga0207674_10021572 3300026116 Bacteria 6934
690 Ga0207674_10032449 3300026116 Bacteria 5478
691 Ga0207674_10050377 3300026116 Bacteria 4254
692 Ga0207674_10076134 3300026116 Bacteria 3364
693 Ga0207674_10133998 3300026116 Unclassified 2440
694 Ga0207674_10198690 3300026116 Unclassified 1955
695 Ga0207674_10530885 3300026116 Bacteria 1137
696 Ga0207675_100095478 3300026118 Bacteria 2797
697 Ga0207675_100149547 3300026118 Bacteria 2222
698 Ga0207675_100201396 3300026118 Bacteria 1912
699 Ga0207675_100285167 3300026118 Unclassified 1605
700 Ga0207683_10007475 3300026121 Bacteria 9374
701 Ga0207683_10042173 3300026121 Bacteria 3985
702 Ga0207683_10299257 3300026121 Unclassified 1472
703 Ga0207698_10000443 3300026142 Bacteria 23827
704 Ga0207698_10023009 3300026142 Bacteria 4346
705 Ga0207698_10029189 3300026142 Bacteria 3945
706 Ga0207698_10052923 3300026142 Bacteria 3113
707 Ga0207698_10057009 3300026142 Bacteria 3019
708 Ga0207698_10646483 3300026142 Bacteria 1047
709 Ga0207698_11207869 3300026142 Unclassified 770
710 Ga0209974_10010444 3300027876 Bacteria 3133
711 Ga0268266_10000458 3300028379 Bacteria 59553
712 Ga0268266_10004939 3300028379 Bacteria 12634
713 Ga0268266_10031622 3300028379 Bacteria 4495
714 Ga0268266_10039609 3300028379 Bacteria 4014
715 Ga0268266_10569847 3300028379 Bacteria 1086
716 Ga0268266_10612069 3300028379 Bacteria 1047
717 Ga0268265_10016311 3300028380 Bacteria 5100
718 Ga0268265_10018988 3300028380 Bacteria 4774
719 Ga0268265_10019122 3300028380 Unclassified 4755
720 Ga0268265_10199531 3300028380 Bacteria 1735
721 Ga0268265_11360642 3300028380 Unclassified 711
722 Ga0268264_10002566 3300028381 Bacteria 15920
723 Ga0268264_10007507 3300028381 Bacteria 9098
724 Ga0268264_10043634 3300028381 Bacteria 3717
725 Ga0268264_10096086 3300028381 Bacteria 2565
726 Ga0268264_10153245 3300028381 Unclassified 2069
727 Ga0268264_10369726 3300028381 Bacteria 1370
728 Ga0307516_10000034 3300031730 Bacteria 155251
729 Ga0307405_10120063 3300031731 Bacteria 1797
730 Ga0307413_10303659 3300031824 Bacteria 1211
731 Ga0307410_10006140 3300031852 Bacteria 6447
732 Ga0307410_10008279 3300031852 Bacteria 5758
733 Ga0307410_10072657 3300031852 Bacteria 2389
734 Ga0307406_10069102 3300031901 Bacteria 2308
735 Ga0307407_10003352 3300031903 Bacteria 6551
736 Ga0307412_10026888 3300031911 Bacteria 3582
737 Ga0307412_10278431 3300031911 Bacteria 1312
738 Ga0307412_10371124 3300031911 Bacteria 1155
739 Ga0307409_100238495 3300031995 Bacteria 1654
740 Ga0307409_100841904 3300031995 Unclassified 927
741 Ga0307416_100025110 3300032002 Bacteria 4363
742 Ga0307416_100250908 3300032002 Bacteria 1722
743 Ga0307414_10005643 3300032004 Bacteria 6906
744 Ga0307414_10126883 3300032004 Bacteria 1973
745 Ga0307414_10681570 3300032004 Bacteria 929
746 Ga0307411_10003870 3300032005 Bacteria 7051
747 Ga0307411_10037211 3300032005 Bacteria 3057
748 Ga0307411_10158838 3300032005 Bacteria 1690
749 Ga0307411_10766554 3300032005 Unclassified 846
750 Ga0307415_100709819 3300032126 Bacteria 908
751 Ga0373931_0136058 3300035691 Bacteria 1419
752 Ga0373937_0414737 3300036401 Unclassified 1278
753 Ga0395899_0005069 3300037312 Bacteria 10250
754 Ga0395899_0040322 3300037312 Bacteria 3492
755 Ga0395899_0044176 3300037312 Bacteria 3321
756 Ga0395899_0072470 3300037312 Bacteria 2520
757 Ga0395899_0153108 3300037312 Bacteria 1633
758 Ga0395899_0294297 3300037312 Bacteria 1100
759 Ga0395899_0321871 3300037312 Bacteria 1041
760 Ga0395899_0470830 3300037312 Unclassified 819
761 Ga0395900_0009541 3300037418 Bacteria 9950
762 Ga0395900_0023793 3300037418 Bacteria 6267
763 Ga0395900_0027680 3300037418 Bacteria 5806
764 Ga0395900_0039979 3300037418 Bacteria 4833
765 Ga0395900_0048315 3300037418 Bacteria 4383
766 Ga0395900_0057853 3300037418 Unclassified 3991
767 Ga0395900_0131059 3300037418 Bacteria 2569
768 Ga0395900_0141799 3300037418 Bacteria 2460
769 Ga0395900_0174337 3300037418 Bacteria 2188
770 Ga0395900_0329344 3300037418 Unclassified 1505
771 Ga0395900_0751515 3300037418 Bacteria 905
772 Ga0395900_0993093 3300037418 Bacteria 759
773 Ga0395898_0009377 3300037466 Bacteria 10281
774 Ga0395898_0031990 3300037466 Bacteria 5252
775 Ga0395898_0054987 3300037466 Bacteria 3883
776 Ga0395898_0177987 3300037466 Bacteria 2032
777 Ga0395898_0406293 3300037466 Bacteria 1298
778 Ga0395898_0591212 3300037466 Bacteria 1052
779 Ga0395905_0008355 3300037471 Bacteria 10211
780 Ga0395905_0012839 3300037471 Bacteria 8051
781 Ga0395905_0014010 3300037471 Bacteria 7669
782 Ga0395905_0019482 3300037471 Bacteria 6431
783 Ga0395905_0071910 3300037471 Bacteria 3242
784 Ga0395905_0096505 3300037471 Unclassified 2775
785 Ga0395905_0116205 3300037471 Bacteria 2514
786 Ga0395905_0139764 3300037471 Bacteria 2279
787 Ga0395905_0174149 3300037471 Bacteria 2020
788 Ga0395905_0226442 3300037471 Unclassified 1749
789 Ga0395905_0309355 3300037471 Bacteria 1468
790 Ga0395905_0565623 3300037471 Bacteria 1038
791 Ga0395901_0008267 3300038443 Bacteria 10510
792 Ga0395901_0014740 3300038443 Bacteria 7946
793 Ga0395901_0017022 3300038443 Bacteria 7408
794 Ga0395901_0020134 3300038443 Bacteria 6827
795 Ga0395901_0023308 3300038443 Bacteria 6344
796 Ga0395901_0060208 3300038443 Bacteria 3951
797 Ga0395901_0061862 3300038443 Bacteria 3895
798 Ga0395901_0167628 3300038443 Unclassified 2305
799 Ga0395901_0185106 3300038443 Bacteria 2184
800 Ga0395901_0214642 3300038443 Bacteria 2012
801 Ga0395901_0495231 3300038443 Bacteria 1245
802 Ga0395901_1179432 3300038443 Unclassified 732
803 Ga0436361_1061929 3300039447 Unclassified 1108
804 Ga0439432_027031 3300042006 Bacteria 1876
805 Ga0439449_0028910 3300042007 Bacteria 2066
806 Ga0466969_0097709 3300044656 Bacteria 1385
807 Ga0466969_0147356 3300044656 Bacteria 1086
808 Ga0466972_0145361 3300044658 Bacteria 1116
809 Ga0466972_0297566 3300044658 Unclassified 754
810 Ga0466965_0241139 3300044683 Bacteria 968
811 Ga0466966_0009469 3300044684 Bacteria 6453
812 Ga0466961_0020554 3300044693 Bacteria 4248
813 Ga0466961_0087329 3300044693 Bacteria 1971
814 Ga0466961_0106654 3300044693 Bacteria 1763
815 Ga0466961_0275410 3300044693 Bacteria 1030
816 Ga0466963_0005307 3300044694 Bacteria 7531
817 Ga0466963_0079548 3300044694 Bacteria 2218
818 Ga0466963_0087170 3300044694 Bacteria 2122
819 Ga0466963_0176344 3300044694 Bacteria 1491
820 Ga0466971_0001211 3300044719 Bacteria 10728
821 Ga0466971_0022472 3300044719 Bacteria 2810
822 Ga0466971_0354625 3300044719 Bacteria 710
823 Ga0466970_0051450 3300044765 Bacteria 2198
824 Ga0466970_0138916 3300044765 Bacteria 1338
825 Ga0466970_0331530 3300044765 Bacteria 861
826 Ga0466957_0002399 3300044842 Bacteria 10056
827 Ga0466957_0184671 3300044842 Bacteria 1363
828 Ga0466957_0313671 3300044842 Bacteria 1056
829 Ga0466959_0034632 3300045049 Bacteria 3736
830 Ga0466959_0252933 3300045049 Bacteria 1215
831 Ga0466959_0655970 3300045049 Bacteria 704
832 Ga0466958_0009813 3300045836 Bacteria 5342
833 Ga0466958_0052869 3300045836 Bacteria 2463
834 Ga0466958_0054461 3300045836 Bacteria 2426
835 Ga0466958_0063042 3300045836 Bacteria 2260
836 Ga0466958_0084009 3300045836 Bacteria 1963
837 Ga0466958_0116092 3300045836 Bacteria 1673
838 Ga0466958_0176799 3300045836 Bacteria 1353
839 Ga0466967_0052424 3300045976 Bacteria 3580
840 Ga0466967_0257609 3300045976 Bacteria 1668
841 Ga0466967_0322807 3300045976 Bacteria 1489
842 Ga0466967_0389541 3300045976 Bacteria 1354
843 Ga0466967_1035638 3300045976 Archaea 817
844 Ga0495663_0005710 3300046525 Bacteria 3446
845 Ga0495663_0022592 3300046525 Unclassified 1818
846 Ga0495663_0024465 3300046525 Bacteria 1756
847 Ga0495598_0003569 3300046537 Bacteria 3317
848 Ga0495598_0065361 3300046537 Bacteria 1132
849 Ga0495621_0006280 3300046539 Bacteria 3459
850 Ga0495621_0013166 3300046539 Bacteria 2594
851 Ga0495661_0034543 3300046665 Bacteria 3181
852 Ga0495669_0000854 3300046684 Bacteria 12893
853 Ga0495669_0002396 3300046684 Bacteria 7693
854 Ga0495669_0009878 3300046684 Unclassified 4033
855 Ga0495669_0058298 3300046684 Bacteria 1742
856 Ga0495670_0044687 3300046691 Bacteria 2211
857 Ga0495681_0040590 3300047470 Bacteria 2265
858 Ga0495626_0080692 3300048091 Bacteria 1446
859 Ga0496100_0387020 3300048903 Bacteria 1063
860 Ga0496101_0104913 3300048904 Bacteria 2120
861 Ga0496102_0042910 3300048905 Bacteria 4099
862 Ga0496103_0016347 3300048906 Bacteria 4428
863 Ga0496103_0476318 3300048906 Bacteria 800
864 Ga0496106_0064316 3300048909 Unclassified 2790
865 Ga0496107_0033903 3300048910 Unclassified 3654
866 Ga0496107_0084381 3300048910 Bacteria 2318
867 Ga0496107_0146455 3300048910 Bacteria 1746
868 Ga0496108_0018888 3300048911 Bacteria 5652
869 Ga0496108_0895572 3300048911 Bacteria 762
870 Ga0496109_0006273 3300048912 Bacteria 10003
871 Ga0496109_0044431 3300048912 Bacteria 4031
872 Ga0496109_0142424 3300048912 Bacteria 2242
873 Ga0496109_0642144 3300048912 Bacteria 998
874 Ga0496110_0003604 3300048913 Bacteria 11911
875 Ga0496110_0004039 3300048913 Bacteria 11323
876 Ga0496110_0373279 3300048913 Bacteria 1300
877 Ga0496111_0000244 3300048914 Bacteria 26061
878 Ga0496111_0205274 3300048914 Unclassified 1464
879 Ga0496112_0019061 3300048915 Bacteria 6467
880 Ga0496113_0000515 3300048916 Bacteria 19121
881 Ga0496113_0359648 3300048916 Bacteria 1168
882 Ga0496114_0030559 3300048917 Bacteria 4433
883 Ga0496121_0000061 3300048924 Bacteria 275757
884 Ga0501067_0163403 3300049583 Bacteria 1240
885 Ga0501249_040130 3300049679 Bacteria 1060
886 nmdc:mga09592_913833_c1 3300050508 Bacteria 737
887 nmdc:mga08y16_1456771_c1 3300050511 Bacteria 646
888 nmdc:mga0n895_568992_c1 3300050512 Bacteria 1138
889 nmdc:mga0a205_10273_c1 3300050515 Bacteria 8600
890 nmdc:mga0a205_4191_c1 3300050515 Bacteria 12927
891 Ga0495655_0004664 3300053083 Bacteria 2365
892 Ga0500627_0031294 3300053158 Bacteria 2234
893 Ga0466962_0008758 3300061719 Bacteria 4850
894 Ga0466962_0119706 3300061719 Unclassified 1270
895 Ga0466962_0208054 3300061719 Unclassified 957

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005441 Ga0070700_100110298 Ga0070700_1001102982 165
2 3300013306 Ga0163162_10369061 Ga0163162_103690611 172
3 3300013308 Ga0157375_10225531 Ga0157375_102255312 172
4 3300014968 Ga0157379_10106465 Ga0157379_101064652 172
5 3300049679 Ga0501249_040130 Ga0501249_040130_377_901 174
6 3300013104 Ga0157370_10015668 Ga0157370_100156682 175
7 3300013105 Ga0157369_10495755 Ga0157369_104957552 175
8 3300013307 Ga0157372_10504214 Ga0157372_105042142 175
9 3300031730 Ga0307516_10000034 Ga0307516_10000034104 175
10 3300037312 Ga0395899_0005069 Ga0395899_0005069_6192_6719 175
11 3300037312 Ga0395899_0072470 Ga0395899_0072470_1677_2204 175
12 3300037418 Ga0395900_0009541 Ga0395900_0009541_3531_4058 175
13 3300037418 Ga0395900_0027680 Ga0395900_0027680_1899_2426 175
14 3300037466 Ga0395898_0009377 Ga0395898_0009377_7048_7575 175
15 3300037466 Ga0395898_0031990 Ga0395898_0031990_2931_3458 175
16 3300037471 Ga0395905_0008355 Ga0395905_0008355_5500_6027 175
17 3300037471 Ga0395905_0071910 Ga0395905_0071910_734_1261 175
18 3300038443 Ga0395901_0008267 Ga0395901_0008267_7277_7804 175
19 3300038443 Ga0395901_0014740 Ga0395901_0014740_4967_5494 175
20 3300045976 Ga0466967_1035638 Ga0466967_1035638_139_684 175
21 3300037312 Ga0395899_0153108 Ga0395899_0153108_62_595 177
22 3300013104 Ga0157370_10000497 Ga0157370_1000049726 180
23 3300013306 Ga0163162_10791586 Ga0163162_107915862 180
24 3300044765 Ga0466970_0051450 Ga0466970_0051450_371_913 180
25 3300013105 Ga0157369_10260148 Ga0157369_102601481 181
26 3300037471 Ga0395905_0226442 Ga0395905_0226442_529_1074 181
27 3300050508 nmdc:mga09592_913833_c1 nmdc:mga09592_913833_c1_94_669 181
28 3300005577 Ga0068857_100361838 Ga0068857_1003618382 185
29 3300005614 Ga0068856_100106345 Ga0068856_1001063452 185
30 3300025904 Ga0207647_10092200 Ga0207647_100922002 185
31 3300026078 Ga0207702_10095930 Ga0207702_100959301 185
32 3300044683 Ga0466965_0241139 Ga0466965_0241139_217_774 185
33 3300048903 Ga0496100_0387020 Ga0496100_0387020_219_776 185
34 3300048904 Ga0496101_0104913 Ga0496101_0104913_777_1334 185
35 3300048910 Ga0496107_0146455 Ga0496107_0146455_347_904 185
36 3300048912 Ga0496109_0642144 Ga0496109_0642144_258_815 185
37 3300048916 Ga0496113_0359648 Ga0496113_0359648_155_712 185
38 3300049583 Ga0501067_0163403 Ga0501067_0163403_483_1040 185
39 3300025920 Ga0207649_10415782 Ga0207649_104157821 186
40 3300014326 Ga0157380_10453228 Ga0157380_104532282 187
41 3300048091 Ga0495626_0080692 Ga0495626_0080692_21_584 187
42 3300004798 Ga0058859_10020293 Ga0058859_100202934 191
43 3300026075 Ga0207708_10159989 Ga0207708_101599892 191
44 3300009094 Ga0111539_11658631 Ga0111539_116586311 192
45 3300025926 Ga0207659_10866155 Ga0207659_108661551 192
46 3300046537 Ga0495598_0065361 Ga0495598_0065361_335_928 192
47 3300048924 Ga0496121_0000061 Ga0496121_0000061_110043_110699 192
48 3300050511 nmdc:mga08y16_1456771_c1 nmdc:mga08y16_1456771_c1_19_612 192
49 3300005327 Ga0070658_10276256 Ga0070658_102762562 193
50 3300005344 Ga0070661_100013745 Ga0070661_1000137456 193
51 3300005458 Ga0070681_10149392 Ga0070681_101493922 193
52 3300005530 Ga0070679_100092415 Ga0070679_1000924152 193
53 3300013104 Ga0157370_10037783 Ga0157370_100377834 193
54 3300013105 Ga0157369_10119859 Ga0157369_101198593 193
55 3300025909 Ga0207705_10005892 Ga0207705_1000589210 193
56 3300025912 Ga0207707_10479375 Ga0207707_104793752 193
57 3300025917 Ga0207660_10237437 Ga0207660_102374371 193
58 3300025919 Ga0207657_10013116 Ga0207657_100131164 193
59 3300025920 Ga0207649_10036909 Ga0207649_100369092 193
60 3300025921 Ga0207652_10256856 Ga0207652_102568562 193
61 3300026067 Ga0207678_10035181 Ga0207678_100351812 193
62 3300005841 Ga0068863_100036360 Ga0068863_1000363605 194
63 3300006931 Ga0097620_100024576 Ga0097620_1000245767 194
64 3300009101 Ga0105247_10128837 Ga0105247_101288372 194
65 3300009177 Ga0105248_10054079 Ga0105248_100540794 194
66 3300025900 Ga0207710_10099888 Ga0207710_100998882 194
67 3300025941 Ga0207711_10198186 Ga0207711_101981863 194
68 3300037418 Ga0395900_0174337 Ga0395900_0174337_1260_1844 194
69 3300037466 Ga0395898_0406293 Ga0395898_0406293_37_621 194
70 3300037471 Ga0395905_0014010 Ga0395905_0014010_4744_5328 194
71 3300038443 Ga0395901_0060208 Ga0395901_0060208_1901_2485 194
72 3300014497 Ga0182008_10047749 Ga0182008_100477492 195
73 3300021361 Ga0213872_10206911 Ga0213872_102069112 195
74 3300039447 Ga0436361_1061929 Ga0436361_1061929_248_865 195
75 3300005335 Ga0070666_10149335 Ga0070666_101493352 196
76 3300005345 Ga0070692_10237705 Ga0070692_102377052 196
77 3300005618 Ga0068864_100385326 Ga0068864_1003853262 196
78 3300005840 Ga0068870_10314823 Ga0068870_103148231 196
79 3300005844 Ga0068862_100018840 Ga0068862_1000188403 196
80 3300026095 Ga0207676_10067865 Ga0207676_100678653 196
81 3300028380 Ga0268265_10019122 Ga0268265_100191223 196
82 3300044658 Ga0466972_0297566 Ga0466972_0297566_82_681 197
83 3300046684 Ga0495669_0009878 Ga0495669_0009878_3274_3867 197
84 3300003316 rootH1_10158387 rootH1_101583872 198
85 3300003322 rootL2_10051997 rootL2_1005199714 198
86 3300005355 Ga0070671_100143805 Ga0070671_1001438052 198
87 3300005366 Ga0070659_100003728 Ga0070659_1000037289 198
88 3300005366 Ga0070659_100286720 Ga0070659_1002867202 198
89 3300005367 Ga0070667_100008232 Ga0070667_1000082327 198
90 3300005435 Ga0070714_100064263 Ga0070714_1000642633 198
91 3300005436 Ga0070713_100005496 Ga0070713_1000054962 198
92 3300005457 Ga0070662_100117275 Ga0070662_1001172752 198
93 3300005458 Ga0070681_10383167 Ga0070681_103831671 198
94 3300005539 Ga0068853_100268309 Ga0068853_1002683092 198
95 3300005543 Ga0070672_100217224 Ga0070672_1002172242 198
96 3300005563 Ga0068855_100169163 Ga0068855_1001691633 198
97 3300005577 Ga0068857_100001454 Ga0068857_10000145412 198
98 3300005577 Ga0068857_100426765 Ga0068857_1004267652 198
99 3300005578 Ga0068854_100372822 Ga0068854_1003728222 198
100 3300005616 Ga0068852_100087972 Ga0068852_1000879722 198
101 3300005617 Ga0068859_100237460 Ga0068859_1002374602 198
102 3300005618 Ga0068864_100000897 Ga0068864_1000008978 198
103 3300005841 Ga0068863_100003418 Ga0068863_1000034188 198
104 3300005842 Ga0068858_100018417 Ga0068858_1000184172 198
105 3300005843 Ga0068860_100170109 Ga0068860_1001701092 198
106 3300006237 Ga0097621_100354879 Ga0097621_1003548791 198
107 3300006358 Ga0068871_100038507 Ga0068871_1000385074 198
108 3300006931 Ga0097620_100237462 Ga0097620_1002374622 198
109 3300009177 Ga0105248_10040397 Ga0105248_100403972 198
110 3300013296 Ga0157374_10377231 Ga0157374_103772312 198
111 3300014968 Ga0157379_10006760 Ga0157379_100067608 198
112 3300025923 Ga0207681_10059294 Ga0207681_100592943 198
113 3300025925 Ga0207650_10725893 Ga0207650_107258931 198
114 3300025926 Ga0207659_10125053 Ga0207659_101250533 198
115 3300025928 Ga0207700_10112019 Ga0207700_101120191 198
116 3300025929 Ga0207664_10039323 Ga0207664_100393233 198
117 3300025931 Ga0207644_10002376 Ga0207644_100023762 198
118 3300025932 Ga0207690_10019258 Ga0207690_100192584 198
119 3300025933 Ga0207706_10125524 Ga0207706_101255243 198
120 3300025945 Ga0207679_10034202 Ga0207679_100342024 198
121 3300025945 Ga0207679_10050807 Ga0207679_100508073 198
122 3300025949 Ga0207667_10485026 Ga0207667_104850262 198
123 3300025986 Ga0207658_10070034 Ga0207658_100700343 198
124 3300026078 Ga0207702_10005348 Ga0207702_100053482 198
125 3300026088 Ga0207641_10053253 Ga0207641_100532532 198
126 3300026095 Ga0207676_10005455 Ga0207676_100054558 198
127 3300026095 Ga0207676_10216504 Ga0207676_102165042 198
128 3300026116 Ga0207674_10003442 Ga0207674_100034428 198
129 3300026116 Ga0207674_10050377 Ga0207674_100503772 198
130 3300026142 Ga0207698_11207869 Ga0207698_112078692 198
131 3300027876 Ga0209974_10010444 Ga0209974_100104442 198
132 3300028380 Ga0268265_10199531 Ga0268265_101995312 198
133 3300028381 Ga0268264_10153245 Ga0268264_101532452 198
134 3300031911 Ga0307412_10371124 Ga0307412_103711242 198
135 3300031995 Ga0307409_100238495 Ga0307409_1002384951 198
136 3300032002 Ga0307416_100250908 Ga0307416_1002509082 198
137 3300032004 Ga0307414_10126883 Ga0307414_101268833 198
138 3300032005 Ga0307411_10158838 Ga0307411_101588382 198
139 3300048905 Ga0496102_0042910 Ga0496102_0042910_1588_2184 198
140 3300048906 Ga0496103_0016347 Ga0496103_0016347_2517_3113 198
141 3300048909 Ga0496106_0064316 Ga0496106_0064316_1436_2032 198
142 3300048910 Ga0496107_0033903 Ga0496107_0033903_877_1473 198
143 3300048911 Ga0496108_0018888 Ga0496108_0018888_2976_3572 198
144 3300048912 Ga0496109_0006273 Ga0496109_0006273_3203_3799 198
145 3300048913 Ga0496110_0004039 Ga0496110_0004039_3162_3758 198
146 3300048914 Ga0496111_0000244 Ga0496111_0000244_18014_18610 198
147 3300048915 Ga0496112_0019061 Ga0496112_0019061_271_867 198
148 3300048916 Ga0496113_0000515 Ga0496113_0000515_13955_14551 198
149 3300001979 JGI24740J21852_10039507 JGI24740J21852_100395072 199
150 3300001979 JGI24740J21852_10064961 JGI24740J21852_100649612 199
151 3300001979 JGI24740J21852_10083333 JGI24740J21852_100833331 199
152 3300001989 JGI24739J22299_10000896 JGI24739J22299_100008965 199
153 3300001990 JGI24737J22298_10000355 JGI24737J22298_1000035516 199
154 3300001990 JGI24737J22298_10017460 JGI24737J22298_100174602 199
155 3300001990 JGI24737J22298_10069308 JGI24737J22298_100693082 199
156 3300002067 JGI24735J21928_10002044 JGI24735J21928_100020444 199
157 3300002075 JGI24738J21930_10001455 JGI24738J21930_100014552 199
158 3300005293 Ga0065715_10017383 Ga0065715_100173832 199
159 3300005327 Ga0070658_10015142 Ga0070658_100151421 199
160 3300005327 Ga0070658_10572032 Ga0070658_105720322 199
161 3300005328 Ga0070676_10090430 Ga0070676_100904302 199
162 3300005328 Ga0070676_10152142 Ga0070676_101521422 199
163 3300005329 Ga0070683_100005337 Ga0070683_1000053378 199
164 3300005329 Ga0070683_100117752 Ga0070683_1001177523 199
165 3300005331 Ga0070670_100002145 Ga0070670_10000214512 199
166 3300005331 Ga0070670_100140360 Ga0070670_1001403602 199
167 3300005334 Ga0068869_100000230 Ga0068869_10000023010 199
168 3300005334 Ga0068869_100073353 Ga0068869_1000733532 199
169 3300005335 Ga0070666_10027596 Ga0070666_100275962 199
170 3300005335 Ga0070666_10112252 Ga0070666_101122521 199
171 3300005336 Ga0070680_100002564 Ga0070680_10000256410 199
172 3300005336 Ga0070680_100002845 Ga0070680_1000028453 199
173 3300005338 Ga0068868_100013097 Ga0068868_1000130975 199
174 3300005339 Ga0070660_100001061 Ga0070660_10000106110 199
175 3300005339 Ga0070660_100011817 Ga0070660_1000118172 199
176 3300005339 Ga0070660_100079553 Ga0070660_1000795532 199
177 3300005340 Ga0070689_101066646 Ga0070689_1010666461 199
178 3300005341 Ga0070691_10009124 Ga0070691_100091244 199
179 3300005344 Ga0070661_100001787 Ga0070661_1000017871 199
180 3300005344 Ga0070661_100022816 Ga0070661_1000228164 199
181 3300005344 Ga0070661_100049439 Ga0070661_1000494394 199
182 3300005344 Ga0070661_100147628 Ga0070661_1001476282 199
183 3300005345 Ga0070692_10011678 Ga0070692_100116786 199
184 3300005345 Ga0070692_10017276 Ga0070692_100172764 199
185 3300005347 Ga0070668_100026740 Ga0070668_1000267404 199
186 3300005347 Ga0070668_100357678 Ga0070668_1003576782 199
187 3300005353 Ga0070669_100005470 Ga0070669_1000054705 199
188 3300005354 Ga0070675_100076235 Ga0070675_1000762353 199
189 3300005354 Ga0070675_100239461 Ga0070675_1002394612 199
190 3300005355 Ga0070671_100025514 Ga0070671_1000255142 199
191 3300005364 Ga0070673_100000535 Ga0070673_10000053512 199
192 3300005366 Ga0070659_100001166 Ga0070659_10000116617 199
193 3300005366 Ga0070659_100005162 Ga0070659_1000051629 199
194 3300005367 Ga0070667_100107881 Ga0070667_1001078812 199
195 3300005434 Ga0070709_10023808 Ga0070709_100238081 199
196 3300005435 Ga0070714_100030110 Ga0070714_1000301102 199
197 3300005435 Ga0070714_100039056 Ga0070714_1000390564 199
198 3300005435 Ga0070714_100153584 Ga0070714_1001535843 199
199 3300005435 Ga0070714_100282172 Ga0070714_1002821722 199
200 3300005436 Ga0070713_100108629 Ga0070713_1001086292 199
201 3300005444 Ga0070694_100056002 Ga0070694_1000560022 199
202 3300005455 Ga0070663_100005878 Ga0070663_1000058787 199
203 3300005455 Ga0070663_100239882 Ga0070663_1002398822 199
204 3300005455 Ga0070663_100424975 Ga0070663_1004249752 199
205 3300005456 Ga0070678_100367072 Ga0070678_1003670722 199
206 3300005457 Ga0070662_100000390 Ga0070662_10000039019 199
207 3300005457 Ga0070662_100005999 Ga0070662_1000059993 199
208 3300005457 Ga0070662_100044884 Ga0070662_1000448842 199
209 3300005458 Ga0070681_10031091 Ga0070681_100310914 199
210 3300005459 Ga0068867_100084021 Ga0068867_1000840213 199
211 3300005530 Ga0070679_100011099 Ga0070679_1000110994 199
212 3300005530 Ga0070679_100037875 Ga0070679_1000378754 199
213 3300005535 Ga0070684_100005950 Ga0070684_10000595012 199
214 3300005535 Ga0070684_100107284 Ga0070684_1001072842 199
215 3300005535 Ga0070684_100587889 Ga0070684_1005878892 199
216 3300005539 Ga0068853_100003747 Ga0068853_1000037472 199
217 3300005539 Ga0068853_100015106 Ga0068853_1000151065 199
218 3300005539 Ga0068853_100018643 Ga0068853_1000186434 199
219 3300005539 Ga0068853_100233391 Ga0068853_1002333911 199
220 3300005539 Ga0068853_100521135 Ga0068853_1005211352 199
221 3300005543 Ga0070672_100001092 Ga0070672_1000010928 199
222 3300005543 Ga0070672_100010946 Ga0070672_1000109465 199
223 3300005543 Ga0070672_100134828 Ga0070672_1001348283 199
224 3300005548 Ga0070665_100008990 Ga0070665_1000089905 199
225 3300005548 Ga0070665_101157758 Ga0070665_1011577581 199
226 3300005563 Ga0068855_100009251 Ga0068855_1000092517 199
227 3300005563 Ga0068855_100014603 Ga0068855_1000146033 199
228 3300005563 Ga0068855_100135459 Ga0068855_1001354592 199
229 3300005563 Ga0068855_100165247 Ga0068855_1001652473 199
230 3300005563 Ga0068855_100694892 Ga0068855_1006948922 199
231 3300005564 Ga0070664_100001296 Ga0070664_1000012962 199
232 3300005564 Ga0070664_100007726 Ga0070664_1000077264 199
233 3300005564 Ga0070664_100169764 Ga0070664_1001697642 199
234 3300005577 Ga0068857_100078293 Ga0068857_1000782933 199
235 3300005577 Ga0068857_100123519 Ga0068857_1001235191 199
236 3300005577 Ga0068857_100191577 Ga0068857_1001915772 199
237 3300005577 Ga0068857_100230281 Ga0068857_1002302812 199
238 3300005578 Ga0068854_100000919 Ga0068854_10000091917 199
239 3300005578 Ga0068854_100003625 Ga0068854_1000036257 199
240 3300005578 Ga0068854_100470359 Ga0068854_1004703592 199
241 3300005578 Ga0068854_100651782 Ga0068854_1006517821 199
242 3300005614 Ga0068856_100011527 Ga0068856_1000115274 199
243 3300005614 Ga0068856_100022741 Ga0068856_1000227414 199
244 3300005614 Ga0068856_100134030 Ga0068856_1001340301 199
245 3300005616 Ga0068852_100006131 Ga0068852_1000061316 199
246 3300005616 Ga0068852_100053794 Ga0068852_1000537943 199
247 3300005616 Ga0068852_100138962 Ga0068852_1001389623 199
248 3300005616 Ga0068852_100319202 Ga0068852_1003192022 199
249 3300005616 Ga0068852_100590222 Ga0068852_1005902221 199
250 3300005617 Ga0068859_100106230 Ga0068859_1001062302 199
251 3300005618 Ga0068864_100003357 Ga0068864_1000033578 199
252 3300005618 Ga0068864_100192870 Ga0068864_1001928702 199
253 3300005718 Ga0068866_10254655 Ga0068866_102546552 199
254 3300005719 Ga0068861_100242394 Ga0068861_1002423942 199
255 3300005834 Ga0068851_10003322 Ga0068851_100033227 199
256 3300005841 Ga0068863_100194707 Ga0068863_1001947072 199
257 3300005842 Ga0068858_100013259 Ga0068858_1000132594 199
258 3300005842 Ga0068858_100017615 Ga0068858_1000176152 199
259 3300005843 Ga0068860_100017848 Ga0068860_1000178483 199
260 3300005843 Ga0068860_100052951 Ga0068860_1000529515 199
261 3300005844 Ga0068862_100115736 Ga0068862_1001157363 199
262 3300005844 Ga0068862_100653203 Ga0068862_1006532032 199
263 3300006028 Ga0070717_10030714 Ga0070717_100307145 199
264 3300006175 Ga0070712_100019418 Ga0070712_1000194185 199
265 3300006844 Ga0075428_100351054 Ga0075428_1003510542 199
266 3300006881 Ga0068865_100020097 Ga0068865_1000200972 199
267 3300006931 Ga0097620_100106217 Ga0097620_1001062173 199
268 3300009092 Ga0105250_10087198 Ga0105250_100871982 199
269 3300009093 Ga0105240_10019380 Ga0105240_100193802 199
270 3300009093 Ga0105240_10065681 Ga0105240_100656813 199
271 3300009093 Ga0105240_10166411 Ga0105240_101664112 199
272 3300009093 Ga0105240_10288745 Ga0105240_102887452 199
273 3300009098 Ga0105245_10001947 Ga0105245_1000194716 199
274 3300009098 Ga0105245_10031880 Ga0105245_100318802 199
275 3300009174 Ga0105241_10116724 Ga0105241_101167243 199
276 3300009176 Ga0105242_10027715 Ga0105242_100277152 199
277 3300009177 Ga0105248_10010146 Ga0105248_100101466 199
278 3300009177 Ga0105248_10327376 Ga0105248_103273761 199
279 3300009545 Ga0105237_10013446 Ga0105237_100134463 199
280 3300009551 Ga0105238_10032849 Ga0105238_100328496 199
281 3300009553 Ga0105249_10096755 Ga0105249_100967552 199
282 3300010375 Ga0105239_10357312 Ga0105239_103573122 199
283 3300013100 Ga0157373_10007319 Ga0157373_1000731910 199
284 3300013100 Ga0157373_10012534 Ga0157373_100125347 199
285 3300013100 Ga0157373_10135577 Ga0157373_101355772 199
286 3300013100 Ga0157373_10195871 Ga0157373_101958712 199
287 3300013100 Ga0157373_10237173 Ga0157373_102371732 199
288 3300013102 Ga0157371_10068402 Ga0157371_100684023 199
289 3300013102 Ga0157371_10136176 Ga0157371_101361763 199
290 3300013104 Ga0157370_10059121 Ga0157370_100591215 199
291 3300013104 Ga0157370_10065215 Ga0157370_100652151 199
292 3300013104 Ga0157370_10066600 Ga0157370_100666005 199
293 3300013104 Ga0157370_10129694 Ga0157370_101296943 199
294 3300013104 Ga0157370_10527226 Ga0157370_105272262 199
295 3300013105 Ga0157369_10046479 Ga0157369_100464792 199
296 3300013105 Ga0157369_10059002 Ga0157369_100590023 199
297 3300013105 Ga0157369_10317225 Ga0157369_103172251 199
298 3300013105 Ga0157369_10426180 Ga0157369_104261802 199
299 3300013105 Ga0157369_10841994 Ga0157369_108419942 199
300 3300013297 Ga0157378_10014264 Ga0157378_100142648 199
301 3300013297 Ga0157378_10406296 Ga0157378_104062962 199
302 3300013306 Ga0163162_10061377 Ga0163162_100613772 199
303 3300013307 Ga0157372_10330400 Ga0157372_103304003 199
304 3300013307 Ga0157372_10375437 Ga0157372_103754372 199
305 3300013307 Ga0157372_10697082 Ga0157372_106970822 199
306 3300013308 Ga0157375_10022235 Ga0157375_100222357 199
307 3300014326 Ga0157380_10354135 Ga0157380_103541352 199
308 3300014745 Ga0157377_10019876 Ga0157377_100198763 199
309 3300014968 Ga0157379_10080161 Ga0157379_100801611 199
310 3300020069 Ga0197907_11483432 Ga0197907_114834321 199
311 3300020070 Ga0206356_10308331 Ga0206356_103083311 199
312 3300020070 Ga0206356_11242570 Ga0206356_112425702 199
313 3300020078 Ga0206352_11205138 Ga0206352_112051381 199
314 3300020080 Ga0206350_10308023 Ga0206350_103080232 199
315 3300020082 Ga0206353_10924983 Ga0206353_109249831 199
316 3300025290 Ga0207673_1008721 Ga0207673_10087212 199
317 3300025315 Ga0207697_10000082 Ga0207697_1000008223 199
318 3300025321 Ga0207656_10002169 Ga0207656_100021692 199
319 3300025899 Ga0207642_10232549 Ga0207642_102325491 199
320 3300025901 Ga0207688_10026523 Ga0207688_100265232 199
321 3300025901 Ga0207688_10250549 Ga0207688_102505492 199
322 3300025903 Ga0207680_10045712 Ga0207680_100457123 199
323 3300025903 Ga0207680_10097002 Ga0207680_100970022 199
324 3300025904 Ga0207647_10000259 Ga0207647_100002598 199
325 3300025904 Ga0207647_10001197 Ga0207647_1000119715 199
326 3300025904 Ga0207647_10003110 Ga0207647_100031106 199
327 3300025904 Ga0207647_10041888 Ga0207647_100418882 199
328 3300025906 Ga0207699_10371708 Ga0207699_103717082 199
329 3300025906 Ga0207699_10423581 Ga0207699_104235812 199
330 3300025907 Ga0207645_10155625 Ga0207645_101556252 199
331 3300025909 Ga0207705_10000123 Ga0207705_1000012341 199
332 3300025909 Ga0207705_10003112 Ga0207705_1000311215 199
333 3300025912 Ga0207707_10224089 Ga0207707_102240891 199
334 3300025913 Ga0207695_10031219 Ga0207695_100312193 199
335 3300025913 Ga0207695_10032631 Ga0207695_100326314 199
336 3300025913 Ga0207695_10292690 Ga0207695_102926902 199
337 3300025913 Ga0207695_10634306 Ga0207695_106343062 199
338 3300025914 Ga0207671_10650081 Ga0207671_106500811 199
339 3300025915 Ga0207693_10031706 Ga0207693_100317063 199
340 3300025915 Ga0207693_10037725 Ga0207693_100377254 199
341 3300025917 Ga0207660_10009248 Ga0207660_100092484 199
342 3300025917 Ga0207660_10592670 Ga0207660_105926701 199
343 3300025919 Ga0207657_10000650 Ga0207657_1000065033 199
344 3300025919 Ga0207657_10004090 Ga0207657_100040908 199
345 3300025919 Ga0207657_10009514 Ga0207657_1000951411 199
346 3300025919 Ga0207657_10027070 Ga0207657_100270706 199
347 3300025919 Ga0207657_10335891 Ga0207657_103358912 199
348 3300025920 Ga0207649_10039258 Ga0207649_100392582 199
349 3300025920 Ga0207649_10120259 Ga0207649_101202592 199
350 3300025921 Ga0207652_10000034 Ga0207652_1000003473 199
351 3300025921 Ga0207652_10288668 Ga0207652_102886682 199
352 3300025924 Ga0207694_10040576 Ga0207694_100405763 199
353 3300025924 Ga0207694_10400242 Ga0207694_104002422 199
354 3300025925 Ga0207650_10004067 Ga0207650_1000406711 199
355 3300025926 Ga0207659_10012771 Ga0207659_100127713 199
356 3300025926 Ga0207659_10200238 Ga0207659_102002382 199
357 3300025928 Ga0207700_10067184 Ga0207700_100671843 199
358 3300025928 Ga0207700_10138985 Ga0207700_101389854 199
359 3300025929 Ga0207664_10075955 Ga0207664_100759555 199
360 3300025932 Ga0207690_10011308 Ga0207690_100113081 199
361 3300025932 Ga0207690_10027521 Ga0207690_100275215 199
362 3300025932 Ga0207690_10030169 Ga0207690_100301693 199
363 3300025932 Ga0207690_10137253 Ga0207690_101372532 199
364 3300025933 Ga0207706_10001125 Ga0207706_1000112526 199
365 3300025933 Ga0207706_10033985 Ga0207706_100339853 199
366 3300025933 Ga0207706_10065654 Ga0207706_100656542 199
367 3300025934 Ga0207686_10112449 Ga0207686_101124493 199
368 3300025935 Ga0207709_10075159 Ga0207709_100751592 199
369 3300025936 Ga0207670_10468249 Ga0207670_104682492 199
370 3300025938 Ga0207704_10019649 Ga0207704_100196492 199
371 3300025940 Ga0207691_10017486 Ga0207691_100174868 199
372 3300025940 Ga0207691_10048595 Ga0207691_100485954 199
373 3300025941 Ga0207711_10016576 Ga0207711_100165768 199
374 3300025942 Ga0207689_10000561 Ga0207689_100005618 199
375 3300025942 Ga0207689_10014133 Ga0207689_100141333 199
376 3300025944 Ga0207661_10003613 Ga0207661_100036138 199
377 3300025945 Ga0207679_10004860 Ga0207679_100048602 199
378 3300025949 Ga0207667_10008316 Ga0207667_100083163 199
379 3300025949 Ga0207667_10031787 Ga0207667_100317873 199
380 3300025949 Ga0207667_10050596 Ga0207667_100505963 199
381 3300025960 Ga0207651_10001237 Ga0207651_100012377 199
382 3300025960 Ga0207651_10480220 Ga0207651_104802202 199
383 3300025961 Ga0207712_10001096 Ga0207712_1000109620 199
384 3300025981 Ga0207640_10000788 Ga0207640_1000078816 199
385 3300025981 Ga0207640_10001178 Ga0207640_100011789 199
386 3300025981 Ga0207640_10020554 Ga0207640_100205544 199
387 3300025981 Ga0207640_10021671 Ga0207640_100216712 199
388 3300025981 Ga0207640_10648202 Ga0207640_106482021 199
389 3300025981 Ga0207640_10760349 Ga0207640_107603491 199
390 3300025986 Ga0207658_10279557 Ga0207658_102795571 199
391 3300026023 Ga0207677_10014000 Ga0207677_100140002 199
392 3300026035 Ga0207703_10013406 Ga0207703_100134062 199
393 3300026041 Ga0207639_10010459 Ga0207639_100104597 199
394 3300026041 Ga0207639_10025397 Ga0207639_100253975 199
395 3300026067 Ga0207678_10000530 Ga0207678_1000053012 199
396 3300026067 Ga0207678_10102494 Ga0207678_101024942 199
397 3300026067 Ga0207678_10125516 Ga0207678_101255162 199
398 3300026075 Ga0207708_10366312 Ga0207708_103663122 199
399 3300026078 Ga0207702_10025220 Ga0207702_100252203 199
400 3300026078 Ga0207702_10068484 Ga0207702_100684842 199
401 3300026078 Ga0207702_10115257 Ga0207702_101152573 199
402 3300026088 Ga0207641_10035574 Ga0207641_100355744 199
403 3300026088 Ga0207641_10202650 Ga0207641_102026502 199
404 3300026089 Ga0207648_10007119 Ga0207648_100071198 199
405 3300026089 Ga0207648_10044397 Ga0207648_100443972 199
406 3300026095 Ga0207676_10031712 Ga0207676_100317125 199
407 3300026095 Ga0207676_10099267 Ga0207676_100992672 199
408 3300026095 Ga0207676_10227979 Ga0207676_102279792 199
409 3300026116 Ga0207674_10002685 Ga0207674_100026858 199
410 3300026116 Ga0207674_10004250 Ga0207674_100042506 199
411 3300026116 Ga0207674_10076134 Ga0207674_100761342 199
412 3300026116 Ga0207674_10133998 Ga0207674_101339983 199
413 3300026116 Ga0207674_10198690 Ga0207674_101986903 199
414 3300026118 Ga0207675_100201396 Ga0207675_1002013962 199
415 3300026118 Ga0207675_100285167 Ga0207675_1002851672 199
416 3300026121 Ga0207683_10042173 Ga0207683_100421734 199
417 3300026121 Ga0207683_10299257 Ga0207683_102992572 199
418 3300026142 Ga0207698_10023009 Ga0207698_100230092 199
419 3300026142 Ga0207698_10052923 Ga0207698_100529232 199
420 3300026142 Ga0207698_10646483 Ga0207698_106464832 199
421 3300028379 Ga0268266_10000458 Ga0268266_1000045842 199
422 3300028379 Ga0268266_10031622 Ga0268266_100316223 199
423 3300028379 Ga0268266_10569847 Ga0268266_105698472 199
424 3300028380 Ga0268265_10016311 Ga0268265_100163116 199
425 3300028381 Ga0268264_10007507 Ga0268264_100075077 199
426 3300028381 Ga0268264_10096086 Ga0268264_100960863 199
427 3300031911 Ga0307412_10026888 Ga0307412_100268883 199
428 3300036401 Ga0373937_0414737 Ga0373937_0414737_122_721 199
429 3300037312 Ga0395899_0040322 Ga0395899_0040322_2658_3257 199
430 3300037312 Ga0395899_0044176 Ga0395899_0044176_2324_2923 199
431 3300037312 Ga0395899_0294297 Ga0395899_0294297_113_712 199
432 3300037312 Ga0395899_0470830 Ga0395899_0470830_174_773 199
433 3300037418 Ga0395900_0023793 Ga0395900_0023793_1170_1769 199
434 3300037418 Ga0395900_0039979 Ga0395900_0039979_3842_4441 199
435 3300037418 Ga0395900_0048315 Ga0395900_0048315_1449_2048 199
436 3300037418 Ga0395900_0141799 Ga0395900_0141799_1817_2416 199
437 3300037418 Ga0395900_0329344 Ga0395900_0329344_621_1220 199
438 3300037418 Ga0395900_0751515 Ga0395900_0751515_192_791 199
439 3300037418 Ga0395900_0993093 Ga0395900_0993093_36_635 199
440 3300037466 Ga0395898_0054987 Ga0395898_0054987_3085_3684 199
441 3300037471 Ga0395905_0012839 Ga0395905_0012839_4523_5122 199
442 3300037471 Ga0395905_0019482 Ga0395905_0019482_641_1240 199
443 3300037471 Ga0395905_0116205 Ga0395905_0116205_387_986 199
444 3300037471 Ga0395905_0139764 Ga0395905_0139764_63_662 199
445 3300037471 Ga0395905_0309355 Ga0395905_0309355_229_828 199
446 3300038443 Ga0395901_0017022 Ga0395901_0017022_5688_6287 199
447 3300038443 Ga0395901_0020134 Ga0395901_0020134_1690_2289 199
448 3300038443 Ga0395901_0023308 Ga0395901_0023308_2882_3481 199
449 3300038443 Ga0395901_0495231 Ga0395901_0495231_623_1222 199
450 3300038443 Ga0395901_1179432 Ga0395901_1179432_123_722 199
451 3300044656 Ga0466969_0097709 Ga0466969_0097709_142_741 199
452 3300044656 Ga0466969_0147356 Ga0466969_0147356_410_1009 199
453 3300044658 Ga0466972_0145361 Ga0466972_0145361_63_680 199
454 3300044684 Ga0466966_0009469 Ga0466966_0009469_35_634 199
455 3300044693 Ga0466961_0020554 Ga0466961_0020554_60_659 199
456 3300044693 Ga0466961_0106654 Ga0466961_0106654_1021_1620 199
457 3300044693 Ga0466961_0275410 Ga0466961_0275410_107_706 199
458 3300044694 Ga0466963_0005307 Ga0466963_0005307_4476_5075 199
459 3300044694 Ga0466963_0079548 Ga0466963_0079548_85_684 199
460 3300044694 Ga0466963_0087170 Ga0466963_0087170_84_683 199
461 3300044719 Ga0466971_0001211 Ga0466971_0001211_4777_5376 199
462 3300044719 Ga0466971_0022472 Ga0466971_0022472_136_735 199
463 3300044719 Ga0466971_0354625 Ga0466971_0354625_54_653 199
464 3300044765 Ga0466970_0138916 Ga0466970_0138916_453_1052 199
465 3300044765 Ga0466970_0331530 Ga0466970_0331530_217_816 199
466 3300044842 Ga0466957_0002399 Ga0466957_0002399_4146_4745 199
467 3300044842 Ga0466957_0184671 Ga0466957_0184671_305_904 199
468 3300044842 Ga0466957_0313671 Ga0466957_0313671_306_905 199
469 3300045049 Ga0466959_0252933 Ga0466959_0252933_517_1116 199
470 3300045049 Ga0466959_0655970 Ga0466959_0655970_26_625 199
471 3300045836 Ga0466958_0009813 Ga0466958_0009813_2477_3076 199
472 3300045836 Ga0466958_0054461 Ga0466958_0054461_1518_2117 199
473 3300045836 Ga0466958_0063042 Ga0466958_0063042_523_1122 199
474 3300045836 Ga0466958_0084009 Ga0466958_0084009_957_1556 199
475 3300045836 Ga0466958_0116092 Ga0466958_0116092_261_860 199
476 3300045836 Ga0466958_0176799 Ga0466958_0176799_321_920 199
477 3300045976 Ga0466967_0052424 Ga0466967_0052424_901_1500 199
478 3300045976 Ga0466967_0257609 Ga0466967_0257609_1056_1655 199
479 3300045976 Ga0466967_0322807 Ga0466967_0322807_753_1352 199
480 3300045976 Ga0466967_0389541 Ga0466967_0389541_256_870 199
481 3300046537 Ga0495598_0003569 Ga0495598_0003569_1593_2192 199
482 3300046539 Ga0495621_0006280 Ga0495621_0006280_2138_2737 199
483 3300048906 Ga0496103_0476318 Ga0496103_0476318_153_752 199
484 3300061719 Ga0466962_0008758 Ga0466962_0008758_1961_2560 199
485 3300061719 Ga0466962_0208054 Ga0466962_0208054_318_917 199
486 3300001904 JGI24736J21556_1000429 JGI24736J21556_10004291 200
487 3300001979 JGI24740J21852_10023652 JGI24740J21852_100236521 200
488 3300001990 JGI24737J22298_10002309 JGI24737J22298_100023098 200
489 3300001990 JGI24737J22298_10008905 JGI24737J22298_100089052 200
490 3300002075 JGI24738J21930_10001891 JGI24738J21930_100018914 200
491 3300005290 Ga0065712_10180228 Ga0065712_101802282 200
492 3300005293 Ga0065715_10167000 Ga0065715_101670001 200
493 3300005295 Ga0065707_10321111 Ga0065707_103211111 200
494 3300005327 Ga0070658_10000107 Ga0070658_1000010752 200
495 3300005327 Ga0070658_10018716 Ga0070658_100187162 200
496 3300005327 Ga0070658_10107558 Ga0070658_101075583 200
497 3300005327 Ga0070658_10254386 Ga0070658_102543862 200
498 3300005328 Ga0070676_10201715 Ga0070676_102017151 200
499 3300005328 Ga0070676_10270820 Ga0070676_102708202 200
500 3300005329 Ga0070683_100000826 Ga0070683_10000082616 200
501 3300005329 Ga0070683_100041523 Ga0070683_1000415232 200
502 3300005329 Ga0070683_100055267 Ga0070683_1000552672 200
503 3300005330 Ga0070690_100311318 Ga0070690_1003113181 200
504 3300005331 Ga0070670_100001372 Ga0070670_1000013729 200
505 3300005331 Ga0070670_100007777 Ga0070670_10000777710 200
506 3300005331 Ga0070670_100007963 Ga0070670_1000079634 200
507 3300005331 Ga0070670_100022348 Ga0070670_1000223486 200
508 3300005335 Ga0070666_10000169 Ga0070666_1000016922 200
509 3300005335 Ga0070666_10047270 Ga0070666_100472702 200
510 3300005335 Ga0070666_10164829 Ga0070666_101648292 200
511 3300005336 Ga0070680_100299125 Ga0070680_1002991252 200
512 3300005337 Ga0070682_100041747 Ga0070682_1000417473 200
513 3300005337 Ga0070682_100166969 Ga0070682_1001669692 200
514 3300005338 Ga0068868_100108376 Ga0068868_1001083763 200
515 3300005338 Ga0068868_100169380 Ga0068868_1001693801 200
516 3300005339 Ga0070660_100000705 Ga0070660_10000070519 200
517 3300005339 Ga0070660_100028953 Ga0070660_1000289532 200
518 3300005339 Ga0070660_100055092 Ga0070660_1000550921 200
519 3300005339 Ga0070660_100471762 Ga0070660_1004717622 200
520 3300005340 Ga0070689_100400779 Ga0070689_1004007792 200
521 3300005343 Ga0070687_100085806 Ga0070687_1000858062 200
522 3300005344 Ga0070661_100000070 Ga0070661_10000007014 200
523 3300005344 Ga0070661_100012952 Ga0070661_1000129526 200
524 3300005344 Ga0070661_100182901 Ga0070661_1001829012 200
525 3300005345 Ga0070692_10012145 Ga0070692_100121455 200
526 3300005345 Ga0070692_10216770 Ga0070692_102167702 200
527 3300005345 Ga0070692_10318799 Ga0070692_103187991 200
528 3300005347 Ga0070668_100001895 Ga0070668_1000018955 200
529 3300005347 Ga0070668_100405204 Ga0070668_1004052042 200
530 3300005353 Ga0070669_100057112 Ga0070669_1000571123 200
531 3300005353 Ga0070669_100068084 Ga0070669_1000680842 200
532 3300005353 Ga0070669_100432002 Ga0070669_1004320021 200
533 3300005353 Ga0070669_100440128 Ga0070669_1004401281 200
534 3300005355 Ga0070671_100003153 Ga0070671_10000315310 200
535 3300005355 Ga0070671_100033882 Ga0070671_1000338824 200
536 3300005355 Ga0070671_100257883 Ga0070671_1002578832 200
537 3300005356 Ga0070674_100134573 Ga0070674_1001345731 200
538 3300005364 Ga0070673_100025088 Ga0070673_1000250882 200
539 3300005364 Ga0070673_100052062 Ga0070673_1000520623 200
540 3300005364 Ga0070673_100480694 Ga0070673_1004806941 200
541 3300005366 Ga0070659_100000045 Ga0070659_10000004525 200
542 3300005366 Ga0070659_100003703 Ga0070659_1000037035 200
543 3300005366 Ga0070659_100010096 Ga0070659_1000100962 200
544 3300005366 Ga0070659_100050724 Ga0070659_1000507242 200
545 3300005366 Ga0070659_100134715 Ga0070659_1001347152 200
546 3300005366 Ga0070659_100267616 Ga0070659_1002676162 200
547 3300005366 Ga0070659_100273396 Ga0070659_1002733962 200
548 3300005367 Ga0070667_100003638 Ga0070667_1000036389 200
549 3300005367 Ga0070667_100040943 Ga0070667_1000409434 200
550 3300005367 Ga0070667_100102216 Ga0070667_1001022162 200
551 3300005367 Ga0070667_100138264 Ga0070667_1001382642 200
552 3300005367 Ga0070667_100148793 Ga0070667_1001487932 200
553 3300005367 Ga0070667_100246053 Ga0070667_1002460533 200
554 3300005367 Ga0070667_100723793 Ga0070667_1007237931 200
555 3300005367 Ga0070667_100744870 Ga0070667_1007448701 200
556 3300005444 Ga0070694_100003942 Ga0070694_1000039424 200
557 3300005444 Ga0070694_100426483 Ga0070694_1004264831 200
558 3300005455 Ga0070663_100001742 Ga0070663_10000174216 200
559 3300005455 Ga0070663_100023452 Ga0070663_1000234525 200
560 3300005455 Ga0070663_100043555 Ga0070663_1000435552 200
561 3300005455 Ga0070663_100053536 Ga0070663_1000535364 200
562 3300005455 Ga0070663_100415732 Ga0070663_1004157322 200
563 3300005456 Ga0070678_100184162 Ga0070678_1001841622 200
564 3300005456 Ga0070678_100246471 Ga0070678_1002464712 200
565 3300005457 Ga0070662_100000037 Ga0070662_1000000374 200
566 3300005457 Ga0070662_100002727 Ga0070662_1000027274 200
567 3300005457 Ga0070662_100110696 Ga0070662_1001106962 200
568 3300005458 Ga0070681_10901276 Ga0070681_109012761 200
569 3300005459 Ga0068867_100060922 Ga0068867_1000609223 200
570 3300005530 Ga0070679_100132242 Ga0070679_1001322421 200
571 3300005530 Ga0070679_100277052 Ga0070679_1002770522 200
572 3300005535 Ga0070684_100003373 Ga0070684_10000337315 200
573 3300005535 Ga0070684_100010973 Ga0070684_1000109734 200
574 3300005535 Ga0070684_100152039 Ga0070684_1001520391 200
575 3300005539 Ga0068853_100000213 Ga0068853_1000002134 200
576 3300005539 Ga0068853_100046718 Ga0068853_1000467185 200
577 3300005539 Ga0068853_100149028 Ga0068853_1001490282 200
578 3300005543 Ga0070672_100074990 Ga0070672_1000749902 200
579 3300005543 Ga0070672_100172853 Ga0070672_1001728532 200
580 3300005547 Ga0070693_100000168 Ga0070693_10000016812 200
581 3300005548 Ga0070665_100001821 Ga0070665_1000018219 200
582 3300005548 Ga0070665_100012284 Ga0070665_1000122849 200
583 3300005548 Ga0070665_100028422 Ga0070665_1000284223 200
584 3300005548 Ga0070665_100787518 Ga0070665_1007875182 200
585 3300005548 Ga0070665_100954062 Ga0070665_1009540621 200
586 3300005563 Ga0068855_100000751 Ga0068855_1000007516 200
587 3300005563 Ga0068855_100047326 Ga0068855_1000473263 200
588 3300005563 Ga0068855_100672131 Ga0068855_1006721312 200
589 3300005563 Ga0068855_100763135 Ga0068855_1007631352 200
590 3300005564 Ga0070664_100000027 Ga0070664_10000002796 200
591 3300005564 Ga0070664_100000464 Ga0070664_10000046436 200
592 3300005564 Ga0070664_100003499 Ga0070664_1000034997 200
593 3300005564 Ga0070664_100017421 Ga0070664_1000174214 200
594 3300005564 Ga0070664_100072242 Ga0070664_1000722423 200
595 3300005564 Ga0070664_100434173 Ga0070664_1004341731 200
596 3300005564 Ga0070664_100481912 Ga0070664_1004819122 200
597 3300005577 Ga0068857_100013811 Ga0068857_1000138115 200
598 3300005577 Ga0068857_100025701 Ga0068857_1000257016 200
599 3300005577 Ga0068857_100198801 Ga0068857_1001988013 200
600 3300005578 Ga0068854_100005197 Ga0068854_1000051971 200
601 3300005578 Ga0068854_100010605 Ga0068854_1000106055 200
602 3300005578 Ga0068854_100047223 Ga0068854_1000472231 200
603 3300005578 Ga0068854_100114548 Ga0068854_1001145482 200
604 3300005614 Ga0068856_100000743 Ga0068856_10000074313 200
605 3300005614 Ga0068856_100052360 Ga0068856_1000523603 200
606 3300005616 Ga0068852_100000480 Ga0068852_10000048017 200
607 3300005616 Ga0068852_100213260 Ga0068852_1002132603 200
608 3300005616 Ga0068852_100234645 Ga0068852_1002346453 200
609 3300005616 Ga0068852_100428775 Ga0068852_1004287752 200
610 3300005616 Ga0068852_100576689 Ga0068852_1005766892 200
611 3300005617 Ga0068859_100003231 Ga0068859_10000323110 200
612 3300005617 Ga0068859_100039750 Ga0068859_1000397502 200
613 3300005617 Ga0068859_100073615 Ga0068859_1000736154 200
614 3300005617 Ga0068859_100124237 Ga0068859_1001242373 200
615 3300005618 Ga0068864_100026930 Ga0068864_1000269305 200
616 3300005618 Ga0068864_100087811 Ga0068864_1000878112 200
617 3300005618 Ga0068864_100170692 Ga0068864_1001706922 200
618 3300005834 Ga0068851_10002638 Ga0068851_100026384 200
619 3300005834 Ga0068851_10128098 Ga0068851_101280982 200
620 3300005840 Ga0068870_10465456 Ga0068870_104654562 200
621 3300005841 Ga0068863_100017105 Ga0068863_1000171053 200
622 3300005841 Ga0068863_100053201 Ga0068863_1000532012 200
623 3300005841 Ga0068863_100528722 Ga0068863_1005287221 200
624 3300005842 Ga0068858_100010567 Ga0068858_1000105677 200
625 3300005842 Ga0068858_100064108 Ga0068858_1000641084 200
626 3300005842 Ga0068858_100303237 Ga0068858_1003032373 200
627 3300005842 Ga0068858_100760785 Ga0068858_1007607852 200
628 3300005843 Ga0068860_100005048 Ga0068860_10000504813 200
629 3300005843 Ga0068860_100006336 Ga0068860_1000063364 200
630 3300005843 Ga0068860_100018770 Ga0068860_1000187708 200
631 3300005843 Ga0068860_100307669 Ga0068860_1003076692 200
632 3300005844 Ga0068862_100004011 Ga0068862_10000401113 200
633 3300005844 Ga0068862_100067965 Ga0068862_1000679654 200
634 3300006237 Ga0097621_100251394 Ga0097621_1002513942 200
635 3300006237 Ga0097621_100402133 Ga0097621_1004021332 200
636 3300006358 Ga0068871_100120013 Ga0068871_1001200132 200
637 3300006844 Ga0075428_100567981 Ga0075428_1005679811 200
638 3300006852 Ga0075433_10008969 Ga0075433_100089699 200
639 3300006852 Ga0075433_10070855 Ga0075433_100708551 200
640 3300006871 Ga0075434_100496963 Ga0075434_1004969632 200
641 3300006881 Ga0068865_100186668 Ga0068865_1001866681 200
642 3300006931 Ga0097620_100003231 Ga0097620_10000323110 200
643 3300006931 Ga0097620_100039749 Ga0097620_1000397492 200
644 3300006931 Ga0097620_100073618 Ga0097620_1000736184 200
645 3300006931 Ga0097620_100124244 Ga0097620_1001242443 200
646 3300007076 Ga0075435_100583628 Ga0075435_1005836281 200
647 3300009092 Ga0105250_10126986 Ga0105250_101269862 200
648 3300009093 Ga0105240_10114679 Ga0105240_101146792 200
649 3300009093 Ga0105240_10116525 Ga0105240_101165252 200
650 3300009093 Ga0105240_10243406 Ga0105240_102434062 200
651 3300009148 Ga0105243_10250746 Ga0105243_102507461 200
652 3300009148 Ga0105243_10447926 Ga0105243_104479261 200
653 3300009174 Ga0105241_10005313 Ga0105241_100053136 200
654 3300009174 Ga0105241_10101656 Ga0105241_101016562 200
655 3300009174 Ga0105241_10398531 Ga0105241_103985311 200
656 3300009176 Ga0105242_10047939 Ga0105242_100479392 200
657 3300009177 Ga0105248_10006665 Ga0105248_100066657 200
658 3300009177 Ga0105248_10340645 Ga0105248_103406452 200
659 3300009177 Ga0105248_10458189 Ga0105248_104581892 200
660 3300009177 Ga0105248_10819462 Ga0105248_108194622 200
661 3300009177 Ga0105248_10846177 Ga0105248_108461771 200
662 3300009545 Ga0105237_10396280 Ga0105237_103962801 200
663 3300009551 Ga0105238_10108986 Ga0105238_101089864 200
664 3300009553 Ga0105249_10013203 Ga0105249_100132036 200
665 3300009553 Ga0105249_10091563 Ga0105249_100915632 200
666 3300009553 Ga0105249_10181325 Ga0105249_101813252 200
667 3300010375 Ga0105239_10039562 Ga0105239_100395625 200
668 3300010375 Ga0105239_10238101 Ga0105239_102381013 200
669 3300011119 Ga0105246_10032838 Ga0105246_100328381 200
670 3300011119 Ga0105246_10134046 Ga0105246_101340462 200
671 3300013100 Ga0157373_10257573 Ga0157373_102575732 200
672 3300013100 Ga0157373_10474380 Ga0157373_104743802 200
673 3300013102 Ga0157371_10047525 Ga0157371_100475252 200
674 3300013102 Ga0157371_10125739 Ga0157371_101257393 200
675 3300013296 Ga0157374_10003502 Ga0157374_1000350211 200
676 3300013306 Ga0163162_10218879 Ga0163162_102188793 200
677 3300013306 Ga0163162_10566753 Ga0163162_105667532 200
678 3300013307 Ga0157372_10260025 Ga0157372_102600252 200
679 3300013307 Ga0157372_10733913 Ga0157372_107339131 200
680 3300013308 Ga0157375_10009605 Ga0157375_100096054 200
681 3300013308 Ga0157375_10944581 Ga0157375_109445811 200
682 3300013308 Ga0157375_11314225 Ga0157375_113142252 200
683 3300014325 Ga0163163_10870712 Ga0163163_108707122 200
684 3300014745 Ga0157377_10219471 Ga0157377_102194712 200
685 3300017792 Ga0163161_10299599 Ga0163161_102995991 200
686 3300017792 Ga0163161_10329381 Ga0163161_103293812 200
687 3300020070 Ga0206356_11673347 Ga0206356_116733471 200
688 3300025304 Ga0209257_1049869 Ga0209257_10498692 200
689 3300025315 Ga0207697_10041776 Ga0207697_100417762 200
690 3300025315 Ga0207697_10070286 Ga0207697_100702862 200
691 3300025321 Ga0207656_10024729 Ga0207656_100247293 200
692 3300025903 Ga0207680_10002046 Ga0207680_1000204610 200
693 3300025903 Ga0207680_10145911 Ga0207680_101459112 200
694 3300025903 Ga0207680_10247598 Ga0207680_102475981 200
695 3300025903 Ga0207680_10396140 Ga0207680_103961401 200
696 3300025903 Ga0207680_10556008 Ga0207680_105560081 200
697 3300025904 Ga0207647_10005894 Ga0207647_100058946 200
698 3300025904 Ga0207647_10007004 Ga0207647_100070049 200
699 3300025904 Ga0207647_10024446 Ga0207647_100244465 200
700 3300025904 Ga0207647_10077080 Ga0207647_100770802 200
701 3300025907 Ga0207645_10121125 Ga0207645_101211252 200
702 3300025907 Ga0207645_10123540 Ga0207645_101235402 200
703 3300025909 Ga0207705_10000086 Ga0207705_1000008676 200
704 3300025909 Ga0207705_10001490 Ga0207705_1000149015 200
705 3300025909 Ga0207705_10097794 Ga0207705_100977942 200
706 3300025909 Ga0207705_10193140 Ga0207705_101931402 200
707 3300025911 Ga0207654_10043613 Ga0207654_100436134 200
708 3300025911 Ga0207654_10093829 Ga0207654_100938292 200
709 3300025912 Ga0207707_10301106 Ga0207707_103011061 200
710 3300025913 Ga0207695_10143752 Ga0207695_101437523 200
711 3300025917 Ga0207660_10456874 Ga0207660_104568742 200
712 3300025917 Ga0207660_10493087 Ga0207660_104930872 200
713 3300025918 Ga0207662_10017339 Ga0207662_100173391 200
714 3300025919 Ga0207657_10000133 Ga0207657_100001338 200
715 3300025919 Ga0207657_10007346 Ga0207657_100073468 200
716 3300025919 Ga0207657_10061211 Ga0207657_100612114 200
717 3300025919 Ga0207657_10093535 Ga0207657_100935352 200
718 3300025920 Ga0207649_10000629 Ga0207649_1000062920 200
719 3300025920 Ga0207649_10005572 Ga0207649_100055724 200
720 3300025920 Ga0207649_10149880 Ga0207649_101498802 200
721 3300025920 Ga0207649_10175924 Ga0207649_101759241 200
722 3300025920 Ga0207649_10294147 Ga0207649_102941472 200
723 3300025921 Ga0207652_10179818 Ga0207652_101798182 200
724 3300025923 Ga0207681_10044987 Ga0207681_100449872 200
725 3300025923 Ga0207681_10079048 Ga0207681_100790482 200
726 3300025923 Ga0207681_10299821 Ga0207681_102998212 200
727 3300025923 Ga0207681_10509429 Ga0207681_105094291 200
728 3300025924 Ga0207694_10023725 Ga0207694_100237255 200
729 3300025925 Ga0207650_10013303 Ga0207650_100133032 200
730 3300025925 Ga0207650_10013753 Ga0207650_100137532 200
731 3300025925 Ga0207650_10039279 Ga0207650_100392793 200
732 3300025925 Ga0207650_10197287 Ga0207650_101972872 200
733 3300025926 Ga0207659_10159746 Ga0207659_101597462 200
734 3300025931 Ga0207644_10023452 Ga0207644_100234525 200
735 3300025931 Ga0207644_10210635 Ga0207644_102106352 200
736 3300025932 Ga0207690_10000265 Ga0207690_1000026535 200
737 3300025932 Ga0207690_10005349 Ga0207690_100053498 200
738 3300025932 Ga0207690_10007225 Ga0207690_100072257 200
739 3300025932 Ga0207690_10027765 Ga0207690_100277655 200
740 3300025932 Ga0207690_10034448 Ga0207690_100344483 200
741 3300025932 Ga0207690_10169200 Ga0207690_101692002 200
742 3300025932 Ga0207690_10387202 Ga0207690_103872022 200
743 3300025933 Ga0207706_10000159 Ga0207706_100001598 200
744 3300025933 Ga0207706_10010750 Ga0207706_100107504 200
745 3300025933 Ga0207706_10015205 Ga0207706_100152052 200
746 3300025933 Ga0207706_10434245 Ga0207706_104342452 200
747 3300025935 Ga0207709_10167607 Ga0207709_101676071 200
748 3300025936 Ga0207670_10459076 Ga0207670_104590761 200
749 3300025937 Ga0207669_10039379 Ga0207669_100393793 200
750 3300025940 Ga0207691_10002508 Ga0207691_1000250810 200
751 3300025940 Ga0207691_10091393 Ga0207691_100913932 200
752 3300025940 Ga0207691_10124016 Ga0207691_101240162 200
753 3300025940 Ga0207691_10397325 Ga0207691_103973252 200
754 3300025941 Ga0207711_10000914 Ga0207711_1000091417 200
755 3300025941 Ga0207711_10226069 Ga0207711_102260692 200
756 3300025941 Ga0207711_10530609 Ga0207711_105306092 200
757 3300025941 Ga0207711_10876412 Ga0207711_108764122 200
758 3300025942 Ga0207689_10012090 Ga0207689_100120907 200
759 3300025944 Ga0207661_10002539 Ga0207661_100025392 200
760 3300025944 Ga0207661_10004214 Ga0207661_100042147 200
761 3300025945 Ga0207679_10000321 Ga0207679_1000032128 200
762 3300025945 Ga0207679_10004415 Ga0207679_100044152 200
763 3300025945 Ga0207679_10091640 Ga0207679_100916402 200
764 3300025945 Ga0207679_10105411 Ga0207679_101054113 200
765 3300025945 Ga0207679_10152575 Ga0207679_101525752 200
766 3300025945 Ga0207679_10222062 Ga0207679_102220622 200
767 3300025949 Ga0207667_10011837 Ga0207667_1001183710 200
768 3300025949 Ga0207667_10018472 Ga0207667_100184726 200
769 3300025949 Ga0207667_10019245 Ga0207667_100192455 200
770 3300025949 Ga0207667_10143974 Ga0207667_101439742 200
771 3300025949 Ga0207667_10182548 Ga0207667_101825482 200
772 3300025949 Ga0207667_10285351 Ga0207667_102853512 200
773 3300025949 Ga0207667_10567793 Ga0207667_105677931 200
774 3300025949 Ga0207667_11115720 Ga0207667_111157201 200
775 3300025960 Ga0207651_10061400 Ga0207651_100614003 200
776 3300025960 Ga0207651_10114671 Ga0207651_101146712 200
777 3300025961 Ga0207712_10002871 Ga0207712_1000287111 200
778 3300025961 Ga0207712_10030262 Ga0207712_100302624 200
779 3300025961 Ga0207712_10307544 Ga0207712_103075443 200
780 3300025972 Ga0207668_10006655 Ga0207668_100066552 200
781 3300025972 Ga0207668_10215233 Ga0207668_102152331 200
782 3300025972 Ga0207668_10749156 Ga0207668_107491561 200
783 3300025981 Ga0207640_10001594 Ga0207640_100015946 200
784 3300025981 Ga0207640_10072761 Ga0207640_100727611 200
785 3300025981 Ga0207640_10329837 Ga0207640_103298372 200
786 3300025981 Ga0207640_10448839 Ga0207640_104488391 200
787 3300025986 Ga0207658_10012396 Ga0207658_1001239610 200
788 3300025986 Ga0207658_10014851 Ga0207658_100148513 200
789 3300025986 Ga0207658_10077914 Ga0207658_100779143 200
790 3300025986 Ga0207658_10336990 Ga0207658_103369902 200
791 3300025986 Ga0207658_10722577 Ga0207658_107225771 200
792 3300026023 Ga0207677_10156709 Ga0207677_101567091 200
793 3300026023 Ga0207677_10260576 Ga0207677_102605763 200
794 3300026035 Ga0207703_10005442 Ga0207703_100054422 200
795 3300026035 Ga0207703_10148060 Ga0207703_101480603 200
796 3300026035 Ga0207703_10179806 Ga0207703_101798061 200
797 3300026035 Ga0207703_10268712 Ga0207703_102687121 200
798 3300026041 Ga0207639_10000137 Ga0207639_1000013749 200
799 3300026041 Ga0207639_10022416 Ga0207639_100224164 200
800 3300026041 Ga0207639_10105871 Ga0207639_101058712 200
801 3300026041 Ga0207639_10167788 Ga0207639_101677881 200
802 3300026041 Ga0207639_10584797 Ga0207639_105847972 200
803 3300026067 Ga0207678_10004220 Ga0207678_100042205 200
804 3300026067 Ga0207678_10004502 Ga0207678_1000450216 200
805 3300026067 Ga0207678_10019805 Ga0207678_100198052 200
806 3300026067 Ga0207678_10435364 Ga0207678_104353642 200
807 3300026067 Ga0207678_10435673 Ga0207678_104356732 200
808 3300026078 Ga0207702_10002212 Ga0207702_1000221212 200
809 3300026078 Ga0207702_10014217 Ga0207702_100142174 200
810 3300026078 Ga0207702_10054567 Ga0207702_100545675 200
811 3300026088 Ga0207641_10010994 Ga0207641_100109942 200
812 3300026088 Ga0207641_10041216 Ga0207641_100412163 200
813 3300026088 Ga0207641_10048376 Ga0207641_100483762 200
814 3300026088 Ga0207641_10336430 Ga0207641_103364301 200
815 3300026089 Ga0207648_10018823 Ga0207648_100188236 200
816 3300026095 Ga0207676_10044425 Ga0207676_100444252 200
817 3300026095 Ga0207676_10215112 Ga0207676_102151122 200
818 3300026116 Ga0207674_10008633 Ga0207674_100086336 200
819 3300026116 Ga0207674_10009133 Ga0207674_1000913315 200
820 3300026116 Ga0207674_10021572 Ga0207674_100215722 200
821 3300026116 Ga0207674_10032449 Ga0207674_100324494 200
822 3300026116 Ga0207674_10530885 Ga0207674_105308851 200
823 3300026118 Ga0207675_100095478 Ga0207675_1000954783 200
824 3300026118 Ga0207675_100149547 Ga0207675_1001495472 200
825 3300026121 Ga0207683_10007475 Ga0207683_100074753 200
826 3300026142 Ga0207698_10000443 Ga0207698_100004436 200
827 3300026142 Ga0207698_10029189 Ga0207698_100291893 200
828 3300026142 Ga0207698_10057009 Ga0207698_100570092 200
829 3300028379 Ga0268266_10004939 Ga0268266_1000493914 200
830 3300028379 Ga0268266_10039609 Ga0268266_100396094 200
831 3300028379 Ga0268266_10612069 Ga0268266_106120692 200
832 3300028380 Ga0268265_10018988 Ga0268265_100189885 200
833 3300028380 Ga0268265_11360642 Ga0268265_113606421 200
834 3300028381 Ga0268264_10002566 Ga0268264_1000256614 200
835 3300028381 Ga0268264_10043634 Ga0268264_100436343 200
836 3300028381 Ga0268264_10369726 Ga0268264_103697262 200
837 3300031731 Ga0307405_10120063 Ga0307405_101200631 200
838 3300031824 Ga0307413_10303659 Ga0307413_103036592 200
839 3300031852 Ga0307410_10006140 Ga0307410_100061404 200
840 3300031852 Ga0307410_10008279 Ga0307410_100082792 200
841 3300031852 Ga0307410_10072657 Ga0307410_100726572 200
842 3300031901 Ga0307406_10069102 Ga0307406_100691022 200
843 3300031903 Ga0307407_10003352 Ga0307407_100033529 200
844 3300031911 Ga0307412_10278431 Ga0307412_102784312 200
845 3300031995 Ga0307409_100841904 Ga0307409_1008419041 200
846 3300032002 Ga0307416_100025110 Ga0307416_1000251102 200
847 3300032004 Ga0307414_10005643 Ga0307414_100056434 200
848 3300032004 Ga0307414_10681570 Ga0307414_106815701 200
849 3300032005 Ga0307411_10003870 Ga0307411_100038703 200
850 3300032005 Ga0307411_10037211 Ga0307411_100372112 200
851 3300032005 Ga0307411_10766554 Ga0307411_107665541 200
852 3300032126 Ga0307415_100709819 Ga0307415_1007098191 200
853 3300035691 Ga0373931_0136058 Ga0373931_0136058_331_954 200
854 3300037312 Ga0395899_0321871 Ga0395899_0321871_412_1014 200
855 3300037418 Ga0395900_0057853 Ga0395900_0057853_2671_3288 200
856 3300037418 Ga0395900_0131059 Ga0395900_0131059_1470_2087 200
857 3300037466 Ga0395898_0177987 Ga0395898_0177987_261_878 200
858 3300037466 Ga0395898_0591212 Ga0395898_0591212_129_746 200
859 3300037471 Ga0395905_0096505 Ga0395905_0096505_537_1154 200
860 3300037471 Ga0395905_0174149 Ga0395905_0174149_1155_1772 200
861 3300037471 Ga0395905_0565623 Ga0395905_0565623_44_646 200
862 3300038443 Ga0395901_0061862 Ga0395901_0061862_2691_3308 200
863 3300038443 Ga0395901_0167628 Ga0395901_0167628_1514_2131 200
864 3300038443 Ga0395901_0185106 Ga0395901_0185106_484_1086 200
865 3300038443 Ga0395901_0214642 Ga0395901_0214642_989_1606 200
866 3300042006 Ga0439432_027031 Ga0439432_027031_260_877 200
867 3300042007 Ga0439449_0028910 Ga0439449_0028910_974_1591 200
868 3300044693 Ga0466961_0087329 Ga0466961_0087329_1018_1653 200
869 3300044694 Ga0466963_0176344 Ga0466963_0176344_597_1199 200
870 3300045049 Ga0466959_0034632 Ga0466959_0034632_2092_2727 200
871 3300045836 Ga0466958_0052869 Ga0466958_0052869_445_1080 200
872 3300046525 Ga0495663_0005710 Ga0495663_0005710_134_751 200
873 3300046525 Ga0495663_0022592 Ga0495663_0022592_221_838 200
874 3300046525 Ga0495663_0024465 Ga0495663_0024465_714_1331 200
875 3300046539 Ga0495621_0013166 Ga0495621_0013166_1886_2503 200
876 3300046665 Ga0495661_0034543 Ga0495661_0034543_81_698 200
877 3300046684 Ga0495669_0000854 Ga0495669_0000854_11938_12555 200
878 3300046684 Ga0495669_0002396 Ga0495669_0002396_1361_1978 200
879 3300046684 Ga0495669_0058298 Ga0495669_0058298_824_1441 200
880 3300046691 Ga0495670_0044687 Ga0495670_0044687_490_1107 200
881 3300047470 Ga0495681_0040590 Ga0495681_0040590_911_1528 200
882 3300048910 Ga0496107_0084381 Ga0496107_0084381_327_944 200
883 3300048911 Ga0496108_0895572 Ga0496108_0895572_106_747 200
884 3300048912 Ga0496109_0044431 Ga0496109_0044431_3292_3933 200
885 3300048912 Ga0496109_0142424 Ga0496109_0142424_272_889 200
886 3300048913 Ga0496110_0003604 Ga0496110_0003604_5821_6438 200
887 3300048913 Ga0496110_0373279 Ga0496110_0373279_146_763 200
888 3300048914 Ga0496111_0205274 Ga0496111_0205274_154_771 200
889 3300048917 Ga0496114_0030559 Ga0496114_0030559_3587_4204 200
890 3300050512 nmdc:mga0n895_568992_c1 nmdc:mga0n895_568992_c1_373_1011 200
891 3300050515 nmdc:mga0a205_10273_c1 nmdc:mga0a205_10273_c1_3925_4548 200
892 3300050515 nmdc:mga0a205_4191_c1 nmdc:mga0a205_4191_c1_7599_8216 200
893 3300053083 Ga0495655_0004664 Ga0495655_0004664_1412_2029 200
894 3300053158 Ga0500627_0031294 Ga0500627_0031294_288_905 200
895 3300061719 Ga0466962_0119706 Ga0466962_0119706_287_922 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

139

188

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

133

186

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

40

104

0.94

PF07638

Sigma70_ECF

ECF sigma factor

93

192

0.81

Feature Viewer

pLDDT pTM Quality
83.18 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map