F484980
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 895 | 256 | 895 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300025931|Ga0207644_10750920|Ga0207644_107509202 |
| Length | 127 |
| Sequence | MFGVDSTEFVIVAVLALVFIGPKDLPKVMRTIGYWVGRMRGMARHFTAGIENMVREAELEEMEKRWREENERIMRLHPANADYPETGKPDEMPPIVEPPPAETAELSLPFDESQPEDSLPPEKRPLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 214 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 215 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 250 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 252 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 256 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.56 |
| Nodule | 0 |
| Rhizoplane | 3.91 |
| Rhizosphere | 95.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1029636 | 3300001904 | Bacteria | 846 |
| 2 | JGI24741J21665_1008768 | 3300001915 | Bacteria | 1892 |
| 3 | JGI24752J21851_1050345 | 3300001976 | Bacteria | 566 |
| 4 | JGI24746J21847_1006385 | 3300001977 | Bacteria | 1828 |
| 5 | JGI24747J21853_1002022 | 3300001978 | Bacteria | 1600 |
| 6 | JGI24747J21853_1040286 | 3300001978 | Bacteria | 553 |
| 7 | JGI24740J21852_10004747 | 3300001979 | Bacteria | 5807 |
| 8 | JGI24740J21852_10007981 | 3300001979 | Bacteria | 4258 |
| 9 | JGI24739J22299_10002685 | 3300001989 | Bacteria | 6849 |
| 10 | JGI24739J22299_10028590 | 3300001989 | Bacteria | 1944 |
| 11 | JGI24739J22299_10029992 | 3300001989 | Bacteria | 1887 |
| 12 | JGI24737J22298_10000665 | 3300001990 | Bacteria | 12142 |
| 13 | JGI24737J22298_10006005 | 3300001990 | Bacteria | 4169 |
| 14 | JGI24743J22301_10006940 | 3300001991 | Bacteria | 1949 |
| 15 | JGI24735J21928_10009940 | 3300002067 | Bacteria | 3046 |
| 16 | JGI24735J21928_10024361 | 3300002067 | Bacteria | 1832 |
| 17 | JGI24735J21928_10032381 | 3300002067 | Bacteria | 1548 |
| 18 | JGI24750J21931_1040320 | 3300002070 | Bacteria | 708 |
| 19 | JGI24745J21846_1000475 | 3300002073 | Bacteria | 3563 |
| 20 | JGI24745J21846_1015883 | 3300002073 | Bacteria | 872 |
| 21 | JGI24748J21848_1004476 | 3300002074 | Bacteria | 1607 |
| 22 | JGI24738J21930_10001343 | 3300002075 | Bacteria | 6826 |
| 23 | JGI24738J21930_10003652 | 3300002075 | Bacteria | 3854 |
| 24 | JGI24744J21845_10000507 | 3300002077 | Bacteria | 6932 |
| 25 | JGI24035J26624_1005027 | 3300002126 | Bacteria | 1260 |
| 26 | JGI24034J26672_10014574 | 3300002239 | Bacteria | 1200 |
| 27 | JGI24742J22300_10004609 | 3300002244 | Bacteria | 2261 |
| 28 | Ga0070658_10099856 | 3300005327 | Bacteria | 2398 |
| 29 | Ga0070658_10100941 | 3300005327 | Bacteria | 2385 |
| 30 | Ga0070658_10140143 | 3300005327 | Bacteria | 2020 |
| 31 | Ga0070658_10191926 | 3300005327 | Bacteria | 1722 |
| 32 | Ga0070658_10275584 | 3300005327 | Bacteria | 1431 |
| 33 | Ga0070658_10372701 | 3300005327 | Bacteria | 1224 |
| 34 | Ga0070658_10396316 | 3300005327 | Bacteria | 1185 |
| 35 | Ga0070658_10628101 | 3300005327 | Bacteria | 932 |
| 36 | Ga0070658_10758230 | 3300005327 | Bacteria | 843 |
| 37 | Ga0070658_10760310 | 3300005327 | Bacteria | 841 |
| 38 | Ga0070658_10831631 | 3300005327 | Bacteria | 802 |
| 39 | Ga0070658_11161205 | 3300005327 | Bacteria | 671 |
| 40 | Ga0070676_10100654 | 3300005328 | Bacteria | 1784 |
| 41 | Ga0070676_10298942 | 3300005328 | Bacteria | 1090 |
| 42 | Ga0070676_10656459 | 3300005328 | Bacteria | 762 |
| 43 | Ga0070683_100010266 | 3300005329 | Bacteria | 8049 |
| 44 | Ga0070683_100095414 | 3300005329 | Bacteria | 2796 |
| 45 | Ga0070683_101835262 | 3300005329 | Bacteria | 583 |
| 46 | Ga0070690_100067604 | 3300005330 | Bacteria | 2315 |
| 47 | Ga0070690_100192390 | 3300005330 | Bacteria | 1415 |
| 48 | Ga0070670_100016013 | 3300005331 | Bacteria | 6435 |
| 49 | Ga0070670_100069930 | 3300005331 | Bacteria | 3013 |
| 50 | Ga0070670_100276616 | 3300005331 | Bacteria | 1466 |
| 51 | Ga0070670_100393872 | 3300005331 | Bacteria | 1222 |
| 52 | Ga0070670_100531636 | 3300005331 | Bacteria | 1048 |
| 53 | Ga0070670_101012071 | 3300005331 | Bacteria | 756 |
| 54 | Ga0070677_10503708 | 3300005333 | Bacteria | 657 |
| 55 | Ga0068869_100000297 | 3300005334 | Bacteria | 26449 |
| 56 | Ga0068869_100054585 | 3300005334 | Bacteria | 2909 |
| 57 | Ga0068869_100117695 | 3300005334 | Bacteria | 2028 |
| 58 | Ga0068869_100404307 | 3300005334 | Bacteria | 1124 |
| 59 | Ga0070666_10034332 | 3300005335 | Bacteria | 3362 |
| 60 | Ga0070666_11481040 | 3300005335 | Bacteria | 508 |
| 61 | Ga0070680_100049943 | 3300005336 | Bacteria | 3411 |
| 62 | Ga0070680_100226528 | 3300005336 | Bacteria | 1578 |
| 63 | Ga0070680_100511634 | 3300005336 | Bacteria | 1028 |
| 64 | Ga0070680_100795325 | 3300005336 | Bacteria | 815 |
| 65 | Ga0070680_101871913 | 3300005336 | Bacteria | 520 |
| 66 | Ga0070682_100080848 | 3300005337 | Bacteria | 2103 |
| 67 | Ga0070682_100205713 | 3300005337 | Bacteria | 1392 |
| 68 | Ga0070682_100608762 | 3300005337 | Bacteria | 864 |
| 69 | Ga0068868_100002601 | 3300005338 | Bacteria | 12510 |
| 70 | Ga0068868_100159778 | 3300005338 | Bacteria | 1860 |
| 71 | Ga0068868_100274741 | 3300005338 | Bacteria | 1424 |
| 72 | Ga0068868_100384664 | 3300005338 | Bacteria | 1208 |
| 73 | Ga0068868_100704723 | 3300005338 | Bacteria | 903 |
| 74 | Ga0068868_100984180 | 3300005338 | Bacteria | 771 |
| 75 | Ga0068868_101184176 | 3300005338 | Bacteria | 706 |
| 76 | Ga0070660_100005787 | 3300005339 | Bacteria | 8562 |
| 77 | Ga0070660_100011191 | 3300005339 | Bacteria | 6367 |
| 78 | Ga0070660_100017159 | 3300005339 | Bacteria | 5272 |
| 79 | Ga0070660_100023819 | 3300005339 | Bacteria | 4538 |
| 80 | Ga0070660_100046275 | 3300005339 | Bacteria | 3334 |
| 81 | Ga0070660_100071720 | 3300005339 | Bacteria | 2705 |
| 82 | Ga0070660_100090116 | 3300005339 | Bacteria | 2417 |
| 83 | Ga0070660_100257756 | 3300005339 | Bacteria | 1423 |
| 84 | Ga0070660_100409086 | 3300005339 | Bacteria | 1122 |
| 85 | Ga0070660_100503587 | 3300005339 | Bacteria | 1007 |
| 86 | Ga0070660_101697709 | 3300005339 | Bacteria | 538 |
| 87 | Ga0070689_100025030 | 3300005340 | Bacteria | 4482 |
| 88 | Ga0070691_10096919 | 3300005341 | Bacteria | 1461 |
| 89 | Ga0070687_101115210 | 3300005343 | Bacteria | 578 |
| 90 | Ga0070687_101202979 | 3300005343 | Bacteria | 559 |
| 91 | Ga0070661_100028731 | 3300005344 | Bacteria | 4012 |
| 92 | Ga0070661_100042451 | 3300005344 | Bacteria | 3319 |
| 93 | Ga0070661_100081906 | 3300005344 | Bacteria | 2383 |
| 94 | Ga0070661_100086650 | 3300005344 | Bacteria | 2316 |
| 95 | Ga0070661_100116791 | 3300005344 | Bacteria | 1996 |
| 96 | Ga0070661_100155087 | 3300005344 | Bacteria | 1733 |
| 97 | Ga0070661_100183281 | 3300005344 | Bacteria | 1594 |
| 98 | Ga0070661_100448942 | 3300005344 | Bacteria | 1026 |
| 99 | Ga0070692_10065069 | 3300005345 | Bacteria | 1930 |
| 100 | Ga0070668_100000628 | 3300005347 | Bacteria | 23738 |
| 101 | Ga0070668_100025282 | 3300005347 | Bacteria | 4501 |
| 102 | Ga0070668_100100226 | 3300005347 | Bacteria | 2294 |
| 103 | Ga0070668_100188721 | 3300005347 | Bacteria | 1687 |
| 104 | Ga0070668_100519953 | 3300005347 | Bacteria | 1032 |
| 105 | Ga0070668_101468519 | 3300005347 | Bacteria | 623 |
| 106 | Ga0070669_100003201 | 3300005353 | Bacteria | 11764 |
| 107 | Ga0070669_100043327 | 3300005353 | Bacteria | 3277 |
| 108 | Ga0070669_100116249 | 3300005353 | Bacteria | 2035 |
| 109 | Ga0070669_100212017 | 3300005353 | Bacteria | 1528 |
| 110 | Ga0070669_100357114 | 3300005353 | Bacteria | 1187 |
| 111 | Ga0070669_100436851 | 3300005353 | Bacteria | 1077 |
| 112 | Ga0070669_100480643 | 3300005353 | Bacteria | 1028 |
| 113 | Ga0070675_100027138 | 3300005354 | Bacteria | 4599 |
| 114 | Ga0070675_100272924 | 3300005354 | Bacteria | 1484 |
| 115 | Ga0070675_101203042 | 3300005354 | Bacteria | 698 |
| 116 | Ga0070675_101875087 | 3300005354 | Bacteria | 553 |
| 117 | Ga0070671_100008491 | 3300005355 | Bacteria | 8232 |
| 118 | Ga0070671_100036772 | 3300005355 | Bacteria | 4060 |
| 119 | Ga0070671_100072474 | 3300005355 | Bacteria | 2876 |
| 120 | Ga0070671_100076109 | 3300005355 | Bacteria | 2804 |
| 121 | Ga0070671_100106549 | 3300005355 | Bacteria | 2353 |
| 122 | Ga0070671_100177644 | 3300005355 | Bacteria | 1802 |
| 123 | Ga0070671_100253062 | 3300005355 | Bacteria | 1496 |
| 124 | Ga0070671_100379729 | 3300005355 | Bacteria | 1208 |
| 125 | Ga0070671_100535747 | 3300005355 | Bacteria | 1009 |
| 126 | Ga0070674_100061418 | 3300005356 | Bacteria | 2622 |
| 127 | Ga0070674_100195035 | 3300005356 | Bacteria | 1560 |
| 128 | Ga0070674_101743667 | 3300005356 | Bacteria | 564 |
| 129 | Ga0070674_101773166 | 3300005356 | Bacteria | 559 |
| 130 | Ga0070673_100000044 | 3300005364 | Bacteria | 51857 |
| 131 | Ga0070673_100007743 | 3300005364 | Bacteria | 7108 |
| 132 | Ga0070673_100073492 | 3300005364 | Bacteria | 2752 |
| 133 | Ga0070673_100400084 | 3300005364 | Bacteria | 1228 |
| 134 | Ga0070673_100593718 | 3300005364 | Bacteria | 1009 |
| 135 | Ga0070673_100677603 | 3300005364 | Bacteria | 945 |
| 136 | Ga0070673_100753269 | 3300005364 | Bacteria | 897 |
| 137 | Ga0070688_100357696 | 3300005365 | Bacteria | 1070 |
| 138 | Ga0070688_101617766 | 3300005365 | Bacteria | 529 |
| 139 | Ga0070659_100000849 | 3300005366 | Bacteria | 22290 |
| 140 | Ga0070659_100002178 | 3300005366 | Bacteria | 13947 |
| 141 | Ga0070659_100044812 | 3300005366 | Bacteria | 3464 |
| 142 | Ga0070659_100068918 | 3300005366 | Bacteria | 2807 |
| 143 | Ga0070659_100182160 | 3300005366 | Bacteria | 1724 |
| 144 | Ga0070659_100227216 | 3300005366 | Bacteria | 1542 |
| 145 | Ga0070659_100238674 | 3300005366 | Bacteria | 1503 |
| 146 | Ga0070659_100315714 | 3300005366 | Bacteria | 1305 |
| 147 | Ga0070659_100347573 | 3300005366 | Bacteria | 1244 |
| 148 | Ga0070659_100495928 | 3300005366 | Bacteria | 1040 |
| 149 | Ga0070659_100698811 | 3300005366 | Bacteria | 877 |
| 150 | Ga0070659_101185975 | 3300005366 | Bacteria | 675 |
| 151 | Ga0070667_100007145 | 3300005367 | Bacteria | 9280 |
| 152 | Ga0070667_100022649 | 3300005367 | Bacteria | 5209 |
| 153 | Ga0070667_100139679 | 3300005367 | Bacteria | 2120 |
| 154 | Ga0070667_100328233 | 3300005367 | Bacteria | 1382 |
| 155 | Ga0070667_100543024 | 3300005367 | Bacteria | 1068 |
| 156 | Ga0070667_100837386 | 3300005367 | Bacteria | 855 |
| 157 | Ga0070667_101287472 | 3300005367 | Bacteria | 685 |
| 158 | Ga0070667_101353338 | 3300005367 | Bacteria | 667 |
| 159 | Ga0070667_102207795 | 3300005367 | Bacteria | 518 |
| 160 | Ga0070714_100504749 | 3300005435 | Bacteria | 1154 |
| 161 | Ga0070701_11419162 | 3300005438 | Bacteria | 500 |
| 162 | Ga0070694_100009449 | 3300005444 | Bacteria | 5982 |
| 163 | Ga0070663_100036659 | 3300005455 | Bacteria | 3408 |
| 164 | Ga0070663_100039104 | 3300005455 | Bacteria | 3313 |
| 165 | Ga0070663_100092002 | 3300005455 | Bacteria | 2248 |
| 166 | Ga0070663_100155876 | 3300005455 | Bacteria | 1755 |
| 167 | Ga0070663_100199032 | 3300005455 | Bacteria | 1562 |
| 168 | Ga0070663_100321820 | 3300005455 | Bacteria | 1244 |
| 169 | Ga0070663_100415200 | 3300005455 | Bacteria | 1103 |
| 170 | Ga0070663_100551441 | 3300005455 | Bacteria | 963 |
| 171 | Ga0070663_100743307 | 3300005455 | Bacteria | 837 |
| 172 | Ga0070663_101292015 | 3300005455 | Bacteria | 643 |
| 173 | Ga0070678_100066889 | 3300005456 | Bacteria | 2672 |
| 174 | Ga0070678_100103020 | 3300005456 | Bacteria | 2216 |
| 175 | Ga0070678_100178388 | 3300005456 | Bacteria | 1736 |
| 176 | Ga0070662_100026020 | 3300005457 | Bacteria | 4048 |
| 177 | Ga0070662_100046561 | 3300005457 | Bacteria | 3116 |
| 178 | Ga0070662_100369417 | 3300005457 | Bacteria | 1179 |
| 179 | Ga0070662_100468414 | 3300005457 | Bacteria | 1048 |
| 180 | Ga0070662_100680072 | 3300005457 | Bacteria | 870 |
| 181 | Ga0070662_100784755 | 3300005457 | Bacteria | 809 |
| 182 | Ga0070662_100887232 | 3300005457 | Bacteria | 760 |
| 183 | Ga0070681_10019981 | 3300005458 | Bacteria | 6710 |
| 184 | Ga0068867_100006552 | 3300005459 | Bacteria | 8225 |
| 185 | Ga0068867_100016338 | 3300005459 | Bacteria | 5269 |
| 186 | Ga0068867_100021116 | 3300005459 | Bacteria | 4644 |
| 187 | Ga0068867_100073777 | 3300005459 | Bacteria | 2555 |
| 188 | Ga0068867_100415925 | 3300005459 | Bacteria | 1138 |
| 189 | Ga0070685_10833814 | 3300005466 | Bacteria | 682 |
| 190 | Ga0070679_100276328 | 3300005530 | Bacteria | 1633 |
| 191 | Ga0070679_100696708 | 3300005530 | Bacteria | 958 |
| 192 | Ga0070679_100713441 | 3300005530 | Bacteria | 946 |
| 193 | Ga0070684_100332812 | 3300005535 | Bacteria | 1396 |
| 194 | Ga0070684_101681716 | 3300005535 | Bacteria | 599 |
| 195 | Ga0068853_100006969 | 3300005539 | Bacteria | 9027 |
| 196 | Ga0068853_100017061 | 3300005539 | Bacteria | 5988 |
| 197 | Ga0068853_100117531 | 3300005539 | Bacteria | 2368 |
| 198 | Ga0068853_100200540 | 3300005539 | Bacteria | 1816 |
| 199 | Ga0068853_100216968 | 3300005539 | Bacteria | 1746 |
| 200 | Ga0068853_100252582 | 3300005539 | Bacteria | 1618 |
| 201 | Ga0068853_100304254 | 3300005539 | Bacteria | 1474 |
| 202 | Ga0068853_100453911 | 3300005539 | Bacteria | 1206 |
| 203 | Ga0068853_101292948 | 3300005539 | Bacteria | 705 |
| 204 | Ga0068853_102255296 | 3300005539 | Bacteria | 528 |
| 205 | Ga0070672_100001174 | 3300005543 | Bacteria | 16019 |
| 206 | Ga0070672_100081851 | 3300005543 | Bacteria | 2589 |
| 207 | Ga0070672_100138369 | 3300005543 | Bacteria | 2006 |
| 208 | Ga0070672_100155007 | 3300005543 | Bacteria | 1897 |
| 209 | Ga0070672_100160558 | 3300005543 | Bacteria | 1864 |
| 210 | Ga0070672_100164156 | 3300005543 | Bacteria | 1844 |
| 211 | Ga0070672_100406974 | 3300005543 | Bacteria | 1167 |
| 212 | Ga0070672_100584461 | 3300005543 | Bacteria | 972 |
| 213 | Ga0070672_101130684 | 3300005543 | Bacteria | 697 |
| 214 | Ga0070672_101332553 | 3300005543 | Bacteria | 641 |
| 215 | Ga0070672_101608646 | 3300005543 | Bacteria | 583 |
| 216 | Ga0070695_100693484 | 3300005545 | Bacteria | 808 |
| 217 | Ga0070696_100013815 | 3300005546 | Bacteria | 5422 |
| 218 | Ga0070693_100083556 | 3300005547 | Bacteria | 1909 |
| 219 | Ga0070693_100322306 | 3300005547 | Bacteria | 1049 |
| 220 | Ga0070665_100224567 | 3300005548 | Bacteria | 1878 |
| 221 | Ga0070704_100642009 | 3300005549 | Bacteria | 936 |
| 222 | Ga0068855_100005808 | 3300005563 | Bacteria | 15057 |
| 223 | Ga0068855_100019628 | 3300005563 | Bacteria | 8120 |
| 224 | Ga0068855_100073993 | 3300005563 | Bacteria | 3957 |
| 225 | Ga0068855_100105816 | 3300005563 | Bacteria | 3234 |
| 226 | Ga0068855_100208814 | 3300005563 | Bacteria | 2195 |
| 227 | Ga0068855_100719668 | 3300005563 | Bacteria | 1067 |
| 228 | Ga0068855_101420276 | 3300005563 | Bacteria | 715 |
| 229 | Ga0070664_100017284 | 3300005564 | Bacteria | 5922 |
| 230 | Ga0070664_100024270 | 3300005564 | Bacteria | 5014 |
| 231 | Ga0070664_100027446 | 3300005564 | Bacteria | 4731 |
| 232 | Ga0070664_100033519 | 3300005564 | Bacteria | 4303 |
| 233 | Ga0070664_100103382 | 3300005564 | Bacteria | 2480 |
| 234 | Ga0070664_100135240 | 3300005564 | Bacteria | 2167 |
| 235 | Ga0070664_100173788 | 3300005564 | Bacteria | 1912 |
| 236 | Ga0070664_100391516 | 3300005564 | Bacteria | 1270 |
| 237 | Ga0070664_101713614 | 3300005564 | Bacteria | 596 |
| 238 | Ga0068857_100002631 | 3300005577 | Bacteria | 14734 |
| 239 | Ga0068857_100025044 | 3300005577 | Bacteria | 5256 |
| 240 | Ga0068857_100060082 | 3300005577 | Bacteria | 3377 |
| 241 | Ga0068857_100218169 | 3300005577 | Bacteria | 1742 |
| 242 | Ga0068857_100304538 | 3300005577 | Bacteria | 1469 |
| 243 | Ga0068857_100364216 | 3300005577 | Bacteria | 1340 |
| 244 | Ga0068854_100000934 | 3300005578 | Bacteria | 17556 |
| 245 | Ga0068854_100023236 | 3300005578 | Bacteria | 4233 |
| 246 | Ga0068854_100024434 | 3300005578 | Bacteria | 4137 |
| 247 | Ga0068854_100050371 | 3300005578 | Bacteria | 2979 |
| 248 | Ga0068854_100162773 | 3300005578 | Bacteria | 1729 |
| 249 | Ga0068854_100189266 | 3300005578 | Bacteria | 1611 |
| 250 | Ga0068854_100398229 | 3300005578 | Bacteria | 1139 |
| 251 | Ga0068854_101152503 | 3300005578 | Bacteria | 693 |
| 252 | Ga0068856_100210543 | 3300005614 | Bacteria | 1959 |
| 253 | Ga0068856_100712708 | 3300005614 | Bacteria | 1024 |
| 254 | Ga0068856_100738998 | 3300005614 | Bacteria | 1004 |
| 255 | Ga0068856_101723585 | 3300005614 | Bacteria | 639 |
| 256 | Ga0070702_100155568 | 3300005615 | Bacteria | 1472 |
| 257 | Ga0068852_100006623 | 3300005616 | Bacteria | 8392 |
| 258 | Ga0068852_100015762 | 3300005616 | Bacteria | 5876 |
| 259 | Ga0068852_100027422 | 3300005616 | Bacteria | 4642 |
| 260 | Ga0068852_100029603 | 3300005616 | Bacteria | 4500 |
| 261 | Ga0068852_100046115 | 3300005616 | Bacteria | 3712 |
| 262 | Ga0068852_100211126 | 3300005616 | Bacteria | 1842 |
| 263 | Ga0068852_100215940 | 3300005616 | Bacteria | 1822 |
| 264 | Ga0068852_100222212 | 3300005616 | Bacteria | 1797 |
| 265 | Ga0068852_100334681 | 3300005616 | Bacteria | 1474 |
| 266 | Ga0068852_100413239 | 3300005616 | Bacteria | 1330 |
| 267 | Ga0068852_102618875 | 3300005616 | Bacteria | 524 |
| 268 | Ga0068859_100000144 | 3300005617 | Bacteria | 67220 |
| 269 | Ga0068859_100000799 | 3300005617 | Bacteria | 31905 |
| 270 | Ga0068859_100004301 | 3300005617 | Bacteria | 14531 |
| 271 | Ga0068859_100088140 | 3300005617 | Bacteria | 3152 |
| 272 | Ga0068859_100366149 | 3300005617 | Bacteria | 1537 |
| 273 | Ga0068859_100841577 | 3300005617 | Bacteria | 1004 |
| 274 | Ga0068859_100947068 | 3300005617 | Bacteria | 944 |
| 275 | Ga0068859_102418835 | 3300005617 | Bacteria | 579 |
| 276 | Ga0068864_100000092 | 3300005618 | Bacteria | 94499 |
| 277 | Ga0068864_100000552 | 3300005618 | Bacteria | 31974 |
| 278 | Ga0068864_100015554 | 3300005618 | Bacteria | 6328 |
| 279 | Ga0068864_100024534 | 3300005618 | Bacteria | 5074 |
| 280 | Ga0068864_100460892 | 3300005618 | Bacteria | 1217 |
| 281 | Ga0068864_100749874 | 3300005618 | Bacteria | 957 |
| 282 | Ga0068866_10047459 | 3300005718 | Bacteria | 2165 |
| 283 | Ga0068866_10146270 | 3300005718 | Bacteria | 1363 |
| 284 | Ga0068866_10598727 | 3300005718 | Bacteria | 744 |
| 285 | Ga0068866_10650393 | 3300005718 | Bacteria | 717 |
| 286 | Ga0068861_100014258 | 3300005719 | Bacteria | 5576 |
| 287 | Ga0068861_100449001 | 3300005719 | Bacteria | 1155 |
| 288 | Ga0068851_10001965 | 3300005834 | Bacteria | 9036 |
| 289 | Ga0068851_10122159 | 3300005834 | Bacteria | 1400 |
| 290 | Ga0068851_10398996 | 3300005834 | Bacteria | 809 |
| 291 | Ga0068851_10467128 | 3300005834 | Bacteria | 752 |
| 292 | Ga0068870_10163063 | 3300005840 | Bacteria | 1324 |
| 293 | Ga0068863_100000222 | 3300005841 | Bacteria | 60169 |
| 294 | Ga0068863_100012961 | 3300005841 | Bacteria | 8038 |
| 295 | Ga0068863_100020497 | 3300005841 | Bacteria | 6319 |
| 296 | Ga0068863_100060705 | 3300005841 | Bacteria | 3575 |
| 297 | Ga0068863_100176435 | 3300005841 | Bacteria | 2051 |
| 298 | Ga0068863_100966112 | 3300005841 | Bacteria | 854 |
| 299 | Ga0068863_101112041 | 3300005841 | Unclassified | 795 |
| 300 | Ga0068858_100000256 | 3300005842 | Bacteria | 56844 |
| 301 | Ga0068858_100026167 | 3300005842 | Bacteria | 5424 |
| 302 | Ga0068858_100042344 | 3300005842 | Bacteria | 4222 |
| 303 | Ga0068858_100045258 | 3300005842 | Bacteria | 4077 |
| 304 | Ga0068858_100302328 | 3300005842 | Bacteria | 1526 |
| 305 | Ga0068858_100454947 | 3300005842 | Bacteria | 1234 |
| 306 | Ga0068860_100002571 | 3300005843 | Bacteria | 18988 |
| 307 | Ga0068860_100007543 | 3300005843 | Bacteria | 10883 |
| 308 | Ga0068860_100013427 | 3300005843 | Bacteria | 8032 |
| 309 | Ga0068860_100058030 | 3300005843 | Bacteria | 3679 |
| 310 | Ga0068860_100101492 | 3300005843 | Bacteria | 2745 |
| 311 | Ga0068860_100315968 | 3300005843 | Bacteria | 1532 |
| 312 | Ga0068860_100398939 | 3300005843 | Bacteria | 1360 |
| 313 | Ga0068860_102283797 | 3300005843 | Bacteria | 561 |
| 314 | Ga0068862_100011848 | 3300005844 | Bacteria | 7201 |
| 315 | Ga0068862_100016716 | 3300005844 | Bacteria | 6109 |
| 316 | Ga0068862_100096996 | 3300005844 | Bacteria | 2574 |
| 317 | Ga0068862_100146291 | 3300005844 | Bacteria | 2100 |
| 318 | Ga0068862_100430889 | 3300005844 | Bacteria | 1239 |
| 319 | Ga0068862_100446903 | 3300005844 | Bacteria | 1218 |
| 320 | Ga0068862_100482614 | 3300005844 | Bacteria | 1173 |
| 321 | Ga0068862_100502434 | 3300005844 | Bacteria | 1151 |
| 322 | Ga0068862_100740442 | 3300005844 | Bacteria | 955 |
| 323 | Ga0068862_100758742 | 3300005844 | Bacteria | 944 |
| 324 | Ga0081539_10052286 | 3300005985 | Bacteria | 2296 |
| 325 | Ga0070715_10722889 | 3300006163 | Bacteria | 597 |
| 326 | Ga0075362_10043302 | 3300006177 | Bacteria | 1993 |
| 327 | Ga0097621_100032280 | 3300006237 | Bacteria | 4161 |
| 328 | Ga0097621_100038079 | 3300006237 | Bacteria | 3858 |
| 329 | Ga0097621_100073583 | 3300006237 | Bacteria | 2829 |
| 330 | Ga0097621_100724886 | 3300006237 | Bacteria | 917 |
| 331 | Ga0097621_101033023 | 3300006237 | Bacteria | 770 |
| 332 | Ga0097621_101564106 | 3300006237 | Bacteria | 626 |
| 333 | Ga0068871_100390025 | 3300006358 | Bacteria | 1238 |
| 334 | Ga0075428_100869631 | 3300006844 | Bacteria | 957 |
| 335 | Ga0075433_10267382 | 3300006852 | Bacteria | 1515 |
| 336 | Ga0075429_100200592 | 3300006880 | Bacteria | 1748 |
| 337 | Ga0068865_100000440 | 3300006881 | Bacteria | 23089 |
| 338 | Ga0068865_100013435 | 3300006881 | Bacteria | 5172 |
| 339 | Ga0068865_100216099 | 3300006881 | Bacteria | 1496 |
| 340 | Ga0097620_100000144 | 3300006931 | Bacteria | 67220 |
| 341 | Ga0097620_100000799 | 3300006931 | Bacteria | 31905 |
| 342 | Ga0097620_100004301 | 3300006931 | Bacteria | 14531 |
| 343 | Ga0097620_100088137 | 3300006931 | Bacteria | 3152 |
| 344 | Ga0097620_100366171 | 3300006931 | Bacteria | 1537 |
| 345 | Ga0097620_100841622 | 3300006931 | Bacteria | 1004 |
| 346 | Ga0097620_100947061 | 3300006931 | Bacteria | 944 |
| 347 | Ga0097620_102418381 | 3300006931 | Bacteria | 579 |
| 348 | Ga0105250_10017542 | 3300009092 | Bacteria | 2911 |
| 349 | Ga0105240_10014684 | 3300009093 | Bacteria | 10686 |
| 350 | Ga0105240_10215052 | 3300009093 | Bacteria | 2243 |
| 351 | Ga0105245_10000709 | 3300009098 | Bacteria | 30034 |
| 352 | Ga0105245_10120514 | 3300009098 | Bacteria | 2450 |
| 353 | Ga0105245_10358422 | 3300009098 | Bacteria | 1447 |
| 354 | Ga0105247_10138621 | 3300009101 | Bacteria | 1592 |
| 355 | Ga0105243_10025801 | 3300009148 | Bacteria | 4494 |
| 356 | Ga0105243_10040963 | 3300009148 | Bacteria | 3621 |
| 357 | Ga0105243_11491130 | 3300009148 | Bacteria | 700 |
| 358 | Ga0105243_11678423 | 3300009148 | Bacteria | 664 |
| 359 | Ga0105243_11916952 | 3300009148 | Bacteria | 626 |
| 360 | Ga0105243_12469514 | 3300009148 | Bacteria | 559 |
| 361 | Ga0105241_10054250 | 3300009174 | Bacteria | 3067 |
| 362 | Ga0105241_10071184 | 3300009174 | Bacteria | 2699 |
| 363 | Ga0105241_10208062 | 3300009174 | Bacteria | 1638 |
| 364 | Ga0105241_10264393 | 3300009174 | Bacteria | 1463 |
| 365 | Ga0105241_10310552 | 3300009174 | Bacteria | 1356 |
| 366 | Ga0105242_10284148 | 3300009176 | Bacteria | 1504 |
| 367 | Ga0105242_10483468 | 3300009176 | Bacteria | 1174 |
| 368 | Ga0105248_10000122 | 3300009177 | Bacteria | 89560 |
| 369 | Ga0105248_10000269 | 3300009177 | Bacteria | 61063 |
| 370 | Ga0105248_10000587 | 3300009177 | Bacteria | 41432 |
| 371 | Ga0105248_10027845 | 3300009177 | Bacteria | 6292 |
| 372 | Ga0105248_10061772 | 3300009177 | Bacteria | 4207 |
| 373 | Ga0105248_10267318 | 3300009177 | Bacteria | 1925 |
| 374 | Ga0105248_10271253 | 3300009177 | Bacteria | 1911 |
| 375 | Ga0105248_10610973 | 3300009177 | Bacteria | 1230 |
| 376 | Ga0105248_10869471 | 3300009177 | Bacteria | 1018 |
| 377 | Ga0105248_11679374 | 3300009177 | Bacteria | 720 |
| 378 | Ga0105248_12026483 | 3300009177 | Bacteria | 654 |
| 379 | Ga0105237_10012608 | 3300009545 | Bacteria | 8902 |
| 380 | Ga0105237_11002096 | 3300009545 | Bacteria | 842 |
| 381 | Ga0105238_10029976 | 3300009551 | Bacteria | 5537 |
| 382 | Ga0105238_11464585 | 3300009551 | Bacteria | 711 |
| 383 | Ga0105249_10009482 | 3300009553 | Bacteria | 8526 |
| 384 | Ga0105249_10014489 | 3300009553 | Bacteria | 6970 |
| 385 | Ga0105249_10019016 | 3300009553 | Bacteria | 6126 |
| 386 | Ga0105249_10224274 | 3300009553 | Bacteria | 1851 |
| 387 | Ga0105249_11003102 | 3300009553 | Bacteria | 904 |
| 388 | Ga0105239_10011604 | 3300010375 | Bacteria | 9830 |
| 389 | Ga0105239_10181263 | 3300010375 | Bacteria | 2357 |
| 390 | Ga0105246_10057757 | 3300011119 | Bacteria | 2686 |
| 391 | Ga0105246_10196525 | 3300011119 | Bacteria | 1565 |
| 392 | Ga0105246_10473893 | 3300011119 | Bacteria | 1057 |
| 393 | Ga0157316_1052877 | 3300012510 | Bacteria | 566 |
| 394 | Ga0157373_10003467 | 3300013100 | Bacteria | 11928 |
| 395 | Ga0157373_10004213 | 3300013100 | Bacteria | 10852 |
| 396 | Ga0157373_10014029 | 3300013100 | Bacteria | 5875 |
| 397 | Ga0157373_10054170 | 3300013100 | Bacteria | 2851 |
| 398 | Ga0157373_10080578 | 3300013100 | Bacteria | 2296 |
| 399 | Ga0157373_10136161 | 3300013100 | Bacteria | 1727 |
| 400 | Ga0157373_11300240 | 3300013100 | Bacteria | 550 |
| 401 | Ga0157373_11536328 | 3300013100 | Bacteria | 509 |
| 402 | Ga0157371_10004494 | 3300013102 | Bacteria | 12163 |
| 403 | Ga0157371_10057520 | 3300013102 | Bacteria | 2758 |
| 404 | Ga0157371_10378527 | 3300013102 | Bacteria | 1033 |
| 405 | Ga0157371_11175777 | 3300013102 | Bacteria | 590 |
| 406 | Ga0157370_10073909 | 3300013104 | Bacteria | 3216 |
| 407 | Ga0157370_10085412 | 3300013104 | Bacteria | 2965 |
| 408 | Ga0157370_10796712 | 3300013104 | Bacteria | 860 |
| 409 | Ga0157369_10054183 | 3300013105 | Bacteria | 4332 |
| 410 | Ga0157369_10102999 | 3300013105 | Bacteria | 3040 |
| 411 | Ga0157369_11929875 | 3300013105 | Bacteria | 599 |
| 412 | Ga0157374_10167199 | 3300013296 | Bacteria | 2144 |
| 413 | Ga0157374_10511670 | 3300013296 | Bacteria | 1206 |
| 414 | Ga0157374_12697182 | 3300013296 | Bacteria | 525 |
| 415 | Ga0157378_10015380 | 3300013297 | Bacteria | 6701 |
| 416 | Ga0157378_10135845 | 3300013297 | Bacteria | 2280 |
| 417 | Ga0157378_10210566 | 3300013297 | Bacteria | 1843 |
| 418 | Ga0163162_10027500 | 3300013306 | Bacteria | 5626 |
| 419 | Ga0163162_10032821 | 3300013306 | Bacteria | 5156 |
| 420 | Ga0163162_10190474 | 3300013306 | Bacteria | 2178 |
| 421 | Ga0163162_10451804 | 3300013306 | Bacteria | 1417 |
| 422 | Ga0163162_10503131 | 3300013306 | Bacteria | 1342 |
| 423 | Ga0163162_10515564 | 3300013306 | Bacteria | 1325 |
| 424 | Ga0163162_11547204 | 3300013306 | Bacteria | 756 |
| 425 | Ga0163162_11641537 | 3300013306 | Bacteria | 734 |
| 426 | Ga0157372_10006954 | 3300013307 | Bacteria | 12043 |
| 427 | Ga0157372_10050035 | 3300013307 | Bacteria | 4649 |
| 428 | Ga0157372_10669999 | 3300013307 | Bacteria | 1208 |
| 429 | Ga0157375_10039226 | 3300013308 | Bacteria | 4556 |
| 430 | Ga0157375_10045756 | 3300013308 | Bacteria | 4260 |
| 431 | Ga0157375_10255336 | 3300013308 | Bacteria | 1914 |
| 432 | Ga0157375_10396567 | 3300013308 | Bacteria | 1547 |
| 433 | Ga0157375_12371332 | 3300013308 | Bacteria | 633 |
| 434 | Ga0163163_10000080 | 3300014325 | Bacteria | 106006 |
| 435 | Ga0163163_12445992 | 3300014325 | Bacteria | 580 |
| 436 | Ga0157380_10164466 | 3300014326 | Bacteria | 1932 |
| 437 | Ga0157380_10567903 | 3300014326 | Bacteria | 1116 |
| 438 | Ga0182008_10309807 | 3300014497 | Bacteria | 828 |
| 439 | Ga0157377_10065466 | 3300014745 | Bacteria | 2088 |
| 440 | Ga0157377_10077311 | 3300014745 | Bacteria | 1938 |
| 441 | Ga0157379_12167833 | 3300014968 | Bacteria | 552 |
| 442 | Ga0157376_11671404 | 3300014969 | Bacteria | 672 |
| 443 | Ga0157376_12468328 | 3300014969 | Bacteria | 559 |
| 444 | Ga0157376_12621779 | 3300014969 | Bacteria | 544 |
| 445 | Ga0197907_11396321 | 3300020069 | Bacteria | 635 |
| 446 | Ga0206354_11602090 | 3300020081 | Bacteria | 811 |
| 447 | Ga0206353_11915595 | 3300020082 | Bacteria | 2485 |
| 448 | Ga0213876_10007945 | 3300021384 | Bacteria | 5755 |
| 449 | Ga0213875_10002606 | 3300021388 | Bacteria | 10707 |
| 450 | Ga0207673_1004407 | 3300025290 | Bacteria | 1683 |
| 451 | Ga0207697_10000142 | 3300025315 | Bacteria | 34778 |
| 452 | Ga0207697_10023020 | 3300025315 | Bacteria | 2551 |
| 453 | Ga0207697_10034678 | 3300025315 | Bacteria | 2066 |
| 454 | Ga0207656_10000430 | 3300025321 | Bacteria | 14083 |
| 455 | Ga0207656_10059770 | 3300025321 | Bacteria | 1669 |
| 456 | Ga0207696_1082874 | 3300025711 | Bacteria | 884 |
| 457 | Ga0207682_10008330 | 3300025893 | Bacteria | 4101 |
| 458 | Ga0207642_10015428 | 3300025899 | Bacteria | 2846 |
| 459 | Ga0207642_10228971 | 3300025899 | Bacteria | 1043 |
| 460 | Ga0207642_10249567 | 3300025899 | Bacteria | 1006 |
| 461 | Ga0207642_10753735 | 3300025899 | Bacteria | 616 |
| 462 | Ga0207710_10083747 | 3300025900 | Bacteria | 1483 |
| 463 | Ga0207710_10091103 | 3300025900 | Bacteria | 1427 |
| 464 | Ga0207688_10002307 | 3300025901 | Bacteria | 10262 |
| 465 | Ga0207688_10008353 | 3300025901 | Bacteria | 5631 |
| 466 | Ga0207688_10012721 | 3300025901 | Bacteria | 4578 |
| 467 | Ga0207688_10063412 | 3300025901 | Bacteria | 2084 |
| 468 | Ga0207688_10522860 | 3300025901 | Bacteria | 744 |
| 469 | Ga0207680_10013945 | 3300025903 | Bacteria | 4143 |
| 470 | Ga0207680_10182224 | 3300025903 | Bacteria | 1421 |
| 471 | Ga0207680_10189755 | 3300025903 | Bacteria | 1394 |
| 472 | Ga0207680_11146132 | 3300025903 | Bacteria | 555 |
| 473 | Ga0207647_10007744 | 3300025904 | Bacteria | 7735 |
| 474 | Ga0207647_10009442 | 3300025904 | Bacteria | 6931 |
| 475 | Ga0207647_10427972 | 3300025904 | Bacteria | 743 |
| 476 | Ga0207645_10014275 | 3300025907 | Bacteria | 5320 |
| 477 | Ga0207645_10016295 | 3300025907 | Bacteria | 4921 |
| 478 | Ga0207645_10046711 | 3300025907 | Bacteria | 2765 |
| 479 | Ga0207645_10061366 | 3300025907 | Bacteria | 2401 |
| 480 | Ga0207645_10134072 | 3300025907 | Bacteria | 1613 |
| 481 | Ga0207643_10175118 | 3300025908 | Bacteria | 1296 |
| 482 | Ga0207705_10006095 | 3300025909 | Bacteria | 8973 |
| 483 | Ga0207705_10011251 | 3300025909 | Bacteria | 6486 |
| 484 | Ga0207705_10013901 | 3300025909 | Bacteria | 5805 |
| 485 | Ga0207705_10018288 | 3300025909 | Bacteria | 5012 |
| 486 | Ga0207705_10173089 | 3300025909 | Bacteria | 1626 |
| 487 | Ga0207705_10212252 | 3300025909 | Bacteria | 1468 |
| 488 | Ga0207705_10226900 | 3300025909 | Bacteria | 1420 |
| 489 | Ga0207705_10271330 | 3300025909 | Bacteria | 1297 |
| 490 | Ga0207705_10529905 | 3300025909 | Bacteria | 915 |
| 491 | Ga0207705_10612199 | 3300025909 | Bacteria | 847 |
| 492 | Ga0207705_10795515 | 3300025909 | Bacteria | 734 |
| 493 | Ga0207654_10202303 | 3300025911 | Bacteria | 1308 |
| 494 | Ga0207654_10380590 | 3300025911 | Bacteria | 977 |
| 495 | Ga0207654_10546006 | 3300025911 | Bacteria | 823 |
| 496 | Ga0207654_10684119 | 3300025911 | Bacteria | 736 |
| 497 | Ga0207707_10004365 | 3300025912 | Bacteria | 12504 |
| 498 | Ga0207707_10012875 | 3300025912 | Bacteria | 7280 |
| 499 | Ga0207707_10174347 | 3300025912 | Bacteria | 1879 |
| 500 | Ga0207695_10135847 | 3300025913 | Bacteria | 2412 |
| 501 | Ga0207671_10017230 | 3300025914 | Bacteria | 5580 |
| 502 | Ga0207660_10001982 | 3300025917 | Bacteria | 13637 |
| 503 | Ga0207660_10039317 | 3300025917 | Bacteria | 3306 |
| 504 | Ga0207660_10125819 | 3300025917 | Bacteria | 1946 |
| 505 | Ga0207660_10615752 | 3300025917 | Bacteria | 885 |
| 506 | Ga0207660_10793878 | 3300025917 | Bacteria | 773 |
| 507 | Ga0207662_10870032 | 3300025918 | Bacteria | 637 |
| 508 | Ga0207657_10007043 | 3300025919 | Bacteria | 11565 |
| 509 | Ga0207657_10010390 | 3300025919 | Bacteria | 9292 |
| 510 | Ga0207657_10028000 | 3300025919 | Bacteria | 5150 |
| 511 | Ga0207657_10044544 | 3300025919 | Bacteria | 3900 |
| 512 | Ga0207657_10046598 | 3300025919 | Bacteria | 3797 |
| 513 | Ga0207657_10103917 | 3300025919 | Bacteria | 2354 |
| 514 | Ga0207657_10165805 | 3300025919 | Bacteria | 1792 |
| 515 | Ga0207657_10206512 | 3300025919 | Bacteria | 1578 |
| 516 | Ga0207657_10297695 | 3300025919 | Bacteria | 1278 |
| 517 | Ga0207657_10307826 | 3300025919 | Bacteria | 1254 |
| 518 | Ga0207649_10005743 | 3300025920 | Bacteria | 6717 |
| 519 | Ga0207649_10013587 | 3300025920 | Bacteria | 4548 |
| 520 | Ga0207649_10045189 | 3300025920 | Bacteria | 2699 |
| 521 | Ga0207649_10046606 | 3300025920 | Bacteria | 2664 |
| 522 | Ga0207649_10053636 | 3300025920 | Bacteria | 2506 |
| 523 | Ga0207649_10114267 | 3300025920 | Bacteria | 1809 |
| 524 | Ga0207649_10217854 | 3300025920 | Bacteria | 1358 |
| 525 | Ga0207649_10255863 | 3300025920 | Bacteria | 1263 |
| 526 | Ga0207649_10361078 | 3300025920 | Bacteria | 1078 |
| 527 | Ga0207652_10003434 | 3300025921 | Bacteria | 13073 |
| 528 | Ga0207652_10250922 | 3300025921 | Bacteria | 1596 |
| 529 | Ga0207652_10293309 | 3300025921 | Bacteria | 1468 |
| 530 | Ga0207652_10419010 | 3300025921 | Bacteria | 1208 |
| 531 | Ga0207652_10453817 | 3300025921 | Bacteria | 1155 |
| 532 | Ga0207681_10000532 | 3300025923 | Bacteria | 26302 |
| 533 | Ga0207681_10035676 | 3300025923 | Bacteria | 3278 |
| 534 | Ga0207681_10051093 | 3300025923 | Bacteria | 2799 |
| 535 | Ga0207681_10144688 | 3300025923 | Bacteria | 1774 |
| 536 | Ga0207681_10164182 | 3300025923 | Bacteria | 1677 |
| 537 | Ga0207681_10609962 | 3300025923 | Bacteria | 902 |
| 538 | Ga0207694_10002972 | 3300025924 | Bacteria | 13607 |
| 539 | Ga0207650_10034920 | 3300025925 | Bacteria | 3648 |
| 540 | Ga0207650_10044704 | 3300025925 | Bacteria | 3255 |
| 541 | Ga0207650_10110113 | 3300025925 | Bacteria | 2131 |
| 542 | Ga0207650_10115214 | 3300025925 | Bacteria | 2085 |
| 543 | Ga0207650_10190082 | 3300025925 | Bacteria | 1640 |
| 544 | Ga0207650_10545910 | 3300025925 | Bacteria | 971 |
| 545 | Ga0207650_11892232 | 3300025925 | Bacteria | 504 |
| 546 | Ga0207659_10064439 | 3300025926 | Bacteria | 2652 |
| 547 | Ga0207659_10067887 | 3300025926 | Bacteria | 2592 |
| 548 | Ga0207659_10169440 | 3300025926 | Bacteria | 1722 |
| 549 | Ga0207659_11037616 | 3300025926 | Bacteria | 706 |
| 550 | Ga0207687_10006315 | 3300025927 | Bacteria | 7834 |
| 551 | Ga0207644_10024128 | 3300025931 | Bacteria | 4172 |
| 552 | Ga0207644_10032109 | 3300025931 | Bacteria | 3661 |
| 553 | Ga0207644_10065496 | 3300025931 | Bacteria | 2642 |
| 554 | Ga0207644_10194747 | 3300025931 | Bacteria | 1595 |
| 555 | Ga0207644_10247038 | 3300025931 | Bacteria | 1422 |
| 556 | Ga0207644_10486312 | 3300025931 | Bacteria | 1017 |
| 557 | Ga0207644_10750920 | 3300025931 | Bacteria | 815 |
| 558 | Ga0207644_11719429 | 3300025931 | Bacteria | 525 |
| 559 | Ga0207690_10001200 | 3300025932 | Bacteria | 16374 |
| 560 | Ga0207690_10006450 | 3300025932 | Bacteria | 6954 |
| 561 | Ga0207690_10009194 | 3300025932 | Bacteria | 5867 |
| 562 | Ga0207690_10045080 | 3300025932 | Bacteria | 2911 |
| 563 | Ga0207690_10127674 | 3300025932 | Bacteria | 1856 |
| 564 | Ga0207690_10277340 | 3300025932 | Bacteria | 1305 |
| 565 | Ga0207690_10533421 | 3300025932 | Bacteria | 952 |
| 566 | Ga0207690_10614012 | 3300025932 | Bacteria | 888 |
| 567 | Ga0207706_10003910 | 3300025933 | Bacteria | 14138 |
| 568 | Ga0207706_10011697 | 3300025933 | Bacteria | 8002 |
| 569 | Ga0207706_10014742 | 3300025933 | Bacteria | 7078 |
| 570 | Ga0207706_10072809 | 3300025933 | Bacteria | 3021 |
| 571 | Ga0207706_10313763 | 3300025933 | Bacteria | 1365 |
| 572 | Ga0207706_10316647 | 3300025933 | Bacteria | 1358 |
| 573 | Ga0207706_10317742 | 3300025933 | Bacteria | 1355 |
| 574 | Ga0207706_10353086 | 3300025933 | Bacteria | 1278 |
| 575 | Ga0207706_10531064 | 3300025933 | Bacteria | 1014 |
| 576 | Ga0207686_10094527 | 3300025934 | Bacteria | 1982 |
| 577 | Ga0207686_10280318 | 3300025934 | Bacteria | 1230 |
| 578 | Ga0207709_10062525 | 3300025935 | Bacteria | 2330 |
| 579 | Ga0207709_10114980 | 3300025935 | Bacteria | 1806 |
| 580 | Ga0207709_10284494 | 3300025935 | Bacteria | 1223 |
| 581 | Ga0207709_10759761 | 3300025935 | Bacteria | 780 |
| 582 | Ga0207709_10861303 | 3300025935 | Bacteria | 735 |
| 583 | Ga0207670_10012456 | 3300025936 | Bacteria | 4979 |
| 584 | Ga0207670_10334169 | 3300025936 | Bacteria | 1196 |
| 585 | Ga0207669_10046809 | 3300025937 | Bacteria | 2558 |
| 586 | Ga0207669_10065729 | 3300025937 | Bacteria | 2251 |
| 587 | Ga0207669_10570779 | 3300025937 | Bacteria | 916 |
| 588 | Ga0207704_10003358 | 3300025938 | Bacteria | 7262 |
| 589 | Ga0207704_10340408 | 3300025938 | Bacteria | 1164 |
| 590 | Ga0207704_10428717 | 3300025938 | Bacteria | 1050 |
| 591 | Ga0207691_10001210 | 3300025940 | Bacteria | 25701 |
| 592 | Ga0207691_10049185 | 3300025940 | Bacteria | 3863 |
| 593 | Ga0207691_10112350 | 3300025940 | Bacteria | 2422 |
| 594 | Ga0207691_10214449 | 3300025940 | Bacteria | 1671 |
| 595 | Ga0207691_10281570 | 3300025940 | Bacteria | 1430 |
| 596 | Ga0207691_10843045 | 3300025940 | Bacteria | 769 |
| 597 | Ga0207711_10000423 | 3300025941 | Bacteria | 44463 |
| 598 | Ga0207711_10004591 | 3300025941 | Bacteria | 11742 |
| 599 | Ga0207711_10035624 | 3300025941 | Bacteria | 4220 |
| 600 | Ga0207711_10056610 | 3300025941 | Bacteria | 3370 |
| 601 | Ga0207711_10073390 | 3300025941 | Bacteria | 2973 |
| 602 | Ga0207711_10119253 | 3300025941 | Bacteria | 2354 |
| 603 | Ga0207711_10509561 | 3300025941 | Bacteria | 1122 |
| 604 | Ga0207689_10000125 | 3300025942 | Bacteria | 64633 |
| 605 | Ga0207689_10006231 | 3300025942 | Bacteria | 10565 |
| 606 | Ga0207689_10006847 | 3300025942 | Bacteria | 10024 |
| 607 | Ga0207689_10117126 | 3300025942 | Bacteria | 2190 |
| 608 | Ga0207689_10150347 | 3300025942 | Bacteria | 1919 |
| 609 | Ga0207661_10009534 | 3300025944 | Bacteria | 6969 |
| 610 | Ga0207661_10434727 | 3300025944 | Bacteria | 1193 |
| 611 | Ga0207661_11561156 | 3300025944 | Bacteria | 604 |
| 612 | Ga0207679_10013308 | 3300025945 | Bacteria | 5390 |
| 613 | Ga0207679_10078653 | 3300025945 | Bacteria | 2512 |
| 614 | Ga0207679_10101395 | 3300025945 | Bacteria | 2252 |
| 615 | Ga0207679_10102645 | 3300025945 | Bacteria | 2240 |
| 616 | Ga0207679_10113610 | 3300025945 | Bacteria | 2142 |
| 617 | Ga0207679_10135168 | 3300025945 | Bacteria | 1984 |
| 618 | Ga0207679_10454422 | 3300025945 | Bacteria | 1136 |
| 619 | Ga0207679_10939438 | 3300025945 | Bacteria | 792 |
| 620 | Ga0207679_11355498 | 3300025945 | Bacteria | 653 |
| 621 | Ga0207679_11502907 | 3300025945 | Bacteria | 618 |
| 622 | Ga0207667_10018797 | 3300025949 | Bacteria | 7737 |
| 623 | Ga0207667_10040158 | 3300025949 | Bacteria | 4982 |
| 624 | Ga0207667_10141128 | 3300025949 | Bacteria | 2480 |
| 625 | Ga0207667_10408040 | 3300025949 | Bacteria | 1383 |
| 626 | Ga0207667_10763532 | 3300025949 | Bacteria | 965 |
| 627 | Ga0207667_11261798 | 3300025949 | Bacteria | 716 |
| 628 | Ga0207667_11509729 | 3300025949 | Bacteria | 643 |
| 629 | Ga0207667_11631274 | 3300025949 | Bacteria | 613 |
| 630 | Ga0207651_10009499 | 3300025960 | Bacteria | 5333 |
| 631 | Ga0207651_10047051 | 3300025960 | Bacteria | 2906 |
| 632 | Ga0207651_10347742 | 3300025960 | Bacteria | 1247 |
| 633 | Ga0207651_10955853 | 3300025960 | Bacteria | 764 |
| 634 | Ga0207712_10033970 | 3300025961 | Bacteria | 3452 |
| 635 | Ga0207712_10194768 | 3300025961 | Bacteria | 1602 |
| 636 | Ga0207712_10682832 | 3300025961 | Bacteria | 895 |
| 637 | Ga0207668_10000689 | 3300025972 | Bacteria | 20729 |
| 638 | Ga0207668_10021174 | 3300025972 | Bacteria | 4143 |
| 639 | Ga0207668_10170457 | 3300025972 | Bacteria | 1706 |
| 640 | Ga0207668_10218701 | 3300025972 | Bacteria | 1528 |
| 641 | Ga0207668_10413662 | 3300025972 | Bacteria | 1143 |
| 642 | Ga0207640_10003384 | 3300025981 | Bacteria | 8593 |
| 643 | Ga0207640_10012265 | 3300025981 | Bacteria | 4876 |
| 644 | Ga0207640_10075918 | 3300025981 | Bacteria | 2279 |
| 645 | Ga0207640_10161362 | 3300025981 | Bacteria | 1659 |
| 646 | Ga0207640_10213037 | 3300025981 | Bacteria | 1473 |
| 647 | Ga0207640_10229284 | 3300025981 | Bacteria | 1428 |
| 648 | Ga0207640_10321577 | 3300025981 | Bacteria | 1232 |
| 649 | Ga0207640_10379668 | 3300025981 | Bacteria | 1145 |
| 650 | Ga0207640_10478998 | 3300025981 | Bacteria | 1032 |
| 651 | Ga0207640_10840637 | 3300025981 | Bacteria | 798 |
| 652 | Ga0207640_11598815 | 3300025981 | Bacteria | 587 |
| 653 | Ga0207658_10006795 | 3300025986 | Bacteria | 7792 |
| 654 | Ga0207658_10087229 | 3300025986 | Bacteria | 2409 |
| 655 | Ga0207658_10153434 | 3300025986 | Bacteria | 1879 |
| 656 | Ga0207658_10241774 | 3300025986 | Bacteria | 1530 |
| 657 | Ga0207658_10262662 | 3300025986 | Bacteria | 1472 |
| 658 | Ga0207658_10305910 | 3300025986 | Bacteria | 1371 |
| 659 | Ga0207658_11287585 | 3300025986 | Bacteria | 668 |
| 660 | Ga0207677_10003680 | 3300026023 | Bacteria | 8141 |
| 661 | Ga0207677_10492004 | 3300026023 | Bacteria | 1059 |
| 662 | Ga0207677_10577563 | 3300026023 | Bacteria | 983 |
| 663 | Ga0207703_10002144 | 3300026035 | Bacteria | 17346 |
| 664 | Ga0207703_10008974 | 3300026035 | Bacteria | 7878 |
| 665 | Ga0207703_10055543 | 3300026035 | Bacteria | 3222 |
| 666 | Ga0207703_10076090 | 3300026035 | Bacteria | 2783 |
| 667 | Ga0207703_10630578 | 3300026035 | Bacteria | 1016 |
| 668 | Ga0207703_11000560 | 3300026035 | Bacteria | 802 |
| 669 | Ga0207639_10002346 | 3300026041 | Bacteria | 12724 |
| 670 | Ga0207639_10016831 | 3300026041 | Bacteria | 5179 |
| 671 | Ga0207639_10023113 | 3300026041 | Bacteria | 4486 |
| 672 | Ga0207639_10032844 | 3300026041 | Bacteria | 3824 |
| 673 | Ga0207639_10175169 | 3300026041 | Bacteria | 1820 |
| 674 | Ga0207639_10574208 | 3300026041 | Bacteria | 1037 |
| 675 | Ga0207639_10611762 | 3300026041 | Bacteria | 1005 |
| 676 | Ga0207639_11703221 | 3300026041 | Bacteria | 591 |
| 677 | Ga0207678_10021310 | 3300026067 | Bacteria | 5682 |
| 678 | Ga0207678_10038015 | 3300026067 | Bacteria | 4185 |
| 679 | Ga0207678_10055099 | 3300026067 | Bacteria | 3425 |
| 680 | Ga0207678_10055740 | 3300026067 | Bacteria | 3404 |
| 681 | Ga0207678_10386659 | 3300026067 | Bacteria | 1210 |
| 682 | Ga0207678_10416042 | 3300026067 | Bacteria | 1165 |
| 683 | Ga0207678_10994520 | 3300026067 | Bacteria | 742 |
| 684 | Ga0207678_11559742 | 3300026067 | Bacteria | 582 |
| 685 | Ga0207702_10203575 | 3300026078 | Bacteria | 1836 |
| 686 | Ga0207702_10457578 | 3300026078 | Bacteria | 1239 |
| 687 | Ga0207702_11002975 | 3300026078 | Bacteria | 828 |
| 688 | Ga0207702_11955688 | 3300026078 | Bacteria | 577 |
| 689 | Ga0207641_10000175 | 3300026088 | Bacteria | 89110 |
| 690 | Ga0207641_10018525 | 3300026088 | Bacteria | 5709 |
| 691 | Ga0207641_10052673 | 3300026088 | Bacteria | 3447 |
| 692 | Ga0207641_10089057 | 3300026088 | Bacteria | 2696 |
| 693 | Ga0207641_10260043 | 3300026088 | Bacteria | 1625 |
| 694 | Ga0207641_10452385 | 3300026088 | Bacteria | 1241 |
| 695 | Ga0207641_10557419 | 3300026088 | Bacteria | 1118 |
| 696 | Ga0207648_10001391 | 3300026089 | Bacteria | 26634 |
| 697 | Ga0207648_10009361 | 3300026089 | Bacteria | 9386 |
| 698 | Ga0207648_10025288 | 3300026089 | Bacteria | 5290 |
| 699 | Ga0207648_10081154 | 3300026089 | Bacteria | 2829 |
| 700 | Ga0207676_10000138 | 3300026095 | Bacteria | 63283 |
| 701 | Ga0207676_10001309 | 3300026095 | Bacteria | 18536 |
| 702 | Ga0207676_10001788 | 3300026095 | Bacteria | 15763 |
| 703 | Ga0207676_10015646 | 3300026095 | Bacteria | 5480 |
| 704 | Ga0207676_10124656 | 3300026095 | Bacteria | 2179 |
| 705 | Ga0207676_10459553 | 3300026095 | Bacteria | 1202 |
| 706 | Ga0207674_10003049 | 3300026116 | Bacteria | 20722 |
| 707 | Ga0207674_10007818 | 3300026116 | Bacteria | 12430 |
| 708 | Ga0207674_10020368 | 3300026116 | Bacteria | 7166 |
| 709 | Ga0207674_10163297 | 3300026116 | Bacteria | 2182 |
| 710 | Ga0207674_10302515 | 3300026116 | Bacteria | 1548 |
| 711 | Ga0207674_10392385 | 3300026116 | Bacteria | 1342 |
| 712 | Ga0207675_100013635 | 3300026118 | Bacteria | 7586 |
| 713 | Ga0207675_100143816 | 3300026118 | Bacteria | 2267 |
| 714 | Ga0207675_100362894 | 3300026118 | Bacteria | 1421 |
| 715 | Ga0207683_10012589 | 3300026121 | Bacteria | 7216 |
| 716 | Ga0207683_10028509 | 3300026121 | Bacteria | 4827 |
| 717 | Ga0207683_10038452 | 3300026121 | Bacteria | 4171 |
| 718 | Ga0207698_10000706 | 3300026142 | Bacteria | 19357 |
| 719 | Ga0207698_10001521 | 3300026142 | Bacteria | 13514 |
| 720 | Ga0207698_10033159 | 3300026142 | Bacteria | 3750 |
| 721 | Ga0207698_10151200 | 3300026142 | Bacteria | 2015 |
| 722 | Ga0207698_10235449 | 3300026142 | Bacteria | 1665 |
| 723 | Ga0207698_10237755 | 3300026142 | Bacteria | 1658 |
| 724 | Ga0207698_10441084 | 3300026142 | Bacteria | 1254 |
| 725 | Ga0207698_10582098 | 3300026142 | Bacteria | 1101 |
| 726 | Ga0207698_10711002 | 3300026142 | Bacteria | 1000 |
| 727 | Ga0268266_11379394 | 3300028379 | Bacteria | 680 |
| 728 | Ga0268265_10001694 | 3300028380 | Bacteria | 17945 |
| 729 | Ga0268265_10007206 | 3300028380 | Bacteria | 7515 |
| 730 | Ga0268265_10033660 | 3300028380 | Bacteria | 3728 |
| 731 | Ga0268265_10089795 | 3300028380 | Bacteria | 2452 |
| 732 | Ga0268265_10104777 | 3300028380 | Bacteria | 2293 |
| 733 | Ga0268265_10143956 | 3300028380 | Bacteria | 1999 |
| 734 | Ga0268265_10426584 | 3300028380 | Bacteria | 1232 |
| 735 | Ga0268265_10868240 | 3300028380 | Bacteria | 884 |
| 736 | Ga0268265_11702388 | 3300028380 | Bacteria | 636 |
| 737 | Ga0268264_10000932 | 3300028381 | Bacteria | 30353 |
| 738 | Ga0268264_10016085 | 3300028381 | Bacteria | 6129 |
| 739 | Ga0268264_10016864 | 3300028381 | Bacteria | 5979 |
| 740 | Ga0268264_10021267 | 3300028381 | Bacteria | 5299 |
| 741 | Ga0268264_10411083 | 3300028381 | Bacteria | 1303 |
| 742 | Ga0268264_11501681 | 3300028381 | Bacteria | 684 |
| 743 | Ga0307408_100012567 | 3300031548 | Bacteria | 5612 |
| 744 | Ga0307408_100545608 | 3300031548 | Bacteria | 1022 |
| 745 | Ga0307408_101614748 | 3300031548 | Bacteria | 616 |
| 746 | Ga0307405_10692074 | 3300031731 | Bacteria | 843 |
| 747 | Ga0307410_10005106 | 3300031852 | Bacteria | 6901 |
| 748 | Ga0307406_11192029 | 3300031901 | Bacteria | 661 |
| 749 | Ga0307407_10181568 | 3300031903 | Bacteria | 1395 |
| 750 | Ga0307409_100052196 | 3300031995 | Bacteria | 3133 |
| 751 | Ga0307416_100352831 | 3300032002 | Bacteria | 1489 |
| 752 | Ga0307414_11015782 | 3300032004 | Bacteria | 764 |
| 753 | Ga0307415_100000440 | 3300032126 | Bacteria | 17845 |
| 754 | Ga0373940_0013620 | 3300035088 | Bacteria | 1972 |
| 755 | Ga0373951_0286487 | 3300035091 | Bacteria | 504 |
| 756 | Ga0373923_0019190 | 3300035111 | Bacteria | 2644 |
| 757 | Ga0373939_0456033 | 3300035114 | Bacteria | 539 |
| 758 | Ga0373941_0193882 | 3300035115 | Bacteria | 769 |
| 759 | Ga0373954_0059966 | 3300035118 | Bacteria | 1794 |
| 760 | Ga0373956_0408190 | 3300035119 | Bacteria | 648 |
| 761 | Ga0373955_0056091 | 3300035172 | Bacteria | 2161 |
| 762 | Ga0373931_0245625 | 3300035691 | Bacteria | 1087 |
| 763 | Ga0373935_0189257 | 3300035692 | Bacteria | 1417 |
| 764 | Ga0373933_0135704 | 3300035724 | Bacteria | 1550 |
| 765 | Ga0373937_0015554 | 3300036401 | Bacteria | 6732 |
| 766 | Ga0395899_0066576 | 3300037312 | Bacteria | 2645 |
| 767 | Ga0395899_0149118 | 3300037312 | Bacteria | 1658 |
| 768 | Ga0395899_0332077 | 3300037312 | Bacteria | 1021 |
| 769 | Ga0395900_0015989 | 3300037418 | Bacteria | 7646 |
| 770 | Ga0395900_0031705 | 3300037418 | Bacteria | 5432 |
| 771 | Ga0395900_0052525 | 3300037418 | Bacteria | 4195 |
| 772 | Ga0395900_0170157 | 3300037418 | Bacteria | 2218 |
| 773 | Ga0395900_0227779 | 3300037418 | Bacteria | 1876 |
| 774 | Ga0395900_0960384 | 3300037418 | Bacteria | 776 |
| 775 | Ga0395898_0034678 | 3300037466 | Bacteria | 5025 |
| 776 | Ga0395898_0226924 | 3300037466 | Bacteria | 1781 |
| 777 | Ga0395898_0230832 | 3300037466 | Bacteria | 1765 |
| 778 | Ga0395898_0241709 | 3300037466 | Bacteria | 1722 |
| 779 | Ga0395898_0364479 | 3300037466 | Bacteria | 1378 |
| 780 | Ga0395898_1196651 | 3300037466 | Bacteria | 691 |
| 781 | Ga0395898_1696302 | 3300037466 | Bacteria | 554 |
| 782 | Ga0395898_1940600 | 3300037466 | Bacteria | 508 |
| 783 | Ga0395905_0000756 | 3300037471 | Bacteria | 42590 |
| 784 | Ga0395905_0004552 | 3300037471 | Bacteria | 14353 |
| 785 | Ga0395905_0018156 | 3300037471 | Bacteria | 6675 |
| 786 | Ga0395905_0037822 | 3300037471 | Bacteria | 4529 |
| 787 | Ga0395905_0047727 | 3300037471 | Bacteria | 4012 |
| 788 | Ga0395905_0097433 | 3300037471 | Bacteria | 2761 |
| 789 | Ga0395905_0211258 | 3300037471 | Bacteria | 1818 |
| 790 | Ga0395905_0250996 | 3300037471 | Bacteria | 1652 |
| 791 | Ga0395905_0335112 | 3300037471 | Bacteria | 1404 |
| 792 | Ga0395905_0364627 | 3300037471 | Bacteria | 1337 |
| 793 | Ga0395905_0380525 | 3300037471 | Bacteria | 1305 |
| 794 | Ga0395905_0504935 | 3300037471 | Bacteria | 1109 |
| 795 | Ga0395905_0656037 | 3300037471 | Bacteria | 951 |
| 796 | Ga0395905_0676187 | 3300037471 | Bacteria | 934 |
| 797 | Ga0395905_0831453 | 3300037471 | Bacteria | 826 |
| 798 | Ga0395905_1422028 | 3300037471 | Bacteria | 598 |
| 799 | Ga0395905_1428332 | 3300037471 | Bacteria | 596 |
| 800 | Ga0436364_1406360 | 3300037853 | Bacteria | 26034 |
| 801 | Ga0395901_0012260 | 3300038443 | Bacteria | 8700 |
| 802 | Ga0395901_0014130 | 3300038443 | Bacteria | 8128 |
| 803 | Ga0395901_0031705 | 3300038443 | Bacteria | 5449 |
| 804 | Ga0395901_0398839 | 3300038443 | Bacteria | 1413 |
| 805 | Ga0395901_0829031 | 3300038443 | Bacteria | 912 |
| 806 | Ga0395901_0941220 | 3300038443 | Bacteria | 843 |
| 807 | Ga0395901_1624973 | 3300038443 | Bacteria | 599 |
| 808 | Ga0436365_0440923 | 3300039437 | Bacteria | 20557 |
| 809 | Ga0439458_0015600 | 3300042157 | Bacteria | 1723 |
| 810 | Ga0439458_0124519 | 3300042157 | Bacteria | 680 |
| 811 | Ga0439459_0054075 | 3300042438 | Bacteria | 890 |
| 812 | Ga0439464_0000045 | 3300042439 | Bacteria | 16165 |
| 813 | Ga0466966_0040985 | 3300044684 | Bacteria | 2978 |
| 814 | Ga0466966_0062865 | 3300044684 | Bacteria | 2340 |
| 815 | Ga0466966_0232422 | 3300044684 | Bacteria | 1112 |
| 816 | Ga0466961_0764214 | 3300044693 | Bacteria | 577 |
| 817 | Ga0466963_0212673 | 3300044694 | Bacteria | 1353 |
| 818 | Ga0466968_0505450 | 3300044735 | Bacteria | 603 |
| 819 | Ga0466970_0149778 | 3300044765 | Bacteria | 1288 |
| 820 | Ga0466959_0128498 | 3300045049 | Bacteria | 1797 |
| 821 | Ga0451576_1836259 | 3300045051 | Bacteria | 626 |
| 822 | Ga0466958_1026428 | 3300045836 | Unclassified | 538 |
| 823 | Ga0466967_0057413 | 3300045976 | Bacteria | 3436 |
| 824 | Ga0466967_0251258 | 3300045976 | Bacteria | 1689 |
| 825 | Ga0466967_0253621 | 3300045976 | Bacteria | 1681 |
| 826 | Ga0466967_0275573 | 3300045976 | Bacteria | 1613 |
| 827 | Ga0466967_0644180 | 3300045976 | Bacteria | 1047 |
| 828 | Ga0495663_0095136 | 3300046525 | Bacteria | 975 |
| 829 | Ga0495663_0113157 | 3300046525 | Bacteria | 903 |
| 830 | Ga0495668_0030101 | 3300046616 | Bacteria | 3066 |
| 831 | Ga0495668_0161966 | 3300046616 | Bacteria | 1225 |
| 832 | Ga0495668_0627628 | 3300046616 | Bacteria | 594 |
| 833 | Ga0495625_0143163 | 3300046660 | Bacteria | 1612 |
| 834 | Ga0495669_0008488 | 3300046684 | Bacteria | 4321 |
| 835 | Ga0495669_0010742 | 3300046684 | Bacteria | 3876 |
| 836 | Ga0495669_0091936 | 3300046684 | Bacteria | 1401 |
| 837 | Ga0495669_0117034 | 3300046684 | Bacteria | 1247 |
| 838 | Ga0495669_0223791 | 3300046684 | Bacteria | 902 |
| 839 | Ga0495669_0314378 | 3300046684 | Bacteria | 756 |
| 840 | Ga0495669_0479572 | 3300046684 | Bacteria | 604 |
| 841 | Ga0495669_0586047 | 3300046684 | Bacteria | 542 |
| 842 | Ga0495670_0475555 | 3300046691 | Bacteria | 678 |
| 843 | Ga0495677_0020757 | 3300047445 | Bacteria | 2380 |
| 844 | Ga0495677_0078560 | 3300047445 | Bacteria | 1235 |
| 845 | Ga0495677_0253125 | 3300047445 | Bacteria | 689 |
| 846 | Ga0495677_0281889 | 3300047445 | Bacteria | 652 |
| 847 | Ga0495685_134930 | 3300047447 | Bacteria | 806 |
| 848 | Ga0495685_177692 | 3300047447 | Bacteria | 686 |
| 849 | Ga0495685_250863 | 3300047447 | Bacteria | 561 |
| 850 | Ga0495602_0045724 | 3300048088 | Bacteria | 3960 |
| 851 | Ga0496100_0402018 | 3300048903 | Bacteria | 1043 |
| 852 | Ga0496100_0679033 | 3300048903 | Bacteria | 803 |
| 853 | Ga0496101_0022205 | 3300048904 | Bacteria | 4367 |
| 854 | Ga0496101_0428226 | 3300048904 | Bacteria | 1043 |
| 855 | Ga0496102_0122899 | 3300048905 | Bacteria | 2425 |
| 856 | Ga0496103_0079072 | 3300048906 | Bacteria | 2066 |
| 857 | Ga0496103_0220741 | 3300048906 | Bacteria | 1219 |
| 858 | Ga0496105_0097313 | 3300048908 | Bacteria | 2431 |
| 859 | Ga0496106_0007365 | 3300048909 | Bacteria | 8132 |
| 860 | Ga0496106_0575379 | 3300048909 | Bacteria | 903 |
| 861 | Ga0496107_0021737 | 3300048910 | Bacteria | 4533 |
| 862 | Ga0496107_0183241 | 3300048910 | Bacteria | 1555 |
| 863 | Ga0496108_0014814 | 3300048911 | Bacteria | 6361 |
| 864 | Ga0496108_0062546 | 3300048911 | Bacteria | 3134 |
| 865 | Ga0496108_0756259 | 3300048911 | Bacteria | 840 |
| 866 | Ga0496109_0004961 | 3300048912 | Bacteria | 11116 |
| 867 | Ga0496109_0153326 | 3300048912 | Bacteria | 2158 |
| 868 | Ga0496109_0264122 | 3300048912 | Bacteria | 1621 |
| 869 | Ga0496109_1934013 | 3300048912 | Bacteria | 522 |
| 870 | Ga0496110_0038463 | 3300048913 | Bacteria | 4163 |
| 871 | Ga0496110_0406966 | 3300048913 | Bacteria | 1240 |
| 872 | Ga0496111_0000342 | 3300048914 | Bacteria | 23149 |
| 873 | Ga0496111_0100321 | 3300048914 | Bacteria | 2126 |
| 874 | Ga0496111_0745089 | 3300048914 | Bacteria | 711 |
| 875 | Ga0496112_0005863 | 3300048915 | Bacteria | 10699 |
| 876 | Ga0496112_0017301 | 3300048915 | Bacteria | 6770 |
| 877 | Ga0496112_0026765 | 3300048915 | Bacteria | 5556 |
| 878 | Ga0496112_0033735 | 3300048915 | Bacteria | 4977 |
| 879 | Ga0496112_0196154 | 3300048915 | Bacteria | 1979 |
| 880 | Ga0496113_0042123 | 3300048916 | Bacteria | 3372 |
| 881 | Ga0496113_0065433 | 3300048916 | Bacteria | 2751 |
| 882 | Ga0496113_0112679 | 3300048916 | Bacteria | 2119 |
| 883 | Ga0496113_0623279 | 3300048916 | Bacteria | 863 |
| 884 | Ga0496114_0034740 | 3300048917 | Bacteria | 4161 |
| 885 | Ga0496115_0001505 | 3300048918 | Bacteria | 16734 |
| 886 | Ga0501035_0436671 | 3300049822 | Bacteria | 1085 |
| 887 | nmdc:mga03683_30007_c1 | 3300050489 | Bacteria | 2173 |
| 888 | nmdc:mga00v17_99174_c1 | 3300050491 | Bacteria | 1837 |
| 889 | nmdc:mga0k408_128530_c1 | 3300050493 | Bacteria | 1503 |
| 890 | nmdc:mga09592_1001126_c1 | 3300050508 | Bacteria | 699 |
| 891 | nmdc:mga09592_176556_c1 | 3300050508 | Bacteria | 1847 |
| 892 | nmdc:mga0a205_18103_c1 | 3300050515 | Bacteria | 6619 |
| 893 | Ga0495655_0109254 | 3300053083 | Bacteria | 829 |
| 894 | Ga0500658_0000149 | 3300053134 | Bacteria | 33339 |
| 895 | Ga0466962_0443365 | 3300061719 | Bacteria | 653 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10099856 | Ga0070658_100998562 | 92 |
| 2 | 3300005329 | Ga0070683_100095414 | Ga0070683_1000954143 | 92 |
| 3 | 3300005338 | Ga0068868_100704723 | Ga0068868_1007047231 | 92 |
| 4 | 3300005535 | Ga0070684_100332812 | Ga0070684_1003328122 | 92 |
| 5 | 3300005539 | Ga0068853_101292948 | Ga0068853_1012929481 | 92 |
| 6 | 3300005563 | Ga0068855_100105816 | Ga0068855_1001058162 | 92 |
| 7 | 3300013102 | Ga0157371_10057520 | Ga0157371_100575205 | 92 |
| 8 | 3300013105 | Ga0157369_10054183 | Ga0157369_100541835 | 92 |
| 9 | 3300025909 | Ga0207705_10212252 | Ga0207705_102122522 | 92 |
| 10 | 3300025944 | Ga0207661_10009534 | Ga0207661_100095349 | 92 |
| 11 | 3300037312 | Ga0395899_0149118 | Ga0395899_0149118_1239_1607 | 92 |
| 12 | 3300037466 | Ga0395898_0034678 | Ga0395898_0034678_3927_4295 | 92 |
| 13 | 3300038443 | Ga0395901_0014130 | Ga0395901_0014130_976_1344 | 92 |
| 14 | 3300005339 | Ga0070660_100409086 | Ga0070660_1004090863 | 93 |
| 15 | 3300005339 | Ga0070660_100503587 | Ga0070660_1005035872 | 96 |
| 16 | 3300025919 | Ga0207657_10297695 | Ga0207657_102976952 | 96 |
| 17 | 3300025932 | Ga0207690_10045080 | Ga0207690_100450804 | 96 |
| 18 | 3300026078 | Ga0207702_11955688 | Ga0207702_119556881 | 96 |
| 19 | 3300002067 | JGI24735J21928_10009940 | JGI24735J21928_100099405 | 98 |
| 20 | 3300002067 | JGI24735J21928_10032381 | JGI24735J21928_100323813 | 98 |
| 21 | 3300005327 | Ga0070658_10760310 | Ga0070658_107603101 | 98 |
| 22 | 3300005329 | Ga0070683_101835262 | Ga0070683_1018352621 | 98 |
| 23 | 3300005339 | Ga0070660_100023819 | Ga0070660_1000238191 | 98 |
| 24 | 3300005344 | Ga0070661_100042451 | Ga0070661_1000424515 | 98 |
| 25 | 3300005366 | Ga0070659_100068918 | Ga0070659_1000689185 | 98 |
| 26 | 3300005458 | Ga0070681_10019981 | Ga0070681_100199812 | 98 |
| 27 | 3300005535 | Ga0070684_101681716 | Ga0070684_1016817162 | 98 |
| 28 | 3300005539 | Ga0068853_100006969 | Ga0068853_1000069699 | 98 |
| 29 | 3300005563 | Ga0068855_100719668 | Ga0068855_1007196682 | 98 |
| 30 | 3300005577 | Ga0068857_100364216 | Ga0068857_1003642162 | 98 |
| 31 | 3300005578 | Ga0068854_101152503 | Ga0068854_1011525032 | 98 |
| 32 | 3300005614 | Ga0068856_101723585 | Ga0068856_1017235852 | 98 |
| 33 | 3300005616 | Ga0068852_100006623 | Ga0068852_1000066232 | 98 |
| 34 | 3300009093 | Ga0105240_10014684 | Ga0105240_100146844 | 98 |
| 35 | 3300009174 | Ga0105241_10054250 | Ga0105241_100542502 | 98 |
| 36 | 3300009545 | Ga0105237_10012608 | Ga0105237_100126087 | 98 |
| 37 | 3300009551 | Ga0105238_10029976 | Ga0105238_100299765 | 98 |
| 38 | 3300010375 | Ga0105239_10011604 | Ga0105239_100116045 | 98 |
| 39 | 3300013100 | Ga0157373_10003467 | Ga0157373_100034677 | 98 |
| 40 | 3300013104 | Ga0157370_10085412 | Ga0157370_100854123 | 98 |
| 41 | 3300013307 | Ga0157372_10050035 | Ga0157372_100500354 | 98 |
| 42 | 3300045976 | Ga0466967_0251258 | Ga0466967_0251258_448_846 | 98 |
| 43 | 3300046684 | Ga0495669_0479572 | Ga0495669_0479572_29_376 | 98 |
| 44 | 3300005331 | Ga0070670_101012071 | Ga0070670_1010120712 | 99 |
| 45 | 3300005844 | Ga0068862_100096996 | Ga0068862_1000969962 | 99 |
| 46 | 3300006177 | Ga0075362_10043302 | Ga0075362_100433024 | 99 |
| 47 | 3300025904 | Ga0207647_10009442 | Ga0207647_100094422 | 99 |
| 48 | 3300025912 | Ga0207707_10012875 | Ga0207707_100128752 | 99 |
| 49 | 3300025913 | Ga0207695_10135847 | Ga0207695_101358472 | 99 |
| 50 | 3300025914 | Ga0207671_10017230 | Ga0207671_100172302 | 99 |
| 51 | 3300025917 | Ga0207660_10125819 | Ga0207660_101258192 | 99 |
| 52 | 3300025919 | Ga0207657_10010390 | Ga0207657_1001039010 | 99 |
| 53 | 3300025920 | Ga0207649_10053636 | Ga0207649_100536362 | 99 |
| 54 | 3300025924 | Ga0207694_10002972 | Ga0207694_100029722 | 99 |
| 55 | 3300025925 | Ga0207650_11892232 | Ga0207650_118922321 | 99 |
| 56 | 3300025932 | Ga0207690_10009194 | Ga0207690_100091948 | 99 |
| 57 | 3300025944 | Ga0207661_11561156 | Ga0207661_115611562 | 99 |
| 58 | 3300025945 | Ga0207679_10102645 | Ga0207679_101026452 | 99 |
| 59 | 3300025949 | Ga0207667_10018797 | Ga0207667_100187973 | 99 |
| 60 | 3300025981 | Ga0207640_11598815 | Ga0207640_115988152 | 99 |
| 61 | 3300026041 | Ga0207639_10002346 | Ga0207639_100023463 | 99 |
| 62 | 3300026078 | Ga0207702_11002975 | Ga0207702_110029752 | 99 |
| 63 | 3300026116 | Ga0207674_10020368 | Ga0207674_100203688 | 99 |
| 64 | 3300026142 | Ga0207698_10582098 | Ga0207698_105820981 | 99 |
| 65 | 3300028380 | Ga0268265_10007206 | Ga0268265_100072066 | 99 |
| 66 | 3300050489 | nmdc:mga03683_30007_c1 | nmdc:mga03683_30007_c1_684_1031 | 99 |
| 67 | 3300050491 | nmdc:mga00v17_99174_c1 | nmdc:mga00v17_99174_c1_649_996 | 99 |
| 68 | 3300005336 | Ga0070680_100049943 | Ga0070680_1000499435 | 100 |
| 69 | 3300005455 | Ga0070663_100551441 | Ga0070663_1005514412 | 100 |
| 70 | 3300005614 | Ga0068856_100210543 | Ga0068856_1002105433 | 100 |
| 71 | 3300005616 | Ga0068852_100046115 | Ga0068852_1000461152 | 100 |
| 72 | 3300020069 | Ga0197907_11396321 | Ga0197907_113963212 | 100 |
| 73 | 3300020081 | Ga0206354_11602090 | Ga0206354_116020902 | 100 |
| 74 | 3300020082 | Ga0206353_11915595 | Ga0206353_119155955 | 100 |
| 75 | 3300025917 | Ga0207660_10039317 | Ga0207660_100393173 | 100 |
| 76 | 3300025919 | Ga0207657_10103917 | Ga0207657_101039174 | 100 |
| 77 | 3300025921 | Ga0207652_10419010 | Ga0207652_104190103 | 100 |
| 78 | 3300025949 | Ga0207667_10141128 | Ga0207667_101411284 | 100 |
| 79 | 3300026067 | Ga0207678_11559742 | Ga0207678_115597422 | 100 |
| 80 | 3300026142 | Ga0207698_10000706 | Ga0207698_1000070619 | 100 |
| 81 | 3300005327 | Ga0070658_10372701 | Ga0070658_103727011 | 101 |
| 82 | 3300005338 | Ga0068868_101184176 | Ga0068868_1011841762 | 101 |
| 83 | 3300005339 | Ga0070660_100046275 | Ga0070660_1000462752 | 101 |
| 84 | 3300005345 | Ga0070692_10065069 | Ga0070692_100650692 | 101 |
| 85 | 3300005347 | Ga0070668_100519953 | Ga0070668_1005199533 | 101 |
| 86 | 3300005353 | Ga0070669_100357114 | Ga0070669_1003571142 | 101 |
| 87 | 3300005366 | Ga0070659_100002178 | Ga0070659_10000217813 | 101 |
| 88 | 3300005435 | Ga0070714_100504749 | Ga0070714_1005047493 | 101 |
| 89 | 3300005438 | Ga0070701_11419162 | Ga0070701_114191621 | 101 |
| 90 | 3300005444 | Ga0070694_100009449 | Ga0070694_1000094496 | 101 |
| 91 | 3300005539 | Ga0068853_100304254 | Ga0068853_1003042542 | 101 |
| 92 | 3300005543 | Ga0070672_100138369 | Ga0070672_1001383692 | 101 |
| 93 | 3300005543 | Ga0070672_100160558 | Ga0070672_1001605583 | 101 |
| 94 | 3300005545 | Ga0070695_100693484 | Ga0070695_1006934842 | 101 |
| 95 | 3300005549 | Ga0070704_100642009 | Ga0070704_1006420092 | 101 |
| 96 | 3300005563 | Ga0068855_100073993 | Ga0068855_1000739934 | 101 |
| 97 | 3300005616 | Ga0068852_100222212 | Ga0068852_1002222122 | 101 |
| 98 | 3300005842 | Ga0068858_100454947 | Ga0068858_1004549473 | 101 |
| 99 | 3300005843 | Ga0068860_100101492 | Ga0068860_1001014924 | 101 |
| 100 | 3300005844 | Ga0068862_100758742 | Ga0068862_1007587422 | 101 |
| 101 | 3300005985 | Ga0081539_10052286 | Ga0081539_100522862 | 101 |
| 102 | 3300006237 | Ga0097621_101033023 | Ga0097621_1010330232 | 101 |
| 103 | 3300009093 | Ga0105240_10215052 | Ga0105240_102150523 | 101 |
| 104 | 3300009148 | Ga0105243_11916952 | Ga0105243_119169521 | 101 |
| 105 | 3300009177 | Ga0105248_10027845 | Ga0105248_100278458 | 101 |
| 106 | 3300009177 | Ga0105248_10271253 | Ga0105248_102712533 | 101 |
| 107 | 3300009553 | Ga0105249_10009482 | Ga0105249_100094828 | 101 |
| 108 | 3300010375 | Ga0105239_10181263 | Ga0105239_101812633 | 101 |
| 109 | 3300011119 | Ga0105246_10473893 | Ga0105246_104738933 | 101 |
| 110 | 3300013102 | Ga0157371_10378527 | Ga0157371_103785272 | 101 |
| 111 | 3300013306 | Ga0163162_10515564 | Ga0163162_105155642 | 101 |
| 112 | 3300021388 | Ga0213875_10002606 | Ga0213875_100026062 | 101 |
| 113 | 3300025912 | Ga0207707_10174347 | Ga0207707_101743471 | 101 |
| 114 | 3300037853 | Ga0436364_1406360 | Ga0436364_1406360_12776_13195 | 101 |
| 115 | 3300044684 | Ga0466966_0062865 | Ga0466966_0062865_340_699 | 101 |
| 116 | 3300005578 | Ga0068854_100398229 | Ga0068854_1003982292 | 102 |
| 117 | 3300025921 | Ga0207652_10250922 | Ga0207652_102509222 | 102 |
| 118 | 3300025981 | Ga0207640_10229284 | Ga0207640_102292842 | 102 |
| 119 | 3300025981 | Ga0207640_10379668 | Ga0207640_103796682 | 102 |
| 120 | 3300037418 | Ga0395900_0015989 | Ga0395900_0015989_5726_6058 | 102 |
| 121 | 3300037466 | Ga0395898_1196651 | Ga0395898_1196651_84_416 | 102 |
| 122 | 3300037471 | Ga0395905_0097433 | Ga0395905_0097433_859_1191 | 102 |
| 123 | 3300038443 | Ga0395901_0941220 | Ga0395901_0941220_390_722 | 102 |
| 124 | 3300045976 | Ga0466967_0057413 | Ga0466967_0057413_1382_1765 | 102 |
| 125 | 3300046525 | Ga0495663_0113157 | Ga0495663_0113157_308_676 | 102 |
| 126 | 3300046616 | Ga0495668_0627628 | Ga0495668_0627628_114_482 | 102 |
| 127 | 3300046684 | Ga0495669_0091936 | Ga0495669_0091936_805_1173 | 102 |
| 128 | 3300046684 | Ga0495669_0117034 | Ga0495669_0117034_55_426 | 102 |
| 129 | 3300046684 | Ga0495669_0223791 | Ga0495669_0223791_156_497 | 102 |
| 130 | 3300047445 | Ga0495677_0020757 | Ga0495677_0020757_642_1010 | 102 |
| 131 | 3300047447 | Ga0495685_177692 | Ga0495685_177692_89_457 | 102 |
| 132 | 3300005367 | Ga0070667_102207795 | Ga0070667_1022077951 | 103 |
| 133 | 3300005614 | Ga0068856_100712708 | Ga0068856_1007127081 | 103 |
| 134 | 3300009174 | Ga0105241_10071184 | Ga0105241_100711845 | 103 |
| 135 | 3300021384 | Ga0213876_10007945 | Ga0213876_100079455 | 103 |
| 136 | 3300025904 | Ga0207647_10427972 | Ga0207647_104279722 | 103 |
| 137 | 3300025972 | Ga0207668_10218701 | Ga0207668_102187014 | 103 |
| 138 | 3300037471 | Ga0395905_0831453 | Ga0395905_0831453_36_377 | 103 |
| 139 | 3300037471 | Ga0395905_1422028 | Ga0395905_1422028_182_559 | 103 |
| 140 | 3300039437 | Ga0436365_0440923 | Ga0436365_0440923_11845_12186 | 103 |
| 141 | 3300044684 | Ga0466966_0232422 | Ga0466966_0232422_547_924 | 103 |
| 142 | 3300045976 | Ga0466967_0275573 | Ga0466967_0275573_487_855 | 103 |
| 143 | 3300046684 | Ga0495669_0586047 | Ga0495669_0586047_48_392 | 103 |
| 144 | 3300005327 | Ga0070658_10140143 | Ga0070658_101401432 | 104 |
| 145 | 3300005327 | Ga0070658_10191926 | Ga0070658_101919264 | 104 |
| 146 | 3300005338 | Ga0068868_100159778 | Ga0068868_1001597783 | 104 |
| 147 | 3300005339 | Ga0070660_100071720 | Ga0070660_1000717204 | 104 |
| 148 | 3300005339 | Ga0070660_101697709 | Ga0070660_1016977091 | 104 |
| 149 | 3300005344 | Ga0070661_100116791 | Ga0070661_1001167914 | 104 |
| 150 | 3300005353 | Ga0070669_100212017 | Ga0070669_1002120172 | 104 |
| 151 | 3300005354 | Ga0070675_101875087 | Ga0070675_1018750871 | 104 |
| 152 | 3300005355 | Ga0070671_100072474 | Ga0070671_1000724742 | 104 |
| 153 | 3300005366 | Ga0070659_100315714 | Ga0070659_1003157142 | 104 |
| 154 | 3300005455 | Ga0070663_100199032 | Ga0070663_1001990322 | 104 |
| 155 | 3300005457 | Ga0070662_100784755 | Ga0070662_1007847552 | 104 |
| 156 | 3300005457 | Ga0070662_100887232 | Ga0070662_1008872321 | 104 |
| 157 | 3300005543 | Ga0070672_100155007 | Ga0070672_1001550074 | 104 |
| 158 | 3300005543 | Ga0070672_101130684 | Ga0070672_1011306842 | 104 |
| 159 | 3300005547 | Ga0070693_100322306 | Ga0070693_1003223062 | 104 |
| 160 | 3300005564 | Ga0070664_100033519 | Ga0070664_1000335192 | 104 |
| 161 | 3300005564 | Ga0070664_100173788 | Ga0070664_1001737882 | 104 |
| 162 | 3300005577 | Ga0068857_100304538 | Ga0068857_1003045382 | 104 |
| 163 | 3300005578 | Ga0068854_100189266 | Ga0068854_1001892662 | 104 |
| 164 | 3300005616 | Ga0068852_100215940 | Ga0068852_1002159404 | 104 |
| 165 | 3300005617 | Ga0068859_100088140 | Ga0068859_1000881403 | 104 |
| 166 | 3300005618 | Ga0068864_100024534 | Ga0068864_1000245347 | 104 |
| 167 | 3300005618 | Ga0068864_100749874 | Ga0068864_1007498742 | 104 |
| 168 | 3300005834 | Ga0068851_10398996 | Ga0068851_103989962 | 104 |
| 169 | 3300005841 | Ga0068863_100060705 | Ga0068863_1000607052 | 104 |
| 170 | 3300005841 | Ga0068863_101112041 | Ga0068863_1011120412 | 104 |
| 171 | 3300005842 | Ga0068858_100302328 | Ga0068858_1003023282 | 104 |
| 172 | 3300005843 | Ga0068860_100398939 | Ga0068860_1003989392 | 104 |
| 173 | 3300005844 | Ga0068862_100482614 | Ga0068862_1004826142 | 104 |
| 174 | 3300006852 | Ga0075433_10267382 | Ga0075433_102673823 | 104 |
| 175 | 3300006931 | Ga0097620_100088137 | Ga0097620_1000881373 | 104 |
| 176 | 3300009177 | Ga0105248_10000269 | Ga0105248_100002692 | 104 |
| 177 | 3300009553 | Ga0105249_10224274 | Ga0105249_102242743 | 104 |
| 178 | 3300011119 | Ga0105246_10196525 | Ga0105246_101965252 | 104 |
| 179 | 3300013308 | Ga0157375_10396567 | Ga0157375_103965674 | 104 |
| 180 | 3300014745 | Ga0157377_10065466 | Ga0157377_100654664 | 104 |
| 181 | 3300025315 | Ga0207697_10034678 | Ga0207697_100346784 | 104 |
| 182 | 3300025901 | Ga0207688_10063412 | Ga0207688_100634122 | 104 |
| 183 | 3300025909 | Ga0207705_10226900 | Ga0207705_102269003 | 104 |
| 184 | 3300025919 | Ga0207657_10206512 | Ga0207657_102065122 | 104 |
| 185 | 3300025920 | Ga0207649_10361078 | Ga0207649_103610782 | 104 |
| 186 | 3300025923 | Ga0207681_10144688 | Ga0207681_101446882 | 104 |
| 187 | 3300025931 | Ga0207644_10024128 | Ga0207644_100241286 | 104 |
| 188 | 3300025932 | Ga0207690_10277340 | Ga0207690_102773402 | 104 |
| 189 | 3300025933 | Ga0207706_10313763 | Ga0207706_103137632 | 104 |
| 190 | 3300025940 | Ga0207691_10112350 | Ga0207691_101123502 | 104 |
| 191 | 3300025941 | Ga0207711_10004591 | Ga0207711_1000459110 | 104 |
| 192 | 3300025942 | Ga0207689_10006847 | Ga0207689_100068472 | 104 |
| 193 | 3300025945 | Ga0207679_10113610 | Ga0207679_101136104 | 104 |
| 194 | 3300025945 | Ga0207679_10135168 | Ga0207679_101351683 | 104 |
| 195 | 3300025961 | Ga0207712_10682832 | Ga0207712_106828321 | 104 |
| 196 | 3300025981 | Ga0207640_10840637 | Ga0207640_108406372 | 104 |
| 197 | 3300025986 | Ga0207658_10153434 | Ga0207658_101534342 | 104 |
| 198 | 3300026023 | Ga0207677_10577563 | Ga0207677_105775632 | 104 |
| 199 | 3300026035 | Ga0207703_10055543 | Ga0207703_100555433 | 104 |
| 200 | 3300026067 | Ga0207678_10416042 | Ga0207678_104160422 | 104 |
| 201 | 3300026088 | Ga0207641_10089057 | Ga0207641_100890572 | 104 |
| 202 | 3300026095 | Ga0207676_10015646 | Ga0207676_100156463 | 104 |
| 203 | 3300026116 | Ga0207674_10392385 | Ga0207674_103923852 | 104 |
| 204 | 3300026142 | Ga0207698_10237755 | Ga0207698_102377552 | 104 |
| 205 | 3300028380 | Ga0268265_10089795 | Ga0268265_100897952 | 104 |
| 206 | 3300028380 | Ga0268265_10143956 | Ga0268265_101439563 | 104 |
| 207 | 3300035091 | Ga0373951_0286487 | Ga0373951_0286487_20_361 | 104 |
| 208 | 3300035114 | Ga0373939_0456033 | Ga0373939_0456033_135_476 | 104 |
| 209 | 3300035115 | Ga0373941_0193882 | Ga0373941_0193882_150_491 | 104 |
| 210 | 3300037471 | Ga0395905_0004552 | Ga0395905_0004552_70_453 | 104 |
| 211 | 3300044693 | Ga0466961_0764214 | Ga0466961_0764214_162_539 | 104 |
| 212 | 3300044735 | Ga0466968_0505450 | Ga0466968_0505450_63_440 | 104 |
| 213 | 3300045836 | Ga0466958_1026428 | Ga0466958_1026428_143_520 | 104 |
| 214 | 3300045976 | Ga0466967_0644180 | Ga0466967_0644180_377_754 | 104 |
| 215 | 3300048904 | Ga0496101_0022205 | Ga0496101_0022205_1823_2191 | 104 |
| 216 | 3300048909 | Ga0496106_0007365 | Ga0496106_0007365_6810_7178 | 104 |
| 217 | 3300048910 | Ga0496107_0021737 | Ga0496107_0021737_3355_3723 | 104 |
| 218 | 3300048911 | Ga0496108_0014814 | Ga0496108_0014814_5259_5627 | 104 |
| 219 | 3300048912 | Ga0496109_0004961 | Ga0496109_0004961_2178_2546 | 104 |
| 220 | 3300048913 | Ga0496110_0038463 | Ga0496110_0038463_796_1164 | 104 |
| 221 | 3300048914 | Ga0496111_0000342 | Ga0496111_0000342_699_1067 | 104 |
| 222 | 3300048914 | Ga0496111_0745089 | Ga0496111_0745089_146_529 | 104 |
| 223 | 3300048915 | Ga0496112_0005863 | Ga0496112_0005863_9077_9445 | 104 |
| 224 | 3300048916 | Ga0496113_0112679 | Ga0496113_0112679_390_758 | 104 |
| 225 | 3300048916 | Ga0496113_0623279 | Ga0496113_0623279_263_646 | 104 |
| 226 | 3300050515 | nmdc:mga0a205_18103_c1 | nmdc:mga0a205_18103_c1_1013_1354 | 104 |
| 227 | 3300061719 | Ga0466962_0443365 | Ga0466962_0443365_88_465 | 104 |
| 228 | 3300001977 | JGI24746J21847_1006385 | JGI24746J21847_10063852 | 105 |
| 229 | 3300001978 | JGI24747J21853_1002022 | JGI24747J21853_10020223 | 105 |
| 230 | 3300001989 | JGI24739J22299_10028590 | JGI24739J22299_100285902 | 105 |
| 231 | 3300001990 | JGI24737J22298_10006005 | JGI24737J22298_100060053 | 105 |
| 232 | 3300001991 | JGI24743J22301_10006940 | JGI24743J22301_100069403 | 105 |
| 233 | 3300002073 | JGI24745J21846_1000475 | JGI24745J21846_10004753 | 105 |
| 234 | 3300002075 | JGI24738J21930_10003652 | JGI24738J21930_100036524 | 105 |
| 235 | 3300002077 | JGI24744J21845_10000507 | JGI24744J21845_100005075 | 105 |
| 236 | 3300002244 | JGI24742J22300_10004609 | JGI24742J22300_100046093 | 105 |
| 237 | 3300005331 | Ga0070670_100069930 | Ga0070670_1000699303 | 105 |
| 238 | 3300005336 | Ga0070680_100511634 | Ga0070680_1005116342 | 105 |
| 239 | 3300005337 | Ga0070682_100205713 | Ga0070682_1002057132 | 105 |
| 240 | 3300005344 | Ga0070661_100086650 | Ga0070661_1000866504 | 105 |
| 241 | 3300005344 | Ga0070661_100448942 | Ga0070661_1004489423 | 105 |
| 242 | 3300005347 | Ga0070668_101468519 | Ga0070668_1014685192 | 105 |
| 243 | 3300005353 | Ga0070669_100116249 | Ga0070669_1001162492 | 105 |
| 244 | 3300005353 | Ga0070669_100480643 | Ga0070669_1004806431 | 105 |
| 245 | 3300005354 | Ga0070675_100272924 | Ga0070675_1002729244 | 105 |
| 246 | 3300005355 | Ga0070671_100253062 | Ga0070671_1002530623 | 105 |
| 247 | 3300005356 | Ga0070674_100061418 | Ga0070674_1000614182 | 105 |
| 248 | 3300005364 | Ga0070673_100073492 | Ga0070673_1000734923 | 105 |
| 249 | 3300005366 | Ga0070659_100182160 | Ga0070659_1001821602 | 105 |
| 250 | 3300005367 | Ga0070667_100139679 | Ga0070667_1001396793 | 105 |
| 251 | 3300005367 | Ga0070667_100328233 | Ga0070667_1003282332 | 105 |
| 252 | 3300005455 | Ga0070663_100039104 | Ga0070663_1000391042 | 105 |
| 253 | 3300005455 | Ga0070663_100092002 | Ga0070663_1000920022 | 105 |
| 254 | 3300005456 | Ga0070678_100066889 | Ga0070678_1000668894 | 105 |
| 255 | 3300005530 | Ga0070679_100696708 | Ga0070679_1006967081 | 105 |
| 256 | 3300005539 | Ga0068853_100117531 | Ga0068853_1001175313 | 105 |
| 257 | 3300005543 | Ga0070672_100081851 | Ga0070672_1000818512 | 105 |
| 258 | 3300005563 | Ga0068855_100208814 | Ga0068855_1002088142 | 105 |
| 259 | 3300005564 | Ga0070664_100017284 | Ga0070664_1000172842 | 105 |
| 260 | 3300005564 | Ga0070664_100027446 | Ga0070664_1000274463 | 105 |
| 261 | 3300005577 | Ga0068857_100002631 | Ga0068857_10000263112 | 105 |
| 262 | 3300005578 | Ga0068854_100023236 | Ga0068854_1000232364 | 105 |
| 263 | 3300005616 | Ga0068852_100211126 | Ga0068852_1002111262 | 105 |
| 264 | 3300005617 | Ga0068859_100004301 | Ga0068859_10000430112 | 105 |
| 265 | 3300005618 | Ga0068864_100015554 | Ga0068864_1000155543 | 105 |
| 266 | 3300005718 | Ga0068866_10650393 | Ga0068866_106503932 | 105 |
| 267 | 3300005841 | Ga0068863_100012961 | Ga0068863_1000129614 | 105 |
| 268 | 3300005841 | Ga0068863_100966112 | Ga0068863_1009661122 | 105 |
| 269 | 3300005842 | Ga0068858_100042344 | Ga0068858_1000423446 | 105 |
| 270 | 3300005843 | Ga0068860_100013427 | Ga0068860_1000134274 | 105 |
| 271 | 3300005844 | Ga0068862_100016716 | Ga0068862_1000167162 | 105 |
| 272 | 3300006237 | Ga0097621_100032280 | Ga0097621_1000322805 | 105 |
| 273 | 3300006931 | Ga0097620_100004301 | Ga0097620_10000430112 | 105 |
| 274 | 3300009098 | Ga0105245_10120514 | Ga0105245_101205143 | 105 |
| 275 | 3300009148 | Ga0105243_10040963 | Ga0105243_100409632 | 105 |
| 276 | 3300009174 | Ga0105241_10208062 | Ga0105241_102080623 | 105 |
| 277 | 3300009174 | Ga0105241_10310552 | Ga0105241_103105523 | 105 |
| 278 | 3300009553 | Ga0105249_10019016 | Ga0105249_100190163 | 105 |
| 279 | 3300013100 | Ga0157373_10136161 | Ga0157373_101361614 | 105 |
| 280 | 3300013105 | Ga0157369_10102999 | Ga0157369_101029994 | 105 |
| 281 | 3300013296 | Ga0157374_10511670 | Ga0157374_105116703 | 105 |
| 282 | 3300013297 | Ga0157378_10015380 | Ga0157378_100153806 | 105 |
| 283 | 3300013306 | Ga0163162_10503131 | Ga0163162_105031312 | 105 |
| 284 | 3300014326 | Ga0157380_10567903 | Ga0157380_105679032 | 105 |
| 285 | 3300014968 | Ga0157379_12167833 | Ga0157379_121678332 | 105 |
| 286 | 3300025315 | Ga0207697_10023020 | Ga0207697_100230204 | 105 |
| 287 | 3300025893 | Ga0207682_10008330 | Ga0207682_100083302 | 105 |
| 288 | 3300025899 | Ga0207642_10249567 | Ga0207642_102495672 | 105 |
| 289 | 3300025901 | Ga0207688_10008353 | Ga0207688_100083534 | 105 |
| 290 | 3300025907 | Ga0207645_10016295 | Ga0207645_100162955 | 105 |
| 291 | 3300025909 | Ga0207705_10612199 | Ga0207705_106121992 | 105 |
| 292 | 3300025911 | Ga0207654_10202303 | Ga0207654_102023033 | 105 |
| 293 | 3300025911 | Ga0207654_10546006 | Ga0207654_105460062 | 105 |
| 294 | 3300025917 | Ga0207660_10793878 | Ga0207660_107938782 | 105 |
| 295 | 3300025919 | Ga0207657_10028000 | Ga0207657_100280003 | 105 |
| 296 | 3300025920 | Ga0207649_10045189 | Ga0207649_100451893 | 105 |
| 297 | 3300025920 | Ga0207649_10046606 | Ga0207649_100466064 | 105 |
| 298 | 3300025923 | Ga0207681_10164182 | Ga0207681_101641822 | 105 |
| 299 | 3300025923 | Ga0207681_10609962 | Ga0207681_106099622 | 105 |
| 300 | 3300025925 | Ga0207650_10044704 | Ga0207650_100447043 | 105 |
| 301 | 3300025925 | Ga0207650_10115214 | Ga0207650_101152142 | 105 |
| 302 | 3300025926 | Ga0207659_10064439 | Ga0207659_100644394 | 105 |
| 303 | 3300025926 | Ga0207659_10169440 | Ga0207659_101694403 | 105 |
| 304 | 3300025933 | Ga0207706_10014742 | Ga0207706_100147428 | 105 |
| 305 | 3300025935 | Ga0207709_10114980 | Ga0207709_101149802 | 105 |
| 306 | 3300025935 | Ga0207709_10759761 | Ga0207709_107597612 | 105 |
| 307 | 3300025936 | Ga0207670_10334169 | Ga0207670_103341693 | 105 |
| 308 | 3300025940 | Ga0207691_10214449 | Ga0207691_102144493 | 105 |
| 309 | 3300025941 | Ga0207711_10119253 | Ga0207711_101192532 | 105 |
| 310 | 3300025942 | Ga0207689_10006231 | Ga0207689_100062318 | 105 |
| 311 | 3300025945 | Ga0207679_10013308 | Ga0207679_100133085 | 105 |
| 312 | 3300025945 | Ga0207679_10101395 | Ga0207679_101013951 | 105 |
| 313 | 3300025961 | Ga0207712_10033970 | Ga0207712_100339702 | 105 |
| 314 | 3300025981 | Ga0207640_10075918 | Ga0207640_100759184 | 105 |
| 315 | 3300025986 | Ga0207658_10305910 | Ga0207658_103059103 | 105 |
| 316 | 3300026035 | Ga0207703_10630578 | Ga0207703_106305782 | 105 |
| 317 | 3300026035 | Ga0207703_11000560 | Ga0207703_110005602 | 105 |
| 318 | 3300026041 | Ga0207639_10175169 | Ga0207639_101751693 | 105 |
| 319 | 3300026067 | Ga0207678_10021310 | Ga0207678_100213105 | 105 |
| 320 | 3300026067 | Ga0207678_10055099 | Ga0207678_100550992 | 105 |
| 321 | 3300026088 | Ga0207641_10052673 | Ga0207641_100526733 | 105 |
| 322 | 3300026088 | Ga0207641_10260043 | Ga0207641_102600432 | 105 |
| 323 | 3300026089 | Ga0207648_10009361 | Ga0207648_100093619 | 105 |
| 324 | 3300026095 | Ga0207676_10001309 | Ga0207676_100013095 | 105 |
| 325 | 3300026095 | Ga0207676_10459553 | Ga0207676_104595533 | 105 |
| 326 | 3300026116 | Ga0207674_10302515 | Ga0207674_103025152 | 105 |
| 327 | 3300026118 | Ga0207675_100143816 | Ga0207675_1001438164 | 105 |
| 328 | 3300026121 | Ga0207683_10038452 | Ga0207683_100384524 | 105 |
| 329 | 3300026142 | Ga0207698_10441084 | Ga0207698_104410842 | 105 |
| 330 | 3300028381 | Ga0268264_10021267 | Ga0268264_100212676 | 105 |
| 331 | 3300035088 | Ga0373940_0013620 | Ga0373940_0013620_767_1111 | 105 |
| 332 | 3300044684 | Ga0466966_0040985 | Ga0466966_0040985_784_1170 | 105 |
| 333 | 3300045049 | Ga0466959_0128498 | Ga0466959_0128498_635_1021 | 105 |
| 334 | 3300045976 | Ga0466967_0253621 | Ga0466967_0253621_435_794 | 105 |
| 335 | 3300048905 | Ga0496102_0122899 | Ga0496102_0122899_977_1363 | 105 |
| 336 | 3300048906 | Ga0496103_0079072 | Ga0496103_0079072_545_931 | 105 |
| 337 | 3300048911 | Ga0496108_0756259 | Ga0496108_0756259_269_613 | 105 |
| 338 | 3300048912 | Ga0496109_0153326 | Ga0496109_0153326_289_633 | 105 |
| 339 | 3300048915 | Ga0496112_0026765 | Ga0496112_0026765_4612_4998 | 105 |
| 340 | 3300001915 | JGI24741J21665_1008768 | JGI24741J21665_10087683 | 106 |
| 341 | 3300001979 | JGI24740J21852_10007981 | JGI24740J21852_100079812 | 106 |
| 342 | 3300001989 | JGI24739J22299_10029992 | JGI24739J22299_100299923 | 106 |
| 343 | 3300002067 | JGI24735J21928_10024361 | JGI24735J21928_100243612 | 106 |
| 344 | 3300005327 | Ga0070658_10396316 | Ga0070658_103963161 | 106 |
| 345 | 3300005329 | Ga0070683_100010266 | Ga0070683_1000102667 | 106 |
| 346 | 3300005336 | Ga0070680_100226528 | Ga0070680_1002265282 | 106 |
| 347 | 3300005337 | Ga0070682_100080848 | Ga0070682_1000808482 | 106 |
| 348 | 3300005341 | Ga0070691_10096919 | Ga0070691_100969193 | 106 |
| 349 | 3300005344 | Ga0070661_100081906 | Ga0070661_1000819062 | 106 |
| 350 | 3300005366 | Ga0070659_100495928 | Ga0070659_1004959281 | 106 |
| 351 | 3300005455 | Ga0070663_100036659 | Ga0070663_1000366595 | 106 |
| 352 | 3300005457 | Ga0070662_100046561 | Ga0070662_1000465615 | 106 |
| 353 | 3300005539 | Ga0068853_100252582 | Ga0068853_1002525822 | 106 |
| 354 | 3300005547 | Ga0070693_100083556 | Ga0070693_1000835564 | 106 |
| 355 | 3300005563 | Ga0068855_100019628 | Ga0068855_1000196289 | 106 |
| 356 | 3300005564 | Ga0070664_100135240 | Ga0070664_1001352402 | 106 |
| 357 | 3300005577 | Ga0068857_100025044 | Ga0068857_1000250445 | 106 |
| 358 | 3300005578 | Ga0068854_100050371 | Ga0068854_1000503714 | 106 |
| 359 | 3300013100 | Ga0157373_10080578 | Ga0157373_100805784 | 106 |
| 360 | 3300013100 | Ga0157373_11536328 | Ga0157373_115363281 | 106 |
| 361 | 3300013104 | Ga0157370_10796712 | Ga0157370_107967122 | 106 |
| 362 | 3300013307 | Ga0157372_10006954 | Ga0157372_1000695410 | 106 |
| 363 | 3300025909 | Ga0207705_10006095 | Ga0207705_100060955 | 106 |
| 364 | 3300025912 | Ga0207707_10004365 | Ga0207707_100043659 | 106 |
| 365 | 3300025917 | Ga0207660_10001982 | Ga0207660_100019825 | 106 |
| 366 | 3300025919 | Ga0207657_10044544 | Ga0207657_100445442 | 106 |
| 367 | 3300025920 | Ga0207649_10005743 | Ga0207649_100057435 | 106 |
| 368 | 3300025921 | Ga0207652_10003434 | Ga0207652_100034348 | 106 |
| 369 | 3300025932 | Ga0207690_10001200 | Ga0207690_100012008 | 106 |
| 370 | 3300025933 | Ga0207706_10011697 | Ga0207706_100116977 | 106 |
| 371 | 3300025944 | Ga0207661_10434727 | Ga0207661_104347273 | 106 |
| 372 | 3300025945 | Ga0207679_10078653 | Ga0207679_100786535 | 106 |
| 373 | 3300025949 | Ga0207667_10408040 | Ga0207667_104080403 | 106 |
| 374 | 3300025981 | Ga0207640_10012265 | Ga0207640_100122657 | 106 |
| 375 | 3300026041 | Ga0207639_10032844 | Ga0207639_100328442 | 106 |
| 376 | 3300026067 | Ga0207678_10055740 | Ga0207678_100557405 | 106 |
| 377 | 3300026116 | Ga0207674_10007818 | Ga0207674_1000781812 | 106 |
| 378 | 3300026142 | Ga0207698_10711002 | Ga0207698_107110022 | 106 |
| 379 | 3300037312 | Ga0395899_0332077 | Ga0395899_0332077_591_932 | 106 |
| 380 | 3300037466 | Ga0395898_0364479 | Ga0395898_0364479_412_753 | 106 |
| 381 | 3300037471 | Ga0395905_0211258 | Ga0395905_0211258_806_1135 | 106 |
| 382 | 3300037471 | Ga0395905_0504935 | Ga0395905_0504935_27_368 | 106 |
| 383 | 3300037471 | Ga0395905_0676187 | Ga0395905_0676187_85_426 | 106 |
| 384 | 3300042157 | Ga0439458_0124519 | Ga0439458_0124519_66_416 | 106 |
| 385 | 3300050493 | nmdc:mga0k408_128530_c1 | nmdc:mga0k408_128530_c1_327_710 | 106 |
| 386 | 3300053083 | Ga0495655_0109254 | Ga0495655_0109254_34_369 | 106 |
| 387 | 3300005334 | Ga0068869_100404307 | Ga0068869_1004043073 | 107 |
| 388 | 3300005338 | Ga0068868_100384664 | Ga0068868_1003846643 | 107 |
| 389 | 3300005339 | Ga0070660_100257756 | Ga0070660_1002577562 | 107 |
| 390 | 3300005347 | Ga0070668_100188721 | Ga0070668_1001887214 | 107 |
| 391 | 3300005353 | Ga0070669_100436851 | Ga0070669_1004368513 | 107 |
| 392 | 3300005354 | Ga0070675_101203042 | Ga0070675_1012030422 | 107 |
| 393 | 3300005355 | Ga0070671_100177644 | Ga0070671_1001776443 | 107 |
| 394 | 3300005364 | Ga0070673_100007743 | Ga0070673_1000077438 | 107 |
| 395 | 3300005366 | Ga0070659_100238674 | Ga0070659_1002386743 | 107 |
| 396 | 3300005367 | Ga0070667_100007145 | Ga0070667_1000071457 | 107 |
| 397 | 3300005455 | Ga0070663_100415200 | Ga0070663_1004152002 | 107 |
| 398 | 3300005539 | Ga0068853_100453911 | Ga0068853_1004539112 | 107 |
| 399 | 3300005539 | Ga0068853_102255296 | Ga0068853_1022552961 | 107 |
| 400 | 3300005543 | Ga0070672_100584461 | Ga0070672_1005844612 | 107 |
| 401 | 3300005548 | Ga0070665_100224567 | Ga0070665_1002245672 | 107 |
| 402 | 3300005616 | Ga0068852_100413239 | Ga0068852_1004132392 | 107 |
| 403 | 3300005616 | Ga0068852_102618875 | Ga0068852_1026188751 | 107 |
| 404 | 3300005617 | Ga0068859_100000144 | Ga0068859_10000014471 | 107 |
| 405 | 3300005618 | Ga0068864_100000092 | Ga0068864_10000009262 | 107 |
| 406 | 3300005719 | Ga0068861_100449001 | Ga0068861_1004490012 | 107 |
| 407 | 3300005841 | Ga0068863_100000222 | Ga0068863_10000022224 | 107 |
| 408 | 3300005842 | Ga0068858_100000256 | Ga0068858_10000025655 | 107 |
| 409 | 3300005843 | Ga0068860_100002571 | Ga0068860_1000025717 | 107 |
| 410 | 3300006237 | Ga0097621_100038079 | Ga0097621_1000380793 | 107 |
| 411 | 3300006931 | Ga0097620_100000144 | Ga0097620_1000001447 | 107 |
| 412 | 3300009092 | Ga0105250_10017542 | Ga0105250_100175422 | 107 |
| 413 | 3300009177 | Ga0105248_10000587 | Ga0105248_100005875 | 107 |
| 414 | 3300009553 | Ga0105249_10014489 | Ga0105249_100144892 | 107 |
| 415 | 3300013100 | Ga0157373_11300240 | Ga0157373_113002401 | 107 |
| 416 | 3300013105 | Ga0157369_11929875 | Ga0157369_119298751 | 107 |
| 417 | 3300013306 | Ga0163162_10032821 | Ga0163162_100328213 | 107 |
| 418 | 3300014325 | Ga0163163_10000080 | Ga0163163_1000008060 | 107 |
| 419 | 3300014969 | Ga0157376_11671404 | Ga0157376_116714042 | 107 |
| 420 | 3300014969 | Ga0157376_12468328 | Ga0157376_124683281 | 107 |
| 421 | 3300025711 | Ga0207696_1082874 | Ga0207696_10828743 | 107 |
| 422 | 3300025900 | Ga0207710_10091103 | Ga0207710_100911031 | 107 |
| 423 | 3300025919 | Ga0207657_10307826 | Ga0207657_103078262 | 107 |
| 424 | 3300025920 | Ga0207649_10217854 | Ga0207649_102178542 | 107 |
| 425 | 3300025923 | Ga0207681_10035676 | Ga0207681_100356764 | 107 |
| 426 | 3300025926 | Ga0207659_11037616 | Ga0207659_110376162 | 107 |
| 427 | 3300025931 | Ga0207644_10032109 | Ga0207644_100321093 | 107 |
| 428 | 3300025932 | Ga0207690_10533421 | Ga0207690_105334212 | 107 |
| 429 | 3300025933 | Ga0207706_10353086 | Ga0207706_103530863 | 107 |
| 430 | 3300025940 | Ga0207691_10843045 | Ga0207691_108430452 | 107 |
| 431 | 3300025941 | Ga0207711_10000423 | Ga0207711_1000042341 | 107 |
| 432 | 3300025949 | Ga0207667_10763532 | Ga0207667_107635322 | 107 |
| 433 | 3300025949 | Ga0207667_11509729 | Ga0207667_115097291 | 107 |
| 434 | 3300025960 | Ga0207651_10009499 | Ga0207651_100094997 | 107 |
| 435 | 3300025961 | Ga0207712_10194768 | Ga0207712_101947683 | 107 |
| 436 | 3300025972 | Ga0207668_10170457 | Ga0207668_101704574 | 107 |
| 437 | 3300025981 | Ga0207640_10161362 | Ga0207640_101613622 | 107 |
| 438 | 3300025986 | Ga0207658_10006795 | Ga0207658_100067958 | 107 |
| 439 | 3300026023 | Ga0207677_10492004 | Ga0207677_104920043 | 107 |
| 440 | 3300026035 | Ga0207703_10002144 | Ga0207703_1000214413 | 107 |
| 441 | 3300026041 | Ga0207639_10574208 | Ga0207639_105742082 | 107 |
| 442 | 3300026041 | Ga0207639_10611762 | Ga0207639_106117623 | 107 |
| 443 | 3300026067 | Ga0207678_10994520 | Ga0207678_109945202 | 107 |
| 444 | 3300026088 | Ga0207641_10000175 | Ga0207641_1000017541 | 107 |
| 445 | 3300026095 | Ga0207676_10000138 | Ga0207676_1000013837 | 107 |
| 446 | 3300026118 | Ga0207675_100362894 | Ga0207675_1003628943 | 107 |
| 447 | 3300028379 | Ga0268266_11379394 | Ga0268266_113793942 | 107 |
| 448 | 3300028381 | Ga0268264_10000932 | Ga0268264_1000093210 | 107 |
| 449 | 3300025981 | Ga0207640_10478998 | Ga0207640_104789981 | 108 |
| 450 | 3300042439 | Ga0439464_0000045 | Ga0439464_0000045_2661_3002 | 108 |
| 451 | 3300005327 | Ga0070658_10275584 | Ga0070658_102755842 | 109 |
| 452 | 3300005328 | Ga0070676_10298942 | Ga0070676_102989423 | 109 |
| 453 | 3300005333 | Ga0070677_10503708 | Ga0070677_105037081 | 109 |
| 454 | 3300005356 | Ga0070674_101743667 | Ga0070674_1017436672 | 109 |
| 455 | 3300005365 | Ga0070688_100357696 | Ga0070688_1003576962 | 109 |
| 456 | 3300005457 | Ga0070662_100369417 | Ga0070662_1003694172 | 109 |
| 457 | 3300014326 | Ga0157380_10164466 | Ga0157380_101644662 | 109 |
| 458 | 3300025901 | Ga0207688_10522860 | Ga0207688_105228601 | 109 |
| 459 | 3300025909 | Ga0207705_10271330 | Ga0207705_102713302 | 109 |
| 460 | 3300025937 | Ga0207669_10570779 | Ga0207669_105707791 | 109 |
| 461 | 3300042157 | Ga0439458_0015600 | Ga0439458_0015600_837_1205 | 109 |
| 462 | 3300042438 | Ga0439459_0054075 | Ga0439459_0054075_65_433 | 109 |
| 463 | 3300046616 | Ga0495668_0161966 | Ga0495668_0161966_239_574 | 109 |
| 464 | 3300046684 | Ga0495669_0008488 | Ga0495669_0008488_1457_1792 | 109 |
| 465 | 3300047445 | Ga0495677_0281889 | Ga0495677_0281889_236_571 | 109 |
| 466 | 3300048915 | Ga0496112_0017301 | Ga0496112_0017301_2900_3268 | 109 |
| 467 | 3300048916 | Ga0496113_0042123 | Ga0496113_0042123_849_1217 | 109 |
| 468 | 3300053134 | Ga0500658_0000149 | Ga0500658_0000149_27615_27950 | 109 |
| 469 | 3300005327 | Ga0070658_11161205 | Ga0070658_111612051 | 110 |
| 470 | 3300005334 | Ga0068869_100117695 | Ga0068869_1001176953 | 110 |
| 471 | 3300005343 | Ga0070687_101202979 | Ga0070687_1012029792 | 110 |
| 472 | 3300005364 | Ga0070673_100677603 | Ga0070673_1006776031 | 110 |
| 473 | 3300005365 | Ga0070688_101617766 | Ga0070688_1016177661 | 110 |
| 474 | 3300005366 | Ga0070659_101185975 | Ga0070659_1011859751 | 110 |
| 475 | 3300005459 | Ga0068867_100073777 | Ga0068867_1000737773 | 110 |
| 476 | 3300005546 | Ga0070696_100013815 | Ga0070696_1000138158 | 110 |
| 477 | 3300005578 | Ga0068854_100162773 | Ga0068854_1001627734 | 110 |
| 478 | 3300005617 | Ga0068859_100841577 | Ga0068859_1008415772 | 110 |
| 479 | 3300006880 | Ga0075429_100200592 | Ga0075429_1002005922 | 110 |
| 480 | 3300006931 | Ga0097620_100841622 | Ga0097620_1008416222 | 110 |
| 481 | 3300009098 | Ga0105245_10358422 | Ga0105245_103584223 | 110 |
| 482 | 3300009148 | Ga0105243_11678423 | Ga0105243_116784231 | 110 |
| 483 | 3300009148 | Ga0105243_12469514 | Ga0105243_124695142 | 110 |
| 484 | 3300013100 | Ga0157373_10014029 | Ga0157373_100140294 | 110 |
| 485 | 3300025903 | Ga0207680_10189755 | Ga0207680_101897552 | 110 |
| 486 | 3300025907 | Ga0207645_10046711 | Ga0207645_100467112 | 110 |
| 487 | 3300025909 | Ga0207705_10173089 | Ga0207705_101730893 | 110 |
| 488 | 3300025918 | Ga0207662_10870032 | Ga0207662_108700322 | 110 |
| 489 | 3300025933 | Ga0207706_10072809 | Ga0207706_100728095 | 110 |
| 490 | 3300025934 | Ga0207686_10280318 | Ga0207686_102803182 | 110 |
| 491 | 3300025942 | Ga0207689_10117126 | Ga0207689_101171264 | 110 |
| 492 | 3300025981 | Ga0207640_10213037 | Ga0207640_102130373 | 110 |
| 493 | 3300028380 | Ga0268265_10868240 | Ga0268265_108682402 | 110 |
| 494 | 3300037418 | Ga0395900_0960384 | Ga0395900_0960384_274_609 | 110 |
| 495 | 3300037466 | Ga0395898_0230832 | Ga0395898_0230832_868_1212 | 110 |
| 496 | 3300037471 | Ga0395905_0047727 | Ga0395905_0047727_2816_3160 | 110 |
| 497 | 3300038443 | Ga0395901_1624973 | Ga0395901_1624973_128_472 | 110 |
| 498 | 3300046525 | Ga0495663_0095136 | Ga0495663_0095136_474_809 | 110 |
| 499 | 3300046616 | Ga0495668_0030101 | Ga0495668_0030101_2673_3008 | 110 |
| 500 | 3300046660 | Ga0495625_0143163 | Ga0495625_0143163_445_780 | 110 |
| 501 | 3300046691 | Ga0495670_0475555 | Ga0495670_0475555_178_513 | 110 |
| 502 | 3300047445 | Ga0495677_0253125 | Ga0495677_0253125_97_432 | 110 |
| 503 | 3300047447 | Ga0495685_134930 | Ga0495685_134930_446_781 | 110 |
| 504 | 3300050508 | nmdc:mga09592_1001126_c1 | nmdc:mga09592_1001126_c1_72_407 | 110 |
| 505 | 3300050508 | nmdc:mga09592_176556_c1 | nmdc:mga09592_176556_c1_181_516 | 110 |
| 506 | 3300005327 | Ga0070658_10100941 | Ga0070658_101009413 | 111 |
| 507 | 3300005327 | Ga0070658_10628101 | Ga0070658_106281011 | 111 |
| 508 | 3300005334 | Ga0068869_100054585 | Ga0068869_1000545853 | 111 |
| 509 | 3300005347 | Ga0070668_100100226 | Ga0070668_1001002263 | 111 |
| 510 | 3300005356 | Ga0070674_101773166 | Ga0070674_1017731661 | 111 |
| 511 | 3300005366 | Ga0070659_100698811 | Ga0070659_1006988113 | 111 |
| 512 | 3300005367 | Ga0070667_101287472 | Ga0070667_1012874721 | 111 |
| 513 | 3300005459 | Ga0068867_100016338 | Ga0068867_1000163382 | 111 |
| 514 | 3300005539 | Ga0068853_100200540 | Ga0068853_1002005401 | 111 |
| 515 | 3300005539 | Ga0068853_100216968 | Ga0068853_1002169682 | 111 |
| 516 | 3300005718 | Ga0068866_10047459 | Ga0068866_100474592 | 111 |
| 517 | 3300005834 | Ga0068851_10001965 | Ga0068851_1000196510 | 111 |
| 518 | 3300005843 | Ga0068860_102283797 | Ga0068860_1022837972 | 111 |
| 519 | 3300005844 | Ga0068862_100011848 | Ga0068862_1000118489 | 111 |
| 520 | 3300005844 | Ga0068862_100740442 | Ga0068862_1007404421 | 111 |
| 521 | 3300006844 | Ga0075428_100869631 | Ga0075428_1008696311 | 111 |
| 522 | 3300009176 | Ga0105242_10483468 | Ga0105242_104834683 | 111 |
| 523 | 3300009177 | Ga0105248_11679374 | Ga0105248_116793742 | 111 |
| 524 | 3300009545 | Ga0105237_11002096 | Ga0105237_110020962 | 111 |
| 525 | 3300009551 | Ga0105238_11464585 | Ga0105238_114645851 | 111 |
| 526 | 3300009553 | Ga0105249_11003102 | Ga0105249_110031022 | 111 |
| 527 | 3300013306 | Ga0163162_11547204 | Ga0163162_115472042 | 111 |
| 528 | 3300013306 | Ga0163162_11641537 | Ga0163162_116415372 | 111 |
| 529 | 3300025321 | Ga0207656_10000430 | Ga0207656_1000043010 | 111 |
| 530 | 3300025899 | Ga0207642_10015428 | Ga0207642_100154284 | 111 |
| 531 | 3300025899 | Ga0207642_10753735 | Ga0207642_107537352 | 111 |
| 532 | 3300025909 | Ga0207705_10529905 | Ga0207705_105299051 | 111 |
| 533 | 3300025911 | Ga0207654_10684119 | Ga0207654_106841192 | 111 |
| 534 | 3300025933 | Ga0207706_10316647 | Ga0207706_103166472 | 111 |
| 535 | 3300025935 | Ga0207709_10284494 | Ga0207709_102844942 | 111 |
| 536 | 3300025945 | Ga0207679_11355498 | Ga0207679_113554981 | 111 |
| 537 | 3300025949 | Ga0207667_11261798 | Ga0207667_112617982 | 111 |
| 538 | 3300025986 | Ga0207658_11287585 | Ga0207658_112875852 | 111 |
| 539 | 3300026041 | Ga0207639_10023113 | Ga0207639_100231137 | 111 |
| 540 | 3300026089 | Ga0207648_10025288 | Ga0207648_100252887 | 111 |
| 541 | 3300028380 | Ga0268265_10001694 | Ga0268265_100016948 | 111 |
| 542 | 3300028380 | Ga0268265_11702388 | Ga0268265_117023881 | 111 |
| 543 | 3300031548 | Ga0307408_100012567 | Ga0307408_1000125674 | 111 |
| 544 | 3300031548 | Ga0307408_101614748 | Ga0307408_1016147482 | 111 |
| 545 | 3300031852 | Ga0307410_10005106 | Ga0307410_100051067 | 111 |
| 546 | 3300031903 | Ga0307407_10181568 | Ga0307407_101815682 | 111 |
| 547 | 3300031995 | Ga0307409_100052196 | Ga0307409_1000521965 | 111 |
| 548 | 3300032004 | Ga0307414_11015782 | Ga0307414_110157822 | 111 |
| 549 | 3300037418 | Ga0395900_0170157 | Ga0395900_0170157_1081_1419 | 111 |
| 550 | 3300037466 | Ga0395898_0226924 | Ga0395898_0226924_1046_1384 | 111 |
| 551 | 3300037471 | Ga0395905_0380525 | Ga0395905_0380525_680_1063 | 111 |
| 552 | 3300038443 | Ga0395901_0398839 | Ga0395901_0398839_224_562 | 111 |
| 553 | 3300044765 | Ga0466970_0149778 | Ga0466970_0149778_854_1225 | 111 |
| 554 | 3300047447 | Ga0495685_250863 | Ga0495685_250863_140_481 | 111 |
| 555 | 3300049822 | Ga0501035_0436671 | Ga0501035_0436671_573_941 | 111 |
| 556 | 3300001904 | JGI24736J21556_1029636 | JGI24736J21556_10296361 | 112 |
| 557 | 3300001976 | JGI24752J21851_1050345 | JGI24752J21851_10503451 | 112 |
| 558 | 3300001978 | JGI24747J21853_1040286 | JGI24747J21853_10402862 | 112 |
| 559 | 3300001979 | JGI24740J21852_10004747 | JGI24740J21852_100047477 | 112 |
| 560 | 3300001989 | JGI24739J22299_10002685 | JGI24739J22299_100026852 | 112 |
| 561 | 3300001990 | JGI24737J22298_10000665 | JGI24737J22298_100006652 | 112 |
| 562 | 3300002070 | JGI24750J21931_1040320 | JGI24750J21931_10403202 | 112 |
| 563 | 3300002073 | JGI24745J21846_1015883 | JGI24745J21846_10158832 | 112 |
| 564 | 3300002074 | JGI24748J21848_1004476 | JGI24748J21848_10044763 | 112 |
| 565 | 3300002075 | JGI24738J21930_10001343 | JGI24738J21930_100013432 | 112 |
| 566 | 3300002126 | JGI24035J26624_1005027 | JGI24035J26624_10050272 | 112 |
| 567 | 3300002239 | JGI24034J26672_10014574 | JGI24034J26672_100145742 | 112 |
| 568 | 3300005327 | Ga0070658_10758230 | Ga0070658_107582302 | 112 |
| 569 | 3300005327 | Ga0070658_10831631 | Ga0070658_108316312 | 112 |
| 570 | 3300005328 | Ga0070676_10100654 | Ga0070676_101006543 | 112 |
| 571 | 3300005328 | Ga0070676_10656459 | Ga0070676_106564592 | 112 |
| 572 | 3300005330 | Ga0070690_100067604 | Ga0070690_1000676044 | 112 |
| 573 | 3300005330 | Ga0070690_100192390 | Ga0070690_1001923902 | 112 |
| 574 | 3300005331 | Ga0070670_100016013 | Ga0070670_1000160137 | 112 |
| 575 | 3300005331 | Ga0070670_100276616 | Ga0070670_1002766163 | 112 |
| 576 | 3300005331 | Ga0070670_100393872 | Ga0070670_1003938722 | 112 |
| 577 | 3300005331 | Ga0070670_100531636 | Ga0070670_1005316363 | 112 |
| 578 | 3300005334 | Ga0068869_100000297 | Ga0068869_10000029711 | 112 |
| 579 | 3300005335 | Ga0070666_10034332 | Ga0070666_100343325 | 112 |
| 580 | 3300005335 | Ga0070666_11481040 | Ga0070666_114810402 | 112 |
| 581 | 3300005336 | Ga0070680_100795325 | Ga0070680_1007953252 | 112 |
| 582 | 3300005336 | Ga0070680_101871913 | Ga0070680_1018719131 | 112 |
| 583 | 3300005337 | Ga0070682_100608762 | Ga0070682_1006087622 | 112 |
| 584 | 3300005338 | Ga0068868_100002601 | Ga0068868_1000026015 | 112 |
| 585 | 3300005338 | Ga0068868_100274741 | Ga0068868_1002747412 | 112 |
| 586 | 3300005338 | Ga0068868_100984180 | Ga0068868_1009841801 | 112 |
| 587 | 3300005339 | Ga0070660_100005787 | Ga0070660_1000057879 | 112 |
| 588 | 3300005339 | Ga0070660_100011191 | Ga0070660_1000111911 | 112 |
| 589 | 3300005339 | Ga0070660_100017159 | Ga0070660_1000171597 | 112 |
| 590 | 3300005339 | Ga0070660_100090116 | Ga0070660_1000901164 | 112 |
| 591 | 3300005340 | Ga0070689_100025030 | Ga0070689_1000250302 | 112 |
| 592 | 3300005343 | Ga0070687_101115210 | Ga0070687_1011152101 | 112 |
| 593 | 3300005344 | Ga0070661_100028731 | Ga0070661_1000287315 | 112 |
| 594 | 3300005344 | Ga0070661_100155087 | Ga0070661_1001550872 | 112 |
| 595 | 3300005344 | Ga0070661_100183281 | Ga0070661_1001832813 | 112 |
| 596 | 3300005347 | Ga0070668_100000628 | Ga0070668_10000062810 | 112 |
| 597 | 3300005347 | Ga0070668_100025282 | Ga0070668_1000252822 | 112 |
| 598 | 3300005353 | Ga0070669_100003201 | Ga0070669_1000032013 | 112 |
| 599 | 3300005353 | Ga0070669_100043327 | Ga0070669_1000433272 | 112 |
| 600 | 3300005354 | Ga0070675_100027138 | Ga0070675_1000271382 | 112 |
| 601 | 3300005355 | Ga0070671_100008491 | Ga0070671_1000084919 | 112 |
| 602 | 3300005355 | Ga0070671_100036772 | Ga0070671_1000367722 | 112 |
| 603 | 3300005355 | Ga0070671_100076109 | Ga0070671_1000761094 | 112 |
| 604 | 3300005355 | Ga0070671_100106549 | Ga0070671_1001065493 | 112 |
| 605 | 3300005355 | Ga0070671_100379729 | Ga0070671_1003797291 | 112 |
| 606 | 3300005355 | Ga0070671_100535747 | Ga0070671_1005357473 | 112 |
| 607 | 3300005356 | Ga0070674_100195035 | Ga0070674_1001950352 | 112 |
| 608 | 3300005364 | Ga0070673_100000044 | Ga0070673_10000004429 | 112 |
| 609 | 3300005364 | Ga0070673_100400084 | Ga0070673_1004000841 | 112 |
| 610 | 3300005364 | Ga0070673_100593718 | Ga0070673_1005937182 | 112 |
| 611 | 3300005364 | Ga0070673_100753269 | Ga0070673_1007532692 | 112 |
| 612 | 3300005366 | Ga0070659_100000849 | Ga0070659_10000084913 | 112 |
| 613 | 3300005366 | Ga0070659_100044812 | Ga0070659_1000448122 | 112 |
| 614 | 3300005366 | Ga0070659_100227216 | Ga0070659_1002272162 | 112 |
| 615 | 3300005366 | Ga0070659_100347573 | Ga0070659_1003475732 | 112 |
| 616 | 3300005367 | Ga0070667_100022649 | Ga0070667_1000226497 | 112 |
| 617 | 3300005367 | Ga0070667_100543024 | Ga0070667_1005430242 | 112 |
| 618 | 3300005367 | Ga0070667_100837386 | Ga0070667_1008373862 | 112 |
| 619 | 3300005367 | Ga0070667_101353338 | Ga0070667_1013533382 | 112 |
| 620 | 3300005455 | Ga0070663_100155876 | Ga0070663_1001558763 | 112 |
| 621 | 3300005455 | Ga0070663_100321820 | Ga0070663_1003218202 | 112 |
| 622 | 3300005455 | Ga0070663_100743307 | Ga0070663_1007433072 | 112 |
| 623 | 3300005455 | Ga0070663_101292015 | Ga0070663_1012920151 | 112 |
| 624 | 3300005456 | Ga0070678_100103020 | Ga0070678_1001030202 | 112 |
| 625 | 3300005456 | Ga0070678_100178388 | Ga0070678_1001783882 | 112 |
| 626 | 3300005457 | Ga0070662_100026020 | Ga0070662_1000260205 | 112 |
| 627 | 3300005457 | Ga0070662_100468414 | Ga0070662_1004684142 | 112 |
| 628 | 3300005457 | Ga0070662_100680072 | Ga0070662_1006800722 | 112 |
| 629 | 3300005459 | Ga0068867_100006552 | Ga0068867_1000065522 | 112 |
| 630 | 3300005459 | Ga0068867_100021116 | Ga0068867_1000211167 | 112 |
| 631 | 3300005459 | Ga0068867_100415925 | Ga0068867_1004159253 | 112 |
| 632 | 3300005466 | Ga0070685_10833814 | Ga0070685_108338142 | 112 |
| 633 | 3300005530 | Ga0070679_100276328 | Ga0070679_1002763283 | 112 |
| 634 | 3300005530 | Ga0070679_100713441 | Ga0070679_1007134411 | 112 |
| 635 | 3300005539 | Ga0068853_100017061 | Ga0068853_1000170617 | 112 |
| 636 | 3300005543 | Ga0070672_100001174 | Ga0070672_10000117414 | 112 |
| 637 | 3300005543 | Ga0070672_100164156 | Ga0070672_1001641563 | 112 |
| 638 | 3300005543 | Ga0070672_100406974 | Ga0070672_1004069743 | 112 |
| 639 | 3300005543 | Ga0070672_101332553 | Ga0070672_1013325532 | 112 |
| 640 | 3300005543 | Ga0070672_101608646 | Ga0070672_1016086462 | 112 |
| 641 | 3300005563 | Ga0068855_100005808 | Ga0068855_10000580815 | 112 |
| 642 | 3300005563 | Ga0068855_101420276 | Ga0068855_1014202762 | 112 |
| 643 | 3300005564 | Ga0070664_100024270 | Ga0070664_1000242707 | 112 |
| 644 | 3300005564 | Ga0070664_100103382 | Ga0070664_1001033822 | 112 |
| 645 | 3300005564 | Ga0070664_100391516 | Ga0070664_1003915161 | 112 |
| 646 | 3300005564 | Ga0070664_101713614 | Ga0070664_1017136141 | 112 |
| 647 | 3300005577 | Ga0068857_100060082 | Ga0068857_1000600822 | 112 |
| 648 | 3300005577 | Ga0068857_100218169 | Ga0068857_1002181692 | 112 |
| 649 | 3300005578 | Ga0068854_100000934 | Ga0068854_10000093411 | 112 |
| 650 | 3300005578 | Ga0068854_100024434 | Ga0068854_1000244345 | 112 |
| 651 | 3300005614 | Ga0068856_100738998 | Ga0068856_1007389982 | 112 |
| 652 | 3300005615 | Ga0070702_100155568 | Ga0070702_1001555682 | 112 |
| 653 | 3300005616 | Ga0068852_100015762 | Ga0068852_1000157622 | 112 |
| 654 | 3300005616 | Ga0068852_100027422 | Ga0068852_1000274223 | 112 |
| 655 | 3300005616 | Ga0068852_100029603 | Ga0068852_1000296033 | 112 |
| 656 | 3300005616 | Ga0068852_100334681 | Ga0068852_1003346812 | 112 |
| 657 | 3300005617 | Ga0068859_100000799 | Ga0068859_10000079911 | 112 |
| 658 | 3300005617 | Ga0068859_100366149 | Ga0068859_1003661492 | 112 |
| 659 | 3300005617 | Ga0068859_100947068 | Ga0068859_1009470682 | 112 |
| 660 | 3300005617 | Ga0068859_102418835 | Ga0068859_1024188352 | 112 |
| 661 | 3300005618 | Ga0068864_100000552 | Ga0068864_10000055221 | 112 |
| 662 | 3300005618 | Ga0068864_100460892 | Ga0068864_1004608923 | 112 |
| 663 | 3300005718 | Ga0068866_10146270 | Ga0068866_101462702 | 112 |
| 664 | 3300005718 | Ga0068866_10598727 | Ga0068866_105987272 | 112 |
| 665 | 3300005719 | Ga0068861_100014258 | Ga0068861_1000142582 | 112 |
| 666 | 3300005834 | Ga0068851_10122159 | Ga0068851_101221592 | 112 |
| 667 | 3300005834 | Ga0068851_10467128 | Ga0068851_104671282 | 112 |
| 668 | 3300005840 | Ga0068870_10163063 | Ga0068870_101630632 | 112 |
| 669 | 3300005841 | Ga0068863_100020497 | Ga0068863_1000204972 | 112 |
| 670 | 3300005841 | Ga0068863_100176435 | Ga0068863_1001764352 | 112 |
| 671 | 3300005842 | Ga0068858_100026167 | Ga0068858_1000261673 | 112 |
| 672 | 3300005842 | Ga0068858_100045258 | Ga0068858_1000452582 | 112 |
| 673 | 3300005843 | Ga0068860_100007543 | Ga0068860_1000075439 | 112 |
| 674 | 3300005843 | Ga0068860_100058030 | Ga0068860_1000580306 | 112 |
| 675 | 3300005843 | Ga0068860_100315968 | Ga0068860_1003159684 | 112 |
| 676 | 3300005844 | Ga0068862_100146291 | Ga0068862_1001462913 | 112 |
| 677 | 3300005844 | Ga0068862_100430889 | Ga0068862_1004308892 | 112 |
| 678 | 3300005844 | Ga0068862_100446903 | Ga0068862_1004469032 | 112 |
| 679 | 3300005844 | Ga0068862_100502434 | Ga0068862_1005024342 | 112 |
| 680 | 3300006163 | Ga0070715_10722889 | Ga0070715_107228892 | 112 |
| 681 | 3300006237 | Ga0097621_100073583 | Ga0097621_1000735833 | 112 |
| 682 | 3300006237 | Ga0097621_100724886 | Ga0097621_1007248862 | 112 |
| 683 | 3300006237 | Ga0097621_101564106 | Ga0097621_1015641061 | 112 |
| 684 | 3300006358 | Ga0068871_100390025 | Ga0068871_1003900252 | 112 |
| 685 | 3300006881 | Ga0068865_100000440 | Ga0068865_10000044015 | 112 |
| 686 | 3300006881 | Ga0068865_100013435 | Ga0068865_1000134356 | 112 |
| 687 | 3300006881 | Ga0068865_100216099 | Ga0068865_1002160992 | 112 |
| 688 | 3300006931 | Ga0097620_100000799 | Ga0097620_10000079926 | 112 |
| 689 | 3300006931 | Ga0097620_100366171 | Ga0097620_1003661712 | 112 |
| 690 | 3300006931 | Ga0097620_100947061 | Ga0097620_1009470612 | 112 |
| 691 | 3300006931 | Ga0097620_102418381 | Ga0097620_1024183812 | 112 |
| 692 | 3300009098 | Ga0105245_10000709 | Ga0105245_1000070912 | 112 |
| 693 | 3300009101 | Ga0105247_10138621 | Ga0105247_101386212 | 112 |
| 694 | 3300009148 | Ga0105243_10025801 | Ga0105243_100258015 | 112 |
| 695 | 3300009148 | Ga0105243_11491130 | Ga0105243_114911302 | 112 |
| 696 | 3300009174 | Ga0105241_10264393 | Ga0105241_102643932 | 112 |
| 697 | 3300009176 | Ga0105242_10284148 | Ga0105242_102841482 | 112 |
| 698 | 3300009177 | Ga0105248_10000122 | Ga0105248_1000012293 | 112 |
| 699 | 3300009177 | Ga0105248_10061772 | Ga0105248_100617723 | 112 |
| 700 | 3300009177 | Ga0105248_10267318 | Ga0105248_102673183 | 112 |
| 701 | 3300009177 | Ga0105248_10610973 | Ga0105248_106109732 | 112 |
| 702 | 3300009177 | Ga0105248_10869471 | Ga0105248_108694712 | 112 |
| 703 | 3300009177 | Ga0105248_12026483 | Ga0105248_120264832 | 112 |
| 704 | 3300011119 | Ga0105246_10057757 | Ga0105246_100577573 | 112 |
| 705 | 3300012510 | Ga0157316_1052877 | Ga0157316_10528771 | 112 |
| 706 | 3300013100 | Ga0157373_10004213 | Ga0157373_1000421311 | 112 |
| 707 | 3300013100 | Ga0157373_10054170 | Ga0157373_100541702 | 112 |
| 708 | 3300013102 | Ga0157371_10004494 | Ga0157371_100044942 | 112 |
| 709 | 3300013102 | Ga0157371_11175777 | Ga0157371_111757771 | 112 |
| 710 | 3300013104 | Ga0157370_10073909 | Ga0157370_100739092 | 112 |
| 711 | 3300013296 | Ga0157374_10167199 | Ga0157374_101671993 | 112 |
| 712 | 3300013296 | Ga0157374_12697182 | Ga0157374_126971822 | 112 |
| 713 | 3300013297 | Ga0157378_10135845 | Ga0157378_101358453 | 112 |
| 714 | 3300013297 | Ga0157378_10210566 | Ga0157378_102105662 | 112 |
| 715 | 3300013306 | Ga0163162_10027500 | Ga0163162_100275006 | 112 |
| 716 | 3300013306 | Ga0163162_10190474 | Ga0163162_101904742 | 112 |
| 717 | 3300013306 | Ga0163162_10451804 | Ga0163162_104518043 | 112 |
| 718 | 3300013307 | Ga0157372_10669999 | Ga0157372_106699993 | 112 |
| 719 | 3300013308 | Ga0157375_10039226 | Ga0157375_100392265 | 112 |
| 720 | 3300013308 | Ga0157375_10045756 | Ga0157375_100457562 | 112 |
| 721 | 3300013308 | Ga0157375_10255336 | Ga0157375_102553362 | 112 |
| 722 | 3300013308 | Ga0157375_12371332 | Ga0157375_123713322 | 112 |
| 723 | 3300014325 | Ga0163163_12445992 | Ga0163163_124459922 | 112 |
| 724 | 3300014497 | Ga0182008_10309807 | Ga0182008_103098072 | 112 |
| 725 | 3300014745 | Ga0157377_10077311 | Ga0157377_100773112 | 112 |
| 726 | 3300014969 | Ga0157376_12621779 | Ga0157376_126217792 | 112 |
| 727 | 3300025290 | Ga0207673_1004407 | Ga0207673_10044071 | 112 |
| 728 | 3300025315 | Ga0207697_10000142 | Ga0207697_100001428 | 112 |
| 729 | 3300025321 | Ga0207656_10059770 | Ga0207656_100597702 | 112 |
| 730 | 3300025899 | Ga0207642_10228971 | Ga0207642_102289712 | 112 |
| 731 | 3300025900 | Ga0207710_10083747 | Ga0207710_100837473 | 112 |
| 732 | 3300025901 | Ga0207688_10002307 | Ga0207688_100023072 | 112 |
| 733 | 3300025901 | Ga0207688_10012721 | Ga0207688_100127211 | 112 |
| 734 | 3300025903 | Ga0207680_10013945 | Ga0207680_100139455 | 112 |
| 735 | 3300025903 | Ga0207680_10182224 | Ga0207680_101822242 | 112 |
| 736 | 3300025903 | Ga0207680_11146132 | Ga0207680_111461321 | 112 |
| 737 | 3300025904 | Ga0207647_10007744 | Ga0207647_100077448 | 112 |
| 738 | 3300025907 | Ga0207645_10014275 | Ga0207645_100142757 | 112 |
| 739 | 3300025907 | Ga0207645_10061366 | Ga0207645_100613661 | 112 |
| 740 | 3300025907 | Ga0207645_10134072 | Ga0207645_101340723 | 112 |
| 741 | 3300025908 | Ga0207643_10175118 | Ga0207643_101751182 | 112 |
| 742 | 3300025909 | Ga0207705_10011251 | Ga0207705_100112512 | 112 |
| 743 | 3300025909 | Ga0207705_10013901 | Ga0207705_100139014 | 112 |
| 744 | 3300025909 | Ga0207705_10018288 | Ga0207705_100182884 | 112 |
| 745 | 3300025909 | Ga0207705_10795515 | Ga0207705_107955152 | 112 |
| 746 | 3300025911 | Ga0207654_10380590 | Ga0207654_103805902 | 112 |
| 747 | 3300025917 | Ga0207660_10615752 | Ga0207660_106157522 | 112 |
| 748 | 3300025919 | Ga0207657_10007043 | Ga0207657_100070432 | 112 |
| 749 | 3300025919 | Ga0207657_10046598 | Ga0207657_100465982 | 112 |
| 750 | 3300025919 | Ga0207657_10165805 | Ga0207657_101658053 | 112 |
| 751 | 3300025920 | Ga0207649_10013587 | Ga0207649_100135874 | 112 |
| 752 | 3300025920 | Ga0207649_10114267 | Ga0207649_101142673 | 112 |
| 753 | 3300025920 | Ga0207649_10255863 | Ga0207649_102558632 | 112 |
| 754 | 3300025921 | Ga0207652_10293309 | Ga0207652_102933093 | 112 |
| 755 | 3300025921 | Ga0207652_10453817 | Ga0207652_104538172 | 112 |
| 756 | 3300025923 | Ga0207681_10000532 | Ga0207681_1000053211 | 112 |
| 757 | 3300025923 | Ga0207681_10051093 | Ga0207681_100510932 | 112 |
| 758 | 3300025925 | Ga0207650_10034920 | Ga0207650_100349202 | 112 |
| 759 | 3300025925 | Ga0207650_10110113 | Ga0207650_101101132 | 112 |
| 760 | 3300025925 | Ga0207650_10190082 | Ga0207650_101900823 | 112 |
| 761 | 3300025925 | Ga0207650_10545910 | Ga0207650_105459102 | 112 |
| 762 | 3300025926 | Ga0207659_10067887 | Ga0207659_100678872 | 112 |
| 763 | 3300025927 | Ga0207687_10006315 | Ga0207687_100063157 | 112 |
| 764 | 3300025931 | Ga0207644_10065496 | Ga0207644_100654962 | 112 |
| 765 | 3300025931 | Ga0207644_10194747 | Ga0207644_101947472 | 112 |
| 766 | 3300025931 | Ga0207644_10247038 | Ga0207644_102470382 | 112 |
| 767 | 3300025931 | Ga0207644_10486312 | Ga0207644_104863122 | 112 |
| 768 | 3300025931 | Ga0207644_10750920 | Ga0207644_107509202 | 112 |
| 769 | 3300025931 | Ga0207644_11719429 | Ga0207644_117194291 | 112 |
| 770 | 3300025932 | Ga0207690_10006450 | Ga0207690_100064507 | 112 |
| 771 | 3300025932 | Ga0207690_10127674 | Ga0207690_101276743 | 112 |
| 772 | 3300025932 | Ga0207690_10614012 | Ga0207690_106140122 | 112 |
| 773 | 3300025933 | Ga0207706_10003910 | Ga0207706_100039102 | 112 |
| 774 | 3300025933 | Ga0207706_10317742 | Ga0207706_103177423 | 112 |
| 775 | 3300025933 | Ga0207706_10531064 | Ga0207706_105310642 | 112 |
| 776 | 3300025934 | Ga0207686_10094527 | Ga0207686_100945273 | 112 |
| 777 | 3300025935 | Ga0207709_10062525 | Ga0207709_100625252 | 112 |
| 778 | 3300025935 | Ga0207709_10861303 | Ga0207709_108613032 | 112 |
| 779 | 3300025936 | Ga0207670_10012456 | Ga0207670_100124565 | 112 |
| 780 | 3300025937 | Ga0207669_10046809 | Ga0207669_100468094 | 112 |
| 781 | 3300025937 | Ga0207669_10065729 | Ga0207669_100657293 | 112 |
| 782 | 3300025938 | Ga0207704_10003358 | Ga0207704_100033586 | 112 |
| 783 | 3300025938 | Ga0207704_10340408 | Ga0207704_103404083 | 112 |
| 784 | 3300025938 | Ga0207704_10428717 | Ga0207704_104287173 | 112 |
| 785 | 3300025940 | Ga0207691_10001210 | Ga0207691_1000121025 | 112 |
| 786 | 3300025940 | Ga0207691_10049185 | Ga0207691_100491852 | 112 |
| 787 | 3300025940 | Ga0207691_10281570 | Ga0207691_102815702 | 112 |
| 788 | 3300025941 | Ga0207711_10035624 | Ga0207711_100356246 | 112 |
| 789 | 3300025941 | Ga0207711_10056610 | Ga0207711_100566102 | 112 |
| 790 | 3300025941 | Ga0207711_10073390 | Ga0207711_100733902 | 112 |
| 791 | 3300025941 | Ga0207711_10509561 | Ga0207711_105095612 | 112 |
| 792 | 3300025942 | Ga0207689_10000125 | Ga0207689_1000012535 | 112 |
| 793 | 3300025942 | Ga0207689_10150347 | Ga0207689_101503473 | 112 |
| 794 | 3300025945 | Ga0207679_10454422 | Ga0207679_104544222 | 112 |
| 795 | 3300025945 | Ga0207679_10939438 | Ga0207679_109394382 | 112 |
| 796 | 3300025945 | Ga0207679_11502907 | Ga0207679_115029071 | 112 |
| 797 | 3300025949 | Ga0207667_10040158 | Ga0207667_100401581 | 112 |
| 798 | 3300025949 | Ga0207667_11631274 | Ga0207667_116312741 | 112 |
| 799 | 3300025960 | Ga0207651_10047051 | Ga0207651_100470513 | 112 |
| 800 | 3300025960 | Ga0207651_10347742 | Ga0207651_103477423 | 112 |
| 801 | 3300025960 | Ga0207651_10955853 | Ga0207651_109558532 | 112 |
| 802 | 3300025972 | Ga0207668_10000689 | Ga0207668_1000068922 | 112 |
| 803 | 3300025972 | Ga0207668_10021174 | Ga0207668_100211744 | 112 |
| 804 | 3300025972 | Ga0207668_10413662 | Ga0207668_104136622 | 112 |
| 805 | 3300025981 | Ga0207640_10003384 | Ga0207640_100033847 | 112 |
| 806 | 3300025981 | Ga0207640_10321577 | Ga0207640_103215773 | 112 |
| 807 | 3300025986 | Ga0207658_10087229 | Ga0207658_100872295 | 112 |
| 808 | 3300025986 | Ga0207658_10241774 | Ga0207658_102417743 | 112 |
| 809 | 3300025986 | Ga0207658_10262662 | Ga0207658_102626622 | 112 |
| 810 | 3300026023 | Ga0207677_10003680 | Ga0207677_100036805 | 112 |
| 811 | 3300026035 | Ga0207703_10008974 | Ga0207703_100089748 | 112 |
| 812 | 3300026035 | Ga0207703_10076090 | Ga0207703_100760902 | 112 |
| 813 | 3300026041 | Ga0207639_10016831 | Ga0207639_100168313 | 112 |
| 814 | 3300026041 | Ga0207639_11703221 | Ga0207639_117032211 | 112 |
| 815 | 3300026067 | Ga0207678_10038015 | Ga0207678_100380152 | 112 |
| 816 | 3300026067 | Ga0207678_10386659 | Ga0207678_103866592 | 112 |
| 817 | 3300026078 | Ga0207702_10203575 | Ga0207702_102035753 | 112 |
| 818 | 3300026078 | Ga0207702_10457578 | Ga0207702_104575781 | 112 |
| 819 | 3300026088 | Ga0207641_10018525 | Ga0207641_100185254 | 112 |
| 820 | 3300026088 | Ga0207641_10452385 | Ga0207641_104523852 | 112 |
| 821 | 3300026088 | Ga0207641_10557419 | Ga0207641_105574193 | 112 |
| 822 | 3300026089 | Ga0207648_10001391 | Ga0207648_100013912 | 112 |
| 823 | 3300026089 | Ga0207648_10081154 | Ga0207648_100811544 | 112 |
| 824 | 3300026095 | Ga0207676_10001788 | Ga0207676_100017888 | 112 |
| 825 | 3300026095 | Ga0207676_10124656 | Ga0207676_101246562 | 112 |
| 826 | 3300026116 | Ga0207674_10003049 | Ga0207674_100030492 | 112 |
| 827 | 3300026116 | Ga0207674_10163297 | Ga0207674_101632973 | 112 |
| 828 | 3300026118 | Ga0207675_100013635 | Ga0207675_1000136359 | 112 |
| 829 | 3300026121 | Ga0207683_10012589 | Ga0207683_100125895 | 112 |
| 830 | 3300026121 | Ga0207683_10028509 | Ga0207683_100285096 | 112 |
| 831 | 3300026142 | Ga0207698_10001521 | Ga0207698_1000152111 | 112 |
| 832 | 3300026142 | Ga0207698_10033159 | Ga0207698_100331593 | 112 |
| 833 | 3300026142 | Ga0207698_10151200 | Ga0207698_101512004 | 112 |
| 834 | 3300026142 | Ga0207698_10235449 | Ga0207698_102354492 | 112 |
| 835 | 3300028380 | Ga0268265_10033660 | Ga0268265_100336604 | 112 |
| 836 | 3300028380 | Ga0268265_10104777 | Ga0268265_101047772 | 112 |
| 837 | 3300028380 | Ga0268265_10426584 | Ga0268265_104265842 | 112 |
| 838 | 3300028381 | Ga0268264_10016085 | Ga0268264_100160853 | 112 |
| 839 | 3300028381 | Ga0268264_10016864 | Ga0268264_100168644 | 112 |
| 840 | 3300028381 | Ga0268264_10411083 | Ga0268264_104110832 | 112 |
| 841 | 3300028381 | Ga0268264_11501681 | Ga0268264_115016812 | 112 |
| 842 | 3300031548 | Ga0307408_100545608 | Ga0307408_1005456082 | 112 |
| 843 | 3300031731 | Ga0307405_10692074 | Ga0307405_106920742 | 112 |
| 844 | 3300031901 | Ga0307406_11192029 | Ga0307406_111920292 | 112 |
| 845 | 3300032002 | Ga0307416_100352831 | Ga0307416_1003528313 | 112 |
| 846 | 3300032126 | Ga0307415_100000440 | Ga0307415_10000044014 | 112 |
| 847 | 3300035111 | Ga0373923_0019190 | Ga0373923_0019190_919_1287 | 112 |
| 848 | 3300035118 | Ga0373954_0059966 | Ga0373954_0059966_958_1326 | 112 |
| 849 | 3300035119 | Ga0373956_0408190 | Ga0373956_0408190_191_559 | 112 |
| 850 | 3300035172 | Ga0373955_0056091 | Ga0373955_0056091_751_1119 | 112 |
| 851 | 3300035691 | Ga0373931_0245625 | Ga0373931_0245625_560_901 | 112 |
| 852 | 3300035692 | Ga0373935_0189257 | Ga0373935_0189257_106_474 | 112 |
| 853 | 3300035724 | Ga0373933_0135704 | Ga0373933_0135704_833_1201 | 112 |
| 854 | 3300036401 | Ga0373937_0015554 | Ga0373937_0015554_6178_6546 | 112 |
| 855 | 3300037312 | Ga0395899_0066576 | Ga0395899_0066576_1494_1835 | 112 |
| 856 | 3300037418 | Ga0395900_0031705 | Ga0395900_0031705_874_1242 | 112 |
| 857 | 3300037418 | Ga0395900_0052525 | Ga0395900_0052525_1123_1464 | 112 |
| 858 | 3300037418 | Ga0395900_0227779 | Ga0395900_0227779_712_1080 | 112 |
| 859 | 3300037466 | Ga0395898_0241709 | Ga0395898_0241709_444_812 | 112 |
| 860 | 3300037466 | Ga0395898_1696302 | Ga0395898_1696302_65_433 | 112 |
| 861 | 3300037466 | Ga0395898_1940600 | Ga0395898_1940600_107_448 | 112 |
| 862 | 3300037471 | Ga0395905_0000756 | Ga0395905_0000756_7237_7605 | 112 |
| 863 | 3300037471 | Ga0395905_0018156 | Ga0395905_0018156_1393_1761 | 112 |
| 864 | 3300037471 | Ga0395905_0037822 | Ga0395905_0037822_3402_3743 | 112 |
| 865 | 3300037471 | Ga0395905_0250996 | Ga0395905_0250996_239_580 | 112 |
| 866 | 3300037471 | Ga0395905_0335112 | Ga0395905_0335112_312_659 | 112 |
| 867 | 3300037471 | Ga0395905_0364627 | Ga0395905_0364627_459_827 | 112 |
| 868 | 3300037471 | Ga0395905_0656037 | Ga0395905_0656037_377_745 | 112 |
| 869 | 3300037471 | Ga0395905_1428332 | Ga0395905_1428332_121_462 | 112 |
| 870 | 3300038443 | Ga0395901_0012260 | Ga0395901_0012260_549_917 | 112 |
| 871 | 3300038443 | Ga0395901_0031705 | Ga0395901_0031705_572_913 | 112 |
| 872 | 3300038443 | Ga0395901_0829031 | Ga0395901_0829031_144_512 | 112 |
| 873 | 3300044694 | Ga0466963_0212673 | Ga0466963_0212673_386_754 | 112 |
| 874 | 3300045051 | Ga0451576_1836259 | Ga0451576_1836259_116_457 | 112 |
| 875 | 3300046684 | Ga0495669_0010742 | Ga0495669_0010742_645_986 | 112 |
| 876 | 3300046684 | Ga0495669_0314378 | Ga0495669_0314378_267_608 | 112 |
| 877 | 3300047445 | Ga0495677_0078560 | Ga0495677_0078560_476_844 | 112 |
| 878 | 3300048088 | Ga0495602_0045724 | Ga0495602_0045724_3500_3868 | 112 |
| 879 | 3300048903 | Ga0496100_0402018 | Ga0496100_0402018_384_725 | 112 |
| 880 | 3300048903 | Ga0496100_0679033 | Ga0496100_0679033_374_745 | 112 |
| 881 | 3300048904 | Ga0496101_0428226 | Ga0496101_0428226_319_660 | 112 |
| 882 | 3300048906 | Ga0496103_0220741 | Ga0496103_0220741_299_670 | 112 |
| 883 | 3300048908 | Ga0496105_0097313 | Ga0496105_0097313_429_800 | 112 |
| 884 | 3300048909 | Ga0496106_0575379 | Ga0496106_0575379_47_418 | 112 |
| 885 | 3300048910 | Ga0496107_0183241 | Ga0496107_0183241_353_697 | 112 |
| 886 | 3300048911 | Ga0496108_0062546 | Ga0496108_0062546_1759_2130 | 112 |
| 887 | 3300048912 | Ga0496109_0264122 | Ga0496109_0264122_50_421 | 112 |
| 888 | 3300048912 | Ga0496109_1934013 | Ga0496109_1934013_149_490 | 112 |
| 889 | 3300048913 | Ga0496110_0406966 | Ga0496110_0406966_144_515 | 112 |
| 890 | 3300048914 | Ga0496111_0100321 | Ga0496111_0100321_1227_1598 | 112 |
| 891 | 3300048915 | Ga0496112_0033735 | Ga0496112_0033735_3962_4303 | 112 |
| 892 | 3300048915 | Ga0496112_0196154 | Ga0496112_0196154_761_1132 | 112 |
| 893 | 3300048916 | Ga0496113_0065433 | Ga0496113_0065433_2299_2670 | 112 |
| 894 | 3300048917 | Ga0496114_0034740 | Ga0496114_0034740_3206_3547 | 112 |
| 895 | 3300048918 | Ga0496115_0001505 | Ga0496115_0001505_6849_7190 | 112 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar