F484980

General Info

Members Datasets Scaffolds Average Seq Length
895 256 895 111

Family's Representative Sequence

Representative Sequence 3300025931|Ga0207644_10750920|Ga0207644_107509202
Length 127
Sequence MFGVDSTEFVIVAVLALVFIGPKDLPKVMRTIGYWVGRMRGMARHFTAGIENMVREAELEEMEKRWREENERIMRLHPANADYPETGKPDEMPPIVEPPPAETAELSLPFDESQPEDSLPPEKRPLP

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
214 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 3.91
Rhizosphere 95.08
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1029636 3300001904 Bacteria 846
2 JGI24741J21665_1008768 3300001915 Bacteria 1892
3 JGI24752J21851_1050345 3300001976 Bacteria 566
4 JGI24746J21847_1006385 3300001977 Bacteria 1828
5 JGI24747J21853_1002022 3300001978 Bacteria 1600
6 JGI24747J21853_1040286 3300001978 Bacteria 553
7 JGI24740J21852_10004747 3300001979 Bacteria 5807
8 JGI24740J21852_10007981 3300001979 Bacteria 4258
9 JGI24739J22299_10002685 3300001989 Bacteria 6849
10 JGI24739J22299_10028590 3300001989 Bacteria 1944
11 JGI24739J22299_10029992 3300001989 Bacteria 1887
12 JGI24737J22298_10000665 3300001990 Bacteria 12142
13 JGI24737J22298_10006005 3300001990 Bacteria 4169
14 JGI24743J22301_10006940 3300001991 Bacteria 1949
15 JGI24735J21928_10009940 3300002067 Bacteria 3046
16 JGI24735J21928_10024361 3300002067 Bacteria 1832
17 JGI24735J21928_10032381 3300002067 Bacteria 1548
18 JGI24750J21931_1040320 3300002070 Bacteria 708
19 JGI24745J21846_1000475 3300002073 Bacteria 3563
20 JGI24745J21846_1015883 3300002073 Bacteria 872
21 JGI24748J21848_1004476 3300002074 Bacteria 1607
22 JGI24738J21930_10001343 3300002075 Bacteria 6826
23 JGI24738J21930_10003652 3300002075 Bacteria 3854
24 JGI24744J21845_10000507 3300002077 Bacteria 6932
25 JGI24035J26624_1005027 3300002126 Bacteria 1260
26 JGI24034J26672_10014574 3300002239 Bacteria 1200
27 JGI24742J22300_10004609 3300002244 Bacteria 2261
28 Ga0070658_10099856 3300005327 Bacteria 2398
29 Ga0070658_10100941 3300005327 Bacteria 2385
30 Ga0070658_10140143 3300005327 Bacteria 2020
31 Ga0070658_10191926 3300005327 Bacteria 1722
32 Ga0070658_10275584 3300005327 Bacteria 1431
33 Ga0070658_10372701 3300005327 Bacteria 1224
34 Ga0070658_10396316 3300005327 Bacteria 1185
35 Ga0070658_10628101 3300005327 Bacteria 932
36 Ga0070658_10758230 3300005327 Bacteria 843
37 Ga0070658_10760310 3300005327 Bacteria 841
38 Ga0070658_10831631 3300005327 Bacteria 802
39 Ga0070658_11161205 3300005327 Bacteria 671
40 Ga0070676_10100654 3300005328 Bacteria 1784
41 Ga0070676_10298942 3300005328 Bacteria 1090
42 Ga0070676_10656459 3300005328 Bacteria 762
43 Ga0070683_100010266 3300005329 Bacteria 8049
44 Ga0070683_100095414 3300005329 Bacteria 2796
45 Ga0070683_101835262 3300005329 Bacteria 583
46 Ga0070690_100067604 3300005330 Bacteria 2315
47 Ga0070690_100192390 3300005330 Bacteria 1415
48 Ga0070670_100016013 3300005331 Bacteria 6435
49 Ga0070670_100069930 3300005331 Bacteria 3013
50 Ga0070670_100276616 3300005331 Bacteria 1466
51 Ga0070670_100393872 3300005331 Bacteria 1222
52 Ga0070670_100531636 3300005331 Bacteria 1048
53 Ga0070670_101012071 3300005331 Bacteria 756
54 Ga0070677_10503708 3300005333 Bacteria 657
55 Ga0068869_100000297 3300005334 Bacteria 26449
56 Ga0068869_100054585 3300005334 Bacteria 2909
57 Ga0068869_100117695 3300005334 Bacteria 2028
58 Ga0068869_100404307 3300005334 Bacteria 1124
59 Ga0070666_10034332 3300005335 Bacteria 3362
60 Ga0070666_11481040 3300005335 Bacteria 508
61 Ga0070680_100049943 3300005336 Bacteria 3411
62 Ga0070680_100226528 3300005336 Bacteria 1578
63 Ga0070680_100511634 3300005336 Bacteria 1028
64 Ga0070680_100795325 3300005336 Bacteria 815
65 Ga0070680_101871913 3300005336 Bacteria 520
66 Ga0070682_100080848 3300005337 Bacteria 2103
67 Ga0070682_100205713 3300005337 Bacteria 1392
68 Ga0070682_100608762 3300005337 Bacteria 864
69 Ga0068868_100002601 3300005338 Bacteria 12510
70 Ga0068868_100159778 3300005338 Bacteria 1860
71 Ga0068868_100274741 3300005338 Bacteria 1424
72 Ga0068868_100384664 3300005338 Bacteria 1208
73 Ga0068868_100704723 3300005338 Bacteria 903
74 Ga0068868_100984180 3300005338 Bacteria 771
75 Ga0068868_101184176 3300005338 Bacteria 706
76 Ga0070660_100005787 3300005339 Bacteria 8562
77 Ga0070660_100011191 3300005339 Bacteria 6367
78 Ga0070660_100017159 3300005339 Bacteria 5272
79 Ga0070660_100023819 3300005339 Bacteria 4538
80 Ga0070660_100046275 3300005339 Bacteria 3334
81 Ga0070660_100071720 3300005339 Bacteria 2705
82 Ga0070660_100090116 3300005339 Bacteria 2417
83 Ga0070660_100257756 3300005339 Bacteria 1423
84 Ga0070660_100409086 3300005339 Bacteria 1122
85 Ga0070660_100503587 3300005339 Bacteria 1007
86 Ga0070660_101697709 3300005339 Bacteria 538
87 Ga0070689_100025030 3300005340 Bacteria 4482
88 Ga0070691_10096919 3300005341 Bacteria 1461
89 Ga0070687_101115210 3300005343 Bacteria 578
90 Ga0070687_101202979 3300005343 Bacteria 559
91 Ga0070661_100028731 3300005344 Bacteria 4012
92 Ga0070661_100042451 3300005344 Bacteria 3319
93 Ga0070661_100081906 3300005344 Bacteria 2383
94 Ga0070661_100086650 3300005344 Bacteria 2316
95 Ga0070661_100116791 3300005344 Bacteria 1996
96 Ga0070661_100155087 3300005344 Bacteria 1733
97 Ga0070661_100183281 3300005344 Bacteria 1594
98 Ga0070661_100448942 3300005344 Bacteria 1026
99 Ga0070692_10065069 3300005345 Bacteria 1930
100 Ga0070668_100000628 3300005347 Bacteria 23738
101 Ga0070668_100025282 3300005347 Bacteria 4501
102 Ga0070668_100100226 3300005347 Bacteria 2294
103 Ga0070668_100188721 3300005347 Bacteria 1687
104 Ga0070668_100519953 3300005347 Bacteria 1032
105 Ga0070668_101468519 3300005347 Bacteria 623
106 Ga0070669_100003201 3300005353 Bacteria 11764
107 Ga0070669_100043327 3300005353 Bacteria 3277
108 Ga0070669_100116249 3300005353 Bacteria 2035
109 Ga0070669_100212017 3300005353 Bacteria 1528
110 Ga0070669_100357114 3300005353 Bacteria 1187
111 Ga0070669_100436851 3300005353 Bacteria 1077
112 Ga0070669_100480643 3300005353 Bacteria 1028
113 Ga0070675_100027138 3300005354 Bacteria 4599
114 Ga0070675_100272924 3300005354 Bacteria 1484
115 Ga0070675_101203042 3300005354 Bacteria 698
116 Ga0070675_101875087 3300005354 Bacteria 553
117 Ga0070671_100008491 3300005355 Bacteria 8232
118 Ga0070671_100036772 3300005355 Bacteria 4060
119 Ga0070671_100072474 3300005355 Bacteria 2876
120 Ga0070671_100076109 3300005355 Bacteria 2804
121 Ga0070671_100106549 3300005355 Bacteria 2353
122 Ga0070671_100177644 3300005355 Bacteria 1802
123 Ga0070671_100253062 3300005355 Bacteria 1496
124 Ga0070671_100379729 3300005355 Bacteria 1208
125 Ga0070671_100535747 3300005355 Bacteria 1009
126 Ga0070674_100061418 3300005356 Bacteria 2622
127 Ga0070674_100195035 3300005356 Bacteria 1560
128 Ga0070674_101743667 3300005356 Bacteria 564
129 Ga0070674_101773166 3300005356 Bacteria 559
130 Ga0070673_100000044 3300005364 Bacteria 51857
131 Ga0070673_100007743 3300005364 Bacteria 7108
132 Ga0070673_100073492 3300005364 Bacteria 2752
133 Ga0070673_100400084 3300005364 Bacteria 1228
134 Ga0070673_100593718 3300005364 Bacteria 1009
135 Ga0070673_100677603 3300005364 Bacteria 945
136 Ga0070673_100753269 3300005364 Bacteria 897
137 Ga0070688_100357696 3300005365 Bacteria 1070
138 Ga0070688_101617766 3300005365 Bacteria 529
139 Ga0070659_100000849 3300005366 Bacteria 22290
140 Ga0070659_100002178 3300005366 Bacteria 13947
141 Ga0070659_100044812 3300005366 Bacteria 3464
142 Ga0070659_100068918 3300005366 Bacteria 2807
143 Ga0070659_100182160 3300005366 Bacteria 1724
144 Ga0070659_100227216 3300005366 Bacteria 1542
145 Ga0070659_100238674 3300005366 Bacteria 1503
146 Ga0070659_100315714 3300005366 Bacteria 1305
147 Ga0070659_100347573 3300005366 Bacteria 1244
148 Ga0070659_100495928 3300005366 Bacteria 1040
149 Ga0070659_100698811 3300005366 Bacteria 877
150 Ga0070659_101185975 3300005366 Bacteria 675
151 Ga0070667_100007145 3300005367 Bacteria 9280
152 Ga0070667_100022649 3300005367 Bacteria 5209
153 Ga0070667_100139679 3300005367 Bacteria 2120
154 Ga0070667_100328233 3300005367 Bacteria 1382
155 Ga0070667_100543024 3300005367 Bacteria 1068
156 Ga0070667_100837386 3300005367 Bacteria 855
157 Ga0070667_101287472 3300005367 Bacteria 685
158 Ga0070667_101353338 3300005367 Bacteria 667
159 Ga0070667_102207795 3300005367 Bacteria 518
160 Ga0070714_100504749 3300005435 Bacteria 1154
161 Ga0070701_11419162 3300005438 Bacteria 500
162 Ga0070694_100009449 3300005444 Bacteria 5982
163 Ga0070663_100036659 3300005455 Bacteria 3408
164 Ga0070663_100039104 3300005455 Bacteria 3313
165 Ga0070663_100092002 3300005455 Bacteria 2248
166 Ga0070663_100155876 3300005455 Bacteria 1755
167 Ga0070663_100199032 3300005455 Bacteria 1562
168 Ga0070663_100321820 3300005455 Bacteria 1244
169 Ga0070663_100415200 3300005455 Bacteria 1103
170 Ga0070663_100551441 3300005455 Bacteria 963
171 Ga0070663_100743307 3300005455 Bacteria 837
172 Ga0070663_101292015 3300005455 Bacteria 643
173 Ga0070678_100066889 3300005456 Bacteria 2672
174 Ga0070678_100103020 3300005456 Bacteria 2216
175 Ga0070678_100178388 3300005456 Bacteria 1736
176 Ga0070662_100026020 3300005457 Bacteria 4048
177 Ga0070662_100046561 3300005457 Bacteria 3116
178 Ga0070662_100369417 3300005457 Bacteria 1179
179 Ga0070662_100468414 3300005457 Bacteria 1048
180 Ga0070662_100680072 3300005457 Bacteria 870
181 Ga0070662_100784755 3300005457 Bacteria 809
182 Ga0070662_100887232 3300005457 Bacteria 760
183 Ga0070681_10019981 3300005458 Bacteria 6710
184 Ga0068867_100006552 3300005459 Bacteria 8225
185 Ga0068867_100016338 3300005459 Bacteria 5269
186 Ga0068867_100021116 3300005459 Bacteria 4644
187 Ga0068867_100073777 3300005459 Bacteria 2555
188 Ga0068867_100415925 3300005459 Bacteria 1138
189 Ga0070685_10833814 3300005466 Bacteria 682
190 Ga0070679_100276328 3300005530 Bacteria 1633
191 Ga0070679_100696708 3300005530 Bacteria 958
192 Ga0070679_100713441 3300005530 Bacteria 946
193 Ga0070684_100332812 3300005535 Bacteria 1396
194 Ga0070684_101681716 3300005535 Bacteria 599
195 Ga0068853_100006969 3300005539 Bacteria 9027
196 Ga0068853_100017061 3300005539 Bacteria 5988
197 Ga0068853_100117531 3300005539 Bacteria 2368
198 Ga0068853_100200540 3300005539 Bacteria 1816
199 Ga0068853_100216968 3300005539 Bacteria 1746
200 Ga0068853_100252582 3300005539 Bacteria 1618
201 Ga0068853_100304254 3300005539 Bacteria 1474
202 Ga0068853_100453911 3300005539 Bacteria 1206
203 Ga0068853_101292948 3300005539 Bacteria 705
204 Ga0068853_102255296 3300005539 Bacteria 528
205 Ga0070672_100001174 3300005543 Bacteria 16019
206 Ga0070672_100081851 3300005543 Bacteria 2589
207 Ga0070672_100138369 3300005543 Bacteria 2006
208 Ga0070672_100155007 3300005543 Bacteria 1897
209 Ga0070672_100160558 3300005543 Bacteria 1864
210 Ga0070672_100164156 3300005543 Bacteria 1844
211 Ga0070672_100406974 3300005543 Bacteria 1167
212 Ga0070672_100584461 3300005543 Bacteria 972
213 Ga0070672_101130684 3300005543 Bacteria 697
214 Ga0070672_101332553 3300005543 Bacteria 641
215 Ga0070672_101608646 3300005543 Bacteria 583
216 Ga0070695_100693484 3300005545 Bacteria 808
217 Ga0070696_100013815 3300005546 Bacteria 5422
218 Ga0070693_100083556 3300005547 Bacteria 1909
219 Ga0070693_100322306 3300005547 Bacteria 1049
220 Ga0070665_100224567 3300005548 Bacteria 1878
221 Ga0070704_100642009 3300005549 Bacteria 936
222 Ga0068855_100005808 3300005563 Bacteria 15057
223 Ga0068855_100019628 3300005563 Bacteria 8120
224 Ga0068855_100073993 3300005563 Bacteria 3957
225 Ga0068855_100105816 3300005563 Bacteria 3234
226 Ga0068855_100208814 3300005563 Bacteria 2195
227 Ga0068855_100719668 3300005563 Bacteria 1067
228 Ga0068855_101420276 3300005563 Bacteria 715
229 Ga0070664_100017284 3300005564 Bacteria 5922
230 Ga0070664_100024270 3300005564 Bacteria 5014
231 Ga0070664_100027446 3300005564 Bacteria 4731
232 Ga0070664_100033519 3300005564 Bacteria 4303
233 Ga0070664_100103382 3300005564 Bacteria 2480
234 Ga0070664_100135240 3300005564 Bacteria 2167
235 Ga0070664_100173788 3300005564 Bacteria 1912
236 Ga0070664_100391516 3300005564 Bacteria 1270
237 Ga0070664_101713614 3300005564 Bacteria 596
238 Ga0068857_100002631 3300005577 Bacteria 14734
239 Ga0068857_100025044 3300005577 Bacteria 5256
240 Ga0068857_100060082 3300005577 Bacteria 3377
241 Ga0068857_100218169 3300005577 Bacteria 1742
242 Ga0068857_100304538 3300005577 Bacteria 1469
243 Ga0068857_100364216 3300005577 Bacteria 1340
244 Ga0068854_100000934 3300005578 Bacteria 17556
245 Ga0068854_100023236 3300005578 Bacteria 4233
246 Ga0068854_100024434 3300005578 Bacteria 4137
247 Ga0068854_100050371 3300005578 Bacteria 2979
248 Ga0068854_100162773 3300005578 Bacteria 1729
249 Ga0068854_100189266 3300005578 Bacteria 1611
250 Ga0068854_100398229 3300005578 Bacteria 1139
251 Ga0068854_101152503 3300005578 Bacteria 693
252 Ga0068856_100210543 3300005614 Bacteria 1959
253 Ga0068856_100712708 3300005614 Bacteria 1024
254 Ga0068856_100738998 3300005614 Bacteria 1004
255 Ga0068856_101723585 3300005614 Bacteria 639
256 Ga0070702_100155568 3300005615 Bacteria 1472
257 Ga0068852_100006623 3300005616 Bacteria 8392
258 Ga0068852_100015762 3300005616 Bacteria 5876
259 Ga0068852_100027422 3300005616 Bacteria 4642
260 Ga0068852_100029603 3300005616 Bacteria 4500
261 Ga0068852_100046115 3300005616 Bacteria 3712
262 Ga0068852_100211126 3300005616 Bacteria 1842
263 Ga0068852_100215940 3300005616 Bacteria 1822
264 Ga0068852_100222212 3300005616 Bacteria 1797
265 Ga0068852_100334681 3300005616 Bacteria 1474
266 Ga0068852_100413239 3300005616 Bacteria 1330
267 Ga0068852_102618875 3300005616 Bacteria 524
268 Ga0068859_100000144 3300005617 Bacteria 67220
269 Ga0068859_100000799 3300005617 Bacteria 31905
270 Ga0068859_100004301 3300005617 Bacteria 14531
271 Ga0068859_100088140 3300005617 Bacteria 3152
272 Ga0068859_100366149 3300005617 Bacteria 1537
273 Ga0068859_100841577 3300005617 Bacteria 1004
274 Ga0068859_100947068 3300005617 Bacteria 944
275 Ga0068859_102418835 3300005617 Bacteria 579
276 Ga0068864_100000092 3300005618 Bacteria 94499
277 Ga0068864_100000552 3300005618 Bacteria 31974
278 Ga0068864_100015554 3300005618 Bacteria 6328
279 Ga0068864_100024534 3300005618 Bacteria 5074
280 Ga0068864_100460892 3300005618 Bacteria 1217
281 Ga0068864_100749874 3300005618 Bacteria 957
282 Ga0068866_10047459 3300005718 Bacteria 2165
283 Ga0068866_10146270 3300005718 Bacteria 1363
284 Ga0068866_10598727 3300005718 Bacteria 744
285 Ga0068866_10650393 3300005718 Bacteria 717
286 Ga0068861_100014258 3300005719 Bacteria 5576
287 Ga0068861_100449001 3300005719 Bacteria 1155
288 Ga0068851_10001965 3300005834 Bacteria 9036
289 Ga0068851_10122159 3300005834 Bacteria 1400
290 Ga0068851_10398996 3300005834 Bacteria 809
291 Ga0068851_10467128 3300005834 Bacteria 752
292 Ga0068870_10163063 3300005840 Bacteria 1324
293 Ga0068863_100000222 3300005841 Bacteria 60169
294 Ga0068863_100012961 3300005841 Bacteria 8038
295 Ga0068863_100020497 3300005841 Bacteria 6319
296 Ga0068863_100060705 3300005841 Bacteria 3575
297 Ga0068863_100176435 3300005841 Bacteria 2051
298 Ga0068863_100966112 3300005841 Bacteria 854
299 Ga0068863_101112041 3300005841 Unclassified 795
300 Ga0068858_100000256 3300005842 Bacteria 56844
301 Ga0068858_100026167 3300005842 Bacteria 5424
302 Ga0068858_100042344 3300005842 Bacteria 4222
303 Ga0068858_100045258 3300005842 Bacteria 4077
304 Ga0068858_100302328 3300005842 Bacteria 1526
305 Ga0068858_100454947 3300005842 Bacteria 1234
306 Ga0068860_100002571 3300005843 Bacteria 18988
307 Ga0068860_100007543 3300005843 Bacteria 10883
308 Ga0068860_100013427 3300005843 Bacteria 8032
309 Ga0068860_100058030 3300005843 Bacteria 3679
310 Ga0068860_100101492 3300005843 Bacteria 2745
311 Ga0068860_100315968 3300005843 Bacteria 1532
312 Ga0068860_100398939 3300005843 Bacteria 1360
313 Ga0068860_102283797 3300005843 Bacteria 561
314 Ga0068862_100011848 3300005844 Bacteria 7201
315 Ga0068862_100016716 3300005844 Bacteria 6109
316 Ga0068862_100096996 3300005844 Bacteria 2574
317 Ga0068862_100146291 3300005844 Bacteria 2100
318 Ga0068862_100430889 3300005844 Bacteria 1239
319 Ga0068862_100446903 3300005844 Bacteria 1218
320 Ga0068862_100482614 3300005844 Bacteria 1173
321 Ga0068862_100502434 3300005844 Bacteria 1151
322 Ga0068862_100740442 3300005844 Bacteria 955
323 Ga0068862_100758742 3300005844 Bacteria 944
324 Ga0081539_10052286 3300005985 Bacteria 2296
325 Ga0070715_10722889 3300006163 Bacteria 597
326 Ga0075362_10043302 3300006177 Bacteria 1993
327 Ga0097621_100032280 3300006237 Bacteria 4161
328 Ga0097621_100038079 3300006237 Bacteria 3858
329 Ga0097621_100073583 3300006237 Bacteria 2829
330 Ga0097621_100724886 3300006237 Bacteria 917
331 Ga0097621_101033023 3300006237 Bacteria 770
332 Ga0097621_101564106 3300006237 Bacteria 626
333 Ga0068871_100390025 3300006358 Bacteria 1238
334 Ga0075428_100869631 3300006844 Bacteria 957
335 Ga0075433_10267382 3300006852 Bacteria 1515
336 Ga0075429_100200592 3300006880 Bacteria 1748
337 Ga0068865_100000440 3300006881 Bacteria 23089
338 Ga0068865_100013435 3300006881 Bacteria 5172
339 Ga0068865_100216099 3300006881 Bacteria 1496
340 Ga0097620_100000144 3300006931 Bacteria 67220
341 Ga0097620_100000799 3300006931 Bacteria 31905
342 Ga0097620_100004301 3300006931 Bacteria 14531
343 Ga0097620_100088137 3300006931 Bacteria 3152
344 Ga0097620_100366171 3300006931 Bacteria 1537
345 Ga0097620_100841622 3300006931 Bacteria 1004
346 Ga0097620_100947061 3300006931 Bacteria 944
347 Ga0097620_102418381 3300006931 Bacteria 579
348 Ga0105250_10017542 3300009092 Bacteria 2911
349 Ga0105240_10014684 3300009093 Bacteria 10686
350 Ga0105240_10215052 3300009093 Bacteria 2243
351 Ga0105245_10000709 3300009098 Bacteria 30034
352 Ga0105245_10120514 3300009098 Bacteria 2450
353 Ga0105245_10358422 3300009098 Bacteria 1447
354 Ga0105247_10138621 3300009101 Bacteria 1592
355 Ga0105243_10025801 3300009148 Bacteria 4494
356 Ga0105243_10040963 3300009148 Bacteria 3621
357 Ga0105243_11491130 3300009148 Bacteria 700
358 Ga0105243_11678423 3300009148 Bacteria 664
359 Ga0105243_11916952 3300009148 Bacteria 626
360 Ga0105243_12469514 3300009148 Bacteria 559
361 Ga0105241_10054250 3300009174 Bacteria 3067
362 Ga0105241_10071184 3300009174 Bacteria 2699
363 Ga0105241_10208062 3300009174 Bacteria 1638
364 Ga0105241_10264393 3300009174 Bacteria 1463
365 Ga0105241_10310552 3300009174 Bacteria 1356
366 Ga0105242_10284148 3300009176 Bacteria 1504
367 Ga0105242_10483468 3300009176 Bacteria 1174
368 Ga0105248_10000122 3300009177 Bacteria 89560
369 Ga0105248_10000269 3300009177 Bacteria 61063
370 Ga0105248_10000587 3300009177 Bacteria 41432
371 Ga0105248_10027845 3300009177 Bacteria 6292
372 Ga0105248_10061772 3300009177 Bacteria 4207
373 Ga0105248_10267318 3300009177 Bacteria 1925
374 Ga0105248_10271253 3300009177 Bacteria 1911
375 Ga0105248_10610973 3300009177 Bacteria 1230
376 Ga0105248_10869471 3300009177 Bacteria 1018
377 Ga0105248_11679374 3300009177 Bacteria 720
378 Ga0105248_12026483 3300009177 Bacteria 654
379 Ga0105237_10012608 3300009545 Bacteria 8902
380 Ga0105237_11002096 3300009545 Bacteria 842
381 Ga0105238_10029976 3300009551 Bacteria 5537
382 Ga0105238_11464585 3300009551 Bacteria 711
383 Ga0105249_10009482 3300009553 Bacteria 8526
384 Ga0105249_10014489 3300009553 Bacteria 6970
385 Ga0105249_10019016 3300009553 Bacteria 6126
386 Ga0105249_10224274 3300009553 Bacteria 1851
387 Ga0105249_11003102 3300009553 Bacteria 904
388 Ga0105239_10011604 3300010375 Bacteria 9830
389 Ga0105239_10181263 3300010375 Bacteria 2357
390 Ga0105246_10057757 3300011119 Bacteria 2686
391 Ga0105246_10196525 3300011119 Bacteria 1565
392 Ga0105246_10473893 3300011119 Bacteria 1057
393 Ga0157316_1052877 3300012510 Bacteria 566
394 Ga0157373_10003467 3300013100 Bacteria 11928
395 Ga0157373_10004213 3300013100 Bacteria 10852
396 Ga0157373_10014029 3300013100 Bacteria 5875
397 Ga0157373_10054170 3300013100 Bacteria 2851
398 Ga0157373_10080578 3300013100 Bacteria 2296
399 Ga0157373_10136161 3300013100 Bacteria 1727
400 Ga0157373_11300240 3300013100 Bacteria 550
401 Ga0157373_11536328 3300013100 Bacteria 509
402 Ga0157371_10004494 3300013102 Bacteria 12163
403 Ga0157371_10057520 3300013102 Bacteria 2758
404 Ga0157371_10378527 3300013102 Bacteria 1033
405 Ga0157371_11175777 3300013102 Bacteria 590
406 Ga0157370_10073909 3300013104 Bacteria 3216
407 Ga0157370_10085412 3300013104 Bacteria 2965
408 Ga0157370_10796712 3300013104 Bacteria 860
409 Ga0157369_10054183 3300013105 Bacteria 4332
410 Ga0157369_10102999 3300013105 Bacteria 3040
411 Ga0157369_11929875 3300013105 Bacteria 599
412 Ga0157374_10167199 3300013296 Bacteria 2144
413 Ga0157374_10511670 3300013296 Bacteria 1206
414 Ga0157374_12697182 3300013296 Bacteria 525
415 Ga0157378_10015380 3300013297 Bacteria 6701
416 Ga0157378_10135845 3300013297 Bacteria 2280
417 Ga0157378_10210566 3300013297 Bacteria 1843
418 Ga0163162_10027500 3300013306 Bacteria 5626
419 Ga0163162_10032821 3300013306 Bacteria 5156
420 Ga0163162_10190474 3300013306 Bacteria 2178
421 Ga0163162_10451804 3300013306 Bacteria 1417
422 Ga0163162_10503131 3300013306 Bacteria 1342
423 Ga0163162_10515564 3300013306 Bacteria 1325
424 Ga0163162_11547204 3300013306 Bacteria 756
425 Ga0163162_11641537 3300013306 Bacteria 734
426 Ga0157372_10006954 3300013307 Bacteria 12043
427 Ga0157372_10050035 3300013307 Bacteria 4649
428 Ga0157372_10669999 3300013307 Bacteria 1208
429 Ga0157375_10039226 3300013308 Bacteria 4556
430 Ga0157375_10045756 3300013308 Bacteria 4260
431 Ga0157375_10255336 3300013308 Bacteria 1914
432 Ga0157375_10396567 3300013308 Bacteria 1547
433 Ga0157375_12371332 3300013308 Bacteria 633
434 Ga0163163_10000080 3300014325 Bacteria 106006
435 Ga0163163_12445992 3300014325 Bacteria 580
436 Ga0157380_10164466 3300014326 Bacteria 1932
437 Ga0157380_10567903 3300014326 Bacteria 1116
438 Ga0182008_10309807 3300014497 Bacteria 828
439 Ga0157377_10065466 3300014745 Bacteria 2088
440 Ga0157377_10077311 3300014745 Bacteria 1938
441 Ga0157379_12167833 3300014968 Bacteria 552
442 Ga0157376_11671404 3300014969 Bacteria 672
443 Ga0157376_12468328 3300014969 Bacteria 559
444 Ga0157376_12621779 3300014969 Bacteria 544
445 Ga0197907_11396321 3300020069 Bacteria 635
446 Ga0206354_11602090 3300020081 Bacteria 811
447 Ga0206353_11915595 3300020082 Bacteria 2485
448 Ga0213876_10007945 3300021384 Bacteria 5755
449 Ga0213875_10002606 3300021388 Bacteria 10707
450 Ga0207673_1004407 3300025290 Bacteria 1683
451 Ga0207697_10000142 3300025315 Bacteria 34778
452 Ga0207697_10023020 3300025315 Bacteria 2551
453 Ga0207697_10034678 3300025315 Bacteria 2066
454 Ga0207656_10000430 3300025321 Bacteria 14083
455 Ga0207656_10059770 3300025321 Bacteria 1669
456 Ga0207696_1082874 3300025711 Bacteria 884
457 Ga0207682_10008330 3300025893 Bacteria 4101
458 Ga0207642_10015428 3300025899 Bacteria 2846
459 Ga0207642_10228971 3300025899 Bacteria 1043
460 Ga0207642_10249567 3300025899 Bacteria 1006
461 Ga0207642_10753735 3300025899 Bacteria 616
462 Ga0207710_10083747 3300025900 Bacteria 1483
463 Ga0207710_10091103 3300025900 Bacteria 1427
464 Ga0207688_10002307 3300025901 Bacteria 10262
465 Ga0207688_10008353 3300025901 Bacteria 5631
466 Ga0207688_10012721 3300025901 Bacteria 4578
467 Ga0207688_10063412 3300025901 Bacteria 2084
468 Ga0207688_10522860 3300025901 Bacteria 744
469 Ga0207680_10013945 3300025903 Bacteria 4143
470 Ga0207680_10182224 3300025903 Bacteria 1421
471 Ga0207680_10189755 3300025903 Bacteria 1394
472 Ga0207680_11146132 3300025903 Bacteria 555
473 Ga0207647_10007744 3300025904 Bacteria 7735
474 Ga0207647_10009442 3300025904 Bacteria 6931
475 Ga0207647_10427972 3300025904 Bacteria 743
476 Ga0207645_10014275 3300025907 Bacteria 5320
477 Ga0207645_10016295 3300025907 Bacteria 4921
478 Ga0207645_10046711 3300025907 Bacteria 2765
479 Ga0207645_10061366 3300025907 Bacteria 2401
480 Ga0207645_10134072 3300025907 Bacteria 1613
481 Ga0207643_10175118 3300025908 Bacteria 1296
482 Ga0207705_10006095 3300025909 Bacteria 8973
483 Ga0207705_10011251 3300025909 Bacteria 6486
484 Ga0207705_10013901 3300025909 Bacteria 5805
485 Ga0207705_10018288 3300025909 Bacteria 5012
486 Ga0207705_10173089 3300025909 Bacteria 1626
487 Ga0207705_10212252 3300025909 Bacteria 1468
488 Ga0207705_10226900 3300025909 Bacteria 1420
489 Ga0207705_10271330 3300025909 Bacteria 1297
490 Ga0207705_10529905 3300025909 Bacteria 915
491 Ga0207705_10612199 3300025909 Bacteria 847
492 Ga0207705_10795515 3300025909 Bacteria 734
493 Ga0207654_10202303 3300025911 Bacteria 1308
494 Ga0207654_10380590 3300025911 Bacteria 977
495 Ga0207654_10546006 3300025911 Bacteria 823
496 Ga0207654_10684119 3300025911 Bacteria 736
497 Ga0207707_10004365 3300025912 Bacteria 12504
498 Ga0207707_10012875 3300025912 Bacteria 7280
499 Ga0207707_10174347 3300025912 Bacteria 1879
500 Ga0207695_10135847 3300025913 Bacteria 2412
501 Ga0207671_10017230 3300025914 Bacteria 5580
502 Ga0207660_10001982 3300025917 Bacteria 13637
503 Ga0207660_10039317 3300025917 Bacteria 3306
504 Ga0207660_10125819 3300025917 Bacteria 1946
505 Ga0207660_10615752 3300025917 Bacteria 885
506 Ga0207660_10793878 3300025917 Bacteria 773
507 Ga0207662_10870032 3300025918 Bacteria 637
508 Ga0207657_10007043 3300025919 Bacteria 11565
509 Ga0207657_10010390 3300025919 Bacteria 9292
510 Ga0207657_10028000 3300025919 Bacteria 5150
511 Ga0207657_10044544 3300025919 Bacteria 3900
512 Ga0207657_10046598 3300025919 Bacteria 3797
513 Ga0207657_10103917 3300025919 Bacteria 2354
514 Ga0207657_10165805 3300025919 Bacteria 1792
515 Ga0207657_10206512 3300025919 Bacteria 1578
516 Ga0207657_10297695 3300025919 Bacteria 1278
517 Ga0207657_10307826 3300025919 Bacteria 1254
518 Ga0207649_10005743 3300025920 Bacteria 6717
519 Ga0207649_10013587 3300025920 Bacteria 4548
520 Ga0207649_10045189 3300025920 Bacteria 2699
521 Ga0207649_10046606 3300025920 Bacteria 2664
522 Ga0207649_10053636 3300025920 Bacteria 2506
523 Ga0207649_10114267 3300025920 Bacteria 1809
524 Ga0207649_10217854 3300025920 Bacteria 1358
525 Ga0207649_10255863 3300025920 Bacteria 1263
526 Ga0207649_10361078 3300025920 Bacteria 1078
527 Ga0207652_10003434 3300025921 Bacteria 13073
528 Ga0207652_10250922 3300025921 Bacteria 1596
529 Ga0207652_10293309 3300025921 Bacteria 1468
530 Ga0207652_10419010 3300025921 Bacteria 1208
531 Ga0207652_10453817 3300025921 Bacteria 1155
532 Ga0207681_10000532 3300025923 Bacteria 26302
533 Ga0207681_10035676 3300025923 Bacteria 3278
534 Ga0207681_10051093 3300025923 Bacteria 2799
535 Ga0207681_10144688 3300025923 Bacteria 1774
536 Ga0207681_10164182 3300025923 Bacteria 1677
537 Ga0207681_10609962 3300025923 Bacteria 902
538 Ga0207694_10002972 3300025924 Bacteria 13607
539 Ga0207650_10034920 3300025925 Bacteria 3648
540 Ga0207650_10044704 3300025925 Bacteria 3255
541 Ga0207650_10110113 3300025925 Bacteria 2131
542 Ga0207650_10115214 3300025925 Bacteria 2085
543 Ga0207650_10190082 3300025925 Bacteria 1640
544 Ga0207650_10545910 3300025925 Bacteria 971
545 Ga0207650_11892232 3300025925 Bacteria 504
546 Ga0207659_10064439 3300025926 Bacteria 2652
547 Ga0207659_10067887 3300025926 Bacteria 2592
548 Ga0207659_10169440 3300025926 Bacteria 1722
549 Ga0207659_11037616 3300025926 Bacteria 706
550 Ga0207687_10006315 3300025927 Bacteria 7834
551 Ga0207644_10024128 3300025931 Bacteria 4172
552 Ga0207644_10032109 3300025931 Bacteria 3661
553 Ga0207644_10065496 3300025931 Bacteria 2642
554 Ga0207644_10194747 3300025931 Bacteria 1595
555 Ga0207644_10247038 3300025931 Bacteria 1422
556 Ga0207644_10486312 3300025931 Bacteria 1017
557 Ga0207644_10750920 3300025931 Bacteria 815
558 Ga0207644_11719429 3300025931 Bacteria 525
559 Ga0207690_10001200 3300025932 Bacteria 16374
560 Ga0207690_10006450 3300025932 Bacteria 6954
561 Ga0207690_10009194 3300025932 Bacteria 5867
562 Ga0207690_10045080 3300025932 Bacteria 2911
563 Ga0207690_10127674 3300025932 Bacteria 1856
564 Ga0207690_10277340 3300025932 Bacteria 1305
565 Ga0207690_10533421 3300025932 Bacteria 952
566 Ga0207690_10614012 3300025932 Bacteria 888
567 Ga0207706_10003910 3300025933 Bacteria 14138
568 Ga0207706_10011697 3300025933 Bacteria 8002
569 Ga0207706_10014742 3300025933 Bacteria 7078
570 Ga0207706_10072809 3300025933 Bacteria 3021
571 Ga0207706_10313763 3300025933 Bacteria 1365
572 Ga0207706_10316647 3300025933 Bacteria 1358
573 Ga0207706_10317742 3300025933 Bacteria 1355
574 Ga0207706_10353086 3300025933 Bacteria 1278
575 Ga0207706_10531064 3300025933 Bacteria 1014
576 Ga0207686_10094527 3300025934 Bacteria 1982
577 Ga0207686_10280318 3300025934 Bacteria 1230
578 Ga0207709_10062525 3300025935 Bacteria 2330
579 Ga0207709_10114980 3300025935 Bacteria 1806
580 Ga0207709_10284494 3300025935 Bacteria 1223
581 Ga0207709_10759761 3300025935 Bacteria 780
582 Ga0207709_10861303 3300025935 Bacteria 735
583 Ga0207670_10012456 3300025936 Bacteria 4979
584 Ga0207670_10334169 3300025936 Bacteria 1196
585 Ga0207669_10046809 3300025937 Bacteria 2558
586 Ga0207669_10065729 3300025937 Bacteria 2251
587 Ga0207669_10570779 3300025937 Bacteria 916
588 Ga0207704_10003358 3300025938 Bacteria 7262
589 Ga0207704_10340408 3300025938 Bacteria 1164
590 Ga0207704_10428717 3300025938 Bacteria 1050
591 Ga0207691_10001210 3300025940 Bacteria 25701
592 Ga0207691_10049185 3300025940 Bacteria 3863
593 Ga0207691_10112350 3300025940 Bacteria 2422
594 Ga0207691_10214449 3300025940 Bacteria 1671
595 Ga0207691_10281570 3300025940 Bacteria 1430
596 Ga0207691_10843045 3300025940 Bacteria 769
597 Ga0207711_10000423 3300025941 Bacteria 44463
598 Ga0207711_10004591 3300025941 Bacteria 11742
599 Ga0207711_10035624 3300025941 Bacteria 4220
600 Ga0207711_10056610 3300025941 Bacteria 3370
601 Ga0207711_10073390 3300025941 Bacteria 2973
602 Ga0207711_10119253 3300025941 Bacteria 2354
603 Ga0207711_10509561 3300025941 Bacteria 1122
604 Ga0207689_10000125 3300025942 Bacteria 64633
605 Ga0207689_10006231 3300025942 Bacteria 10565
606 Ga0207689_10006847 3300025942 Bacteria 10024
607 Ga0207689_10117126 3300025942 Bacteria 2190
608 Ga0207689_10150347 3300025942 Bacteria 1919
609 Ga0207661_10009534 3300025944 Bacteria 6969
610 Ga0207661_10434727 3300025944 Bacteria 1193
611 Ga0207661_11561156 3300025944 Bacteria 604
612 Ga0207679_10013308 3300025945 Bacteria 5390
613 Ga0207679_10078653 3300025945 Bacteria 2512
614 Ga0207679_10101395 3300025945 Bacteria 2252
615 Ga0207679_10102645 3300025945 Bacteria 2240
616 Ga0207679_10113610 3300025945 Bacteria 2142
617 Ga0207679_10135168 3300025945 Bacteria 1984
618 Ga0207679_10454422 3300025945 Bacteria 1136
619 Ga0207679_10939438 3300025945 Bacteria 792
620 Ga0207679_11355498 3300025945 Bacteria 653
621 Ga0207679_11502907 3300025945 Bacteria 618
622 Ga0207667_10018797 3300025949 Bacteria 7737
623 Ga0207667_10040158 3300025949 Bacteria 4982
624 Ga0207667_10141128 3300025949 Bacteria 2480
625 Ga0207667_10408040 3300025949 Bacteria 1383
626 Ga0207667_10763532 3300025949 Bacteria 965
627 Ga0207667_11261798 3300025949 Bacteria 716
628 Ga0207667_11509729 3300025949 Bacteria 643
629 Ga0207667_11631274 3300025949 Bacteria 613
630 Ga0207651_10009499 3300025960 Bacteria 5333
631 Ga0207651_10047051 3300025960 Bacteria 2906
632 Ga0207651_10347742 3300025960 Bacteria 1247
633 Ga0207651_10955853 3300025960 Bacteria 764
634 Ga0207712_10033970 3300025961 Bacteria 3452
635 Ga0207712_10194768 3300025961 Bacteria 1602
636 Ga0207712_10682832 3300025961 Bacteria 895
637 Ga0207668_10000689 3300025972 Bacteria 20729
638 Ga0207668_10021174 3300025972 Bacteria 4143
639 Ga0207668_10170457 3300025972 Bacteria 1706
640 Ga0207668_10218701 3300025972 Bacteria 1528
641 Ga0207668_10413662 3300025972 Bacteria 1143
642 Ga0207640_10003384 3300025981 Bacteria 8593
643 Ga0207640_10012265 3300025981 Bacteria 4876
644 Ga0207640_10075918 3300025981 Bacteria 2279
645 Ga0207640_10161362 3300025981 Bacteria 1659
646 Ga0207640_10213037 3300025981 Bacteria 1473
647 Ga0207640_10229284 3300025981 Bacteria 1428
648 Ga0207640_10321577 3300025981 Bacteria 1232
649 Ga0207640_10379668 3300025981 Bacteria 1145
650 Ga0207640_10478998 3300025981 Bacteria 1032
651 Ga0207640_10840637 3300025981 Bacteria 798
652 Ga0207640_11598815 3300025981 Bacteria 587
653 Ga0207658_10006795 3300025986 Bacteria 7792
654 Ga0207658_10087229 3300025986 Bacteria 2409
655 Ga0207658_10153434 3300025986 Bacteria 1879
656 Ga0207658_10241774 3300025986 Bacteria 1530
657 Ga0207658_10262662 3300025986 Bacteria 1472
658 Ga0207658_10305910 3300025986 Bacteria 1371
659 Ga0207658_11287585 3300025986 Bacteria 668
660 Ga0207677_10003680 3300026023 Bacteria 8141
661 Ga0207677_10492004 3300026023 Bacteria 1059
662 Ga0207677_10577563 3300026023 Bacteria 983
663 Ga0207703_10002144 3300026035 Bacteria 17346
664 Ga0207703_10008974 3300026035 Bacteria 7878
665 Ga0207703_10055543 3300026035 Bacteria 3222
666 Ga0207703_10076090 3300026035 Bacteria 2783
667 Ga0207703_10630578 3300026035 Bacteria 1016
668 Ga0207703_11000560 3300026035 Bacteria 802
669 Ga0207639_10002346 3300026041 Bacteria 12724
670 Ga0207639_10016831 3300026041 Bacteria 5179
671 Ga0207639_10023113 3300026041 Bacteria 4486
672 Ga0207639_10032844 3300026041 Bacteria 3824
673 Ga0207639_10175169 3300026041 Bacteria 1820
674 Ga0207639_10574208 3300026041 Bacteria 1037
675 Ga0207639_10611762 3300026041 Bacteria 1005
676 Ga0207639_11703221 3300026041 Bacteria 591
677 Ga0207678_10021310 3300026067 Bacteria 5682
678 Ga0207678_10038015 3300026067 Bacteria 4185
679 Ga0207678_10055099 3300026067 Bacteria 3425
680 Ga0207678_10055740 3300026067 Bacteria 3404
681 Ga0207678_10386659 3300026067 Bacteria 1210
682 Ga0207678_10416042 3300026067 Bacteria 1165
683 Ga0207678_10994520 3300026067 Bacteria 742
684 Ga0207678_11559742 3300026067 Bacteria 582
685 Ga0207702_10203575 3300026078 Bacteria 1836
686 Ga0207702_10457578 3300026078 Bacteria 1239
687 Ga0207702_11002975 3300026078 Bacteria 828
688 Ga0207702_11955688 3300026078 Bacteria 577
689 Ga0207641_10000175 3300026088 Bacteria 89110
690 Ga0207641_10018525 3300026088 Bacteria 5709
691 Ga0207641_10052673 3300026088 Bacteria 3447
692 Ga0207641_10089057 3300026088 Bacteria 2696
693 Ga0207641_10260043 3300026088 Bacteria 1625
694 Ga0207641_10452385 3300026088 Bacteria 1241
695 Ga0207641_10557419 3300026088 Bacteria 1118
696 Ga0207648_10001391 3300026089 Bacteria 26634
697 Ga0207648_10009361 3300026089 Bacteria 9386
698 Ga0207648_10025288 3300026089 Bacteria 5290
699 Ga0207648_10081154 3300026089 Bacteria 2829
700 Ga0207676_10000138 3300026095 Bacteria 63283
701 Ga0207676_10001309 3300026095 Bacteria 18536
702 Ga0207676_10001788 3300026095 Bacteria 15763
703 Ga0207676_10015646 3300026095 Bacteria 5480
704 Ga0207676_10124656 3300026095 Bacteria 2179
705 Ga0207676_10459553 3300026095 Bacteria 1202
706 Ga0207674_10003049 3300026116 Bacteria 20722
707 Ga0207674_10007818 3300026116 Bacteria 12430
708 Ga0207674_10020368 3300026116 Bacteria 7166
709 Ga0207674_10163297 3300026116 Bacteria 2182
710 Ga0207674_10302515 3300026116 Bacteria 1548
711 Ga0207674_10392385 3300026116 Bacteria 1342
712 Ga0207675_100013635 3300026118 Bacteria 7586
713 Ga0207675_100143816 3300026118 Bacteria 2267
714 Ga0207675_100362894 3300026118 Bacteria 1421
715 Ga0207683_10012589 3300026121 Bacteria 7216
716 Ga0207683_10028509 3300026121 Bacteria 4827
717 Ga0207683_10038452 3300026121 Bacteria 4171
718 Ga0207698_10000706 3300026142 Bacteria 19357
719 Ga0207698_10001521 3300026142 Bacteria 13514
720 Ga0207698_10033159 3300026142 Bacteria 3750
721 Ga0207698_10151200 3300026142 Bacteria 2015
722 Ga0207698_10235449 3300026142 Bacteria 1665
723 Ga0207698_10237755 3300026142 Bacteria 1658
724 Ga0207698_10441084 3300026142 Bacteria 1254
725 Ga0207698_10582098 3300026142 Bacteria 1101
726 Ga0207698_10711002 3300026142 Bacteria 1000
727 Ga0268266_11379394 3300028379 Bacteria 680
728 Ga0268265_10001694 3300028380 Bacteria 17945
729 Ga0268265_10007206 3300028380 Bacteria 7515
730 Ga0268265_10033660 3300028380 Bacteria 3728
731 Ga0268265_10089795 3300028380 Bacteria 2452
732 Ga0268265_10104777 3300028380 Bacteria 2293
733 Ga0268265_10143956 3300028380 Bacteria 1999
734 Ga0268265_10426584 3300028380 Bacteria 1232
735 Ga0268265_10868240 3300028380 Bacteria 884
736 Ga0268265_11702388 3300028380 Bacteria 636
737 Ga0268264_10000932 3300028381 Bacteria 30353
738 Ga0268264_10016085 3300028381 Bacteria 6129
739 Ga0268264_10016864 3300028381 Bacteria 5979
740 Ga0268264_10021267 3300028381 Bacteria 5299
741 Ga0268264_10411083 3300028381 Bacteria 1303
742 Ga0268264_11501681 3300028381 Bacteria 684
743 Ga0307408_100012567 3300031548 Bacteria 5612
744 Ga0307408_100545608 3300031548 Bacteria 1022
745 Ga0307408_101614748 3300031548 Bacteria 616
746 Ga0307405_10692074 3300031731 Bacteria 843
747 Ga0307410_10005106 3300031852 Bacteria 6901
748 Ga0307406_11192029 3300031901 Bacteria 661
749 Ga0307407_10181568 3300031903 Bacteria 1395
750 Ga0307409_100052196 3300031995 Bacteria 3133
751 Ga0307416_100352831 3300032002 Bacteria 1489
752 Ga0307414_11015782 3300032004 Bacteria 764
753 Ga0307415_100000440 3300032126 Bacteria 17845
754 Ga0373940_0013620 3300035088 Bacteria 1972
755 Ga0373951_0286487 3300035091 Bacteria 504
756 Ga0373923_0019190 3300035111 Bacteria 2644
757 Ga0373939_0456033 3300035114 Bacteria 539
758 Ga0373941_0193882 3300035115 Bacteria 769
759 Ga0373954_0059966 3300035118 Bacteria 1794
760 Ga0373956_0408190 3300035119 Bacteria 648
761 Ga0373955_0056091 3300035172 Bacteria 2161
762 Ga0373931_0245625 3300035691 Bacteria 1087
763 Ga0373935_0189257 3300035692 Bacteria 1417
764 Ga0373933_0135704 3300035724 Bacteria 1550
765 Ga0373937_0015554 3300036401 Bacteria 6732
766 Ga0395899_0066576 3300037312 Bacteria 2645
767 Ga0395899_0149118 3300037312 Bacteria 1658
768 Ga0395899_0332077 3300037312 Bacteria 1021
769 Ga0395900_0015989 3300037418 Bacteria 7646
770 Ga0395900_0031705 3300037418 Bacteria 5432
771 Ga0395900_0052525 3300037418 Bacteria 4195
772 Ga0395900_0170157 3300037418 Bacteria 2218
773 Ga0395900_0227779 3300037418 Bacteria 1876
774 Ga0395900_0960384 3300037418 Bacteria 776
775 Ga0395898_0034678 3300037466 Bacteria 5025
776 Ga0395898_0226924 3300037466 Bacteria 1781
777 Ga0395898_0230832 3300037466 Bacteria 1765
778 Ga0395898_0241709 3300037466 Bacteria 1722
779 Ga0395898_0364479 3300037466 Bacteria 1378
780 Ga0395898_1196651 3300037466 Bacteria 691
781 Ga0395898_1696302 3300037466 Bacteria 554
782 Ga0395898_1940600 3300037466 Bacteria 508
783 Ga0395905_0000756 3300037471 Bacteria 42590
784 Ga0395905_0004552 3300037471 Bacteria 14353
785 Ga0395905_0018156 3300037471 Bacteria 6675
786 Ga0395905_0037822 3300037471 Bacteria 4529
787 Ga0395905_0047727 3300037471 Bacteria 4012
788 Ga0395905_0097433 3300037471 Bacteria 2761
789 Ga0395905_0211258 3300037471 Bacteria 1818
790 Ga0395905_0250996 3300037471 Bacteria 1652
791 Ga0395905_0335112 3300037471 Bacteria 1404
792 Ga0395905_0364627 3300037471 Bacteria 1337
793 Ga0395905_0380525 3300037471 Bacteria 1305
794 Ga0395905_0504935 3300037471 Bacteria 1109
795 Ga0395905_0656037 3300037471 Bacteria 951
796 Ga0395905_0676187 3300037471 Bacteria 934
797 Ga0395905_0831453 3300037471 Bacteria 826
798 Ga0395905_1422028 3300037471 Bacteria 598
799 Ga0395905_1428332 3300037471 Bacteria 596
800 Ga0436364_1406360 3300037853 Bacteria 26034
801 Ga0395901_0012260 3300038443 Bacteria 8700
802 Ga0395901_0014130 3300038443 Bacteria 8128
803 Ga0395901_0031705 3300038443 Bacteria 5449
804 Ga0395901_0398839 3300038443 Bacteria 1413
805 Ga0395901_0829031 3300038443 Bacteria 912
806 Ga0395901_0941220 3300038443 Bacteria 843
807 Ga0395901_1624973 3300038443 Bacteria 599
808 Ga0436365_0440923 3300039437 Bacteria 20557
809 Ga0439458_0015600 3300042157 Bacteria 1723
810 Ga0439458_0124519 3300042157 Bacteria 680
811 Ga0439459_0054075 3300042438 Bacteria 890
812 Ga0439464_0000045 3300042439 Bacteria 16165
813 Ga0466966_0040985 3300044684 Bacteria 2978
814 Ga0466966_0062865 3300044684 Bacteria 2340
815 Ga0466966_0232422 3300044684 Bacteria 1112
816 Ga0466961_0764214 3300044693 Bacteria 577
817 Ga0466963_0212673 3300044694 Bacteria 1353
818 Ga0466968_0505450 3300044735 Bacteria 603
819 Ga0466970_0149778 3300044765 Bacteria 1288
820 Ga0466959_0128498 3300045049 Bacteria 1797
821 Ga0451576_1836259 3300045051 Bacteria 626
822 Ga0466958_1026428 3300045836 Unclassified 538
823 Ga0466967_0057413 3300045976 Bacteria 3436
824 Ga0466967_0251258 3300045976 Bacteria 1689
825 Ga0466967_0253621 3300045976 Bacteria 1681
826 Ga0466967_0275573 3300045976 Bacteria 1613
827 Ga0466967_0644180 3300045976 Bacteria 1047
828 Ga0495663_0095136 3300046525 Bacteria 975
829 Ga0495663_0113157 3300046525 Bacteria 903
830 Ga0495668_0030101 3300046616 Bacteria 3066
831 Ga0495668_0161966 3300046616 Bacteria 1225
832 Ga0495668_0627628 3300046616 Bacteria 594
833 Ga0495625_0143163 3300046660 Bacteria 1612
834 Ga0495669_0008488 3300046684 Bacteria 4321
835 Ga0495669_0010742 3300046684 Bacteria 3876
836 Ga0495669_0091936 3300046684 Bacteria 1401
837 Ga0495669_0117034 3300046684 Bacteria 1247
838 Ga0495669_0223791 3300046684 Bacteria 902
839 Ga0495669_0314378 3300046684 Bacteria 756
840 Ga0495669_0479572 3300046684 Bacteria 604
841 Ga0495669_0586047 3300046684 Bacteria 542
842 Ga0495670_0475555 3300046691 Bacteria 678
843 Ga0495677_0020757 3300047445 Bacteria 2380
844 Ga0495677_0078560 3300047445 Bacteria 1235
845 Ga0495677_0253125 3300047445 Bacteria 689
846 Ga0495677_0281889 3300047445 Bacteria 652
847 Ga0495685_134930 3300047447 Bacteria 806
848 Ga0495685_177692 3300047447 Bacteria 686
849 Ga0495685_250863 3300047447 Bacteria 561
850 Ga0495602_0045724 3300048088 Bacteria 3960
851 Ga0496100_0402018 3300048903 Bacteria 1043
852 Ga0496100_0679033 3300048903 Bacteria 803
853 Ga0496101_0022205 3300048904 Bacteria 4367
854 Ga0496101_0428226 3300048904 Bacteria 1043
855 Ga0496102_0122899 3300048905 Bacteria 2425
856 Ga0496103_0079072 3300048906 Bacteria 2066
857 Ga0496103_0220741 3300048906 Bacteria 1219
858 Ga0496105_0097313 3300048908 Bacteria 2431
859 Ga0496106_0007365 3300048909 Bacteria 8132
860 Ga0496106_0575379 3300048909 Bacteria 903
861 Ga0496107_0021737 3300048910 Bacteria 4533
862 Ga0496107_0183241 3300048910 Bacteria 1555
863 Ga0496108_0014814 3300048911 Bacteria 6361
864 Ga0496108_0062546 3300048911 Bacteria 3134
865 Ga0496108_0756259 3300048911 Bacteria 840
866 Ga0496109_0004961 3300048912 Bacteria 11116
867 Ga0496109_0153326 3300048912 Bacteria 2158
868 Ga0496109_0264122 3300048912 Bacteria 1621
869 Ga0496109_1934013 3300048912 Bacteria 522
870 Ga0496110_0038463 3300048913 Bacteria 4163
871 Ga0496110_0406966 3300048913 Bacteria 1240
872 Ga0496111_0000342 3300048914 Bacteria 23149
873 Ga0496111_0100321 3300048914 Bacteria 2126
874 Ga0496111_0745089 3300048914 Bacteria 711
875 Ga0496112_0005863 3300048915 Bacteria 10699
876 Ga0496112_0017301 3300048915 Bacteria 6770
877 Ga0496112_0026765 3300048915 Bacteria 5556
878 Ga0496112_0033735 3300048915 Bacteria 4977
879 Ga0496112_0196154 3300048915 Bacteria 1979
880 Ga0496113_0042123 3300048916 Bacteria 3372
881 Ga0496113_0065433 3300048916 Bacteria 2751
882 Ga0496113_0112679 3300048916 Bacteria 2119
883 Ga0496113_0623279 3300048916 Bacteria 863
884 Ga0496114_0034740 3300048917 Bacteria 4161
885 Ga0496115_0001505 3300048918 Bacteria 16734
886 Ga0501035_0436671 3300049822 Bacteria 1085
887 nmdc:mga03683_30007_c1 3300050489 Bacteria 2173
888 nmdc:mga00v17_99174_c1 3300050491 Bacteria 1837
889 nmdc:mga0k408_128530_c1 3300050493 Bacteria 1503
890 nmdc:mga09592_1001126_c1 3300050508 Bacteria 699
891 nmdc:mga09592_176556_c1 3300050508 Bacteria 1847
892 nmdc:mga0a205_18103_c1 3300050515 Bacteria 6619
893 Ga0495655_0109254 3300053083 Bacteria 829
894 Ga0500658_0000149 3300053134 Bacteria 33339
895 Ga0466962_0443365 3300061719 Bacteria 653

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10099856 Ga0070658_100998562 92
2 3300005329 Ga0070683_100095414 Ga0070683_1000954143 92
3 3300005338 Ga0068868_100704723 Ga0068868_1007047231 92
4 3300005535 Ga0070684_100332812 Ga0070684_1003328122 92
5 3300005539 Ga0068853_101292948 Ga0068853_1012929481 92
6 3300005563 Ga0068855_100105816 Ga0068855_1001058162 92
7 3300013102 Ga0157371_10057520 Ga0157371_100575205 92
8 3300013105 Ga0157369_10054183 Ga0157369_100541835 92
9 3300025909 Ga0207705_10212252 Ga0207705_102122522 92
10 3300025944 Ga0207661_10009534 Ga0207661_100095349 92
11 3300037312 Ga0395899_0149118 Ga0395899_0149118_1239_1607 92
12 3300037466 Ga0395898_0034678 Ga0395898_0034678_3927_4295 92
13 3300038443 Ga0395901_0014130 Ga0395901_0014130_976_1344 92
14 3300005339 Ga0070660_100409086 Ga0070660_1004090863 93
15 3300005339 Ga0070660_100503587 Ga0070660_1005035872 96
16 3300025919 Ga0207657_10297695 Ga0207657_102976952 96
17 3300025932 Ga0207690_10045080 Ga0207690_100450804 96
18 3300026078 Ga0207702_11955688 Ga0207702_119556881 96
19 3300002067 JGI24735J21928_10009940 JGI24735J21928_100099405 98
20 3300002067 JGI24735J21928_10032381 JGI24735J21928_100323813 98
21 3300005327 Ga0070658_10760310 Ga0070658_107603101 98
22 3300005329 Ga0070683_101835262 Ga0070683_1018352621 98
23 3300005339 Ga0070660_100023819 Ga0070660_1000238191 98
24 3300005344 Ga0070661_100042451 Ga0070661_1000424515 98
25 3300005366 Ga0070659_100068918 Ga0070659_1000689185 98
26 3300005458 Ga0070681_10019981 Ga0070681_100199812 98
27 3300005535 Ga0070684_101681716 Ga0070684_1016817162 98
28 3300005539 Ga0068853_100006969 Ga0068853_1000069699 98
29 3300005563 Ga0068855_100719668 Ga0068855_1007196682 98
30 3300005577 Ga0068857_100364216 Ga0068857_1003642162 98
31 3300005578 Ga0068854_101152503 Ga0068854_1011525032 98
32 3300005614 Ga0068856_101723585 Ga0068856_1017235852 98
33 3300005616 Ga0068852_100006623 Ga0068852_1000066232 98
34 3300009093 Ga0105240_10014684 Ga0105240_100146844 98
35 3300009174 Ga0105241_10054250 Ga0105241_100542502 98
36 3300009545 Ga0105237_10012608 Ga0105237_100126087 98
37 3300009551 Ga0105238_10029976 Ga0105238_100299765 98
38 3300010375 Ga0105239_10011604 Ga0105239_100116045 98
39 3300013100 Ga0157373_10003467 Ga0157373_100034677 98
40 3300013104 Ga0157370_10085412 Ga0157370_100854123 98
41 3300013307 Ga0157372_10050035 Ga0157372_100500354 98
42 3300045976 Ga0466967_0251258 Ga0466967_0251258_448_846 98
43 3300046684 Ga0495669_0479572 Ga0495669_0479572_29_376 98
44 3300005331 Ga0070670_101012071 Ga0070670_1010120712 99
45 3300005844 Ga0068862_100096996 Ga0068862_1000969962 99
46 3300006177 Ga0075362_10043302 Ga0075362_100433024 99
47 3300025904 Ga0207647_10009442 Ga0207647_100094422 99
48 3300025912 Ga0207707_10012875 Ga0207707_100128752 99
49 3300025913 Ga0207695_10135847 Ga0207695_101358472 99
50 3300025914 Ga0207671_10017230 Ga0207671_100172302 99
51 3300025917 Ga0207660_10125819 Ga0207660_101258192 99
52 3300025919 Ga0207657_10010390 Ga0207657_1001039010 99
53 3300025920 Ga0207649_10053636 Ga0207649_100536362 99
54 3300025924 Ga0207694_10002972 Ga0207694_100029722 99
55 3300025925 Ga0207650_11892232 Ga0207650_118922321 99
56 3300025932 Ga0207690_10009194 Ga0207690_100091948 99
57 3300025944 Ga0207661_11561156 Ga0207661_115611562 99
58 3300025945 Ga0207679_10102645 Ga0207679_101026452 99
59 3300025949 Ga0207667_10018797 Ga0207667_100187973 99
60 3300025981 Ga0207640_11598815 Ga0207640_115988152 99
61 3300026041 Ga0207639_10002346 Ga0207639_100023463 99
62 3300026078 Ga0207702_11002975 Ga0207702_110029752 99
63 3300026116 Ga0207674_10020368 Ga0207674_100203688 99
64 3300026142 Ga0207698_10582098 Ga0207698_105820981 99
65 3300028380 Ga0268265_10007206 Ga0268265_100072066 99
66 3300050489 nmdc:mga03683_30007_c1 nmdc:mga03683_30007_c1_684_1031 99
67 3300050491 nmdc:mga00v17_99174_c1 nmdc:mga00v17_99174_c1_649_996 99
68 3300005336 Ga0070680_100049943 Ga0070680_1000499435 100
69 3300005455 Ga0070663_100551441 Ga0070663_1005514412 100
70 3300005614 Ga0068856_100210543 Ga0068856_1002105433 100
71 3300005616 Ga0068852_100046115 Ga0068852_1000461152 100
72 3300020069 Ga0197907_11396321 Ga0197907_113963212 100
73 3300020081 Ga0206354_11602090 Ga0206354_116020902 100
74 3300020082 Ga0206353_11915595 Ga0206353_119155955 100
75 3300025917 Ga0207660_10039317 Ga0207660_100393173 100
76 3300025919 Ga0207657_10103917 Ga0207657_101039174 100
77 3300025921 Ga0207652_10419010 Ga0207652_104190103 100
78 3300025949 Ga0207667_10141128 Ga0207667_101411284 100
79 3300026067 Ga0207678_11559742 Ga0207678_115597422 100
80 3300026142 Ga0207698_10000706 Ga0207698_1000070619 100
81 3300005327 Ga0070658_10372701 Ga0070658_103727011 101
82 3300005338 Ga0068868_101184176 Ga0068868_1011841762 101
83 3300005339 Ga0070660_100046275 Ga0070660_1000462752 101
84 3300005345 Ga0070692_10065069 Ga0070692_100650692 101
85 3300005347 Ga0070668_100519953 Ga0070668_1005199533 101
86 3300005353 Ga0070669_100357114 Ga0070669_1003571142 101
87 3300005366 Ga0070659_100002178 Ga0070659_10000217813 101
88 3300005435 Ga0070714_100504749 Ga0070714_1005047493 101
89 3300005438 Ga0070701_11419162 Ga0070701_114191621 101
90 3300005444 Ga0070694_100009449 Ga0070694_1000094496 101
91 3300005539 Ga0068853_100304254 Ga0068853_1003042542 101
92 3300005543 Ga0070672_100138369 Ga0070672_1001383692 101
93 3300005543 Ga0070672_100160558 Ga0070672_1001605583 101
94 3300005545 Ga0070695_100693484 Ga0070695_1006934842 101
95 3300005549 Ga0070704_100642009 Ga0070704_1006420092 101
96 3300005563 Ga0068855_100073993 Ga0068855_1000739934 101
97 3300005616 Ga0068852_100222212 Ga0068852_1002222122 101
98 3300005842 Ga0068858_100454947 Ga0068858_1004549473 101
99 3300005843 Ga0068860_100101492 Ga0068860_1001014924 101
100 3300005844 Ga0068862_100758742 Ga0068862_1007587422 101
101 3300005985 Ga0081539_10052286 Ga0081539_100522862 101
102 3300006237 Ga0097621_101033023 Ga0097621_1010330232 101
103 3300009093 Ga0105240_10215052 Ga0105240_102150523 101
104 3300009148 Ga0105243_11916952 Ga0105243_119169521 101
105 3300009177 Ga0105248_10027845 Ga0105248_100278458 101
106 3300009177 Ga0105248_10271253 Ga0105248_102712533 101
107 3300009553 Ga0105249_10009482 Ga0105249_100094828 101
108 3300010375 Ga0105239_10181263 Ga0105239_101812633 101
109 3300011119 Ga0105246_10473893 Ga0105246_104738933 101
110 3300013102 Ga0157371_10378527 Ga0157371_103785272 101
111 3300013306 Ga0163162_10515564 Ga0163162_105155642 101
112 3300021388 Ga0213875_10002606 Ga0213875_100026062 101
113 3300025912 Ga0207707_10174347 Ga0207707_101743471 101
114 3300037853 Ga0436364_1406360 Ga0436364_1406360_12776_13195 101
115 3300044684 Ga0466966_0062865 Ga0466966_0062865_340_699 101
116 3300005578 Ga0068854_100398229 Ga0068854_1003982292 102
117 3300025921 Ga0207652_10250922 Ga0207652_102509222 102
118 3300025981 Ga0207640_10229284 Ga0207640_102292842 102
119 3300025981 Ga0207640_10379668 Ga0207640_103796682 102
120 3300037418 Ga0395900_0015989 Ga0395900_0015989_5726_6058 102
121 3300037466 Ga0395898_1196651 Ga0395898_1196651_84_416 102
122 3300037471 Ga0395905_0097433 Ga0395905_0097433_859_1191 102
123 3300038443 Ga0395901_0941220 Ga0395901_0941220_390_722 102
124 3300045976 Ga0466967_0057413 Ga0466967_0057413_1382_1765 102
125 3300046525 Ga0495663_0113157 Ga0495663_0113157_308_676 102
126 3300046616 Ga0495668_0627628 Ga0495668_0627628_114_482 102
127 3300046684 Ga0495669_0091936 Ga0495669_0091936_805_1173 102
128 3300046684 Ga0495669_0117034 Ga0495669_0117034_55_426 102
129 3300046684 Ga0495669_0223791 Ga0495669_0223791_156_497 102
130 3300047445 Ga0495677_0020757 Ga0495677_0020757_642_1010 102
131 3300047447 Ga0495685_177692 Ga0495685_177692_89_457 102
132 3300005367 Ga0070667_102207795 Ga0070667_1022077951 103
133 3300005614 Ga0068856_100712708 Ga0068856_1007127081 103
134 3300009174 Ga0105241_10071184 Ga0105241_100711845 103
135 3300021384 Ga0213876_10007945 Ga0213876_100079455 103
136 3300025904 Ga0207647_10427972 Ga0207647_104279722 103
137 3300025972 Ga0207668_10218701 Ga0207668_102187014 103
138 3300037471 Ga0395905_0831453 Ga0395905_0831453_36_377 103
139 3300037471 Ga0395905_1422028 Ga0395905_1422028_182_559 103
140 3300039437 Ga0436365_0440923 Ga0436365_0440923_11845_12186 103
141 3300044684 Ga0466966_0232422 Ga0466966_0232422_547_924 103
142 3300045976 Ga0466967_0275573 Ga0466967_0275573_487_855 103
143 3300046684 Ga0495669_0586047 Ga0495669_0586047_48_392 103
144 3300005327 Ga0070658_10140143 Ga0070658_101401432 104
145 3300005327 Ga0070658_10191926 Ga0070658_101919264 104
146 3300005338 Ga0068868_100159778 Ga0068868_1001597783 104
147 3300005339 Ga0070660_100071720 Ga0070660_1000717204 104
148 3300005339 Ga0070660_101697709 Ga0070660_1016977091 104
149 3300005344 Ga0070661_100116791 Ga0070661_1001167914 104
150 3300005353 Ga0070669_100212017 Ga0070669_1002120172 104
151 3300005354 Ga0070675_101875087 Ga0070675_1018750871 104
152 3300005355 Ga0070671_100072474 Ga0070671_1000724742 104
153 3300005366 Ga0070659_100315714 Ga0070659_1003157142 104
154 3300005455 Ga0070663_100199032 Ga0070663_1001990322 104
155 3300005457 Ga0070662_100784755 Ga0070662_1007847552 104
156 3300005457 Ga0070662_100887232 Ga0070662_1008872321 104
157 3300005543 Ga0070672_100155007 Ga0070672_1001550074 104
158 3300005543 Ga0070672_101130684 Ga0070672_1011306842 104
159 3300005547 Ga0070693_100322306 Ga0070693_1003223062 104
160 3300005564 Ga0070664_100033519 Ga0070664_1000335192 104
161 3300005564 Ga0070664_100173788 Ga0070664_1001737882 104
162 3300005577 Ga0068857_100304538 Ga0068857_1003045382 104
163 3300005578 Ga0068854_100189266 Ga0068854_1001892662 104
164 3300005616 Ga0068852_100215940 Ga0068852_1002159404 104
165 3300005617 Ga0068859_100088140 Ga0068859_1000881403 104
166 3300005618 Ga0068864_100024534 Ga0068864_1000245347 104
167 3300005618 Ga0068864_100749874 Ga0068864_1007498742 104
168 3300005834 Ga0068851_10398996 Ga0068851_103989962 104
169 3300005841 Ga0068863_100060705 Ga0068863_1000607052 104
170 3300005841 Ga0068863_101112041 Ga0068863_1011120412 104
171 3300005842 Ga0068858_100302328 Ga0068858_1003023282 104
172 3300005843 Ga0068860_100398939 Ga0068860_1003989392 104
173 3300005844 Ga0068862_100482614 Ga0068862_1004826142 104
174 3300006852 Ga0075433_10267382 Ga0075433_102673823 104
175 3300006931 Ga0097620_100088137 Ga0097620_1000881373 104
176 3300009177 Ga0105248_10000269 Ga0105248_100002692 104
177 3300009553 Ga0105249_10224274 Ga0105249_102242743 104
178 3300011119 Ga0105246_10196525 Ga0105246_101965252 104
179 3300013308 Ga0157375_10396567 Ga0157375_103965674 104
180 3300014745 Ga0157377_10065466 Ga0157377_100654664 104
181 3300025315 Ga0207697_10034678 Ga0207697_100346784 104
182 3300025901 Ga0207688_10063412 Ga0207688_100634122 104
183 3300025909 Ga0207705_10226900 Ga0207705_102269003 104
184 3300025919 Ga0207657_10206512 Ga0207657_102065122 104
185 3300025920 Ga0207649_10361078 Ga0207649_103610782 104
186 3300025923 Ga0207681_10144688 Ga0207681_101446882 104
187 3300025931 Ga0207644_10024128 Ga0207644_100241286 104
188 3300025932 Ga0207690_10277340 Ga0207690_102773402 104
189 3300025933 Ga0207706_10313763 Ga0207706_103137632 104
190 3300025940 Ga0207691_10112350 Ga0207691_101123502 104
191 3300025941 Ga0207711_10004591 Ga0207711_1000459110 104
192 3300025942 Ga0207689_10006847 Ga0207689_100068472 104
193 3300025945 Ga0207679_10113610 Ga0207679_101136104 104
194 3300025945 Ga0207679_10135168 Ga0207679_101351683 104
195 3300025961 Ga0207712_10682832 Ga0207712_106828321 104
196 3300025981 Ga0207640_10840637 Ga0207640_108406372 104
197 3300025986 Ga0207658_10153434 Ga0207658_101534342 104
198 3300026023 Ga0207677_10577563 Ga0207677_105775632 104
199 3300026035 Ga0207703_10055543 Ga0207703_100555433 104
200 3300026067 Ga0207678_10416042 Ga0207678_104160422 104
201 3300026088 Ga0207641_10089057 Ga0207641_100890572 104
202 3300026095 Ga0207676_10015646 Ga0207676_100156463 104
203 3300026116 Ga0207674_10392385 Ga0207674_103923852 104
204 3300026142 Ga0207698_10237755 Ga0207698_102377552 104
205 3300028380 Ga0268265_10089795 Ga0268265_100897952 104
206 3300028380 Ga0268265_10143956 Ga0268265_101439563 104
207 3300035091 Ga0373951_0286487 Ga0373951_0286487_20_361 104
208 3300035114 Ga0373939_0456033 Ga0373939_0456033_135_476 104
209 3300035115 Ga0373941_0193882 Ga0373941_0193882_150_491 104
210 3300037471 Ga0395905_0004552 Ga0395905_0004552_70_453 104
211 3300044693 Ga0466961_0764214 Ga0466961_0764214_162_539 104
212 3300044735 Ga0466968_0505450 Ga0466968_0505450_63_440 104
213 3300045836 Ga0466958_1026428 Ga0466958_1026428_143_520 104
214 3300045976 Ga0466967_0644180 Ga0466967_0644180_377_754 104
215 3300048904 Ga0496101_0022205 Ga0496101_0022205_1823_2191 104
216 3300048909 Ga0496106_0007365 Ga0496106_0007365_6810_7178 104
217 3300048910 Ga0496107_0021737 Ga0496107_0021737_3355_3723 104
218 3300048911 Ga0496108_0014814 Ga0496108_0014814_5259_5627 104
219 3300048912 Ga0496109_0004961 Ga0496109_0004961_2178_2546 104
220 3300048913 Ga0496110_0038463 Ga0496110_0038463_796_1164 104
221 3300048914 Ga0496111_0000342 Ga0496111_0000342_699_1067 104
222 3300048914 Ga0496111_0745089 Ga0496111_0745089_146_529 104
223 3300048915 Ga0496112_0005863 Ga0496112_0005863_9077_9445 104
224 3300048916 Ga0496113_0112679 Ga0496113_0112679_390_758 104
225 3300048916 Ga0496113_0623279 Ga0496113_0623279_263_646 104
226 3300050515 nmdc:mga0a205_18103_c1 nmdc:mga0a205_18103_c1_1013_1354 104
227 3300061719 Ga0466962_0443365 Ga0466962_0443365_88_465 104
228 3300001977 JGI24746J21847_1006385 JGI24746J21847_10063852 105
229 3300001978 JGI24747J21853_1002022 JGI24747J21853_10020223 105
230 3300001989 JGI24739J22299_10028590 JGI24739J22299_100285902 105
231 3300001990 JGI24737J22298_10006005 JGI24737J22298_100060053 105
232 3300001991 JGI24743J22301_10006940 JGI24743J22301_100069403 105
233 3300002073 JGI24745J21846_1000475 JGI24745J21846_10004753 105
234 3300002075 JGI24738J21930_10003652 JGI24738J21930_100036524 105
235 3300002077 JGI24744J21845_10000507 JGI24744J21845_100005075 105
236 3300002244 JGI24742J22300_10004609 JGI24742J22300_100046093 105
237 3300005331 Ga0070670_100069930 Ga0070670_1000699303 105
238 3300005336 Ga0070680_100511634 Ga0070680_1005116342 105
239 3300005337 Ga0070682_100205713 Ga0070682_1002057132 105
240 3300005344 Ga0070661_100086650 Ga0070661_1000866504 105
241 3300005344 Ga0070661_100448942 Ga0070661_1004489423 105
242 3300005347 Ga0070668_101468519 Ga0070668_1014685192 105
243 3300005353 Ga0070669_100116249 Ga0070669_1001162492 105
244 3300005353 Ga0070669_100480643 Ga0070669_1004806431 105
245 3300005354 Ga0070675_100272924 Ga0070675_1002729244 105
246 3300005355 Ga0070671_100253062 Ga0070671_1002530623 105
247 3300005356 Ga0070674_100061418 Ga0070674_1000614182 105
248 3300005364 Ga0070673_100073492 Ga0070673_1000734923 105
249 3300005366 Ga0070659_100182160 Ga0070659_1001821602 105
250 3300005367 Ga0070667_100139679 Ga0070667_1001396793 105
251 3300005367 Ga0070667_100328233 Ga0070667_1003282332 105
252 3300005455 Ga0070663_100039104 Ga0070663_1000391042 105
253 3300005455 Ga0070663_100092002 Ga0070663_1000920022 105
254 3300005456 Ga0070678_100066889 Ga0070678_1000668894 105
255 3300005530 Ga0070679_100696708 Ga0070679_1006967081 105
256 3300005539 Ga0068853_100117531 Ga0068853_1001175313 105
257 3300005543 Ga0070672_100081851 Ga0070672_1000818512 105
258 3300005563 Ga0068855_100208814 Ga0068855_1002088142 105
259 3300005564 Ga0070664_100017284 Ga0070664_1000172842 105
260 3300005564 Ga0070664_100027446 Ga0070664_1000274463 105
261 3300005577 Ga0068857_100002631 Ga0068857_10000263112 105
262 3300005578 Ga0068854_100023236 Ga0068854_1000232364 105
263 3300005616 Ga0068852_100211126 Ga0068852_1002111262 105
264 3300005617 Ga0068859_100004301 Ga0068859_10000430112 105
265 3300005618 Ga0068864_100015554 Ga0068864_1000155543 105
266 3300005718 Ga0068866_10650393 Ga0068866_106503932 105
267 3300005841 Ga0068863_100012961 Ga0068863_1000129614 105
268 3300005841 Ga0068863_100966112 Ga0068863_1009661122 105
269 3300005842 Ga0068858_100042344 Ga0068858_1000423446 105
270 3300005843 Ga0068860_100013427 Ga0068860_1000134274 105
271 3300005844 Ga0068862_100016716 Ga0068862_1000167162 105
272 3300006237 Ga0097621_100032280 Ga0097621_1000322805 105
273 3300006931 Ga0097620_100004301 Ga0097620_10000430112 105
274 3300009098 Ga0105245_10120514 Ga0105245_101205143 105
275 3300009148 Ga0105243_10040963 Ga0105243_100409632 105
276 3300009174 Ga0105241_10208062 Ga0105241_102080623 105
277 3300009174 Ga0105241_10310552 Ga0105241_103105523 105
278 3300009553 Ga0105249_10019016 Ga0105249_100190163 105
279 3300013100 Ga0157373_10136161 Ga0157373_101361614 105
280 3300013105 Ga0157369_10102999 Ga0157369_101029994 105
281 3300013296 Ga0157374_10511670 Ga0157374_105116703 105
282 3300013297 Ga0157378_10015380 Ga0157378_100153806 105
283 3300013306 Ga0163162_10503131 Ga0163162_105031312 105
284 3300014326 Ga0157380_10567903 Ga0157380_105679032 105
285 3300014968 Ga0157379_12167833 Ga0157379_121678332 105
286 3300025315 Ga0207697_10023020 Ga0207697_100230204 105
287 3300025893 Ga0207682_10008330 Ga0207682_100083302 105
288 3300025899 Ga0207642_10249567 Ga0207642_102495672 105
289 3300025901 Ga0207688_10008353 Ga0207688_100083534 105
290 3300025907 Ga0207645_10016295 Ga0207645_100162955 105
291 3300025909 Ga0207705_10612199 Ga0207705_106121992 105
292 3300025911 Ga0207654_10202303 Ga0207654_102023033 105
293 3300025911 Ga0207654_10546006 Ga0207654_105460062 105
294 3300025917 Ga0207660_10793878 Ga0207660_107938782 105
295 3300025919 Ga0207657_10028000 Ga0207657_100280003 105
296 3300025920 Ga0207649_10045189 Ga0207649_100451893 105
297 3300025920 Ga0207649_10046606 Ga0207649_100466064 105
298 3300025923 Ga0207681_10164182 Ga0207681_101641822 105
299 3300025923 Ga0207681_10609962 Ga0207681_106099622 105
300 3300025925 Ga0207650_10044704 Ga0207650_100447043 105
301 3300025925 Ga0207650_10115214 Ga0207650_101152142 105
302 3300025926 Ga0207659_10064439 Ga0207659_100644394 105
303 3300025926 Ga0207659_10169440 Ga0207659_101694403 105
304 3300025933 Ga0207706_10014742 Ga0207706_100147428 105
305 3300025935 Ga0207709_10114980 Ga0207709_101149802 105
306 3300025935 Ga0207709_10759761 Ga0207709_107597612 105
307 3300025936 Ga0207670_10334169 Ga0207670_103341693 105
308 3300025940 Ga0207691_10214449 Ga0207691_102144493 105
309 3300025941 Ga0207711_10119253 Ga0207711_101192532 105
310 3300025942 Ga0207689_10006231 Ga0207689_100062318 105
311 3300025945 Ga0207679_10013308 Ga0207679_100133085 105
312 3300025945 Ga0207679_10101395 Ga0207679_101013951 105
313 3300025961 Ga0207712_10033970 Ga0207712_100339702 105
314 3300025981 Ga0207640_10075918 Ga0207640_100759184 105
315 3300025986 Ga0207658_10305910 Ga0207658_103059103 105
316 3300026035 Ga0207703_10630578 Ga0207703_106305782 105
317 3300026035 Ga0207703_11000560 Ga0207703_110005602 105
318 3300026041 Ga0207639_10175169 Ga0207639_101751693 105
319 3300026067 Ga0207678_10021310 Ga0207678_100213105 105
320 3300026067 Ga0207678_10055099 Ga0207678_100550992 105
321 3300026088 Ga0207641_10052673 Ga0207641_100526733 105
322 3300026088 Ga0207641_10260043 Ga0207641_102600432 105
323 3300026089 Ga0207648_10009361 Ga0207648_100093619 105
324 3300026095 Ga0207676_10001309 Ga0207676_100013095 105
325 3300026095 Ga0207676_10459553 Ga0207676_104595533 105
326 3300026116 Ga0207674_10302515 Ga0207674_103025152 105
327 3300026118 Ga0207675_100143816 Ga0207675_1001438164 105
328 3300026121 Ga0207683_10038452 Ga0207683_100384524 105
329 3300026142 Ga0207698_10441084 Ga0207698_104410842 105
330 3300028381 Ga0268264_10021267 Ga0268264_100212676 105
331 3300035088 Ga0373940_0013620 Ga0373940_0013620_767_1111 105
332 3300044684 Ga0466966_0040985 Ga0466966_0040985_784_1170 105
333 3300045049 Ga0466959_0128498 Ga0466959_0128498_635_1021 105
334 3300045976 Ga0466967_0253621 Ga0466967_0253621_435_794 105
335 3300048905 Ga0496102_0122899 Ga0496102_0122899_977_1363 105
336 3300048906 Ga0496103_0079072 Ga0496103_0079072_545_931 105
337 3300048911 Ga0496108_0756259 Ga0496108_0756259_269_613 105
338 3300048912 Ga0496109_0153326 Ga0496109_0153326_289_633 105
339 3300048915 Ga0496112_0026765 Ga0496112_0026765_4612_4998 105
340 3300001915 JGI24741J21665_1008768 JGI24741J21665_10087683 106
341 3300001979 JGI24740J21852_10007981 JGI24740J21852_100079812 106
342 3300001989 JGI24739J22299_10029992 JGI24739J22299_100299923 106
343 3300002067 JGI24735J21928_10024361 JGI24735J21928_100243612 106
344 3300005327 Ga0070658_10396316 Ga0070658_103963161 106
345 3300005329 Ga0070683_100010266 Ga0070683_1000102667 106
346 3300005336 Ga0070680_100226528 Ga0070680_1002265282 106
347 3300005337 Ga0070682_100080848 Ga0070682_1000808482 106
348 3300005341 Ga0070691_10096919 Ga0070691_100969193 106
349 3300005344 Ga0070661_100081906 Ga0070661_1000819062 106
350 3300005366 Ga0070659_100495928 Ga0070659_1004959281 106
351 3300005455 Ga0070663_100036659 Ga0070663_1000366595 106
352 3300005457 Ga0070662_100046561 Ga0070662_1000465615 106
353 3300005539 Ga0068853_100252582 Ga0068853_1002525822 106
354 3300005547 Ga0070693_100083556 Ga0070693_1000835564 106
355 3300005563 Ga0068855_100019628 Ga0068855_1000196289 106
356 3300005564 Ga0070664_100135240 Ga0070664_1001352402 106
357 3300005577 Ga0068857_100025044 Ga0068857_1000250445 106
358 3300005578 Ga0068854_100050371 Ga0068854_1000503714 106
359 3300013100 Ga0157373_10080578 Ga0157373_100805784 106
360 3300013100 Ga0157373_11536328 Ga0157373_115363281 106
361 3300013104 Ga0157370_10796712 Ga0157370_107967122 106
362 3300013307 Ga0157372_10006954 Ga0157372_1000695410 106
363 3300025909 Ga0207705_10006095 Ga0207705_100060955 106
364 3300025912 Ga0207707_10004365 Ga0207707_100043659 106
365 3300025917 Ga0207660_10001982 Ga0207660_100019825 106
366 3300025919 Ga0207657_10044544 Ga0207657_100445442 106
367 3300025920 Ga0207649_10005743 Ga0207649_100057435 106
368 3300025921 Ga0207652_10003434 Ga0207652_100034348 106
369 3300025932 Ga0207690_10001200 Ga0207690_100012008 106
370 3300025933 Ga0207706_10011697 Ga0207706_100116977 106
371 3300025944 Ga0207661_10434727 Ga0207661_104347273 106
372 3300025945 Ga0207679_10078653 Ga0207679_100786535 106
373 3300025949 Ga0207667_10408040 Ga0207667_104080403 106
374 3300025981 Ga0207640_10012265 Ga0207640_100122657 106
375 3300026041 Ga0207639_10032844 Ga0207639_100328442 106
376 3300026067 Ga0207678_10055740 Ga0207678_100557405 106
377 3300026116 Ga0207674_10007818 Ga0207674_1000781812 106
378 3300026142 Ga0207698_10711002 Ga0207698_107110022 106
379 3300037312 Ga0395899_0332077 Ga0395899_0332077_591_932 106
380 3300037466 Ga0395898_0364479 Ga0395898_0364479_412_753 106
381 3300037471 Ga0395905_0211258 Ga0395905_0211258_806_1135 106
382 3300037471 Ga0395905_0504935 Ga0395905_0504935_27_368 106
383 3300037471 Ga0395905_0676187 Ga0395905_0676187_85_426 106
384 3300042157 Ga0439458_0124519 Ga0439458_0124519_66_416 106
385 3300050493 nmdc:mga0k408_128530_c1 nmdc:mga0k408_128530_c1_327_710 106
386 3300053083 Ga0495655_0109254 Ga0495655_0109254_34_369 106
387 3300005334 Ga0068869_100404307 Ga0068869_1004043073 107
388 3300005338 Ga0068868_100384664 Ga0068868_1003846643 107
389 3300005339 Ga0070660_100257756 Ga0070660_1002577562 107
390 3300005347 Ga0070668_100188721 Ga0070668_1001887214 107
391 3300005353 Ga0070669_100436851 Ga0070669_1004368513 107
392 3300005354 Ga0070675_101203042 Ga0070675_1012030422 107
393 3300005355 Ga0070671_100177644 Ga0070671_1001776443 107
394 3300005364 Ga0070673_100007743 Ga0070673_1000077438 107
395 3300005366 Ga0070659_100238674 Ga0070659_1002386743 107
396 3300005367 Ga0070667_100007145 Ga0070667_1000071457 107
397 3300005455 Ga0070663_100415200 Ga0070663_1004152002 107
398 3300005539 Ga0068853_100453911 Ga0068853_1004539112 107
399 3300005539 Ga0068853_102255296 Ga0068853_1022552961 107
400 3300005543 Ga0070672_100584461 Ga0070672_1005844612 107
401 3300005548 Ga0070665_100224567 Ga0070665_1002245672 107
402 3300005616 Ga0068852_100413239 Ga0068852_1004132392 107
403 3300005616 Ga0068852_102618875 Ga0068852_1026188751 107
404 3300005617 Ga0068859_100000144 Ga0068859_10000014471 107
405 3300005618 Ga0068864_100000092 Ga0068864_10000009262 107
406 3300005719 Ga0068861_100449001 Ga0068861_1004490012 107
407 3300005841 Ga0068863_100000222 Ga0068863_10000022224 107
408 3300005842 Ga0068858_100000256 Ga0068858_10000025655 107
409 3300005843 Ga0068860_100002571 Ga0068860_1000025717 107
410 3300006237 Ga0097621_100038079 Ga0097621_1000380793 107
411 3300006931 Ga0097620_100000144 Ga0097620_1000001447 107
412 3300009092 Ga0105250_10017542 Ga0105250_100175422 107
413 3300009177 Ga0105248_10000587 Ga0105248_100005875 107
414 3300009553 Ga0105249_10014489 Ga0105249_100144892 107
415 3300013100 Ga0157373_11300240 Ga0157373_113002401 107
416 3300013105 Ga0157369_11929875 Ga0157369_119298751 107
417 3300013306 Ga0163162_10032821 Ga0163162_100328213 107
418 3300014325 Ga0163163_10000080 Ga0163163_1000008060 107
419 3300014969 Ga0157376_11671404 Ga0157376_116714042 107
420 3300014969 Ga0157376_12468328 Ga0157376_124683281 107
421 3300025711 Ga0207696_1082874 Ga0207696_10828743 107
422 3300025900 Ga0207710_10091103 Ga0207710_100911031 107
423 3300025919 Ga0207657_10307826 Ga0207657_103078262 107
424 3300025920 Ga0207649_10217854 Ga0207649_102178542 107
425 3300025923 Ga0207681_10035676 Ga0207681_100356764 107
426 3300025926 Ga0207659_11037616 Ga0207659_110376162 107
427 3300025931 Ga0207644_10032109 Ga0207644_100321093 107
428 3300025932 Ga0207690_10533421 Ga0207690_105334212 107
429 3300025933 Ga0207706_10353086 Ga0207706_103530863 107
430 3300025940 Ga0207691_10843045 Ga0207691_108430452 107
431 3300025941 Ga0207711_10000423 Ga0207711_1000042341 107
432 3300025949 Ga0207667_10763532 Ga0207667_107635322 107
433 3300025949 Ga0207667_11509729 Ga0207667_115097291 107
434 3300025960 Ga0207651_10009499 Ga0207651_100094997 107
435 3300025961 Ga0207712_10194768 Ga0207712_101947683 107
436 3300025972 Ga0207668_10170457 Ga0207668_101704574 107
437 3300025981 Ga0207640_10161362 Ga0207640_101613622 107
438 3300025986 Ga0207658_10006795 Ga0207658_100067958 107
439 3300026023 Ga0207677_10492004 Ga0207677_104920043 107
440 3300026035 Ga0207703_10002144 Ga0207703_1000214413 107
441 3300026041 Ga0207639_10574208 Ga0207639_105742082 107
442 3300026041 Ga0207639_10611762 Ga0207639_106117623 107
443 3300026067 Ga0207678_10994520 Ga0207678_109945202 107
444 3300026088 Ga0207641_10000175 Ga0207641_1000017541 107
445 3300026095 Ga0207676_10000138 Ga0207676_1000013837 107
446 3300026118 Ga0207675_100362894 Ga0207675_1003628943 107
447 3300028379 Ga0268266_11379394 Ga0268266_113793942 107
448 3300028381 Ga0268264_10000932 Ga0268264_1000093210 107
449 3300025981 Ga0207640_10478998 Ga0207640_104789981 108
450 3300042439 Ga0439464_0000045 Ga0439464_0000045_2661_3002 108
451 3300005327 Ga0070658_10275584 Ga0070658_102755842 109
452 3300005328 Ga0070676_10298942 Ga0070676_102989423 109
453 3300005333 Ga0070677_10503708 Ga0070677_105037081 109
454 3300005356 Ga0070674_101743667 Ga0070674_1017436672 109
455 3300005365 Ga0070688_100357696 Ga0070688_1003576962 109
456 3300005457 Ga0070662_100369417 Ga0070662_1003694172 109
457 3300014326 Ga0157380_10164466 Ga0157380_101644662 109
458 3300025901 Ga0207688_10522860 Ga0207688_105228601 109
459 3300025909 Ga0207705_10271330 Ga0207705_102713302 109
460 3300025937 Ga0207669_10570779 Ga0207669_105707791 109
461 3300042157 Ga0439458_0015600 Ga0439458_0015600_837_1205 109
462 3300042438 Ga0439459_0054075 Ga0439459_0054075_65_433 109
463 3300046616 Ga0495668_0161966 Ga0495668_0161966_239_574 109
464 3300046684 Ga0495669_0008488 Ga0495669_0008488_1457_1792 109
465 3300047445 Ga0495677_0281889 Ga0495677_0281889_236_571 109
466 3300048915 Ga0496112_0017301 Ga0496112_0017301_2900_3268 109
467 3300048916 Ga0496113_0042123 Ga0496113_0042123_849_1217 109
468 3300053134 Ga0500658_0000149 Ga0500658_0000149_27615_27950 109
469 3300005327 Ga0070658_11161205 Ga0070658_111612051 110
470 3300005334 Ga0068869_100117695 Ga0068869_1001176953 110
471 3300005343 Ga0070687_101202979 Ga0070687_1012029792 110
472 3300005364 Ga0070673_100677603 Ga0070673_1006776031 110
473 3300005365 Ga0070688_101617766 Ga0070688_1016177661 110
474 3300005366 Ga0070659_101185975 Ga0070659_1011859751 110
475 3300005459 Ga0068867_100073777 Ga0068867_1000737773 110
476 3300005546 Ga0070696_100013815 Ga0070696_1000138158 110
477 3300005578 Ga0068854_100162773 Ga0068854_1001627734 110
478 3300005617 Ga0068859_100841577 Ga0068859_1008415772 110
479 3300006880 Ga0075429_100200592 Ga0075429_1002005922 110
480 3300006931 Ga0097620_100841622 Ga0097620_1008416222 110
481 3300009098 Ga0105245_10358422 Ga0105245_103584223 110
482 3300009148 Ga0105243_11678423 Ga0105243_116784231 110
483 3300009148 Ga0105243_12469514 Ga0105243_124695142 110
484 3300013100 Ga0157373_10014029 Ga0157373_100140294 110
485 3300025903 Ga0207680_10189755 Ga0207680_101897552 110
486 3300025907 Ga0207645_10046711 Ga0207645_100467112 110
487 3300025909 Ga0207705_10173089 Ga0207705_101730893 110
488 3300025918 Ga0207662_10870032 Ga0207662_108700322 110
489 3300025933 Ga0207706_10072809 Ga0207706_100728095 110
490 3300025934 Ga0207686_10280318 Ga0207686_102803182 110
491 3300025942 Ga0207689_10117126 Ga0207689_101171264 110
492 3300025981 Ga0207640_10213037 Ga0207640_102130373 110
493 3300028380 Ga0268265_10868240 Ga0268265_108682402 110
494 3300037418 Ga0395900_0960384 Ga0395900_0960384_274_609 110
495 3300037466 Ga0395898_0230832 Ga0395898_0230832_868_1212 110
496 3300037471 Ga0395905_0047727 Ga0395905_0047727_2816_3160 110
497 3300038443 Ga0395901_1624973 Ga0395901_1624973_128_472 110
498 3300046525 Ga0495663_0095136 Ga0495663_0095136_474_809 110
499 3300046616 Ga0495668_0030101 Ga0495668_0030101_2673_3008 110
500 3300046660 Ga0495625_0143163 Ga0495625_0143163_445_780 110
501 3300046691 Ga0495670_0475555 Ga0495670_0475555_178_513 110
502 3300047445 Ga0495677_0253125 Ga0495677_0253125_97_432 110
503 3300047447 Ga0495685_134930 Ga0495685_134930_446_781 110
504 3300050508 nmdc:mga09592_1001126_c1 nmdc:mga09592_1001126_c1_72_407 110
505 3300050508 nmdc:mga09592_176556_c1 nmdc:mga09592_176556_c1_181_516 110
506 3300005327 Ga0070658_10100941 Ga0070658_101009413 111
507 3300005327 Ga0070658_10628101 Ga0070658_106281011 111
508 3300005334 Ga0068869_100054585 Ga0068869_1000545853 111
509 3300005347 Ga0070668_100100226 Ga0070668_1001002263 111
510 3300005356 Ga0070674_101773166 Ga0070674_1017731661 111
511 3300005366 Ga0070659_100698811 Ga0070659_1006988113 111
512 3300005367 Ga0070667_101287472 Ga0070667_1012874721 111
513 3300005459 Ga0068867_100016338 Ga0068867_1000163382 111
514 3300005539 Ga0068853_100200540 Ga0068853_1002005401 111
515 3300005539 Ga0068853_100216968 Ga0068853_1002169682 111
516 3300005718 Ga0068866_10047459 Ga0068866_100474592 111
517 3300005834 Ga0068851_10001965 Ga0068851_1000196510 111
518 3300005843 Ga0068860_102283797 Ga0068860_1022837972 111
519 3300005844 Ga0068862_100011848 Ga0068862_1000118489 111
520 3300005844 Ga0068862_100740442 Ga0068862_1007404421 111
521 3300006844 Ga0075428_100869631 Ga0075428_1008696311 111
522 3300009176 Ga0105242_10483468 Ga0105242_104834683 111
523 3300009177 Ga0105248_11679374 Ga0105248_116793742 111
524 3300009545 Ga0105237_11002096 Ga0105237_110020962 111
525 3300009551 Ga0105238_11464585 Ga0105238_114645851 111
526 3300009553 Ga0105249_11003102 Ga0105249_110031022 111
527 3300013306 Ga0163162_11547204 Ga0163162_115472042 111
528 3300013306 Ga0163162_11641537 Ga0163162_116415372 111
529 3300025321 Ga0207656_10000430 Ga0207656_1000043010 111
530 3300025899 Ga0207642_10015428 Ga0207642_100154284 111
531 3300025899 Ga0207642_10753735 Ga0207642_107537352 111
532 3300025909 Ga0207705_10529905 Ga0207705_105299051 111
533 3300025911 Ga0207654_10684119 Ga0207654_106841192 111
534 3300025933 Ga0207706_10316647 Ga0207706_103166472 111
535 3300025935 Ga0207709_10284494 Ga0207709_102844942 111
536 3300025945 Ga0207679_11355498 Ga0207679_113554981 111
537 3300025949 Ga0207667_11261798 Ga0207667_112617982 111
538 3300025986 Ga0207658_11287585 Ga0207658_112875852 111
539 3300026041 Ga0207639_10023113 Ga0207639_100231137 111
540 3300026089 Ga0207648_10025288 Ga0207648_100252887 111
541 3300028380 Ga0268265_10001694 Ga0268265_100016948 111
542 3300028380 Ga0268265_11702388 Ga0268265_117023881 111
543 3300031548 Ga0307408_100012567 Ga0307408_1000125674 111
544 3300031548 Ga0307408_101614748 Ga0307408_1016147482 111
545 3300031852 Ga0307410_10005106 Ga0307410_100051067 111
546 3300031903 Ga0307407_10181568 Ga0307407_101815682 111
547 3300031995 Ga0307409_100052196 Ga0307409_1000521965 111
548 3300032004 Ga0307414_11015782 Ga0307414_110157822 111
549 3300037418 Ga0395900_0170157 Ga0395900_0170157_1081_1419 111
550 3300037466 Ga0395898_0226924 Ga0395898_0226924_1046_1384 111
551 3300037471 Ga0395905_0380525 Ga0395905_0380525_680_1063 111
552 3300038443 Ga0395901_0398839 Ga0395901_0398839_224_562 111
553 3300044765 Ga0466970_0149778 Ga0466970_0149778_854_1225 111
554 3300047447 Ga0495685_250863 Ga0495685_250863_140_481 111
555 3300049822 Ga0501035_0436671 Ga0501035_0436671_573_941 111
556 3300001904 JGI24736J21556_1029636 JGI24736J21556_10296361 112
557 3300001976 JGI24752J21851_1050345 JGI24752J21851_10503451 112
558 3300001978 JGI24747J21853_1040286 JGI24747J21853_10402862 112
559 3300001979 JGI24740J21852_10004747 JGI24740J21852_100047477 112
560 3300001989 JGI24739J22299_10002685 JGI24739J22299_100026852 112
561 3300001990 JGI24737J22298_10000665 JGI24737J22298_100006652 112
562 3300002070 JGI24750J21931_1040320 JGI24750J21931_10403202 112
563 3300002073 JGI24745J21846_1015883 JGI24745J21846_10158832 112
564 3300002074 JGI24748J21848_1004476 JGI24748J21848_10044763 112
565 3300002075 JGI24738J21930_10001343 JGI24738J21930_100013432 112
566 3300002126 JGI24035J26624_1005027 JGI24035J26624_10050272 112
567 3300002239 JGI24034J26672_10014574 JGI24034J26672_100145742 112
568 3300005327 Ga0070658_10758230 Ga0070658_107582302 112
569 3300005327 Ga0070658_10831631 Ga0070658_108316312 112
570 3300005328 Ga0070676_10100654 Ga0070676_101006543 112
571 3300005328 Ga0070676_10656459 Ga0070676_106564592 112
572 3300005330 Ga0070690_100067604 Ga0070690_1000676044 112
573 3300005330 Ga0070690_100192390 Ga0070690_1001923902 112
574 3300005331 Ga0070670_100016013 Ga0070670_1000160137 112
575 3300005331 Ga0070670_100276616 Ga0070670_1002766163 112
576 3300005331 Ga0070670_100393872 Ga0070670_1003938722 112
577 3300005331 Ga0070670_100531636 Ga0070670_1005316363 112
578 3300005334 Ga0068869_100000297 Ga0068869_10000029711 112
579 3300005335 Ga0070666_10034332 Ga0070666_100343325 112
580 3300005335 Ga0070666_11481040 Ga0070666_114810402 112
581 3300005336 Ga0070680_100795325 Ga0070680_1007953252 112
582 3300005336 Ga0070680_101871913 Ga0070680_1018719131 112
583 3300005337 Ga0070682_100608762 Ga0070682_1006087622 112
584 3300005338 Ga0068868_100002601 Ga0068868_1000026015 112
585 3300005338 Ga0068868_100274741 Ga0068868_1002747412 112
586 3300005338 Ga0068868_100984180 Ga0068868_1009841801 112
587 3300005339 Ga0070660_100005787 Ga0070660_1000057879 112
588 3300005339 Ga0070660_100011191 Ga0070660_1000111911 112
589 3300005339 Ga0070660_100017159 Ga0070660_1000171597 112
590 3300005339 Ga0070660_100090116 Ga0070660_1000901164 112
591 3300005340 Ga0070689_100025030 Ga0070689_1000250302 112
592 3300005343 Ga0070687_101115210 Ga0070687_1011152101 112
593 3300005344 Ga0070661_100028731 Ga0070661_1000287315 112
594 3300005344 Ga0070661_100155087 Ga0070661_1001550872 112
595 3300005344 Ga0070661_100183281 Ga0070661_1001832813 112
596 3300005347 Ga0070668_100000628 Ga0070668_10000062810 112
597 3300005347 Ga0070668_100025282 Ga0070668_1000252822 112
598 3300005353 Ga0070669_100003201 Ga0070669_1000032013 112
599 3300005353 Ga0070669_100043327 Ga0070669_1000433272 112
600 3300005354 Ga0070675_100027138 Ga0070675_1000271382 112
601 3300005355 Ga0070671_100008491 Ga0070671_1000084919 112
602 3300005355 Ga0070671_100036772 Ga0070671_1000367722 112
603 3300005355 Ga0070671_100076109 Ga0070671_1000761094 112
604 3300005355 Ga0070671_100106549 Ga0070671_1001065493 112
605 3300005355 Ga0070671_100379729 Ga0070671_1003797291 112
606 3300005355 Ga0070671_100535747 Ga0070671_1005357473 112
607 3300005356 Ga0070674_100195035 Ga0070674_1001950352 112
608 3300005364 Ga0070673_100000044 Ga0070673_10000004429 112
609 3300005364 Ga0070673_100400084 Ga0070673_1004000841 112
610 3300005364 Ga0070673_100593718 Ga0070673_1005937182 112
611 3300005364 Ga0070673_100753269 Ga0070673_1007532692 112
612 3300005366 Ga0070659_100000849 Ga0070659_10000084913 112
613 3300005366 Ga0070659_100044812 Ga0070659_1000448122 112
614 3300005366 Ga0070659_100227216 Ga0070659_1002272162 112
615 3300005366 Ga0070659_100347573 Ga0070659_1003475732 112
616 3300005367 Ga0070667_100022649 Ga0070667_1000226497 112
617 3300005367 Ga0070667_100543024 Ga0070667_1005430242 112
618 3300005367 Ga0070667_100837386 Ga0070667_1008373862 112
619 3300005367 Ga0070667_101353338 Ga0070667_1013533382 112
620 3300005455 Ga0070663_100155876 Ga0070663_1001558763 112
621 3300005455 Ga0070663_100321820 Ga0070663_1003218202 112
622 3300005455 Ga0070663_100743307 Ga0070663_1007433072 112
623 3300005455 Ga0070663_101292015 Ga0070663_1012920151 112
624 3300005456 Ga0070678_100103020 Ga0070678_1001030202 112
625 3300005456 Ga0070678_100178388 Ga0070678_1001783882 112
626 3300005457 Ga0070662_100026020 Ga0070662_1000260205 112
627 3300005457 Ga0070662_100468414 Ga0070662_1004684142 112
628 3300005457 Ga0070662_100680072 Ga0070662_1006800722 112
629 3300005459 Ga0068867_100006552 Ga0068867_1000065522 112
630 3300005459 Ga0068867_100021116 Ga0068867_1000211167 112
631 3300005459 Ga0068867_100415925 Ga0068867_1004159253 112
632 3300005466 Ga0070685_10833814 Ga0070685_108338142 112
633 3300005530 Ga0070679_100276328 Ga0070679_1002763283 112
634 3300005530 Ga0070679_100713441 Ga0070679_1007134411 112
635 3300005539 Ga0068853_100017061 Ga0068853_1000170617 112
636 3300005543 Ga0070672_100001174 Ga0070672_10000117414 112
637 3300005543 Ga0070672_100164156 Ga0070672_1001641563 112
638 3300005543 Ga0070672_100406974 Ga0070672_1004069743 112
639 3300005543 Ga0070672_101332553 Ga0070672_1013325532 112
640 3300005543 Ga0070672_101608646 Ga0070672_1016086462 112
641 3300005563 Ga0068855_100005808 Ga0068855_10000580815 112
642 3300005563 Ga0068855_101420276 Ga0068855_1014202762 112
643 3300005564 Ga0070664_100024270 Ga0070664_1000242707 112
644 3300005564 Ga0070664_100103382 Ga0070664_1001033822 112
645 3300005564 Ga0070664_100391516 Ga0070664_1003915161 112
646 3300005564 Ga0070664_101713614 Ga0070664_1017136141 112
647 3300005577 Ga0068857_100060082 Ga0068857_1000600822 112
648 3300005577 Ga0068857_100218169 Ga0068857_1002181692 112
649 3300005578 Ga0068854_100000934 Ga0068854_10000093411 112
650 3300005578 Ga0068854_100024434 Ga0068854_1000244345 112
651 3300005614 Ga0068856_100738998 Ga0068856_1007389982 112
652 3300005615 Ga0070702_100155568 Ga0070702_1001555682 112
653 3300005616 Ga0068852_100015762 Ga0068852_1000157622 112
654 3300005616 Ga0068852_100027422 Ga0068852_1000274223 112
655 3300005616 Ga0068852_100029603 Ga0068852_1000296033 112
656 3300005616 Ga0068852_100334681 Ga0068852_1003346812 112
657 3300005617 Ga0068859_100000799 Ga0068859_10000079911 112
658 3300005617 Ga0068859_100366149 Ga0068859_1003661492 112
659 3300005617 Ga0068859_100947068 Ga0068859_1009470682 112
660 3300005617 Ga0068859_102418835 Ga0068859_1024188352 112
661 3300005618 Ga0068864_100000552 Ga0068864_10000055221 112
662 3300005618 Ga0068864_100460892 Ga0068864_1004608923 112
663 3300005718 Ga0068866_10146270 Ga0068866_101462702 112
664 3300005718 Ga0068866_10598727 Ga0068866_105987272 112
665 3300005719 Ga0068861_100014258 Ga0068861_1000142582 112
666 3300005834 Ga0068851_10122159 Ga0068851_101221592 112
667 3300005834 Ga0068851_10467128 Ga0068851_104671282 112
668 3300005840 Ga0068870_10163063 Ga0068870_101630632 112
669 3300005841 Ga0068863_100020497 Ga0068863_1000204972 112
670 3300005841 Ga0068863_100176435 Ga0068863_1001764352 112
671 3300005842 Ga0068858_100026167 Ga0068858_1000261673 112
672 3300005842 Ga0068858_100045258 Ga0068858_1000452582 112
673 3300005843 Ga0068860_100007543 Ga0068860_1000075439 112
674 3300005843 Ga0068860_100058030 Ga0068860_1000580306 112
675 3300005843 Ga0068860_100315968 Ga0068860_1003159684 112
676 3300005844 Ga0068862_100146291 Ga0068862_1001462913 112
677 3300005844 Ga0068862_100430889 Ga0068862_1004308892 112
678 3300005844 Ga0068862_100446903 Ga0068862_1004469032 112
679 3300005844 Ga0068862_100502434 Ga0068862_1005024342 112
680 3300006163 Ga0070715_10722889 Ga0070715_107228892 112
681 3300006237 Ga0097621_100073583 Ga0097621_1000735833 112
682 3300006237 Ga0097621_100724886 Ga0097621_1007248862 112
683 3300006237 Ga0097621_101564106 Ga0097621_1015641061 112
684 3300006358 Ga0068871_100390025 Ga0068871_1003900252 112
685 3300006881 Ga0068865_100000440 Ga0068865_10000044015 112
686 3300006881 Ga0068865_100013435 Ga0068865_1000134356 112
687 3300006881 Ga0068865_100216099 Ga0068865_1002160992 112
688 3300006931 Ga0097620_100000799 Ga0097620_10000079926 112
689 3300006931 Ga0097620_100366171 Ga0097620_1003661712 112
690 3300006931 Ga0097620_100947061 Ga0097620_1009470612 112
691 3300006931 Ga0097620_102418381 Ga0097620_1024183812 112
692 3300009098 Ga0105245_10000709 Ga0105245_1000070912 112
693 3300009101 Ga0105247_10138621 Ga0105247_101386212 112
694 3300009148 Ga0105243_10025801 Ga0105243_100258015 112
695 3300009148 Ga0105243_11491130 Ga0105243_114911302 112
696 3300009174 Ga0105241_10264393 Ga0105241_102643932 112
697 3300009176 Ga0105242_10284148 Ga0105242_102841482 112
698 3300009177 Ga0105248_10000122 Ga0105248_1000012293 112
699 3300009177 Ga0105248_10061772 Ga0105248_100617723 112
700 3300009177 Ga0105248_10267318 Ga0105248_102673183 112
701 3300009177 Ga0105248_10610973 Ga0105248_106109732 112
702 3300009177 Ga0105248_10869471 Ga0105248_108694712 112
703 3300009177 Ga0105248_12026483 Ga0105248_120264832 112
704 3300011119 Ga0105246_10057757 Ga0105246_100577573 112
705 3300012510 Ga0157316_1052877 Ga0157316_10528771 112
706 3300013100 Ga0157373_10004213 Ga0157373_1000421311 112
707 3300013100 Ga0157373_10054170 Ga0157373_100541702 112
708 3300013102 Ga0157371_10004494 Ga0157371_100044942 112
709 3300013102 Ga0157371_11175777 Ga0157371_111757771 112
710 3300013104 Ga0157370_10073909 Ga0157370_100739092 112
711 3300013296 Ga0157374_10167199 Ga0157374_101671993 112
712 3300013296 Ga0157374_12697182 Ga0157374_126971822 112
713 3300013297 Ga0157378_10135845 Ga0157378_101358453 112
714 3300013297 Ga0157378_10210566 Ga0157378_102105662 112
715 3300013306 Ga0163162_10027500 Ga0163162_100275006 112
716 3300013306 Ga0163162_10190474 Ga0163162_101904742 112
717 3300013306 Ga0163162_10451804 Ga0163162_104518043 112
718 3300013307 Ga0157372_10669999 Ga0157372_106699993 112
719 3300013308 Ga0157375_10039226 Ga0157375_100392265 112
720 3300013308 Ga0157375_10045756 Ga0157375_100457562 112
721 3300013308 Ga0157375_10255336 Ga0157375_102553362 112
722 3300013308 Ga0157375_12371332 Ga0157375_123713322 112
723 3300014325 Ga0163163_12445992 Ga0163163_124459922 112
724 3300014497 Ga0182008_10309807 Ga0182008_103098072 112
725 3300014745 Ga0157377_10077311 Ga0157377_100773112 112
726 3300014969 Ga0157376_12621779 Ga0157376_126217792 112
727 3300025290 Ga0207673_1004407 Ga0207673_10044071 112
728 3300025315 Ga0207697_10000142 Ga0207697_100001428 112
729 3300025321 Ga0207656_10059770 Ga0207656_100597702 112
730 3300025899 Ga0207642_10228971 Ga0207642_102289712 112
731 3300025900 Ga0207710_10083747 Ga0207710_100837473 112
732 3300025901 Ga0207688_10002307 Ga0207688_100023072 112
733 3300025901 Ga0207688_10012721 Ga0207688_100127211 112
734 3300025903 Ga0207680_10013945 Ga0207680_100139455 112
735 3300025903 Ga0207680_10182224 Ga0207680_101822242 112
736 3300025903 Ga0207680_11146132 Ga0207680_111461321 112
737 3300025904 Ga0207647_10007744 Ga0207647_100077448 112
738 3300025907 Ga0207645_10014275 Ga0207645_100142757 112
739 3300025907 Ga0207645_10061366 Ga0207645_100613661 112
740 3300025907 Ga0207645_10134072 Ga0207645_101340723 112
741 3300025908 Ga0207643_10175118 Ga0207643_101751182 112
742 3300025909 Ga0207705_10011251 Ga0207705_100112512 112
743 3300025909 Ga0207705_10013901 Ga0207705_100139014 112
744 3300025909 Ga0207705_10018288 Ga0207705_100182884 112
745 3300025909 Ga0207705_10795515 Ga0207705_107955152 112
746 3300025911 Ga0207654_10380590 Ga0207654_103805902 112
747 3300025917 Ga0207660_10615752 Ga0207660_106157522 112
748 3300025919 Ga0207657_10007043 Ga0207657_100070432 112
749 3300025919 Ga0207657_10046598 Ga0207657_100465982 112
750 3300025919 Ga0207657_10165805 Ga0207657_101658053 112
751 3300025920 Ga0207649_10013587 Ga0207649_100135874 112
752 3300025920 Ga0207649_10114267 Ga0207649_101142673 112
753 3300025920 Ga0207649_10255863 Ga0207649_102558632 112
754 3300025921 Ga0207652_10293309 Ga0207652_102933093 112
755 3300025921 Ga0207652_10453817 Ga0207652_104538172 112
756 3300025923 Ga0207681_10000532 Ga0207681_1000053211 112
757 3300025923 Ga0207681_10051093 Ga0207681_100510932 112
758 3300025925 Ga0207650_10034920 Ga0207650_100349202 112
759 3300025925 Ga0207650_10110113 Ga0207650_101101132 112
760 3300025925 Ga0207650_10190082 Ga0207650_101900823 112
761 3300025925 Ga0207650_10545910 Ga0207650_105459102 112
762 3300025926 Ga0207659_10067887 Ga0207659_100678872 112
763 3300025927 Ga0207687_10006315 Ga0207687_100063157 112
764 3300025931 Ga0207644_10065496 Ga0207644_100654962 112
765 3300025931 Ga0207644_10194747 Ga0207644_101947472 112
766 3300025931 Ga0207644_10247038 Ga0207644_102470382 112
767 3300025931 Ga0207644_10486312 Ga0207644_104863122 112
768 3300025931 Ga0207644_10750920 Ga0207644_107509202 112
769 3300025931 Ga0207644_11719429 Ga0207644_117194291 112
770 3300025932 Ga0207690_10006450 Ga0207690_100064507 112
771 3300025932 Ga0207690_10127674 Ga0207690_101276743 112
772 3300025932 Ga0207690_10614012 Ga0207690_106140122 112
773 3300025933 Ga0207706_10003910 Ga0207706_100039102 112
774 3300025933 Ga0207706_10317742 Ga0207706_103177423 112
775 3300025933 Ga0207706_10531064 Ga0207706_105310642 112
776 3300025934 Ga0207686_10094527 Ga0207686_100945273 112
777 3300025935 Ga0207709_10062525 Ga0207709_100625252 112
778 3300025935 Ga0207709_10861303 Ga0207709_108613032 112
779 3300025936 Ga0207670_10012456 Ga0207670_100124565 112
780 3300025937 Ga0207669_10046809 Ga0207669_100468094 112
781 3300025937 Ga0207669_10065729 Ga0207669_100657293 112
782 3300025938 Ga0207704_10003358 Ga0207704_100033586 112
783 3300025938 Ga0207704_10340408 Ga0207704_103404083 112
784 3300025938 Ga0207704_10428717 Ga0207704_104287173 112
785 3300025940 Ga0207691_10001210 Ga0207691_1000121025 112
786 3300025940 Ga0207691_10049185 Ga0207691_100491852 112
787 3300025940 Ga0207691_10281570 Ga0207691_102815702 112
788 3300025941 Ga0207711_10035624 Ga0207711_100356246 112
789 3300025941 Ga0207711_10056610 Ga0207711_100566102 112
790 3300025941 Ga0207711_10073390 Ga0207711_100733902 112
791 3300025941 Ga0207711_10509561 Ga0207711_105095612 112
792 3300025942 Ga0207689_10000125 Ga0207689_1000012535 112
793 3300025942 Ga0207689_10150347 Ga0207689_101503473 112
794 3300025945 Ga0207679_10454422 Ga0207679_104544222 112
795 3300025945 Ga0207679_10939438 Ga0207679_109394382 112
796 3300025945 Ga0207679_11502907 Ga0207679_115029071 112
797 3300025949 Ga0207667_10040158 Ga0207667_100401581 112
798 3300025949 Ga0207667_11631274 Ga0207667_116312741 112
799 3300025960 Ga0207651_10047051 Ga0207651_100470513 112
800 3300025960 Ga0207651_10347742 Ga0207651_103477423 112
801 3300025960 Ga0207651_10955853 Ga0207651_109558532 112
802 3300025972 Ga0207668_10000689 Ga0207668_1000068922 112
803 3300025972 Ga0207668_10021174 Ga0207668_100211744 112
804 3300025972 Ga0207668_10413662 Ga0207668_104136622 112
805 3300025981 Ga0207640_10003384 Ga0207640_100033847 112
806 3300025981 Ga0207640_10321577 Ga0207640_103215773 112
807 3300025986 Ga0207658_10087229 Ga0207658_100872295 112
808 3300025986 Ga0207658_10241774 Ga0207658_102417743 112
809 3300025986 Ga0207658_10262662 Ga0207658_102626622 112
810 3300026023 Ga0207677_10003680 Ga0207677_100036805 112
811 3300026035 Ga0207703_10008974 Ga0207703_100089748 112
812 3300026035 Ga0207703_10076090 Ga0207703_100760902 112
813 3300026041 Ga0207639_10016831 Ga0207639_100168313 112
814 3300026041 Ga0207639_11703221 Ga0207639_117032211 112
815 3300026067 Ga0207678_10038015 Ga0207678_100380152 112
816 3300026067 Ga0207678_10386659 Ga0207678_103866592 112
817 3300026078 Ga0207702_10203575 Ga0207702_102035753 112
818 3300026078 Ga0207702_10457578 Ga0207702_104575781 112
819 3300026088 Ga0207641_10018525 Ga0207641_100185254 112
820 3300026088 Ga0207641_10452385 Ga0207641_104523852 112
821 3300026088 Ga0207641_10557419 Ga0207641_105574193 112
822 3300026089 Ga0207648_10001391 Ga0207648_100013912 112
823 3300026089 Ga0207648_10081154 Ga0207648_100811544 112
824 3300026095 Ga0207676_10001788 Ga0207676_100017888 112
825 3300026095 Ga0207676_10124656 Ga0207676_101246562 112
826 3300026116 Ga0207674_10003049 Ga0207674_100030492 112
827 3300026116 Ga0207674_10163297 Ga0207674_101632973 112
828 3300026118 Ga0207675_100013635 Ga0207675_1000136359 112
829 3300026121 Ga0207683_10012589 Ga0207683_100125895 112
830 3300026121 Ga0207683_10028509 Ga0207683_100285096 112
831 3300026142 Ga0207698_10001521 Ga0207698_1000152111 112
832 3300026142 Ga0207698_10033159 Ga0207698_100331593 112
833 3300026142 Ga0207698_10151200 Ga0207698_101512004 112
834 3300026142 Ga0207698_10235449 Ga0207698_102354492 112
835 3300028380 Ga0268265_10033660 Ga0268265_100336604 112
836 3300028380 Ga0268265_10104777 Ga0268265_101047772 112
837 3300028380 Ga0268265_10426584 Ga0268265_104265842 112
838 3300028381 Ga0268264_10016085 Ga0268264_100160853 112
839 3300028381 Ga0268264_10016864 Ga0268264_100168644 112
840 3300028381 Ga0268264_10411083 Ga0268264_104110832 112
841 3300028381 Ga0268264_11501681 Ga0268264_115016812 112
842 3300031548 Ga0307408_100545608 Ga0307408_1005456082 112
843 3300031731 Ga0307405_10692074 Ga0307405_106920742 112
844 3300031901 Ga0307406_11192029 Ga0307406_111920292 112
845 3300032002 Ga0307416_100352831 Ga0307416_1003528313 112
846 3300032126 Ga0307415_100000440 Ga0307415_10000044014 112
847 3300035111 Ga0373923_0019190 Ga0373923_0019190_919_1287 112
848 3300035118 Ga0373954_0059966 Ga0373954_0059966_958_1326 112
849 3300035119 Ga0373956_0408190 Ga0373956_0408190_191_559 112
850 3300035172 Ga0373955_0056091 Ga0373955_0056091_751_1119 112
851 3300035691 Ga0373931_0245625 Ga0373931_0245625_560_901 112
852 3300035692 Ga0373935_0189257 Ga0373935_0189257_106_474 112
853 3300035724 Ga0373933_0135704 Ga0373933_0135704_833_1201 112
854 3300036401 Ga0373937_0015554 Ga0373937_0015554_6178_6546 112
855 3300037312 Ga0395899_0066576 Ga0395899_0066576_1494_1835 112
856 3300037418 Ga0395900_0031705 Ga0395900_0031705_874_1242 112
857 3300037418 Ga0395900_0052525 Ga0395900_0052525_1123_1464 112
858 3300037418 Ga0395900_0227779 Ga0395900_0227779_712_1080 112
859 3300037466 Ga0395898_0241709 Ga0395898_0241709_444_812 112
860 3300037466 Ga0395898_1696302 Ga0395898_1696302_65_433 112
861 3300037466 Ga0395898_1940600 Ga0395898_1940600_107_448 112
862 3300037471 Ga0395905_0000756 Ga0395905_0000756_7237_7605 112
863 3300037471 Ga0395905_0018156 Ga0395905_0018156_1393_1761 112
864 3300037471 Ga0395905_0037822 Ga0395905_0037822_3402_3743 112
865 3300037471 Ga0395905_0250996 Ga0395905_0250996_239_580 112
866 3300037471 Ga0395905_0335112 Ga0395905_0335112_312_659 112
867 3300037471 Ga0395905_0364627 Ga0395905_0364627_459_827 112
868 3300037471 Ga0395905_0656037 Ga0395905_0656037_377_745 112
869 3300037471 Ga0395905_1428332 Ga0395905_1428332_121_462 112
870 3300038443 Ga0395901_0012260 Ga0395901_0012260_549_917 112
871 3300038443 Ga0395901_0031705 Ga0395901_0031705_572_913 112
872 3300038443 Ga0395901_0829031 Ga0395901_0829031_144_512 112
873 3300044694 Ga0466963_0212673 Ga0466963_0212673_386_754 112
874 3300045051 Ga0451576_1836259 Ga0451576_1836259_116_457 112
875 3300046684 Ga0495669_0010742 Ga0495669_0010742_645_986 112
876 3300046684 Ga0495669_0314378 Ga0495669_0314378_267_608 112
877 3300047445 Ga0495677_0078560 Ga0495677_0078560_476_844 112
878 3300048088 Ga0495602_0045724 Ga0495602_0045724_3500_3868 112
879 3300048903 Ga0496100_0402018 Ga0496100_0402018_384_725 112
880 3300048903 Ga0496100_0679033 Ga0496100_0679033_374_745 112
881 3300048904 Ga0496101_0428226 Ga0496101_0428226_319_660 112
882 3300048906 Ga0496103_0220741 Ga0496103_0220741_299_670 112
883 3300048908 Ga0496105_0097313 Ga0496105_0097313_429_800 112
884 3300048909 Ga0496106_0575379 Ga0496106_0575379_47_418 112
885 3300048910 Ga0496107_0183241 Ga0496107_0183241_353_697 112
886 3300048911 Ga0496108_0062546 Ga0496108_0062546_1759_2130 112
887 3300048912 Ga0496109_0264122 Ga0496109_0264122_50_421 112
888 3300048912 Ga0496109_1934013 Ga0496109_1934013_149_490 112
889 3300048913 Ga0496110_0406966 Ga0496110_0406966_144_515 112
890 3300048914 Ga0496111_0100321 Ga0496111_0100321_1227_1598 112
891 3300048915 Ga0496112_0033735 Ga0496112_0033735_3962_4303 112
892 3300048915 Ga0496112_0196154 Ga0496112_0196154_761_1132 112
893 3300048916 Ga0496113_0065433 Ga0496113_0065433_2299_2670 112
894 3300048917 Ga0496114_0034740 Ga0496114_0034740_3206_3547 112
895 3300048918 Ga0496115_0001505 Ga0496115_0001505_6849_7190 112

Feature Viewer

pLDDT pTM Quality
68.97 0.31 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map